WorldWideScience

Sample records for hassium 271

  1. 18 CFR 284.271 - Waiver.

    Science.gov (United States)

    2010-04-01

    ... Emergency Natural Gas Sale, Transportation, and Exchange Transactions § 284.271 Waiver. The Commission may... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Waiver. 284.271 Section 284.271 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT OF...

  2. 49 CFR 27.1 - Purpose.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Purpose. 27.1 Section 27.1 Transportation Office of the Secretary of Transportation NONDISCRIMINATION ON THE BASIS OF DISABILITY IN PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE General § 27.1 Purpose. The purpose of this part is to...

  3. 48 CFR 1842.271 - NASA clause.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true NASA clause. 1842.271 Section 1842.271 Federal Acquisition Regulations System NATIONAL AERONAUTICS AND SPACE ADMINISTRATION... NASA clause. Insert the clause at 1852.242-70, Technical Direction, when paragraph 3(m) of the NASA...

  4. 14 CFR 271.9 - Discrimination prohibited.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Discrimination prohibited. 271.9 Section... TRANSPORTATION § 271.9 Discrimination prohibited. (a) All air carriers receiving subsidy under this part shall comply with the following: (1) The Age Discrimination Act of 1975; (2) The Civil Rights Act of 1964 and...

  5. 36 CFR 271.4 - Commercial license.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Commercial license. 271.4... BEARâ SYMBOL § 271.4 Commercial license. (a) The Chief may authorize the commercial manufacture... a use or royalty charge which is reasonably related to the commercial enterprise has been...

  6. 48 CFR 1352.271-76 - Performance.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Performance. 1352.271-76... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1352.271-76 Performance. As prescribed in 48 CFR 1371.107, insert the following clause: Performance (APR 2010) (a) The contractor shall...

  7. The Cryo-Thermochromatographic Separator (CTS) A new rapid separation and alpha-detection system for on-line chemical studies of highly volatile osmium and hassium (Z=108) tetroxides

    CERN Document Server

    Kirbach, U W; Gregorich, K E; Lee, D M; Ninov, V; Omtvedt, J P; Patin, J B; Seward, N K; Strellis, D A; Sudowe, R; Türler, A; Wilk, P A; Zielinski, P M; Hoffman, D C; Nitsche, H

    2002-01-01

    The Cryo-Thermochromatographic Separator (CTS) was designed and constructed for rapid, continuous on-line separation and simultaneous detection of highly volatile compounds of short-lived alpha-decaying isotopes of osmium and hassium (Hs, Z=108). A flowing carrier gas containing the volatile species is passed through a channel formed by two facing rows of 32 alpha-particle detectors, cooled to form a temperature gradient extending from 247 K at the channel entrance down to 176 K at the exit. The volatile species adsorb onto the SiO sub 2 -coated detector surfaces at a characteristic deposition temperature and are identified by their observed alpha-decay energies. The CTS was tested on-line with OsO sub 4 prepared from sup 1 sup 6 sup 9 sup - sup 1 sup 7 sup 3 Os isotopes produced in sup 1 sup 1 sup 8 sup , sup 1 sup 2 sup 0 Sn( sup 5 sup 6 Fe, 3,4,5n) reactions. An adsorption enthalpy for OsO sub 4 of -40.2+-1.5 kJ/mol on SiO sub 2 was deduced by comparing the measured deposition distribution with Monte Carlo...

  8. 12 CFR 271.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... duplicating documents in response to a request made under § 271.5. (d) Duplication refers to the process of... Committee includes rules, statements, decisions, minutes, memoranda, letters, reports, transcripts, accounts... available for purchase or subscription by the general public. (3) “Freelance” journalists may be regarded as...

  9. 49 CFR 192.271 - Scope.

    Science.gov (United States)

    2010-10-01

    ... Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY TRANSPORTATION OF NATURAL AND OTHER GAS BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Joining of Materials Other Than by Welding § 192.271...

  10. 14 CFR 271.4 - Carrier costs.

    Science.gov (United States)

    2010-01-01

    ... Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS GUIDELINES FOR SUBSIDIZING AIR CARRIERS PROVIDING ESSENTIAL AIR TRANSPORTATION § 271.4 Carrier costs. (a) The reasonable costs projected for a carrier providing essential air service at an eligible...

  11. 14 CFR 271.6 - Profit element.

    Science.gov (United States)

    2010-01-01

    ... Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS GUIDELINES FOR SUBSIDIZING AIR CARRIERS PROVIDING ESSENTIAL AIR TRANSPORTATION § 271.6 Profit element. The reasonable return for a carrier for providing essential air service at an eligible place...

  12. 14 CFR 271.8 - Rate period.

    Science.gov (United States)

    2010-01-01

    ... Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS GUIDELINES FOR SUBSIDIZING AIR CARRIERS PROVIDING ESSENTIAL AIR TRANSPORTATION § 271.8 Rate period... place essential air service level; or (5) The uncertainties of the market or other circumstances warrant...

  13. 14 CFR 271.1 - Purpose.

    Science.gov (United States)

    2010-01-01

    ... and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS GUIDELINES FOR SUBSIDIZING AIR CARRIERS PROVIDING ESSENTIAL AIR TRANSPORTATION § 271.1 Purpose... establishing the fair and reasonable amount of compensation needed to ensure the continuation of essential air...

  14. 14 CFR 271.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS GUIDELINES FOR SUBSIDIZING AIR CARRIERS PROVIDING ESSENTIAL AIR TRANSPORTATION § 271.2 Definitions... compensation under Subchapter II of Chapter 417 of the Statute. Essential air service is that air...

  15. 14 CFR 271.5 - Carrier revenues.

    Science.gov (United States)

    2010-01-01

    ... Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS GUIDELINES FOR SUBSIDIZING AIR CARRIERS PROVIDING ESSENTIAL AIR TRANSPORTATION § 271.5 Carrier revenues. (a) The projected passenger revenue for a carrier providing essential air service at an eligible...

  16. 48 CFR 1352.271-87 - Changes-ship repair.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Changes-ship repair. 1352.271-87 Section 1352.271-87 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1352.271-87 Changes—ship repair. As prescribed in 48 CFR 1371.118,...

  17. 47 CFR 25.271 - Control of transmitting stations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Control of transmitting stations. 25.271 Section 25.271 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Operations § 25.271 Control of transmitting stations. (a) The licensee of...

  18. 40 CFR 271.18 - Coordination with other programs.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Coordination with other programs. 271.18 Section 271.18 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES... Authorization § 271.18 Coordination with other programs. (a) Issuance of State permits under this subpart may be...

  19. 7 CFR 27.1 - Meaning of words.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Meaning of words. 27.1 Section 27.1 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... CLASSIFICATION UNDER COTTON FUTURES LEGISLATION Regulations Definitions § 27.1 Meaning of words. Words used in...

  20. 27 CFR 19.271 - Construction of buildings

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Construction of buildings 19.271 Section 19.271 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Construction of buildings Buildings in which spirits, denatured spirits, articles, or wines are produced...

  1. 48 CFR 1816.405-271 - Base fee.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Base fee. 1816.405-271... CONTRACTING METHODS AND CONTRACT TYPES TYPES OF CONTRACTS Incentive Contracts 1816.405-271 Base fee. (a) A base fee shall not be used on CPAF contracts for which the periodic award fee evaluations are final...

  2. 40 CFR 271.7 - Attorney General's statement.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Attorney General's statement. 271.7... Authorization § 271.7 Attorney General's statement. (a) Any State that seeks to administer a program under this subpart shall submit a statement from the State Attorney General (or the attorney for those State agencies...

  3. 7 CFR 205.271 - Facility pest management practice standard.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Facility pest management practice standard. 205.271... Requirements § 205.271 Facility pest management practice standard. (a) The producer or handler of an organic facility must use management practices to prevent pests, including but not limited to: (1) Removal of pest...

  4. 40 CFR 271.26 - Requirements for used oil management.

    Science.gov (United States)

    2010-07-01

    ... to EPA under § 271.5) EPA to allow the use of used oil (that is not mixed with hazardous waste and... part 271, state programs shall have standards for the marketing and burning of used oil for energy...) and (b) Sec. 279.66(b) Sec. 279.72(b) 1 Contains additional new definitions that were not included in...

  5. 48 CFR 1352.271-86 - Lay days.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Lay days. 1352.271-86... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1352.271-86 Lay days. As prescribed in 48 CFR 1371.117, insert the following clause: Lay Days (APR 2010) (a) A lay day is defined as an...

  6. CD271+ osteosarcoma cells display stem-like properties.

    Directory of Open Access Journals (Sweden)

    Jiguang Tian

    Full Text Available Cancer stem cell (CSC theory has been proposed and verified in many cancers. The existence of osteosarcoma CSCs has been confirmed for many years and multiple surface markers have been employed to identify them. In this study, we identified CD271(+ subpopulation of osteosarcoma displaying stem-like properties. CD271, known as the neural crest nerve growth factor receptor, is the marker of bone marrow mesenchymal stem cells (MSCs and human melanoma-initiating cells. We discovered that CD271 was expressed differentially in diverse types of human osteosarcoma and stabilized cell lines. CD271(+ osteosarcoma cells displayed most of the properties of CSC, such as self-renewal, differentiation, drug resistance and tumorigenicity in vivo. Nanog, Oct3/4, STAT3, DNA-PKcs, Bcl-2 and ABCG2 were more expressed in CD271(+ cells compared with CD271- cells. Our study supported the osteosarcoma CSC hypothesis and, to a certain extent, revealed one of the possible mechanisms involved in maintaining CSCs properties.

  7. Gamma spectrometry on MANITU 271-01 gamma scan wires

    International Nuclear Information System (INIS)

    Dassel, G.; Buurveld, H.A.; Minkema, J.

    1994-08-01

    A series of irradiation experiments (271-series) is being performed of the sustain programme for material development and characterization of the NET (Next European Torus). In the framework of the first irradiation experiment 271-01, with irradiation up to 0.2 dpa, four gamma scan wires have been examined by gamma scanning. The purpose of the gamma scan wires (GSW) is to get information about the neutron fluence distribution in the capsules during irradiation. In the stainless steel wires the nuclides Co-58, Mu-54, Fe-59 and Co-60 are produced, are characteristic for fast and thermal neutron reactions. (orig./HP)

  8. 48 CFR 719.271-4 - Heads of contracting activities.

    Science.gov (United States)

    2010-10-01

    ... DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 719.271-4 Heads of contracting activities. In order for the agency small business program to be effective, the active support of top management... made by SDB; (b) Consulting with SDB in establishing small business and minority business enterprise...

  9. 12 CFR 27.1 - Scope and OMB control number.

    Science.gov (United States)

    2010-01-01

    ... Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY FAIR HOUSING HOME LOAN DATA SYSTEM § 27.1 Scope and OMB control number. (a) Scope. This part applies to the activities of national... information requirements contained in this part were approved by the Office of Management and Budget under OMB...

  10. 14 CFR 271.3 - Carrier subsidy need.

    Science.gov (United States)

    2010-01-01

    ... Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS GUIDELINES FOR SUBSIDIZING AIR CARRIERS PROVIDING ESSENTIAL AIR TRANSPORTATION § 271.3 Carrier subsidy need. In establishing the subsidy for an air carrier providing essential air service at an...

  11. 12 CFR 271.9 - Fee schedules; waiver of fees.

    Science.gov (United States)

    2010-01-01

    ... 271.9 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) FEDERAL OPEN MARKET COMMITTEE RULES... because it is likely to contribute significantly to public understanding of the operation or activities of... the subject of the records concerns the operations or activities of the government; (ii) Whether...

  12. 40 CFR 271.1 - Purpose and scope.

    Science.gov (United States)

    2010-07-01

    .... 21, 1990. Nov. 2, 1990 Petroleum refinery primary and secondary oil/water/solids separation sludge... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) REQUIREMENTS FOR AUTHORIZATION OF STATE HAZARDOUS WASTE PROGRAMS Requirements for Final Authorization § 271.1...

  13. 27 CFR 27.1 - Imported distilled spirits, wines, and beer.

    Science.gov (United States)

    2010-04-01

    ..., wines, and beer. 27.1 Section 27.1 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS IMPORTATION OF DISTILLED SPIRITS, WINES, AND BEER Scope of Regulations § 27.1 Imported distilled spirits, wines, and beer. This part, “Importation of...

  14. 48 CFR 852.271-73 - Use and publication of counseling results.

    Science.gov (United States)

    2010-10-01

    ... counseling results. 852.271-73 Section 852.271-73 Federal Acquisition Regulations System DEPARTMENT OF... Clauses 852.271-73 Use and publication of counseling results. As prescribed in 871.212, insert the following clause: Use and Publication of Counseling Results (JAN 2008) The contractor agrees that none of...

  15. 48 CFR 852.271-72 - Time spent by counselee in counseling process.

    Science.gov (United States)

    2010-10-01

    ... counseling process. 852.271-72 Section 852.271-72 Federal Acquisition Regulations System DEPARTMENT OF... Clauses 852.271-72 Time spent by counselee in counseling process. As prescribed in 871.212, insert the following clause: Time Spent by Counselee in Counseling Process (APR 1984) The contractor agrees that no...

  16. Potential Effect of CD271 on Human Mesenchymal Stromal Cell Proliferation and Differentiation

    Directory of Open Access Journals (Sweden)

    Giovanna Calabrese

    2015-07-01

    Full Text Available The Low-Affinity Nerve Growth Factor Receptor (LNGFR, also known as CD271, is a member of the tumor necrosis factor receptor superfamily. The CD271 cell surface marker defines a subset of multipotential mesenchymal stromal cells and may be used to isolate and enrich cells derived from bone marrow aspirate. In this study, we compare the proliferative and differentiation potentials of CD271+ and CD271− mesenchymal stromal cells. Mesenchymal stromal cells were isolated from bone marrow aspirate and adipose tissue by plastic adherence and positive selection. The proliferation and differentiation potentials of CD271+ and CD271− mesenchymal stromal cells were assessed by inducing osteogenic, adipogenic and chondrogenic in vitro differentiation. Compared to CD271+, CD271− mesenchymal stromal cells showed a lower proliferation rate and a decreased ability to give rise to osteocytes, adipocytes and chondrocytes. Furthermore, we observed that CD271+ mesenchymal stromal cells isolated from adipose tissue displayed a higher efficiency of proliferation and trilineage differentiation compared to CD271+ mesenchymal stromal cells isolated from bone marrow samples, although the CD271 expression levels were comparable. In conclusion, these data show that both the presence of CD271 antigen and the source of mesenchymal stromal cells represent important factors in determining the ability of the cells to proliferate and differentiate.

  17. Potential Effect of CD271 on Human Mesenchymal Stromal Cell Proliferation and Differentiation.

    Science.gov (United States)

    Calabrese, Giovanna; Giuffrida, Raffaella; Lo Furno, Debora; Parrinello, Nunziatina Laura; Forte, Stefano; Gulino, Rosario; Colarossi, Cristina; Schinocca, Luciana Rita; Giuffrida, Rosario; Cardile, Venera; Memeo, Lorenzo

    2015-07-09

    The Low-Affinity Nerve Growth Factor Receptor (LNGFR), also known as CD271, is a member of the tumor necrosis factor receptor superfamily. The CD271 cell surface marker defines a subset of multipotential mesenchymal stromal cells and may be used to isolate and enrich cells derived from bone marrow aspirate. In this study, we compare the proliferative and differentiation potentials of CD271+ and CD271- mesenchymal stromal cells. Mesenchymal stromal cells were isolated from bone marrow aspirate and adipose tissue by plastic adherence and positive selection. The proliferation and differentiation potentials of CD271+ and CD271- mesenchymal stromal cells were assessed by inducing osteogenic, adipogenic and chondrogenic in vitro differentiation. Compared to CD271+, CD271- mesenchymal stromal cells showed a lower proliferation rate and a decreased ability to give rise to osteocytes, adipocytes and chondrocytes. Furthermore, we observed that CD271+ mesenchymal stromal cells isolated from adipose tissue displayed a higher efficiency of proliferation and trilineage differentiation compared to CD271+ mesenchymal stromal cells isolated from bone marrow samples, although the CD271 expression levels were comparable. In conclusion, these data show that both the presence of CD271 antigen and the source of mesenchymal stromal cells represent important factors in determining the ability of the cells to proliferate and differentiate.

  18. 48 CFR 1352.271-71 - Method of payment and invoicing instructions for ship repair.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Method of payment and invoicing instructions for ship repair. 1352.271-71 Section 1352.271-71 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1352.271-71 Method of...

  19. 49 CFR 40.271 - How are alcohol testing problems corrected?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false How are alcohol testing problems corrected? 40.271 Section 40.271 Transportation Office of the Secretary of Transportation PROCEDURES FOR TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS Problems in Alcohol Testing § 40.271 How are alcohol testing...

  20. 47 CFR 80.271 - Technical requirements for portable survival craft radiotelephone transceivers.

    Science.gov (United States)

    2010-10-01

    ... craft radiotelephone transceivers. 80.271 Section 80.271 Telecommunication FEDERAL COMMUNICATIONS... Authorization for Compulsory Ships § 80.271 Technical requirements for portable survival craft radiotelephone transceivers. (a) Portable survival craft radiotelephone transceivers must comply with the following: (1) The...

  1. 29 CFR 1952.271 - Where the plan may be inspected.

    Science.gov (United States)

    2010-07-01

    ... and copied during normal business hours at the following locations: Office of State Programs... 29 Labor 9 2010-07-01 2010-07-01 false Where the plan may be inspected. 1952.271 Section 1952.271..., DEPARTMENT OF LABOR (CONTINUED) APPROVED STATE PLANS FOR ENFORCEMENT OF STATE STANDARDS Vermont § 1952.271...

  2. α decay chains in 271-294115 superheavy nuclei

    International Nuclear Information System (INIS)

    Santhosh, K. P.; Priyanka, B.; Joseph, Jayesh George; Sahadevan, Sabina

    2011-01-01

    α decay of 271-294 115 superheavy nuclei is studied using the Coulomb and proximity potential model for deformed nuclei (CPPMDN). The predicted α half-lives of 287 115 and 288 115 nuclei and their decay products are in good agreement with experimental values. Comparison of α and spontaneous fission half-lives predicts four-α chains and three-α chains, respectively, from 287 115 and 288 115 nuclei and are in agreement with experimental observation. Our study predicts two-α chains from 273,274,289 115, three-α chains from 275 115, and four-α chains consistently from 284,285,286 115 nuclei. These observations will be useful for further experimental investigation in this region.

  3. 48 CFR 853.271 - Loan Guaranty, Education and Vocational Rehabilitation and Counseling Programs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Loan Guaranty, Education and Vocational Rehabilitation and Counseling Programs. 853.271 Section 853.271 Federal Acquisition... Guaranty, Education and Vocational Rehabilitation and Counseling Programs. ...

  4. 36 CFR 271.8 - Consultation with Association of State Foresters and the Advertising Council.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Consultation with Association of State Foresters and the Advertising Council. 271.8 Section 271.8 Parks, Forests, and Public... Association of State Foresters and the Advertising Council. These regulations in this part have been issued...

  5. 34 CFR 271.10 - What types of projects may be funded?

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false What types of projects may be funded? 271.10 Section... Activities Does the Secretary Assist Under This Program? § 271.10 What types of projects may be funded? The Secretary awards grants to SEAs for projects offering technical assistance (including training) to school...

  6. 48 CFR 1352.271-82 - Department of Labor occupational safety and health standards for ship repair.

    Science.gov (United States)

    2010-10-01

    ... occupational safety and health standards for ship repair. 1352.271-82 Section 1352.271-82 Federal Acquisition... of Provisions and Clauses 1352.271-82 Department of Labor occupational safety and health standards... Occupational Safety and Health Standards for Ship Repair (APR 2010) The contractor, in performance of all work...

  7. 7 CFR 2.71 - Director, Office of Risk Assessment and Cost-Benefit Analysis.

    Science.gov (United States)

    2010-01-01

    ... Chief Economist § 2.71 Director, Office of Risk Assessment and Cost-Benefit Analysis. (a) Delegations. Pursuant to § 2.29(a)(2), the following delegations of authority are by the Chief Economist to the Director... reserved to the Chief Economist: Review all proposed decisions having substantial economic policy...

  8. 14 CFR 135.271 - Helicopter hospital emergency medical evacuation service (HEMES).

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Helicopter hospital emergency medical....271 Helicopter hospital emergency medical evacuation service (HEMES). (a) No certificate holder may... certificate holder may assign a helicopter flight crewmember, and no flight crewmember may accept an...

  9. 40 CFR 271.12 - Requirements for hazardous waste management facilities.

    Science.gov (United States)

    2010-07-01

    ... Requirements for Final Authorization § 271.12 Requirements for hazardous waste management facilities. The State shall have standards for hazardous waste management facilities which are equivalent to 40 CFR parts 264... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Requirements for hazardous waste...

  10. 48 CFR 236.271 - Cost-plus-fixed-fee contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Cost-plus-fixed-fee... CONTRACTS Special Aspects of Contracting for Construction 236.271 Cost-plus-fixed-fee contracts. Annual military construction appropriations acts restrict the use of cost-plus-fixed-fee contracts (see 216.306(c...

  11. BKR 27(1) pp. 50-55 (Achuba et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji

    2015-03-31

    Mar 31, 2015 ... Biokemistri 27(1): 50–55. 54. Farombi, E.O. (2000) Mechanisms for the hepatoprotective action of kolaviron, studies on hepatic enzymes, microsomal lipids and peroxidation in carbon tetrachloride-treated rats. Pharmacological Research 42: 75–80. Farris MW (1991) Cadmium toxicity: Unique cytoprotective.

  12. 25 CFR 1000.271 - What other statutes and regulations apply to FTCA coverage?

    Science.gov (United States)

    2010-04-01

    ... OF THE INTERIOR ANNUAL FUNDING AGREEMENTS UNDER THE TRIBAL SELF-GOVERNMENT ACT AMENDMENTS TO THE INDIAN SELF-DETERMINATION AND EDUCATION ACT Federal Tort Claims § 1000.271 What other statutes and... 25 Indians 2 2010-04-01 2010-04-01 false What other statutes and regulations apply to FTCA...

  13. 12 CFR 271.5 - Records available to the public on request.

    Science.gov (United States)

    2010-01-01

    ....5 Section 271.5 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) FEDERAL OPEN MARKET COMMITTEE... Committee's operations. (2) The request shall be submitted in writing to the Secretary of the Committee, Federal Open Market Committee, 20th & C Street, N.W., Washington, D.C. 20551; or sent by facsimile to the...

  14. Saturation of the 2.71 µm laser output in erbium doped ZBLAN fibers

    NARCIS (Netherlands)

    Bedö, S.; Pollnau, Markus; Lüthy, W.; Weber, H.P.

    1995-01-01

    The saturation of the 2.71 μm laser output power has been investigated in an erbium doped ZBLAN single-mode fiber with an Er3+ concentration of 5000 ppm mol. The bleaching of the ground state, the absorption coefficient at the pump wavelength and the fluorescence intensities over a wide wavelength

  15. 20 CFR 404.271 - When automatic cost-of-living increases apply.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false When automatic cost-of-living increases apply... AND DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts Cost-Of-Living Increases § 404.271 When automatic cost-of-living increases apply. Besides increases in the primary insurance amounts...

  16. Examining the feasibility of clinical grade CD271+ enrichment of mesenchymal stromal cells for bone regeneration.

    Directory of Open Access Journals (Sweden)

    Richard J Cuthbert

    Full Text Available Current clinical trials utilize mesenchymal stromal cells (MSCs expanded in culture, however these interventions carry considerable costs and concerns pertaining to culture-induced losses of potency. This study assessed the feasibility of new clinical-grade technology to obtain uncultured MSC isolates from three human intra-osseous tissue sources based on immunomagnetic selection for CD271-positive cells.MSCs were isolated from bone marrow (BM aspirates or surgical waste materials; enzymatically digested femoral heads (FHs and reamer irrigator aspirator (RIA waste fluids. Flow cytometry for the CD45-/lowCD73+CD271+ phenotype was used to evaluate uncultured MSCs before and after selection, and to measure MSC enrichment in parallel to colony forming-unit fibroblast assay. Trilineage differentiation assays and quantitative polymerase chain-reaction for key transcripts involved in bone regeneration was used to assess the functional utility of isolated cells for bone repair.Uncultured CD45-/lowCD271+ MSCs uniformly expressed CD73, CD90 and CD105 but showed variable expression of MSCA-1 and SUSD2 (BM>RIA>FH. MSCs were enriched over 150-fold from BM aspirates and RIA fluids, whereas the highest MSC purities were obtained from FH digests. Enriched fractions expressed increased levels of BMP-2, COL1A2, VEGFC, SPARC and CXCL12 transcripts (BM>RIA>FH, with the highest up-regulation detected for CXCL12 in BM (>1300-fold. Following culture expansion, CD271-selected MSCS were tri-potential and phenotypically identical to plastic adherence-selected MSCs.A CD271-based GMP-compliant immunomagnetic selection resulted in a substantial increase in MSC purity and elevated expression of transcripts involved in bone formation, vascularisation and chemo-attraction. Although this technology, particularly from RIA fluids, can be immediately applied by orthopaedic surgeons as autologous therapy, further improvements in MSC purities and pre-clinical testing of product

  17. Trehalose preincubation increases mesenchymal (CD271+ stem cells post-cryopreservation viability

    Directory of Open Access Journals (Sweden)

    Indra Kusuma

    2016-10-01

    Full Text Available Background: Dimethyl sulfoxide (Me2SO is a common cryoprotective agent widely used in cell preservation system. Me2SO is currently known to cause epigenetic changes which are  critical in stem cells development and cellular differentiation. Therefore, it is imperative to develop cryopreservation techniques that protect cellular functions and avert Me2SO adverse effect. Trehalose was able to protect organism in extreme condition such as dehydration and cold. This study aimed to verify the protective effect of trehalose preincubation procedure in cryopreservation.Methods: The study was conducted using experimental design. Thawed mesenchymal (CD271+ stem cells from YARSI biorepository were used for the experiment. Trehalose preincubation was performed for 1 hour, internalized trehalose was confirmed by FTIR-ATR measurement. Three groups consisted of (1 cryopreserved without trehalose preincubation, (2 cryopreserved with trehalose preincubation, and (3 did not undergo cryopreservation were evaluated after 24 hours in LN2 for viability in culture. The absorbance from each group was measured at 450 nm. The analysis performed using paired student t test.Results: Viability of thawed mesenchymal (CD271+ stem cells that undergo trehalose preincubation prior cryopreservation was significantly higher (p<0.05 compared to group without trehalose preincubation. Higher viability observed between group with trehalose preincubation compared with controlled group suggests protection to trypsinization. Mesenchymal (CD271+ stem cells incubated for 1 hour in 100 mM trehalose supplemented medium  results in 15%  trehalose loading efficiency.Conclusion: These findings confirm the protective effect of trehalose preincubation in cryopreservation. Future research should be directed to elucidate the trehalose internalization mechanism and eventually the protective mechanism of trehalose in mammalian cell cryopreservation.

  18. Retrospective analysis of 271 arteriovenous fistulas as vascular access for hemodialysis

    Directory of Open Access Journals (Sweden)

    P Sahasrabudhe

    2013-01-01

    Full Text Available This report describes our experience of arteriovenous fistula (AVF creation as vascular access for hemodialysis (HD. Study has been carried out in Deenanath Mangeshkar Hospital, Pune from January 2004 to December 2009. A total of 271 AVFs were created in 249 patients. Maximum follow up was 7 years and minimum was 1 year. In this study of 271 cases of AVFs, there were 196 (72.3% successful cases and 75 (27.7% failures. Basilic vein was used in 77 (28.4% cases, cephalic vein in 186 (68.6%, and antecubital vein in 8 (3% cases. End (vein to side (artery anastomosis was done in 170 (63% cases. Side to side anastomosis was done in 100 (37% cases. On table bruit was present in 244 (90% and thrill in 232 (85.6% cases. During dialysis, flow rate >250 ml/min was obtained in 136 (50.4% cases. In complications, 16 (5.9% patients developed distal edema, 32 (11.8% developed steal phenomenon. Presence of on table thrill and bruit are indicators of successful AVF. If vein diameter is <2 mm, chances of AVF failure are high. During proximal side to side fistula between antecubital/basilic vein and brachial artery, breaking of first valve toward wrist helps to develop distal veins in forearm by retrograde flow. This technique avoids requirement of superficialization of basilic vein in arm.

  19. [A study on genotype of 271 mycobacterium tuberculosis isolates in 6 prefectures in Yunnan Province].

    Science.gov (United States)

    Chen, L Y; Yang, X; Ru, H H; Yang, H J; Yan, S Q; Ma, L; Chen, J O; Yang, R; Xu, L

    2018-01-06

    Objective: To understand the characteristics of genotypes of Mycobacterium tuberculosis isolates in Yunnan province, and provide the molecular epidemiological evidence for prevention and control of tuberculosis in Yunnan Province. Methods: Mycobacterium Tuberculosis isolates were collected from 6 prefectures of Yunnan province in 2014 and their Genetypes of Mycobacterium tuberculosis isolates were obtained using spoligotyping and multiple locus variable numbers of tandem repeats analysis (MLVA). The results of spoligotyping were entered into the SITVITWEB database to obtain the Spoligotyping International Type (SIT) patterns and the sublineages of MTB isolates. The genoyping patterns were clustered with BioNumerics (version 5.0). Results: A total of 271 MTB isolates represented patients were collected from six prefectures in Yunnan province. Out of these patients, 196 (72.3%) were male. The mean age of the patients was (41.9±15.1) years. The most MTB isolates were from Puer, totally 94 iusolates(34.69%). Spoligotyping analysis revealed that 151 (55.72%) MTB isolates belonged to the Beijing genotype, while the other 120 (44.28%) were from non-Beijing genotype; 40 genotypes were consisted of 24 unique genotypes and 16 clusters. The 271 isolates were differentiated into 30 clusters (2 to 17 isolates per cluster) and 177 unique genotypes, showing a clustering rate of 23.62%. Beijing genotype strains showed higher clustering rate than non-Beijing genotype strains (29.14% vs 16.67%). The HGI of 12-locus VNTR in total MTB strains, Beijing genotype strains and non-Beijing genotype was 0.993, 0.982 and 0.995 respectively. Conclusion: The Beijing genotype was the predominant genotype in Yunnan Province, the characteristics of Mycobacterium tuberculosis showed high genetic diversity. The genotyping data reflect the potential recent ongoing transmission in some area, which highlights the urgent need for early diagnosis and treatment of the infectious TB cases, to cut off the

  20. Handbook of Accelerator Physics and Engineering (sections 2.7.1 - 2.7.5 and 7.6.2)

    Energy Technology Data Exchange (ETDEWEB)

    Roser, T.

    1999-04-19

    The sections written by this author are: 2.7.1- Thomas - BMT equation; 2.2.2- Spinor Algebra; 2.7.3- Spin Rotators and Siberian Snakes; 2.7.4- Ring with Spin Rotator and Siberian Snakes; 2.7.5- Depolarizing Resonances and Spin Flippers; & 7.6.2- Proton Beam Polarimeters

  1. The central star candidate of the planetary nebula Sh2-71: photometric and spectroscopic variability

    Science.gov (United States)

    Močnik, T.; Lloyd, M.; Pollacco, D.; Street, R. A.

    2015-07-01

    We present the analysis of several newly obtained and archived photometric and spectroscopic data sets of the intriguing and yet poorly understood 13.5 mag central star candidate of the bipolar planetary nebula Sh2-71. Photometric observations confirmed the previously determined quasi-sinusoidal light curve with a period of 68 d and also indicated periodic sharp brightness dips, possibly eclipses, with a period of 17.2 d. In addition, the comparison between U and V light curves revealed that the 68 d brightness variations are accompanied by a variable reddening effect of ΔE(U - V) = 0.38. Spectroscopic data sets demonstrated pronounced variations in spectral profiles of Balmer, helium and singly ionized metal lines and indicated that these variations occur on a time-scale of a few days. The most accurate verification to date revealed that spectral variability is not correlated with the 68 d brightness variations. The mean radial velocity of the observed star was measured to be ˜26 km s-1 with an amplitude of ±40 km s-1. The spectral type was determined to be B8V through spectral comparison with synthetic and standard spectra. The newly proposed model for the central star candidate is a Be binary with a misaligned precessing disc.

  2. Characterization of endo-β-mannanase from Enterobacter ludwigii MY271 and application in pulp industry.

    Science.gov (United States)

    Yang, Miao; Cai, Jun; Wang, Changgao; Du, Xin; Lin, Jianguo

    2017-01-01

    β-Mannanases are the second most important enzymes for the hydrolysis of hemicelluloses. An endo-β-mannanase from Enterobacter ludwigii MY271 was purified at 11.7 ± 0.2-fold to homogeneity with a final recovery of 15.2 ± 0.2 %. Using purified β-mannanase protein and SDS-PAGE, the molecular mass was found to be 43.16 kDa. The optimal pH and temperature of the enzyme was found to be 7.0 and 55 °C, respectively. The β-mannanase activity was stable over a broad pH range of pH 2.0-10.0. In addition, the purified enzyme was highly activated by several metal ions and chemical reagents, such as Mg 2+ , L-cysteine, glutathione (GSH) and β-mercaptoethanol. Whereas the enzyme was strongly inhibited by Hg 2+ , Cu 2+ , N-bromosuccinimide (NBS), 1-ethyl-3-(3-dimethyl-amino-propyl)-carbodiimide (EDC), phenylmethanesulfonyl fluoride (PMSF), and sodium dodecyl sulfate (SDS). The β-mannanase was highly active towards glucomannan, and showed endo-activity by producing a mixture of oligosaccharides. Moreover, the enzyme displayed a classical endo-type mode on mannooligosaccharides. The β-mannanase coupled with xylanase significantly improved the brightness of kraft pulp, whereas it has no remarkable effect on the tensile strength of the pulp. Our functional studies of the purified β-mannanase indicate that the enzyme is beneficial to industrial applications, in particular, biotechnological processes, such as food, feed and pulp industry.

  3. Instrument evaluation no. 11. ESI nuclear model 271 C contamination monitor

    International Nuclear Information System (INIS)

    Burgess, P.H.; Iles, W.J.

    1978-06-01

    The various radiations encountered in radiological protection cover a wide range of energies and radiation measurements have to he carried out under an equally broad spectrum of environmental conditions. This report is one of a series intended to give information on the performance characteristics of radiological protection instruments, to assist in the selection of appropriate instruments for a given purpose, to interpret the results obtained with such instruments, and, in particular, to know the likely sources and magnitude of errors that might be associated with measurements in the field. The radiation, electrical and environmental characteristics of radiation protection instruments are considered together with those aspects of the construction which make an instrument convenient for routine use. To provide consistent criteria for instrument performance, the range of tests performed on any particular class of instrument, the test methods and the criteria of acceptable performance are based broadly on the appropriate Recommendations of the International Electrotechnical Commission. The radiations in the tests are, in general, selected from the range of reference radiations for instrument calibration being drawn up by the International Standards Organisation. Normally, each report deals with the capabilities and limitations of one model of instrument and no direct comparison with other instruments intended for similar purposes is made, since the significance of particular performance characteristics largely depends on the radiations and environmental conditions in which the instrument is to be used. The results quoted here have all been obtained from tests on instruments in routine production, with the appropriate measurements being made by the NRPB. This report deals with the ESI Nuclear Model 271 C; a general purpose contamination monitor, comprising a GM tube connected by a coiled extensible cable to a ratemeter

  4. Development of a SISAK extraction system for chemical studies of element 108, hassium

    Energy Technology Data Exchange (ETDEWEB)

    Samadani, F.; Alstad, J.; Bjoernstad, T.; Stavsetra, L.; Omtvedt, J.P. [Oslo Univ. (Germany). Dept. of Chemistry

    2010-07-01

    A liquid-liquid extraction system suitable for studies of chemical properties of Hs (element 108), in the form of HsO{sub 4}, was developed using {gamma}-emitting isotopes of its homologue Os. The system is targeted for the fast on-line extraction system SISAK, which operates in a continuous manner and is suitable for liquid-phase studies of transactinide elements. The distribution of OsO{sub 4} between various dilute NaOH solutions and toluene was studied. Both batch and SISAK on-line experiments were performed to develop an appropriate system. From analysis of the extraction curves equilibrium constants for the formation of the presumed complexes, Na[OsO{sub 4}(OH)] and Na{sub 2}[OsO{sub 4}(OH){sub 2}], were obtained: K{sub 1} = (1 {+-} 0.5) x 10{sup 4} and K{sub 2} = 12 {+-} 8, respectively. The SISAK system includes a liquid-scintillation detection system for {alpha} measurements. Due to quenching effects it is not possible to perform direct measurement of the aqueous phase {alpha}'s. Therefore, a two-stage extraction method that provides an indirect measurement of the activity in the aqueous phase was developed as part of the proposed system for Hs: Acidification of the raffinate from the first stage result in recovery of OsO{sub 4}, which is highly extractable into toluene. The yield of extraction in the second step, from 0.01 M NaOH solution after acidification with H{sub 2}SO{sub 4} solution, was (90 {+-} 3)%. (orig.)

  5. Development of a SISAK extraction system for chemical studies of element 108, hassium

    International Nuclear Information System (INIS)

    Samadani, F.; Alstad, J.; Bjoernstad, T.; Stavsetra, L.; Omtvedt, J.P.

    2010-01-01

    A liquid-liquid extraction system suitable for studies of chemical properties of Hs (element 108), in the form of HsO 4 , was developed using γ-emitting isotopes of its homologue Os. The system is targeted for the fast on-line extraction system SISAK, which operates in a continuous manner and is suitable for liquid-phase studies of transactinide elements. The distribution of OsO 4 between various dilute NaOH solutions and toluene was studied. Both batch and SISAK on-line experiments were performed to develop an appropriate system. From analysis of the extraction curves equilibrium constants for the formation of the presumed complexes, Na[OsO 4 (OH)] and Na 2 [OsO 4 (OH) 2 ], were obtained: K 1 = (1 ± 0.5) x 10 4 and K 2 = 12 ± 8, respectively. The SISAK system includes a liquid-scintillation detection system for α measurements. Due to quenching effects it is not possible to perform direct measurement of the aqueous phase α's. Therefore, a two-stage extraction method that provides an indirect measurement of the activity in the aqueous phase was developed as part of the proposed system for Hs: Acidification of the raffinate from the first stage result in recovery of OsO 4 , which is highly extractable into toluene. The yield of extraction in the second step, from 0.01 M NaOH solution after acidification with H 2 SO 4 solution, was (90 ± 3)%. (orig.)

  6. Aggressive pituitary adenomas occurring in young patients in a large Polynesian kindred with a germline R271W mutation in the AIP gene.

    OpenAIRE

    Jennings, J. E.; Georgitsi, M.; Holdaway, I.; Daly, Adrian; Tichomirowa, M.; Beckers, Albert; Aaltonen, Lauri A; Karhu, A.; Cameron, F. J.

    2009-01-01

    OBJECTIVE: Mutations in the aryl hydrocarbon receptor-interacting protein (AIP) were recently shown to confer a pituitary adenoma predisposition in patients with familial isolated pituitary adenomas (FIPA). We report a large Samoan FIPA kindred from Australia/New Zealand with an R271W mutation that was associated with aggressive pituitary tumors. DESIGN AND METHODS: Case series with germline screening of AIP and haplotype analyses among R271W families. RESULTS: This previously unreported kind...

  7. Antibody Therapy Targeting CD47 and CD271 Effectively Suppresses Melanoma Metastasis in Patient-Derived Xenografts

    Directory of Open Access Journals (Sweden)

    Michael Ngo

    2016-08-01

    Full Text Available The high rate of metastasis and recurrence among melanoma patients indicates the existence of cells within melanoma that have the ability to both initiate metastatic programs and bypass immune recognition. Here, we identify CD47 as a regulator of melanoma tumor metastasis and immune evasion. Protein and gene expression analysis of clinical melanoma samples reveals that CD47, an anti-phagocytic signal, correlates with melanoma metastasis. Antibody-mediated blockade of CD47 coupled with targeting of CD271+ melanoma cells strongly inhibits tumor metastasis in patient-derived xenografts. This therapeutic effect is mediated by drastic changes in the tumor and metastatic site immune microenvironments, both of whichwhich exhibit greatly increased density of differentiated macrophages and significantly fewer inflammatory monocytes, pro-metastatic macrophages (CCR2+/VEGFR1+, and neutrophils, all of which are associated with disease progression. Thus, antibody therapy that activates the innate immune response in combination with selective targeting of CD271+ melanoma cells represents a powerful therapeutic approach against metastatic melanoma.

  8. In vitro migration and proliferation ("wound healing") potential of mesenchymal stromal cells generated from human CD271(+) bone marrow mononuclear cells.

    Science.gov (United States)

    Latifi-Pupovci, Hatixhe; Kuçi, Zyrafete; Wehner, Sibylle; Bönig, Halvard; Lieberz, Ralf; Klingebiel, Thomas; Bader, Peter; Kuçi, Selim

    2015-09-25

    Emerging evidence indicates that mesenchymal stromal cells (MSCs) isolated from different tissue sources may be used in vivo as tissue restorative agents. To date, there is no evidence, however, on migration and proliferation ("wound healing") potential of different subsets of MSCs. The main goal of this study was therefore to compare the in vitro "wound healing" capacity of MSCs generated from positively selected CD271(+) bone marrow mononuclear cells (CD271-MSCs) and MSCs generated by plastic adherence (PA-MSCs). The in vitro model of wound healing (CytoSelect™ 24-Well Wound Healing Assay) was used in order to compare the migration and proliferation potential of CD271-MSCs and PA-MSCs of passage 2 and 4 cultured in presence or absence of growth factors or cytokines. CD271-MSCs of both passages when compared to PA-MSCs demonstrated a significantly higher potential to close the wound 12 and 24 h after initiation of the wound healing assay (P MSCs of second passage was significantly improved after stimulation with FGF-2 (P MSCs of P4 12 h after the treatment (P MSCs of both passages with growth factors or cytokines did not affect their migratory potential. Our in vitro data provide the first evidence that CD271-MSCs are significantly more potent in "wound healing" than their counterparts PA-MSCs.

  9. Isolation, Screening, and Identification of Cellulolytic Bacteria from Natural Reserves in the Subtropical Region of China and Optimization of Cellulase Production by Paenibacillus terrae ME27-1

    Directory of Open Access Journals (Sweden)

    Yan-Ling Liang

    2014-01-01

    Full Text Available From different natural reserves in the subtropical region of China, a total of 245 aerobic bacterial strains were isolated on agar plates containing sugarcane bagasse pulp as the sole carbon source. Of the 245 strains, 22 showed hydrolyzing zones on agar plates containing carboxymethyl cellulose after Congo-red staining. Molecular identification showed that the 22 strains belonged to 10 different genera, with the Burkholderia genus exhibiting the highest strain diversity and accounting for 36.36% of all the 22 strains. Three isolates among the 22 strains showed higher carboxymethyl cellulase (CMCase activity, and isolate ME27-1 exhibited the highest CMCase activity in liquid culture. The strain ME27-1 was identified as Paenibacillus terrae on the basis of 16S rRNA gene sequence analysis as well as physiological and biochemical properties. The optimum pH and temperature for CMCase activity produced by the strain ME27-1 were 5.5 and 50°C, respectively, and the enzyme was stable at a wide pH range of 5.0–9.5. A 12-fold improvement in the CMCase activity (2.08 U/mL of ME27-1 was obtained under optimal conditions for CMCase production. Thus, this study provided further information about the diversity of cellulose-degrading bacteria in the subtropical region of China and found P. terrae ME27-1 to be highly cellulolytic.

  10. Crystal Growth in Al72.9Ge27.1 Alloy Melt under Acoustic Levitation Conditions

    International Nuclear Information System (INIS)

    Yan Na; Dai Fu-Ping; Wang Wei-Li; Wei Bing-Bo

    2011-01-01

    The nonequilibrium solidification of liquid Al 72.9 Ge 27.1 hypoeutectic alloy is accomplished by using single-axis acoustic levitation. A maximum undercooling of 112K (0.16T L ) is obtained for the alloy melt at a cooling rate of 50 K/s. The primary (Al) phase displays a morphological transition from coarse dendrite under a normal conditions to equiaxed grain under acoustic levitation. In the (Al)+(Ge) eutectic, the (Ge) phase exhibits a conspicuous branched growth morphology. Both the primary (Al) dendrites and (Al)+(Ge) eutectics are well refined and the solute content of the primary (Al) phase is extended under acoustic levitation. The calculated and experimental results indicate that the solute trapping effect becomes more intensive with the enhancement of bulk undercooling. (cross-disciplinary physics and related areas of science and technology)

  11. Three-dimensional structure of phosphoribosyl pyrophosphate synthetase from E. coli at 2.71 Å resolution

    Energy Technology Data Exchange (ETDEWEB)

    Timofeev, V. I., E-mail: inna@ns.crys.ras.ru, E-mail: tostars@mail.ru, E-mail: ugama@yandex.ru [Russian Academy of Sciences, Shubnikov Institute of Crystallography (Russian Federation); Abramchik, Yu. A. [Russian Academy of Sciences, Shemyakin–Ovchinnikov Institute of Bioorganic Chemistry (Russian Federation); Zhukhlistova, N. E. [Russian Academy of Sciences, Shubnikov Institute of Crystallography (Russian Federation); Muravieva, T. I.; Esipov, R. S. [Russian Academy of Sciences, Shemyakin–Ovchinnikov Institute of Bioorganic Chemistry (Russian Federation); Kuranova, I. P. [Russian Academy of Sciences, Shubnikov Institute of Crystallography (Russian Federation)

    2016-01-15

    Phosphoribosyl pyrophosphate synthetase from Escherichia coli was cloned, purified, and crystallized. Single crystals of the enzyme were grown under microgravity. The X-ray diffraction data set was collected at the Spring-8 synchrotron facility and used to determine the three-dimensional structure of the enzyme by the molecular-replacement method at 2.71 Å resolution. The active and regulatory sites in the molecule of E. coli phosphoribosyl pyrophosphate synthetase were revealed by comparison with the homologous protein from Bacillus subtilis, the structure of which was determined in a complex with functional ligands. The conformations of polypeptide-chain fragments surrounding and composing the active and regulatory sites were shown to be identical in both proteins.

  12. From COST 271 to 296 EU actions on ionospheric monitoring and modelling for terrestrial and Earth space radio systems

    Science.gov (United States)

    Zolesi, B.; Cander, Lj. R.; Altadill, D.

    The ionospheric community has long been aware that co-operative research on an international basis is essential to deal with temporal and spatial changes in the ionosphere that influence the performance of terrestrial and Earth-space radio systems. The EU COST (Co-operation in the field of Scientific and Technical Research) 271 Action on "Effects of the Upper Atmosphere on Terrestrial and Earth-space Communications" has had during the period of October 2000-August 2004 the following main objectives: (1) to evaluate the influence of upper atmospheric conditions on terrestrial and Earth-space communications, (2) to develop methods and techniques to improve ionospheric models over Europe for telecommunication and navigation applications and (3) to transfer the results to the appropriate radiocommunication study groups of the International Telecommunication Union (ITU-R) and other national and international organizations dealing with the modern communication systems. At the beginning of 2005 the new 296 Action in the COST Telecommunications, Information Science and Technology domain on "Mitigation of Ionospheric Effects on Radio Systems (MIERS)" was approved for the period 2005-2009. The main objectives of the MIERS are: (a) to support and enhanced the existing European facilities for historical and real-time digital ionospheric data collection and exchange; (b) to develop an integrated approach to ionospheric modelling, create the mechanism needed to ingest processed data into models, extend and develop suitable mitigation models and define the protocols needed to link models together; and (c) to strengthen the areas of expertise that already exist by stimulating closer cooperation between scientists and users, focusing the scope of all the previous COST ionospheric related studies to the mitigation of ionospheric effects on radio systems. This paper summarises briefly how the major objectives of the COST271 Action have been achieved and what are the most important

  13. Lysine 271 but not lysine 210 of XRCC4 is required for the nuclear localization of XRCC4 and DNA ligase IV

    Energy Technology Data Exchange (ETDEWEB)

    Fukuchi, Mikoto; Wanotayan, Rujira; Liu, Sicheng; Imamichi, Shoji; Sharma, Mukesh Kumar; Matsumoto, Yoshihisa, E-mail: yoshim@nr.titech.ac.jp

    2015-06-12

    XRCC4 and DNA Ligase IV (LIG4) cooperate to join two DNA ends at the final step of DNA double-strand break (DSB) repair through non-homologous end-joining (NHEJ). However, it is not fully understood how these proteins are localized to the nucleus. Here we created XRCC4{sup K271R} mutant, as Lys271 lies within the putative nuclear localization signal (NLS), and XRCC4{sup K210R} mutant, as Lys210 was reported to undergo SUMOylation, implicated in the nuclear localization of XRCC4. Wild-type and mutated XRCC4 with EGFP tag were introduced into HeLa cell, in which endogenous XRCC4 had been knocked down using siRNA directed to 3′-untranslated region, and tested for the nuclear localization function by fluorescence microscopy. XRCC4{sup K271R} was defective in the nuclear localization of itself and LIG4, whereas XRCC4{sup K210R} was competent for the nuclear localization with LIG4. To examine DSB repair function, wild-type and mutated XRCC4 were introduced into XRCC4-deficient M10. M10-XRCC4{sup K271R}, but not M10-XRCC4{sup K210R}, showed significantly reduced surviving fraction after 2 Gy γ-ray irradiation as compared to M10-XRCC4{sup WT}. The number of γ-H2AX foci remaining 2 h after 2 Gy γ-ray irradiation was significantly greater in M10-XRCC4{sup K271R} than in M10-XRCC4{sup WT}, whereas it was only marginally increased in M10-XRCC4{sup K210R} as compared to M10-XRCC4{sup WT}. The present results collectively indicated that Lys271, but not Lys210, of XRCC4 is required for the nuclear localization of XRCC4 and LIG4 and that the nuclear localizing ability is essential for DSB repair function of XRCC4. - Highlights: • XRCC4{sup K271R} is defective in the nuclear localization of itself and LIG4. • XRCC4{sup K210R} is competent for the nuclear localization of itself and LIG4. • XRCC4{sup K271R} is deficient in DSB repair function. • XRCC4{sup K210R} is mostly normal in DSB repair function.

  14. Studies on some agronomic and quality characteristics of 271 induced early mutants of rice (Oryza sativa L. cv. Nizersail)

    International Nuclear Information System (INIS)

    Rahman, Mostafizur; Miah, A.J.; Mansur, M.A.; Kaul, A.K.

    1980-01-01

    Nizersail, the most popular, recommended rice variety in Bangladesh, was subjected to gamma-irradiation (10 - 25 kR) or ethyl methane sulfonate (EMS) (0.75 - 1.50%) treatments to obtain the mutants with stiff straw and early maturity. In the M 2 generation, 29 gamma-ray- and 8 EMS-induced mutants were selected mainly for short culm length and earliness. Further selections were made in the segregating M 3 and M 4 populations, and finally 400 plants with short culm length were obtained. These 400 selections were grown in M 5 lines, and 271 of these lines were analyzed for several characters. Heading time had singificantly shifted towards earliness in 40 lines. Yield per plant, 1,000-kernel weight, the length/breadth ratio of kernels, alkali spreading index value (indicator of amylose content) and dye-binding capacity (indicator of protein content) were significantly higher than those in the mother variety in 10 - 30% of the lines examined. However, no positive correlation among these characters was observed. Significant negative correlations were observed between heading time and 1,000-kernel weight, and between yield per plant and dye-binding capacity. These results suggest that the early heading plants may produce fewer tillers with bolder seeds, and that high yielding types may not simultaneously show high protein content. (Kaihara, S.)

  15. Percutaneous transluminal forceps biopsy in patients suspected of having malignant biliary obstruction: factors influencing the outcomes of 271 patients

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jung Gu; Jung, Gyoo-Sik; Yun, Jong Hyouk [Kosin University College of Medicine, Department of Radiology, Seo-gu, Busan (Korea, Republic of); Yun, Byung Chul; Lee, Sang Uk; Han, Byung Hoon [Kosin University College of Medicine, Department of Internal Medicine, Busan (Korea, Republic of); Ko, Ji Ho [Busan Medical Center, Department of Radiology, Busan (Korea, Republic of)

    2017-10-15

    To evaluate predictive factors for false-negative diagnosis of percutaneous forceps biopsies in patients suspected of having a malignant biliary obstruction Two hundred seventy one consecutive patients with obstructive jaundice underwent percutaneous forceps biopsy. In each patient, three to five specimens (mean, 3.5 specimens) were collected from the lesion. The final diagnosis for each patient was confirmed with pathologic findings at surgery, additional histocytologic data, or clinical and radiologic follow-up. Univariate and multivariate logistic regression analysis was used to identify risk factors associated with false-negative diagnosis. One hundred ninety four of 271 biopsies resulted in correct diagnoses of malignancy, while 20 biopsy diagnoses were proved to be true-negative. There were 57 false-negative diagnoses and no false-positive diagnoses. The diagnostic performance of transluminal forceps biopsy in malignant biliary obstructions was as follows: sensitivity, 77.2%; specificity, 100%; and accuracy, 78.9%; positive predictive value, 100%, negative predictive value; 25.9%. Periampullary segment of common bile duct, intrahepatic bile duct and metastatic disease were the significant risk factors of false-negative diagnosis. Percutaneous forceps biopsy provides relatively high accuracy in the diagnosis of malignant biliary obstructions. The predictive factors of false-negative biopsy were determined to be biopsy site and origin of primary tumour. (orig.)

  16. The -271 G>A polymorphism of kinase insert domain-containing receptor gene regulates its transcription level in patients with non-small cell lung cancer

    International Nuclear Information System (INIS)

    An, She-Juan; Chen, Zhi-Hong; Lin, Qiu-Xiong; Su, Jian; Chen, Hua-Jun; Lin, Jia-Ying; Wu, Yi-Long

    2009-01-01

    Kinase insert domain-containing receptor (KDR) plays a critical role in the metastasis of cancer and is used as a molecular target in cancer therapy. We investigated the characteristics of the -271 G>A polymorphism of the KDR gene to gain information that may benefit the development of individualized therapies for patients with non-small cell lung cancer (NSCLC). The -271 G>A polymorphism of the KDR gene in 106 lung cancer patients and 203 healthy control individuals was analyzed by polymerase chain reaction (PCR) and DNA sequencing methods. Real-time quantitative PCR and immunohistochemical methods were used to evaluate KDR mRNA and protein expression levels, respectively, in frozen tumor specimens. The -271 G>A polymorphism was associated with the mRNA expression level of the KDR gene in tumor tissues (t = 2.178, P = 0.032, independent samples t-test). Compared with the AG/GG genotype, the AA genotype was associated with higher KDR mRNA expression in tumor tissues. We found no relationship between the genotype and the KDR protein expression level and no significant difference in the distribution of the KDR gene polymorphism genotypes between lung cancer patients and the control group (χ 2 = 1.269, P = 0.264, Fisher's exact test). This study is the first to show that the -271 G>A polymorphism of the KDR gene may be a functional polymorphism related to the regulation of gene transcription. These findings may have important implications for therapies targeting KDR in patients with NSCLC

  17. In vitro and in vivo effects of kisspeptin antagonists p234, p271, p354, and p356 on GPR54 activation.

    Directory of Open Access Journals (Sweden)

    C H J Albers-Wolthers

    Full Text Available Kisspeptins (KPs and their receptor (GPR54 or KiSS1R play a key-role in regulation of the hypothalamic-pituitary-gonadal axis and are therefore interesting targets for therapeutic interventions in the field of reproductive endocrinology. As dogs show a rapid and robust LH response after the administration of KP10, they can serve as a good animal model for research concerning KP signaling. The aims of the present study were to test the antagonistic properties of KP analogs p234, p271, p354, and p356 in vitro, by determining the intracellular Ca2+ response of CHEM1 cells that stably express human GPR54, and to study the in vivo effects of these peptides on basal plasma LH concentration and the KP10-induced LH response in female dogs. Exposure of the CHEM1 cells to KP-10 resulted in a clear Ca2+ response. P234, p271, p354, and p356 did not prevent or lower the KP10-induced Ca2+ response. Moreover, the in vivo studies in the dogs showed that none of these supposed antagonists lowered the basal plasma LH concentration and none of the peptides lowered the KP10-induced LH response. In conclusion, p234, p271, p354, and p356 had no antagonistic effects in vitro nor any effect on basal and kisspeptin-stimulated plasma LH concentration in female dogs.

  18. Corrective Action Decision Document for Corrective Action Unit 271: Areas 25, 26, and 27 Septic Systems, Nevada Test Site, Nevada, Rev. 0

    International Nuclear Information System (INIS)

    2002-01-01

    This corrective action decision document (CADD) identifies and rationalizes the U.S. Department of Energy, National Nuclear Security Administration Nevada Operations Office's selection of a recommended corrective action alternative (CAA) appropriate to facilitate the closure of Corrective Action Unit (CAU) 271, Areas 25, 26, and 27 Septic Systems, Nevada Test Site (NTS), Nevada, under the Federal Facility Agreement and Consent Order (FFACO). Located on the NTS approximately 65 miles northwest of Las Vegas, CAU 271 consists of fifteen Corrective Action Sites (CASs). The CASs consist of 13 septic systems, a radioactive leachfield, and a contaminated reservoir. The purpose of this CADD is to identify and provide a rationale for the selection of a recommended CAA for each CAS within CAU 271. Corrective action investigation (CAI) activities were performed from October 29, 2001, through February 22, 2002, and April 29, 2002, through June 25, 2002. Analytes detected during the CAI were evaluated against preliminary action levels and regulatory disposal limits to determine contaminants of concern (COC) for each CAS. It was determined that contaminants of concern included hydrocarbon-contaminated media, polychlorinated biphenyls, and radiologically-contaminated media. Three corrective action objectives were identified for these CASs, and subsequently three CAAs developed for consideration based on a review of existing data, future use, and current operations in Areas 25, 26, and 27 of the NTS. These CAAs were: Alternative 1 - No Further Action, Alternative 2 - Clean Closure, and Alternative 3 - Closure in Place with Administrative Controls. Alternative 2, Clean Closure, was chosen as the preferred CAA for all but two of the CASs (25-04-04 and 27-05-02) because Nevada Administrative Control 444.818 requires clean closure of the septic tanks involved with these CASs. Alternative 3, Closure in Place, was chosen for the final two CASs because the short-term risks of

  19. Corrective Action Decision Document for Corrective Action Unit 271: Areas 25, 26, and 27 Septic Systems, Nevada Test Site, Nevada, Rev. 0

    Energy Technology Data Exchange (ETDEWEB)

    NNSA/NV

    2002-09-16

    This corrective action decision document (CADD) identifies and rationalizes the U.S. Department of Energy, National Nuclear Security Administration Nevada Operations Office's selection of a recommended corrective action alternative (CAA) appropriate to facilitate the closure of Corrective Action Unit (CAU) 271, Areas 25, 26, and 27 Septic Systems, Nevada Test Site (NTS), Nevada, under the Federal Facility Agreement and Consent Order (FFACO). Located on the NTS approximately 65 miles northwest of Las Vegas, CAU 271 consists of fifteen Corrective Action Sites (CASs). The CASs consist of 13 septic systems, a radioactive leachfield, and a contaminated reservoir. The purpose of this CADD is to identify and provide a rationale for the selection of a recommended CAA for each CAS within CAU 271. Corrective action investigation (CAI) activities were performed from October 29, 2001, through February 22, 2002, and April 29, 2002, through June 25, 2002. Analytes detected during the CAI were evaluated against preliminary action levels and regulatory disposal limits to determine contaminants of concern (COC) for each CAS. It was determined that contaminants of concern included hydrocarbon-contaminated media, polychlorinated biphenyls, and radiologically-contaminated media. Three corrective action objectives were identified for these CASs, and subsequently three CAAs developed for consideration based on a review of existing data, future use, and current operations in Areas 25, 26, and 27 of the NTS. These CAAs were: Alternative 1 - No Further Action, Alternative 2 - Clean Closure, and Alternative 3 - Closure in Place with Administrative Controls. Alternative 2, Clean Closure, was chosen as the preferred CAA for all but two of the CASs (25-04-04 and 27-05-02) because Nevada Administrative Control 444.818 requires clean closure of the septic tanks involved with these CASs. Alternative 3, Closure in Place, was chosen for the final two CASs because the short-term risks of

  20. Performance Characterization of Loctite (Registered Trademark) 242 and 271 Liquid Locking Compounds (LLCs) as a Secondary Locking Feature for International Space Station (ISS) Fasteners

    Science.gov (United States)

    Dube, Michael J.; Gamwell, Wayne R.

    2011-01-01

    Several International Space Station (ISS) hardware components use Loctite (and other polymer based liquid locking compounds (LLCs)) as a means of meeting the secondary (redundant) locking feature requirement for fasteners. The primary locking method is the fastener preload, with the application of the Loctite compound which when cured is intended to resist preload reduction. The reliability of these compounds has been questioned due to a number of failures during ground testing. The ISS Program Manager requested the NASA Engineering and Safety Center (NESC) to characterize and quantify sensitivities of Loctite being used as a secondary locking feature. The findings and recommendations provided in this investigation apply to the anaerobic LLCs Loctite 242 and 271. No other anaerobic LLCs were evaluated for this investigation. This document contains the findings and recommendations of the NESC investigation

  1. Closure Report for Corrective Action Unit 271: Areas 25, 26, and 27 Septic Systems, Nevada Test Site, Nevada with Errata Sheet, Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Mark Krauss

    2004-08-01

    The purpose of this CR is to document that closure activities have met the approved closure standards detailed in the NDEP-approved CAP for CAU 271. The purpose of the Errata Sheet is as follows: In Appendix G, Use Restriction (UR) Documentation, the UR form and drawing of the UR area do not reflect the correct coordinates. Since the original UR was put into place, the UR Form has been updated to include additional information that was not on the original form. This Errata Sheet replaces the original UR Form and drawing. In place of the drawing of the UR area, an aerial photograph is included which reflects the UR area and the correct coordinates for the UR area.

  2. Identification of tetrapeptides from a mixture based positional scanning library that can restore nM full agonist function of the L106P, I69T, I102S, A219V, C271Y, and C271R human melanocortin-4 polymorphic receptors (hMC4Rs).

    Science.gov (United States)

    Haslach, Erica M; Huang, Huisuo; Dirain, Marvin; Debevec, Ginamarie; Geer, Phaedra; Santos, Radleigh G; Giulianotti, Marc A; Pinilla, Clemencia; Appel, Jon R; Doering, Skye R; Walters, Michael A; Houghten, Richard A; Haskell-Luevano, Carrie

    2014-06-12

    Human obesity has been linked to genetic factors and single nucleotide polymorphisms (SNPs). Melanocortin-4 receptor (MC4R) SNPs have been associated with up to 6% frequency in morbidly obese children and adults. A potential therapy for individuals possessing such genetic modifications is the identification of molecules that can restore proper receptor signaling and function. These compounds could serve as personalized medications improving quality of life issues as well as alleviating diseases symptoms associated with obesity including type 2 diabetes. Several hMC4 SNP receptors have been pharmacologically characterized in vitro to have a decreased, or a lack of response, to endogenous agonists such as α-, β-, and γ2-melanocyte stimulating hormones (MSH) and adrenocorticotropin hormone (ACTH). Herein we report the use of a mixture based positional scanning combinatorial tetrapeptide library to discover molecules with nM full agonist potency and efficacy to the L106P, I69T, I102S, A219V, C271Y, and C271R hMC4Rs. The most potent compounds at all these hMC4R SNPs include Ac-His-(pI)DPhe-Tic-(pNO2)DPhe-NH2, Ac-His-(pCl)DPhe-Tic-(pNO2)DPhe-NH2, Ac-His-(pCl)DPhe-Arg-(pI)Phe-NH2, and Ac-Arg-(pCl)DPhe-Tic-(pNO2)DPhe-NH2, revealing new ligand pharmacophore models for melanocortin receptor drug design strategies.

  3. Comparison of referral and non-referral hypertensive disorders during pregnancy: an analysis of 271 consecutive cases at a tertiary hospital.

    Science.gov (United States)

    Liu, Ching-Ming; Chang, Shuenn-Dyh; Cheng, Po-Jen

    2005-05-01

    This retrospective cohort study analyzed the clinical manifestations in patients with preeclampsia and eclampsia, assessed the risk factors compared to the severity of hypertensive disorders on maternal and perinatal morbidity, and mortality between the referral and non-referral patients. 271 pregnant women with preeclampsia and eclampsia were assessed (1993 to 1997). Chi-square analysis was used for the comparison of categorical variables, and the comparison of the two independent variables of proportions in estimation of confidence intervals and calculated odds ratio of the referral and non-referral groups. Multivariate logistic regression was used for adjusting potential confounding risk factors. Of the 271 patients included in this study, 71 (26.2%) patients were referrals from other hospitals. Most of the 62 (87.3%) referral patients were transferred during the period 21 and 37 weeks of gestation. Univariate analysis revealed that referral patients with hypertensive disorder were significantly associated with SBP > or =180, DBP > or =105, severe preclampsia, haemolysis, elevated liver enzymes, low platelets (HELLP), emergency C/S, maternal complications, and low birth weight babies, as well as poor Apgar score. Multivariate logistic regression analyses revealed that the risk factors identified to be significantly associated with increased risk of referral patients included: diastolic blood pressure above 105 mmHg (adjusted odds ratio, 2.09; 95 percent confidence interval, 1.06 to 4.13; P = 0.034), severe preeclampsia (adjusted odds ratio, 3.46; 95 percent confidence interval, 1.76 to 6.81; P < 0.001), eclampsia (adjusted odds ratio, 2.77; 95 percent confidence interval, 0.92 to 8.35; P = 0.071), HELLP syndrome (adjusted odds ratio, 18.81; 95 percent confidence interval, 2.14 to 164.99; P = 0.008). The significant factors associated with the referral patients with hypertensive disorders were severe preeclampsia, HELLP, and eclampsia. Lack of prenatal care was

  4. Hb Agenogi [β90(F6)Glu→Lys (GAG>AAG) HBB: c.271G>A)] in a Pregnant Thai Woman.

    Science.gov (United States)

    Panyasai, Sitthichai; Thongsuk, Pollawat; Pornprasert, Sakorn

    2016-01-01

    Hb Agenogi [β90(F6)Glu→Lys (GAG>AAG) HBB: c.271G>A)] is a very rare β-globin chain variant. We report for the first time this hemoglobinopathy in a pregnant 20-year-old Thai woman. She was seen by an obstetrician at her 14th week of gestation. She was pale and had an inflammatory lesion of her lower left leg. The hemoglobin (Hb) analysis by high performance liquid chromatography (HPLC) and low pressure liquid chromatography (LPLC) showed a peak of abnormal Hb at the C window. On capillary electrophoresis (CE), the abnormal Hb peak was observed at electrophoretic zone 4 that corresponded to the Hb E (HBB: c.79G>A) peak. Direct DNA sequencing revealed a GAG>AAG mutation at codon 90 of the β-globin gene. Thus, even though Hb Agenogi is very rare, it can be found in Thai people. The knowledge and understanding of this hemoglobinopathy will be used to assist in diagnosis, management and counseling for patients.

  5. G:\\Potentiel 27(1)\\PMKER 27(1)\\

    African Journals Online (AJOL)

    AISA

    Changes in the pH of solutions of incubated soil-organic waste mixtures over time. ɱ ..... and environmental aspects. Soil Biology ... externalities of intensive use of organic wastes on two tropical ... climate change and advance food security.

  6. G:\\Potentiel 27(1)\\PMKER 27(1)\\

    African Journals Online (AJOL)

    AISA

    alimentaires ont changé. Si la banane plantain et le manioc .... bien développée entraînant un bon drainage interne. Sur deux horizons (0 - 20 et. 20 - 40 cm), le taux d'argile passe de 10 % en surface à 25 % en profondeur. Le taux de sable ... fumure de couverture est assurée par l'apport d'urée à la dose de 100 kg/ha en ...

  7. The Role of Neurotrophin Signaling in Gliomagenesis: A Focus on the p75 Neurotrophin Receptor (p75NTR/CD271).

    Science.gov (United States)

    Alshehri, M M; Robbins, S M; Senger, D L

    2017-01-01

    The p75 neurotrophin receptor (p75 NTR , a.k.a. CD271), a transmembrane glycoprotein and a member of the tumor necrosis family (TNF) of receptors, was originally identified as a nerve growth factor receptor in the mid-1980s. While p75 NTR is recognized to have important roles during neural development, its presence in both neural and nonneural tissues clearly supports the potential to mediate a broad range of functions depending on cellular context. Using an unbiased in vivo selection paradigm for genes underlying the invasive behavior of glioma, a critical characteristic that contributes to poor clinical outcome for glioma patients, we identified p75 NTR as a central regulator of glioma invasion. Herein we review the expanding role that p75 NTR plays in glioma progression with an emphasis on how p75 NTR may contribute to the treatment refractory nature of glioma. Based on the observation that p75 NTR is expressed and functional in two critical glioma disease reservoirs, namely, the highly infiltrative cells that evade surgical resection, and the radiation- and chemotherapy-resistant brain tumor-initiating cells (also referred to as brain tumor stem cells), we propose that p75 NTR and its myriad of downstream signaling effectors represent rationale therapeutic targets for this devastating disease. Lastly, we provide the provocative hypothesis that, in addition to the well-documented cell autonomous signaling functions, the neurotrophins, and their respective receptors, contribute in a cell nonautonomous manner to drive the complex cellular and molecular composition of the brain tumor microenvironment, an environment that fuels tumorigenesis. © 2017 Elsevier Inc. All rights reserved.

  8. Paternity testing with VNTR DNA systems. II. Evaluation of 271 cases of disputed paternity with the VNTR systems D2S44, D5S43, D7S21, D7S22, and D12S11

    DEFF Research Database (Denmark)

    Hansen, Hanna Elsebeth; Morling, N

    1993-01-01

    Paternity testing was carried out in 271 cases of disputed paternity using the 5 VNTR systems D2S44 (YNH24), D5S43 (MS8), D7S21 (MS31), D7S22 (g3), and D12S11 (MS43a), and 10-15 conventional marker systems including the HLA-A,B system. By means of the matching criteria for the VNTR systems...

  9. 40 CFR 60.271a - Definitions.

    Science.gov (United States)

    2010-07-01

    ..., dampers, etc.) used to capture or transport particulate matter generated by an electric arc furnace or AOD... PERFORMANCE FOR NEW STATIONARY SOURCES Standards of Performance for Steel Plants: Electric Arc Furnaces and... materials into the top of an electric arc furnace or the addition of molten steel or other materials into...

  10. Publications | Page 271 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Through books, articles, research publications, and studies, we aim to widen the ... Journal articles ... Potato farmers in the province of Carchi in northern Ecuador suffer from decreased mental capacity caused by high exposure to chemical ...

  11. ESI nuclear model 271 C contamination monitor

    International Nuclear Information System (INIS)

    Burgess, P.H.; Iles, W.J.

    1978-06-01

    This instrument is a general purpose contamination monitor, comprising a GM tube connected by a coiled extensible cable to a ratemeter. The scale is marked quasi-logarithmically from 0 to 600 in 'counts per second'. The report falls under the headings: general description, facilities and controls, radiation performance, electrical characteristics, environmental characteristics, mechanical characteristics, summary of performance, conclusions. (U.K.)

  12. 44_271 - 276_Dawaki et al

    African Journals Online (AJOL)

    user pc

    2017-12-02

    Dec 2, 2017 ... July-October, 2014 rainy season to estimates mean squares for general combining ability (GCA), ..... Table 2: Format of analysis of variance (ANOVA) for combining ability of maize inbred .... Genetic variability, heritability and.

  13. 40 CFR 271.4 - Consistency.

    Science.gov (United States)

    2010-07-01

    ... waste in the State may be deemed inconsistent. (c) If the State manifest system does not meet the requirements of this part, the State program shall be deemed inconsistent. [48 FR 14248, Apr. 1, 1983; 48 FR... facilities authorized to operate under the Federal or an approved State program shall be deemed inconsistent...

  14. 7 CFR 271.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... security income (SSI) recipients, and their spouses, a public or private nonprofit establishment (eating or... gross retail sales in hot and/or cold prepared, ready-to-eat foods that are intended for immediate... and cheese, multi-ingredient soup, or frozen dinners, shall only be counted as one staple food item...

  15. Publications | Page 271 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local ... Brendan Baker can be called many things: an engineer, an international ... Profile of IDRC's Environment and Natural Resource Management (ENRM) program area. ... Businesses in a smattering of Latin American cities now enjoy a quick and ...

  16. 40 CFR 60.271 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... EAF begins to pour molten steel and ending either three minutes after steel ceases to flow from an EAF, or six minutes after steel begins to flow, whichever is longer. (i) Meltdown and refining means that... intermediate charging periods and times when power to the EAF is off. (k) Shop opacity means the arithmetic...

  17. 12 CFR 271.3 - Published information.

    Science.gov (United States)

    2010-01-01

    ... preceding year upon all matters of policy relating to open market operations, showing the reasons underlying... information relating to open market operations of the Federal Reserve Banks is published in the Federal... Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) FEDERAL OPEN MARKET COMMITTEE RULES REGARDING...

  18. 48 CFR 1352.271-79 - Liability and insurance.

    Science.gov (United States)

    2010-10-01

    ... Insurance (APR 2010) (a) The contractor shall exercise reasonable care and use its best efforts to prevent accidents, injury or damage to all employees, persons and property, in and about the work, and to the vessel... at the plant or elsewhere, arising or growing out of the performance of the work, except where the...

  19. 38 CFR 3.271 - Computation of income.

    Science.gov (United States)

    2010-07-01

    ... period (e.g., an inheritance). Pension computations of income will include nonrecurring income for a full... amount of a person's earnings or wages before any deductions are made for such things as taxes, insurance... goods sold, or expenditures for rent, taxes, and upkeep, or costs of repairs or replacements. The value...

  20. 48 CFR 719.271-3 - USAID contracting officers.

    Science.gov (United States)

    2010-10-01

    ... components of end items or services be purchased separately so small firms may compete; (f) Making a... procurement process which may prevent small business participation in the competitive process are modified to... final decision on a proposed non-competitive procurement action, and as part of his/her findings and...

  1. 27 CFR 46.271 - Entry, examination and testimony.

    Science.gov (United States)

    2010-04-01

    ... are open. Appropriate TTB officers may audit and examine all articles, inventory records, books.... Appropriate TTB officers, in performing official duties, may enter any premises to examine articles subject to...

  2. Worldwide Report, Telecommunications Policy, Research and Development, No. 271

    Science.gov (United States)

    1983-05-17

    and not as educational or cultural instru- ments is the fact that the director of Radio Educacion is now appointed by the Govern- ment Secretariat...Journalists, Froyland Rascon of Radio Educacion , Jose Alvarez Icaza of Cencos [National Mass Media Center]; Leopoldo de Gyves, the mayor of Juchitan...board, especially for the new television station. Programmes of a political nature would also take up air-time but if South Africa objected to

  3. 77 FR 271 - Privacy Act of 1974; System of Records

    Science.gov (United States)

    2012-01-04

    ... Liaison Officer, Department of Defense. HDTRA 007 System name: Security Services (December 4, 2009, 74 FR... manager.'' * * * * * HDTRA 007 System name: Security Services. System location(s): Primary location... date; badge number; vehicle ID and decal number; special intelligence access; expiration date, agency...

  4. 48 CFR 1352.271-81 - Discharge of liens.

    Science.gov (United States)

    2010-10-01

    ...) The contractor shall immediately discharge or cause to be discharged any lien or right in rem of any... done or materials furnished under the contract. If any such lien or right in rem is not immediately discharged, the Government may discharge or cause to be discharged such lien or right at the expense of the...

  5. Translations on Narcotics and Dangerous Drugs No. 271

    Science.gov (United States)

    1976-11-11

    Worth 25,000 Kyats Seized in Rangoon (MYANMA ALIN, 18 Oct 76) 10 Marihuana Burned in Okto (MYANMA ALIN, 2 Oct 76) 11 MALAYSIA American... Marihuana , Cocaine Pushers, Addicts Arrested (EL TIEMPO, 23 Sep 76) 29 Briefs Drug Ring Smashed 31 Drug Hauls and Arrests 31 Drug Traffickers Arrested...lead of the Labor Governments in New South Wales and South Australia in moves to legalise marihuana ," he said. A submission by the Australian

  6. Dicty_cDB: VHE271 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -21 (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 105 3e-21 BC171956_1( BC171956 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 (Q9JLC8) RecName: Full=Sacsin; 103 1e-20 AB006708_10( AB006

  7. 7 CFR 271.1 - General purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... agricultural economy, as well as result in more orderly marketing and distribution of foods. To alleviate such... households to obtain a more nutritious diet through normal channels of trade by increasing food purchasing...

  8. 48 CFR 536.271 - Project labor agreements.

    Science.gov (United States)

    2010-10-01

    ... is subordinate to a national or international labor organization (42 U.S.C. 2000e(d)). Large and...) The use of a PLA is not intended to create any right or benefit, substantive or procedural enforceable... reliable source of skilled, experienced building trades workers in all crafts needed on the job site for...

  9. 40 CFR 52.271 - Malfunction, startup, and shutdown regulations.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Malfunction, startup, and shutdown..., startup, and shutdown regulations. (a) The following regulations are disapproved because they would permit... malfunctions and/or fail to sufficiently limit startup and shutdown exemptions to those periods where it is...

  10. Dicty_cDB: SHL271 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *tl*eiksnrc*sfiih**wlcnwfglylkiirsk*rfrfsslvrsysiem *n*skenvg*skckryqrgsksfsn*kds...*stfkeflyhrtclglkl hrsydq**r*tl*eiksnrc*sfiih**wlcnwfglylkiirsk*rfrfsslvrsysiem *n*skenvg*skckryqrgsksfsn*kd

  11. All projects related to | Page 271 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: SCIENCE AND TECHNOLOGY POLICY, INNOVATIONS, COMMUNICATION TECHNOLOGY, POVERTY MITIGATION, SOCIAL INEQUALITY, COOPERATION BETWEEN ORGANIZATIONS. Region: Brazil, South America, China, Far East Asia, India, Uruguay, South Africa, South of Sahara, North and Central America, ...

  12. The synthesis of the deformed superheavy elements 107 to 111

    International Nuclear Information System (INIS)

    Armbuster, P.

    1995-01-01

    By inflight separation, implantation into Si-detector arrays, and correlation analysis of subsequent α-decay chains many isotopes were discovered at GSI since 1980, among others the elements Nielsbohriurn, Hassium and Meitnerium. The sensitivity of the method allows to identify an element by one decay chain, as we demonstrated for the case of 266 Mt. After a break of our work during the time when the new accelerator system SIS-FRS-ESR was installed (1989-1993) at GSI, and many improvements of our system EZR-UNILAC-SHIP accomplished, we restarted element synthesis in 1994. The synthesis of the isotopes 269 110, 271 110, and 272 111 of the new elements Z--110 and Z=l11 was a first success at the end of 1994. This discovery is in the center of this presentation. The reaction mechanism, a one-step, cold and compact rearrangement process at a level of some 10 -36 cm 2 is discussed. Cross sections and excitation functions systematically studied allow to extrapolate to the next element Z=112, which seems not to be out of reach

  13. Decay properties of nuclei close to Z = 108 and N = 162

    International Nuclear Information System (INIS)

    Dvorak, Jan

    2007-01-01

    The goal of the research conducted in the frame of this thesis was to investigate the decay properties of the nuclides 269-271 Hs and their daughters using an improved chemical separation and detection system. Shell stabilization was predicted in the region around Z=108 and N=162 in calculations, taking into account possible higher orders of deformations of the nuclei. The nucleus 270 Hs with a closed proton and a closed neutron deformed shell, was predicted to be ''deformed doubly magic''. Nuclei around 270 Hs can be produced only via fusion reactions at picobarn levels, resulting in a production rates of few atoms per day. Investigating short-lived nuclei using rapid chemical separation and subsequent on-line detection methods provides an independent and alternative means to electromagnetic on-line separators. Chemical separation of Hs in the form of HsO 4 provides an excellent tool to study the formation reactions and nuclear structure in this region of the chart of nuclides due to a high overall efficiency and a very high purification factor. The goal was accomplished, as element 108, hassium, was produced in the reaction 248 Cm( 26 Mg,xn) 274-x Hs and chemically isolated. After gas phase separation of HsO 4 , 26 genetically linked decay chains have been observed. These were attributed to decays of three different Hs isotopes produced in the 3-5n evaporation channels. The known decay chain of 269 Hs, the 5n evaporation product, serves as an anchor point, thus allowing the unambiguous assignment of the observed decay chains to the 5n, 4n, and 3n channels, respectively. Decay properties of five nuclei have been unambiguously established for the first time, including the one for the the doubly-magic nuclide 270 Hs. This hassium isotope is the next doubly magic nucleus after the well known 208 Pb and the first experimentally observed even-even nucleus on the predicted N=162 neutron shell. The observed decay properties provide strong indications for enhanced nuclear

  14. IAEA Newsbriefs. V. 11, no. 2(71). Apr-May 1996

    International Nuclear Information System (INIS)

    1996-01-01

    This issue gives brief information on the following topics: Chernobyl Conference sums up Scientific Understanding, International Forum on the Safety of RBMK Reactors, IAEA Board of Governors, Radiological Study of the Mururoa and Fangataufa Atolls, Safeguards Support, Workshop on Modelling Methods for Water Systems, Uranium Market Trends, Security Council Resolution on Iraq, South East Asian NWFZ, Radioactive Waste Management, Nuclear Seminar in Poland, and other short information

  15. Mechanical properties of weldings by electron beams on alloy 8090 (CP 271)

    International Nuclear Information System (INIS)

    Le Poac, P.; Nomine, A.M.; Miannay, D.

    1987-06-01

    Weldings by electron beams got on rings in alloy 8090 in the T4 and T6 state are mechanically tested in traction in the original state of welding or after a thermal processing of 12 hours at 210 0 C [fr

  16. BKR 27(1) pp. 39-43 (Ibrahim et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji

    2015-03-31

    Mar 31, 2015 ... Pharmacy Practice, University Of Ilorin Nigeria. 3Department of Pharmacognosy and ... one generation to the other verbally, however in the 21st century there is need that such knowledge must be evaluated and documented ...

  17. SU-F-T-271: Comparing IMRT QA Pass Rates Before and After MLC Calibration

    Energy Technology Data Exchange (ETDEWEB)

    Mazza, A; Perrin, D; Fontenot, J [Mary Bird Perkins Cancer Center, Baton Rouge, LA (United States)

    2016-06-15

    Purpose: To compare IMRT QA pass rates before and after an in-house MLC leaf calibration procedure. Methods: The MLC leaves and backup jaws on four Elekta linear accelerators with MLCi2 heads were calibrated using the EPID-based RIT Hancock Test as the means for evaluation. The MLCs were considered to be successfully calibrated when they could pass the Hancock Test with criteria of 1 mm jaw position tolerance, and 1 mm leaf position tolerance. IMRT QA results were collected pre- and postcalibration and analyzed using gamma analysis with 3%/3mm DTA criteria. AAPM TG-119 test plans were also compared pre- and post-calibration, at both 2%/2mm DTA and 3%/3mm DTA. Results: A weighted average was performed on the results for all four linear accelerators. The pre-calibration IMRT QA pass rate was 98.3 ± 0.1%, compared with the post-calibration pass rate of 98.5 ± 0.1%. The TG-119 test plan results showed more of an improvement, particularly at the 2%/2mm criteria. The averaged results were 89.1% pre and 96.1% post for the C-shape plan, 94.8% pre and 97.1% post for the multi-target plan, 98.6% pre and 99.7% post for the prostate plan, 94.7% pre and 94.8% post for the head/neck plan. Conclusion: The patient QA results did not show statistically significant improvement at the 3%/3mm DTA criteria after the MLC calibration procedure. However, the TG-119 test cases did show significant improvement at the 2%/2mm level.

  18. 34 CFR 271.20 - What conditions must an applicant meet to obtain funding?

    Science.gov (United States)

    2010-07-01

    ... ensure its success; (k) The applicant, as part of its nondiscriminatory employment practices, shall ensure that its personnel are selected for employment without regard to race, color, national origin, gender, age or handicapping condition. (l) The project must have an adequate budget to support the...

  19. Instrument evaluation no. 11. ESI nuclear model 271 C contamination monitor

    CERN Document Server

    Burgess, P H

    1978-01-01

    The various radiations encountered in radiological protection cover a wide range of energies and radiation measurements have to he carried out under an equally broad spectrum of environmental conditions. This report is one of a series intended to give information on the performance characteristics of radiological protection instruments, to assist in the selection of appropriate instruments for a given purpose, to interpret the results obtained with such instruments, and, in particular, to know the likely sources and magnitude of errors that might be associated with measurements in the field. The radiation, electrical and environmental characteristics of radiation protection instruments are considered together with those aspects of the construction which make an instrument convenient for routine use. To provide consistent criteria for instrument performance, the range of tests performed on any particular class of instrument, the test methods and the criteria of acceptable performance are based broadly on the a...

  20. BKR 27(1) pp. 33-38 (Egwim et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji

    2015-03-31

    Mar 31, 2015 ... polymers via simple sugars to biofuels like ethanol, butanol, or biodiesel, or to chemicals ... such as pyrolysis (thermolysis), chemical oxidation, hydrogenolysis ..... Review of Thermochemical Methods.Chem Engin Technol ...

  1. Dickson et al., Afr J Tradit Complement Altern Med. (2012) 9(2):271 ...

    African Journals Online (AJOL)

    AJTCAM

    *R.A. Dickson, Department of Pharmacognosy, Faculty of Pharmacy and ... Chronic inflammatory disorders: chronic non-healing ulcers, rheumatoid arthritis, chronic .... have been suggested to contribute to the mechanism of inflammation .... may be generated as by products of biological reactions or from exogenous factors.

  2. Ioana BOT, Eminescu explicat fratelui meu, Editura Art, București, 2012, 271 p.

    Directory of Open Access Journals (Sweden)

    Anca-Elena DANCIU

    2012-01-01

    Full Text Available A-i face o prezentare Ioanei Bot ar fi, oarecum, în zadar, luând în considerare vasta bibliografie care ne-a fost dedicată de-a lungul timpului, dar mai ales, dăruirea și devotamentul pe care fiecare student l-a simțit în momentul în care a asistat la cursurile universitare ale autoarei. Ioana Bot se află printre cele mai importante nume din țară și nu numai în critica literară, iar aprecierile la adresa sa nu au întărziat să apară.Pentru a urma canoanele unei recenzii, vom aminti, totuși, câteva date biografice ale autoarei, tocmai pentru acei cititori „cu ochi străini”, care nu au pășit încă, îndeaproape, în universul Ioanei Bot. Așadar, născută în 1964, la Cluj-Napoca, Ioana Bot este în prezent profesor la Facultatea de Litere din cadrul Univeristății „Babeș-Bolyai” și autoare a numeroase volume cu impact major în literatura română. Benefica persistență a operei sale se îndreaptă către studiul operei eminesciene, concretizat în publicații valoroase, dintre care extragem câteva titluri: Eminescu și lirica românească de azi (1990; Mihai Eminescu – Scrisori (2004; Mihai Eminescu, poet naţional român (2002. Volumele care ne călăuzesc în tainele literaturii sunt multe și interesante, însă abordarea unghiurilor și perspectivelor inedite asupra noilor apariții publicistice îi aduc autoarei aprecieri suplimentare. Ne referim aici la rubrica din „Dilematica”, denumită Cărți de plastic, unde autoarea își exprimă cele mai sincere și justificate opinii despre aceste producții.

  3. Pediatric Infectious Endophthalmitis: A 271-case Retrospective Study at a Single Center in China

    Directory of Open Access Journals (Sweden)

    Meng Zhang

    2016-01-01

    Conclusions: Penetrating ocular trauma is the most frequent cause of pediatric endophthalmitis in China. Streptococcus and Staphylococcus species are the most commonly identified organisms in exogenous pediatric endophthalmitis whereas Fusarium species are commonly seen in endogenous endophthalmitis. In this research, in spite of aggressive management with antibiotics and vitrectomy, the visual prognosis was found to be generally poor.

  4. BKR 27(1) pp. 22-25 (Ufelle et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji

    2015-03-31

    Mar 31, 2015 ... Groups A to D were administered orally with graded-doses of crude methanolic extract ... macrophylla (Ugba in Igbo language) is consumed by an estimated 15 ... herbal remedy may lead to either bone marrow stimulation for.

  5. Sud du Sahara | Page 271 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Savoir. Innovation. Solutions. Carrières · Communiquez avec nous · Plan du site · Droits d'auteur · Éthique de la recherche · Politique de libre accès · Politique de confidentialité · Transparence · Utilisation du site Web. Suivez-nous; Facebook · Twitter · Youtube · Linked In · RSS Feed. © 2015 CRDI. Tous droits réservés.

  6. BKR 27(1) pp. 8-13 (Falodun et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji

    2015-03-31

    Mar 31, 2015 ... importance after tomatoes among the vegetables in Nigeria. Aliyu et al., (2008) ... due to low organic matter content (Amans et al., 1996). The rain forest ... the effects of fertilizer application and spacing on onion performance ...

  7. 40 CFR 271.23 - Procedures for withdrawing approval of State programs.

    Science.gov (United States)

    2010-07-01

    ... number/gender); (ii) Section 22.04(c)—(authorities of Presiding Officer); (iii) Section 22.06—(filing... by making an oral or written statement of his/her position on the issues within such limits and on... Presiding Officer's recommended decision, the Administrator shall review the record before him and issue his...

  8. 48 CFR 1352.271-72 - Additional Item Requirements (AIR)-growth work

    Science.gov (United States)

    2010-10-01

    ... direct material purchases and subcontractor handling. The estimated quantity of labor hours and handling... performance period. All growth work shall be paid at the prices stated in the Schedule. (b) The contractor... Government's intention to award any growth work identified during the repair to the contractor, if a fair and...

  9. BKR 27(1) pp. 44-49 (Achuba et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji

    2015-03-31

    Mar 31, 2015 ... ... hydrocarbon petroleum products. (gasoline and kerosene) were evaluated in this study. ..... Journal of Nutrition 23: 581. Ita, S. O. and Udofia,A.U. (2011) Comparative study of some. Haematological Parameters in Rat following ingestion of crude oil. (Nigeria Bonny Light), gasoline, kerosene and diesel.

  10. People and things. CERN Courier, Jan-Feb 1987, v. 27(1)

    International Nuclear Information System (INIS)

    Anon.

    1987-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The search goes on for gravitational radiation, the existence of such waves was implied by the first formulations of general relativity some sixty years ago, but their detection has taxed the ingenuity of experimenters. Any signals would be easily screened by seismic noise, etc. In an effort to eliminate this background, a network of three highly sensitive cryogenic detectors was set up – one at CERN, used by a Rome group, another at Stanford and a third at Louisiana State. The 1987 JINR-CERN School of Physics is the tenth in a series organized by the Joint Institute for Nuclear Research (JINR, Dubna, USSR) and CERN. The aim is to teach various aspects of high energy physics, especially theoretical, to young experimentalists with at least one year's research experience, coming mainly from Member States of JINR and CERN. The fourth workshop to discuss physics at CERN's LEAR Low Energy Antiproton Ring will be held at Villars-sur-Ollon, Switzerland, from 6-13 September

  11. Dominance of multidrug resistant CC271 clones in macrolide-resistant streptococcus pneumoniae in Arizona

    Directory of Open Access Journals (Sweden)

    Bowers Jolene R

    2012-01-01

    Full Text Available Abstract Background Rates of resistance to macrolide antibiotics in Streptococcus pneumoniae are rising around the world due to the spread of mobile genetic elements harboring mef(E and erm(B genes and post-vaccine clonal expansion of strains that carry them. Results Characterization of 592 clinical isolates collected in Arizona over a 10 year period shows 23.6% are macrolide resistant. The largest portion of the macrolide-resistant population, 52%, is dual mef(E/erm(B-positive. All dual-positive isolates are multidrug-resistant clonal lineages of Taiwan19F-14, mostly multilocus sequence type 320, carrying the recently described transposon Tn2010. The remainder of the macrolide resistant S. pneumoniae collection includes 31% mef(E-positive, and 9% erm(B-positive strains. Conclusions The dual-positive, multidrug-resistant S. pneumoniae clones have likely expanded by switching to non-vaccine serotypes after the heptavalent pneumococcal conjugate vaccine release, and their success limits therapy options. This upsurge could have a considerable clinical impact in Arizona.

  12. People and things. CERN Courier, Jan-Feb 1987, v. 27(1)

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1987-01-15

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The search goes on for gravitational radiation, the existence of such waves was implied by the first formulations of general relativity some sixty years ago, but their detection has taxed the ingenuity of experimenters. Any signals would be easily screened by seismic noise, etc. In an effort to eliminate this background, a network of three highly sensitive cryogenic detectors was set up – one at CERN, used by a Rome group, another at Stanford and a third at Louisiana State. The 1987 JINR-CERN School of Physics is the tenth in a series organized by the Joint Institute for Nuclear Research (JINR, Dubna, USSR) and CERN. The aim is to teach various aspects of high energy physics, especially theoretical, to young experimentalists with at least one year's research experience, coming mainly from Member States of JINR and CERN. The fourth workshop to discuss physics at CERN's LEAR Low Energy Antiproton Ring will be held at Villars-sur-Ollon, Switzerland, from 6-13 September.

  13. The Emergence of China in the Middle East (Strategic Forum, Number 271, December 2011)

    Science.gov (United States)

    2011-12-01

    of Iran, China’s arms trading activity goes beyond simple transactions to include transfer of designs, manufacturing techniques, and technology. A...benefited the region’s oil-exporting gov- ernments as well as consumers in the form of lower prices for imported Chinese goods. However, local nontechnical...receive any benefits in the form of jobs or monetary compensation.23 Similar dynamics have surfaced in other developing countries such as Zambia and

  14. 26 CFR 1.271-1 - Debts owed by political parties.

    Science.gov (United States)

    2010-04-01

    ... has been active in the party no bad debt deduction will be allowed with respect to the loan. (b...), no deduction shall be allowed under section 166 (relating to bad debts) or section 165(g) (relating... appears that the bad debt was incurred to or purchased by, or the worthless security was acquired by, the...

  15. : tous les projets | Page 271 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Date de début : 1 mars 2011. End Date: 1 mars 2016. Région: North and Central America, South America, Brazil, Chile, Colombia, Canada. Financement total : CA$ 2,500,000.00. Changements climatiques et santé des autochtones. Projet. Les populations autochtones figurent parmi celles qui sont les plus touchées par les ...

  16. BKR 27(1) pp. xx-xx (Dick et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji

    2015-03-31

    Mar 31, 2015 ... Antibiotic sensitivity profiles of the bacteria (Escherichia coli, Vibrio sp. and Salmonella sp.) ..... of Vibrio parahaemolyticus isolated from cockles in Padang, ... potentially pathogenic Halophilic Vibrios isolated from seafood.

  17. BKR 27(1) pp. 1-7 (Akinloye et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji

    2015-03-31

    Mar 31, 2015 ... ozone used as disinfectant in drinking water, because ozonation of ..... The micronuclei assay is developed for detection of in vivo chromosomal ... cell integrity accompanied by leakage of cellular content from the damaged ...

  18. 271 Dislodging the “University of Nkwo Nnewi” through Open and ...

    African Journals Online (AJOL)

    First Lady

    2013-01-28

    Jan 28, 2013 ... face more problems in business than their forebears because information ... but there is need advocacy campaigns through town unions, market ..... therefore produces new breed managers who understand the emerging.

  19. 271 A New Approach in the Social Field – Law No. 62/2011

    Directory of Open Access Journals (Sweden)

    Radu Răzvan Popescu

    2012-05-01

    Full Text Available Law no. 62/2011 of social dialogue, as it was regulated by the lawmaker, comes and reuniteswithin it a series of fundamental institutions in social matters, such as: social dialogue (trade unions,employees’ representatives, owners’ associations, the Economic and Social Council, the collectiveemployment contract, labour conflicts and, not lastly, a series of elements pertaining to labour jurisdiction. Itthus abrogates the old regulations in the matter: Law no. 54/2003 with respect to trade unions, Law no.356/2001 regarding owners’ associations, Law no. 109/1997 regarding the organizing and functioning of theEconomic and Social Council, Law no. 130/1996 with respect to the collective employment contracts, Lawno. 168/1999 regarding the settling of labour conflicts and Government Decision (G.D. no. 369/2009regarding the establishment and functioning of the social dialogue commissions at the level of the centralpublic administration and at the territorial level.

  20. 48 CFR 1352.271-70 - Inspection and manner of doing work.

    Science.gov (United States)

    2010-10-01

    ... and test at all times during the contractor's performance of the work to determine their quality and... application, filler material type, position of welding, and welding process involved in the work being... necessary as required by good marine practice or by current Occupational Safety and Health Administration...

  1. S. A{r. Tldskr. Veek. 4, 271-274 (1974) NWTSTE ONTWIKKELINGE ...

    African Journals Online (AJOL)

    teen 'n toonemende tempo geihtensifiseer en ook in die voerkrale kan mineraalversorgingen mineraalmetabolisme ... vulling teen 150 mg 7-nldag by die didte van norrnale jmg mans, die tempo van wondgenesing ... knowns in zinc nutrition, especially with ruminants, than there are established facts. Ttre fact that a severe ...

  2. Decay properties of nuclei close to Z = 108 and N = 162

    Energy Technology Data Exchange (ETDEWEB)

    Dvorak, Jan

    2007-07-12

    The goal of the research conducted in the frame of this thesis was to investigate the decay properties of the nuclides {sup 269-271}Hs and their daughters using an improved chemical separation and detection system. Shell stabilization was predicted in the region around Z=108 and N=162 in calculations, taking into account possible higher orders of deformations of the nuclei. The nucleus {sup 270}Hs with a closed proton and a closed neutron deformed shell, was predicted to be ''deformed doubly magic''. Nuclei around {sup 270}Hs can be produced only via fusion reactions at picobarn levels, resulting in a production rates of few atoms per day. Investigating short-lived nuclei using rapid chemical separation and subsequent on-line detection methods provides an independent and alternative means to electromagnetic on-line separators. Chemical separation of Hs in the form of HsO{sub 4} provides an excellent tool to study the formation reactions and nuclear structure in this region of the chart of nuclides due to a high overall efficiency and a very high purification factor. The goal was accomplished, as element 108, hassium, was produced in the reaction {sup 248}Cm({sup 26}Mg,xn){sup 274-x}Hs and chemically isolated. After gas phase separation of HsO{sub 4}, 26 genetically linked decay chains have been observed. These were attributed to decays of three different Hs isotopes produced in the 3-5n evaporation channels. The known decay chain of {sup 269}Hs, the 5n evaporation product, serves as an anchor point, thus allowing the unambiguous assignment of the observed decay chains to the 5n, 4n, and 3n channels, respectively. Decay properties of five nuclei have been unambiguously established for the first time, including the one for the the doubly-magic nuclide {sup 270}Hs. This hassium isotope is the next doubly magic nucleus after the well known {sup 208}Pb and the first experimentally observed even-even nucleus on the predicted N=162 neutron shell. The

  3. SU-E-T-271: Direct Measurement of Tenth Value Layer Thicknesses for High Density Concretes with a Clinical Machine

    Energy Technology Data Exchange (ETDEWEB)

    Tanny, S; Parsai, E [University of Toledo Medical Center, Toledo, OH (United States); Harrell, D; Noller, J [Shielding Construction Solutions, Inc, Tuscon, AZ (United States); Chopra, M [Unviersal Minerals International, Inc, Tuscon, AZ (United States)

    2015-06-15

    Purpose: Use of high density concrete for radiation shielding is increasing, trading cost for space savings associated with the reduced tenth value layer (TVL). Precise information on the attenuation properties of high-density concretes is not readily present in the literature. A simple approximation is to scale the TVLs from NCRP 151 according relative increase in density. Here we present measured TVLs for heavy concretes of various densities using a built-in shielding test port. Methods: Concrete densities tested range from 2.35 g cc{sup −1} (147 pcf) to 5.6 g cc{sup −1} (350 pcf). Measurements were taken using 6MV, 6FFF, and 10FFF on a Varian Truebeam linear accelerator. Field sizes of 4x4, 9x9 and 30x30 cm{sup 2} were measured. A PTW 31013 Farmer chamber with a buildup cap was positioned 5.5 m from isocenter along the beam CAX. Concrete thicknesses were incremented in 5 cm intervals. Comparison TVLs were determined by scaling the NCRP 151 TVLs by the density ratio between the sample and standard density. Results: The trend from the first to equilibrium TVL was an increase in thickness, compared with MC modeling, which predicted a decrease. Measured TVLs for 6 MV were reduced by as much as 8.9 cm for TVL{sub 1} and 3.4 cm for TVL{sub E} compared to values scaled from NCRP 151. There was 1–3 mm difference in TVL between measurements done at 4x4 versus 30x30 cm{sup 2}. TVL{sub 1} for 6FFF was 1.1 cm smaller than TVL{sub 1} for 6MV, but TVL{sub E} was consistent to within 4 mm. TVL{sub 1} and TVL{sub E} for 10FFF were reduced by 8.8 and 3.7 cm from scaled NCRP values, respectively. Conclusions: We have measured the TVL thicknesses for various concretes. Simple density scaling of the values in NCRP 151 is a conservatively safe approximation, but actual TVLs may be reduced enough to eliminate some of the expense of installation. Daniel Harrell and Jim Noller are employees of Shielding Construction Solutions, Inc, the shielding construction company that built the vault discussed in this abstract. Manjit Chopra is an employee of Universal Minerals International, Inc, the company that provided the aggregates for the high density concretes used in the vault construction.

  4. Certification of polycyclic aromatic compounds. Pt. 6. CRM Nos. 152, 265, 266, 267, 268, 269, 270, 271, 272

    Energy Technology Data Exchange (ETDEWEB)

    Jacob, J; Belliardo, J J; Wagstaffe, P J

    1985-01-01

    The purity of samples of seven polycyclic aromatic hydrocarbons and two nitrogen-containing heterocyclics has been determined in an interlaboratory exercise, involving eleven laboratories of the EC member countries. The purity measurements were carried out using independent analytical methods (gas liquid chromatography, high performance liquid chromatography and mass spectrometry). This report describes the certification procedure and experimental details of the interlaboratory analyses of standard materials for environmental pollutants.

  5. SU-E-J-271: Correlation of CT Number Change with Radiation Treatment Response for Pancreatic Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Dalah, E; Tai, A; Oshima, K; Hall, W; Knechtges, P; Erickson, B; Li, X [Medical College of Wisconsin, Milwaukee, WI (United States)

    2015-06-15

    Purpose: It has been reported recently that radiation can induce CT number (CTN) change during radiation therapy (RT) delivery. In the effort to explore whether CTN can be used to assess RT response, we analyze the relationship between the pathological treatment response (PTR) and the changes of CTN, MRI, and PET before and after the neoadjuvant chemoradiation (nCR) for pancreatic adenocarcinoma. Methods: The preand post-nCR CT, MRI, and PET data for a total of 8 patients with resectable, or borderline resectable pancreatic head adenocarcinoma treated with nCR were retrospectively analyzed. Radiographic characteristics were correlated to PTR data. The histograms, means and standard derivations (SD) of the CTNs in pancreatic head (CTNPH), the GTV defined by ADC (CTNGTV), and the rest of pancreatic head (CTNPH-CTNGTV) were compared. Changes before and after nCR were correlated with the corresponding changes of ADC, lean body mass normalized SUV (SUVlb), and PTR using Pearson’ s correlation coefficient test. Results: The average mean and SD in CTPH for all the patients analyzed were higher in post-nCR (53.17 ± 31.05 HU) compared to those at pre-nCR (28.09 ± 4.253 HU). The CTNGTV were generally higher than CTNPH and CTNPH-CTNGTV, though the differences were not significant. The post-nCR changes of mean CTN, ADC, and SUVlb values in pancreatic head were correlated with PTR (R=0.3273/P=0.5357, R=−0.5455/P<0.0001, and R=0.7638/P=0.0357, respectively). The mean difference in the maximum tumor dimension measured from CTN, ADC, and SUVlb as compared with pathological measurements was −2.1, −0.5, and 0.22 cm, respectively. Conclusion: The radiation-induced change of CTN in pancreas head after chemoradiation therapy of pancreatic cancer was observed, which may be related to treatment responses as assessed by biological imaging and pathology. More data are needed to determine whether the CTN can be used as a quantitative biomarker for response to neoadjuvant therapy.

  6. SU-E-T-271: Direct Measurement of Tenth Value Layer Thicknesses for High Density Concretes with a Clinical Machine

    International Nuclear Information System (INIS)

    Tanny, S; Parsai, E; Harrell, D; Noller, J; Chopra, M

    2015-01-01

    Purpose: Use of high density concrete for radiation shielding is increasing, trading cost for space savings associated with the reduced tenth value layer (TVL). Precise information on the attenuation properties of high-density concretes is not readily present in the literature. A simple approximation is to scale the TVLs from NCRP 151 according relative increase in density. Here we present measured TVLs for heavy concretes of various densities using a built-in shielding test port. Methods: Concrete densities tested range from 2.35 g cc −1 (147 pcf) to 5.6 g cc −1 (350 pcf). Measurements were taken using 6MV, 6FFF, and 10FFF on a Varian Truebeam linear accelerator. Field sizes of 4x4, 9x9 and 30x30 cm 2 were measured. A PTW 31013 Farmer chamber with a buildup cap was positioned 5.5 m from isocenter along the beam CAX. Concrete thicknesses were incremented in 5 cm intervals. Comparison TVLs were determined by scaling the NCRP 151 TVLs by the density ratio between the sample and standard density. Results: The trend from the first to equilibrium TVL was an increase in thickness, compared with MC modeling, which predicted a decrease. Measured TVLs for 6 MV were reduced by as much as 8.9 cm for TVL 1 and 3.4 cm for TVL E compared to values scaled from NCRP 151. There was 1–3 mm difference in TVL between measurements done at 4x4 versus 30x30 cm 2 . TVL 1 for 6FFF was 1.1 cm smaller than TVL 1 for 6MV, but TVL E was consistent to within 4 mm. TVL 1 and TVL E for 10FFF were reduced by 8.8 and 3.7 cm from scaled NCRP values, respectively. Conclusions: We have measured the TVL thicknesses for various concretes. Simple density scaling of the values in NCRP 151 is a conservatively safe approximation, but actual TVLs may be reduced enough to eliminate some of the expense of installation. Daniel Harrell and Jim Noller are employees of Shielding Construction Solutions, Inc, the shielding construction company that built the vault discussed in this abstract. Manjit Chopra is an employee of Universal Minerals International, Inc, the company that provided the aggregates for the high density concretes used in the vault construction

  7. 48 CFR 2923.271 - Purchase and use of environmentally sound and energy efficient products and services.

    Science.gov (United States)

    2010-10-01

    ... can be used to assess the life cycle cost of each good or product, including building energy system... the Government Through Leadership in Environmental Management Systems, dated April 21, 2000. This Executive Order assists with developing an environmental management system. The following sources are...

  8. Sugar-Sweetened Beverage Consumption among U.S. Youth, 2011-2014. NCHS Data Brief. Number 271

    Science.gov (United States)

    Rosinger, Asher; Herrick, Kirsten; Gahche, Jaime; Park, Sohyun

    2017-01-01

    Sugar-sweetened beverages contribute calories and added sugars to the diets of U.S. children. Studies have suggested a link between the consumption of sugar-sweetened beverages and dental caries, weight gain, type 2 diabetes, dyslipidemia, and nonalcoholic fatty liver disease in children. The 2015-2020 Dietary Guidelines for Americans recommend…

  9. Evidence for the formation of sodium hassate(VIII)

    International Nuclear Information System (INIS)

    Zweidorf, A. von; Angert, R.; Bruechle, W.; Buerger, S.; Eberhardt, K.; Eichler, R.; Hummrich, H.; Jaeger, E.; Kling, H.O.; Kratz, J.V.; Kuczewski, B.; Langrock, G.; Mendel, M.; Rieth, U.; Schaedel, M.; Schausten, B.; Schimpf, E.; Thoerle, P.; Trautmann, N.; Tsukada, K.; Wiehl, N.; Wirth, G.

    2004-01-01

    Hassium, element 108, was produced in the fusion reaction between 26 Mg and 248 Cm. The hassium recoils were oxidized in-situ to a highly volatile oxide, presumably HsO 4 , and were transported in a mixture of He and O 2 to a deposition and detection system. The latter consisted of 16 silicon PIN-photodiodes facing a layer of NaOH, which served, in the presence of a certain partial pressure of water in the transport gas, as reactive surface for the deposition of the volatile tetroxides. Six correlated α-decay chains of Hs were detected in the first 5 detectors centred around detection position 3. In analogy to OsO 4 , which forms Na 2 [OsO 4 (OH) 2 ], an osmate(VIII), with aqueous NaOH, HsO 4 presumably was deposited as Na 2 [HsO 4 (OH) 2 ], a hassate(VIII). (orig.)

  10. What Is the Evidence Base to Support Reading Interventions for Improving Student Outcomes in Grades 1-3? REL 2017-271

    Science.gov (United States)

    Gersten, Russell; Newman-Gonchar, Rebecca; Haymond, Kelly S.; Dimino, Joseph

    2017-01-01

    Response to intervention (RTI) is a comprehensive early detection and prevention strategy used to identify and support struggling students before they fall behind. An RTI model usually has three tiers or levels of support. Tier 1 is generally defined as classroom instruction provided to all students, tier 2 is typically a preventive intervention…

  11. Generation of an isogenic, gene-corrected control cell line of the spinocerebellar ataxia type 2 patient-derived iPSC line H271

    DEFF Research Database (Denmark)

    Marthaler, Adele Gabriele; Schmid, Benjamin; Tubsuwan, Alisa

    2016-01-01

    Spinocerebellar ataxia type 2 (SCA2) is a neurodegenerative disease primarily affecting the cerebellum. Very little is known about the molecular mechanisms underlying the disease and, to date, no cure or treatment is available. We have successfully generated bona fide induced pluripotent stem cell...

  12. What types of social interactions reduce the risk of psychological distress? Fixed effects longitudinal analysis of a cohort of 30,271 middle-to-older aged Australians.

    Science.gov (United States)

    Feng, Xiaoqi; Astell-Burt, Thomas

    2016-11-01

    Research on the impact of social interactions on psychological distress tends to be limited to particular forms of support, cross-sectional designs and by the spectre of omitted variables bias. A baseline sample with 3.4±0.95 years follow-up time was extracted from the 45 and Up Study. Change in the risk of psychological distress (Kessler Psychological Distress Scale) was assessed using fixed effects logistic regressions in relation to the number of times in the past week a participant: i) spent time with friends or family they did not live with; ii) talked to friends, relatives or others on the telephone; iii) attended meetings at social clubs or religious groups; and the count of people outside their home, but within one hour travel-time, participants felt close to. Separate models were fitted for men and women, adjusting for age, income, economic and couple status. An increase in the number of social interactions was associated with a reduction in the risk of psychological distress, with some gender differences. Interactions with friends or family were important for women (adjusted OR 0.85, 95%CI 0.74, 0.98, p=0.024), whereas telephone calls were effective among men (adjusted OR 0.83, 95%CI 0.72, 0.96, p=0.011). Strong effects for the number of people that can be relied on were observed for men and women, but attendance at clubs and groups was not. No age-specific effects were observed. No indicator of positive mental health. Policies targeting greater social interactions in middle-to-older age may help protect mental health. Copyright © 2016 Elsevier B.V. All rights reserved.

  13. +2.71 LOD score at zero recombination is not sufficient for establishing linkage between X-linked mental retardation and X-chromosome markers

    Energy Technology Data Exchange (ETDEWEB)

    Robledo, R.; Melis, P.; Siniscalco, M. [and others

    1996-07-12

    Nonspecific X-linked mental retardation (MRX) is the denomination attributed to the familial type of mental retardation compatible with X-linked inheritance but lacking specific phenotypic manifestations. It is thus to be expected that families falling under such broad definition are genetically heterogeneous in the sense that they may be due to different types of mutations occurring, most probably, at distinct X-chromosome loci. To facilitate a genetic classification of these conditions, the Nomenclature Committee of the Eleventh Human Gene Mapping Workshop proposed to assign a unique MRX-serial number to each family where evidence of linkage with one or more X-chromosome markers had been established with a LOD score of at least +2 at zero recombination. This letter is meant to emphasize the inadequacy of this criterion for a large pedigree where the segregation of the disease has been evaluated against the haplotype constitution of the entire X-chromosome carrying the mutation in question. 12 refs., 2 figs., 1 tab.

  14. Identification of Tetrapeptides from a Mixture Based Positional Scanning Library That Can Restore nM Full Agonist Function of the L106P, I69T, I102S, A219V, C271Y, and C271R Human Melanocortin-4 Polymorphic Receptors (hMC4Rs)

    OpenAIRE

    Haslach, Erica M.; Huang, Huisuo; Dirain, Marvin; Debevec, Ginamarie; Geer, Phaedra; Santos, Radleigh G.; Giulianotti, Marc A.; Pinilla, Clemencia; Appel, Jon R.; Doering, Skye R.; Walters, Michael A.; Houghten, Richard A.; Haskell-Luevano, Carrie

    2014-01-01

    Human obesity has been linked to genetic factors and single nucleotide polymorphisms (SNPs). Melanocortin-4 receptor (MC4R) SNPs have been associated with up to 6% frequency in morbidly obese children and adults. A potential therapy for individuals possessing such genetic modifications is the identification of molecules that can restore proper receptor signaling and function. These compounds could serve as personalized medications improving quality of life issues as well as alleviating diseas...

  15. Erratum: Correction to Table 3, in: Equivalent threshold sound pressure levels (ETSPL) for Sennheiser HDA 280 supra-aural audiometric earphones in the frequency range 125 Hz to 8000 Hz (International Journal of Audiology (2009) 48 (271-276))

    DEFF Research Database (Denmark)

    Poulsen, Torben

    2014-01-01

    The main results in Poulsen & Oakley (2009) are given as the equivalent threshold sound pressure level, ETSPL, measured in an acoustic coupler specifi ed in IEC 60318-3. These results are all correct. The ETSPL values for the ear simulator specifi ed in IEC 60318-1 were calculated from acoustic...

  16. Corrigendum to "Chemical composition and acidity of size-fractionated inorganic aerosols of 2013-14 winter haze in Shanghai and associated health risk of toxic elements" [Atmos. Environ. (2015) 259-271

    Science.gov (United States)

    Behera, Sailesh N.; Cheng, Jinping; Huang, Xian; Zhu, Qiongyu; Liu, Ping; Balasubramanian, Rajasekhar

    2018-03-01

    The authors regret that the sources from which the RfC (reference concentration) and the IUR (inhalation unit risk) values were obtained for estimation of RfD (reference dose, presented in Table 2) and SF (slope factor, presented in Table 3) were not clearly indicated in the published article due to an oversight. The revised tables with improved clarity are given below. a The Risk Assessment Information System (https://rais.ornl.gov/) b USEPA Integrated Risk Information System (IRIS) (http://www.epa.gov/iris) c The California EPA, the office of Environmental Health Hazard Assessment (OEHHA) (https://www.oehha.gov.gov/) d Behera, S.N., Xian, H. and Balasubramanian, R., 2014. Human health risk associated with exposure to toxic elements in mainstream and sidestream cigarette smoke. Science of the Total Environment, 472, pp.947-956.

  17. Jacobo-Velázquez, D.A and Cisneros-Zevallos, L. An Alternative Use of Horticultural Crops: Stressed Plants as Biofactories of Bioactive Phenolic Compounds. Agriculture 2012, 2, 259-271

    Directory of Open Access Journals (Sweden)

    Luis Cisneros-Zevallos

    2013-09-01

    Full Text Available The authors are sorry to report that some data in the text (Section 2, Section 2.1.1. and Section 2.1.2 and Table 1 were incorrect in reference [1], doi: 10.3390/agriculture2030259, website: http://www.mdpi.com/2077-0472/2/3/259. Our mistake was basically in the calculations of changes observed in the reported values in those references; unfortunately we did not detect the errors at the time of publication. However, since we saw them afterwards, we believed it was pertinent to make the corrections. The authors would, therefore, like to make the following corrections to the paper:

  18. From bohrium to copernicium and beyond SHE research at SHIP

    Energy Technology Data Exchange (ETDEWEB)

    Münzenberg, G., E-mail: G.Muenzenberg@gsi.de [GSI Helmholtzzentrum für Schwerionenforschung, Planckstrasse 1, 64291 Darmstadt (Germany); Manipal Centre for Natural Sciences, Manipal University, Manipal 576104, Karnataka (India)

    2015-12-15

    Heavy-element research with SHIP at GSI is reviewed including the discovery of the chemical elements bohrium to copernicium, experimental developments, cold fusion of heavy ions, and the discovery of a shell region around hassium. Elements bohrium and heavier are located beyond the limit of liquid-drop stability. They exist by shell stabilization. A universal, sensitive, and fast method: in-flight separation and identification of single atomic nuclei has been developed with the velocity filter SHIP and the detector system to measure decay sequences of individual atoms. Research with single atomic nuclei including detection methods, identification, and physics results will be discussed. Experiments with actinide targets as well as prospects with NUSTAR at FAIR will be addressed.

  19. “The Time of the Historian”: On the Book by V.A. Kitaev “Social Thought and Historical Science in Russia in 18-20th Centuries (Problems of Historiography” (Nizhny Novgorod: Izd-vo NNGU, 2016. – 271 p.

    Directory of Open Access Journals (Sweden)

    Kuznetsov Oleg V.

    2016-09-01

    Full Text Available The book of V.A. Kitaev includes reviews of monographs and textbook, collective publications, including encyclopedias, publications of sources, historiographical articles, some of which were published in leading scientific journals in 1980-2015, and some were published for the first time. This publication is not exactly a review to V.A. Kitaev’s book, but an attempt to provide the reader with reflections on some of the problems of public thoughts and historiography highlighted by the author: the features of the professional study of history, historiographical analysis as a genre of research, methodology and terminology in modern studies on the history of social thought and historical science, the ratio of professional approach and political convictions, attitude to scientific traditions, etc. The present paper highlights the highest scientific professionalism of V.A. Kitaev, his ability and willingness to be critical not only to other people’s research, but also to his own. Despite the well-known assertion that “we do not choose the times”, we can safely say that V.A. Kitaev consciously chose the “time of the historian” and found himself in this time.

  20. Logical analysis of biological systems

    DEFF Research Database (Denmark)

    Mardare, Radu Iulian

    2005-01-01

    R. Mardare, Logical analysis of biological systems. Fundamenta Informaticae, N 64:271-285, 2005.......R. Mardare, Logical analysis of biological systems. Fundamenta Informaticae, N 64:271-285, 2005....

  1. 78 FR 59752 - Notice of a Record of Decision

    Science.gov (United States)

    2013-09-27

    ... ROD may be viewed online or during regular business hours at the following locations: 1. Online at www.... Grey may be contacted during business hours at (907) 271-5453 (telephone) and (907) 271-2851 (fax), or...

  2. ORF Alignment: NC_001134 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available QSMPYHVDHTTGLIDYDNLQVLAKAFRPKVIVAGT Sbjct: 121 PDGGHLSHGYQLKSGTPISFISKYFQSMPYHVDHTTGLIDYDNLQVLAKAFRPKVIVAGT 180 ... Query: 271 RGAMIF...FRKGIKSVTKKGKEIPYELEKKINFSVFPGHQGGPHNHTIGAMAVALKQAMSPE 330 ... RGAMIFFRKGIKSVTK...KGKEIPYELEKKINFSVFPGHQGGPHNHTIGAMAVALKQAMSPE Sbjct: 241 RGAMIFFRKGIKSVTKKGKEIPYEL

  3. ORF Alignment: NT_033777 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available AGPDAPGNQGLKDQVLALKWVRDNIAAFGGDPNQVTIFGESAGASSVQLLLLSSQAKGLF 210 ... Query: 241 TITAEDQRNNIGLPFVPV...VEGYWNQDSQEEQFYEEPFLTQHPSDMYHSQNFNSDVAYMTG 300 ... TITAEDQRNNIGLPFVPVVEGYWNQDSQEEQFYEE...PFLTQHPSDMYHSQNFNSDVAYMTG Sbjct: 271 TITAEDQRNNIGLPFVPVVEGYWNQDSQEEQFYEEPFLTQHPSDMYHSQNFNSDVAYMTG 330 ... Query

  4. Skin-resident stem cells and wound healing.

    Science.gov (United States)

    Iwata, Yohei; Akamatsu, Hirohiko; Hasebe, Yuichi; Hasegawa, Seiji; Sugiura, Kazumitsu

    2017-01-01

    CD271 is common stem cell marker for the epidermis and dermis. We assessed a kinetic movement of epidermal and dermal CD271 + cells in the wound healing process to elucidate the possible involvement with chronic skin ulcers. Epidermal CD271 + cells were proliferated and migrated from 3 days after wounding. Purified epidermal CD271 + cells expressed higher TGFβ2 and VEGFα transcripts than CD271 - cells. Delayed wound healing was observed in the aged mice compared with young mice. During the wound healing process, the peak of dermal CD271 + cell accumulation was delayed in aged mice compared with young mice. The expression levels of collagen-1, -3, -5, F4-80, EGF, FGF2, TGFβ1, and IL-1α were significantly increased in young mice compared with aged mice. Furthermore, purified dermal CD271 + cells expressed higher FGF2, EGF, PDGFB, and TGFβ1 gene transcripts than CD271 - cells. These results suggested that epidermal and dermal CD271 + cells were closely associated with wound healing process by producing various growth factors. Epidermal and dermal CD271 + cells in chronic skin ulcer patients were significantly reduced compared with healthy controls. Thus, both epidermal and dermal stem cells can play an important role in wound healing process.

  5. Existing Analytical Frameworks for Information Behaviour Don’t Fully Explain HIV/AIDS Information Exchange in Rural Communities in Ontario, Canada. A Review of: Veinot, T., Harris, R., Bella, L., Rootman, I., & Krajnak, J. (2006. HIV/AIDS Information exchange in rural communities: Preliminary findings from a three‐province study. Canadian Journal of Information and Library Science, 30(3/4, 271‐290.

    Directory of Open Access Journals (Sweden)

    Kate Kelly

    2010-03-01

    Full Text Available Objective – To explore and analyze, against three theoretical frameworks of information behaviours, how people with HIV/AIDS, their friends, and their family living in rural communities find information on HIV/AIDS.Design – Qualitative, individual, in‐depth, semi‐structured interviews.Setting – Two rural regions in Ontario, Canada.Subjects – Sixteen participants; 10 people with HIV/AIDS (PHAs and 6 family members or friends.Methods – Participants were recruited through health care providers, social service agencies and through snowball sampling. Semi‐structure interviews were conducted focusing on participants’ experience with HIV/AIDS, how they find and use information on HIV/AIDS, networks for information exchange and the effect of technology on information exchange. Interviews were taped, transcribed, analyzed qualitatively using NVivo software. Results were compared to three theoretical frameworks for information behaviour: 1. purposeful information seeking (i.e., the idea that people purposefully seek information to bridge perceived knowledge gaps; 2. non‐purposeful or incidental information acquisition (i.e., the idea that people absorb information from going about daily activities; and 3. information gate keeping (i.e., the concept of private individuals who act as community links and filters for information gathering and dissemination.Main Results – Consistent with the theories:•PHAs prefer to receive information from people they have a personal relationship with, particularly their physician and especially other PHAs.•PHAs’ friends and families rely on their friends and family for information, and are particularly reliant upon the PHA in their lives.•Fear of stigma and discrimination cause some to avoid seeking information or to prefer certain sources of information, such as healthcare providers, who are bound by codes of professional conduct.•Emotional support is important in information provision and its presence supersedes the professional role of the provider (social workers and counsellors were identified as key information sources over medical professionals in this instance. Participants responded negatively to the perceived lack of support from providers including doubting the information provided.•PHAs monitor their worlds and keep up to date about HIV/AIDS.Inconsistent with theories:•Reliance on caregivers for information is not solely explained by fear of stigma or exposure. Rather, it is the specialized knowledge and immersion in HIV/AIDS which is valued.•The distinction between peer or kin sources of information and institutional information sources is less clear and relationships with professionals can turn personal over time.•Inter‐personal connections include organisations, not just individuals, particularly AIDS Service Organizations and HIV specialist clinics.•Relatively few incidents of finding useful information about HIV/AIDS incidentally were described. The concept of information just being “out there” was not really applicable to rural settings, likely due to the lack of discussion within participant communities and local media. When it was discussed, participants reported being more likely to gain misinformation through their personal networks.•Incidental information acquisition originates mostly from professional and organisational sources. Participants identified posters, leaflets, and, for those who interacted with organisations, information via mail as contributing to current awareness.•The gate keeping concept does not capture all the information sharing activities undertaken by “gate keepers” in rural areas, and neither does it include formal providers of information, yet all PHAs interviewed identified formal providers as key sources.Conclusion – The findings reinforce some of the existing analytical framework theories, particularly the importance of affective components (i.e. emotional supports of information seeking, the presence of monitoring behaviours, and of interpersonal sources of information. However, alternate theories may need to be explored as the role of institutional information sources in the lives of PHAs doesn’t match the theoretical predication and the “gate keeper” concept doesn’t capture a significant portion of that role in rural HIV/AIDS information exchange.

  6. Superheavy element chemistry. Achievements and perspectives

    International Nuclear Information System (INIS)

    Schaedel, M.

    2007-01-01

    Superheavy elements have been synthesized and chemically characterized one-atom-at-a-time up to element 108. Presently, the quest for element 112 is one of the hottest topics in this field. The transactinide elements 104 to 108 are members of group 4 to 8 of the Periodic Table and element 112 belongs into group 12. Chemical properties of some of these elements, like elements 104 and 105, show stunning deviations from simple extrapolations within their respective group while others exhibit great similarities with their lighter homologues elements. First experiments to investigate seaborgium (Sg, element 106) in aqueous solution were performed. Again, in large international collaborations at the GSI, several gas-phase chemistry experiments were performed with hassium (Hs, element 108). Recently, the highly efficient and very clean separation of Hs was applied for nuclear studies of various Hs nuclides investigating their cross section and their nuclear decay properties in the region of the doubly-magic 270 Hs (Z=108, N=162). To overcome certain limitations of the presently used on-line chemical separations the new TransActinide Separation and Chemistry Apparatus (TASCA) - with a gas-filled recoil separator as a front-end tool - was designed and built at the GSI in a collaborative effort. Presently in its commissioning phase, TASCA shall be a key instrument for a big leap into quantitatively and qualitatively new experiments in the region of superheavy elements. (author)

  7. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    Energy Technology Data Exchange (ETDEWEB)

    Even, Julia

    2011-12-13

    Topic of this thesis is the development of experiments behind the gas-filled separator TASCA (TransActinide Separator and Chemistry Apparatus) to study the chemical properties of the transactinide elements. In the first part of the thesis, the electrodepositions of short-lived isotopes of ruthenium and osmium on gold electrodes were studied as model experiments for hassium. From literature it is known that the deposition potential of single atoms differs significantly from the potential predicted by the Nernst equation. This shift of the potential depends on the adsorption enthalpy of therndeposited element on the electrode material. If the adsorption on the electrode-material is favoured over the adsorption on a surface made of the same element as the deposited atom, the electrode potential is shifted to higher potentials. This phenomenon is called underpotential deposition. Possibilities to automatize an electro chemistry experiment behind the gas-filled separator were explored for later studies with transactinide elements. The second part of this thesis is about the in-situ synthesis of transition-metal-carbonyl complexes with nuclear reaction products. Fission products of uranium-235 and californium-249 were produced at the TRIGA Mainz reactor and thermalized in a carbon-monoxide containing atmosphere. The formed volatile metal-carbonyl complexes could be transported in a gas-stream. Furthermore, short-lived isotopes of tungsten, rhenium, osmium, and iridium were synthesised at the linear accelerator UNILAC at GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt. The recoiling fusion products were separated from the primary beam and the transfer products in the gas-filled separator TASCA. The fusion products were stopped in the focal plane of TASCA in a recoil transfer chamber. This chamber contained a carbon-monoxide - helium gas mixture. The formed metal-carbonyl complexes could be transported in a gas stream to various experimental setups. All

  8. Design and properties of silicon charged-particle detectors developed at the Institute of Electron Technology (ITE)

    Science.gov (United States)

    Wegrzecki, Maciej; Bar, Jan; Budzyński, Tadeusz; CieŻ, Michal; Grabiec, Piotr; Kozłowski, Roman; Kulawik, Jan; Panas, Andrzej; Sarnecki, Jerzy; Słysz, Wojciech; Szmigiel, Dariusz; Wegrzecka, Iwona; Wielunski, Marek; Witek, Krzysztof; Yakushev, Alexander; Zaborowski, Michał

    2013-07-01

    The paper discusses the design of charged-particle detectors commissioned and developed at the Institute of Electron Technology (ITE) in collaboration with foreign partners, used in international research on transactinide elements and to build personal radiation protection devices in Germany. Properties of these detectors and the results obtained using the devices are also presented. The design of the following epiplanar detector structures is discussed: ♢ 64-element chromatographic arrays for the COMPACT (Cryo On-line Multidetector for Physics And Chemistry of Transactinides) detection system used at the GSI Helmholtzzentrum für Schwerionenforschung in Darmstadt (GSI) for research on Hassium, Copernicium and Flerovium, as well as elements 119 and 120, ♢ 2-element flow detectors for the COLD (Cryo On-Line Detector) system used for research on Copernicium and Flerovium at the Joint Institute for Nuclear Research, Dubna, ♢ detectors for a radon exposimeter and sensors for a neutron dosimeter developed at the Institut für Strahlenschutz, Helmholtz Zentrum München. The design of planar detectors - single-sided and double-sided strip detectors for the Focal Plane Detector Box used at GSI for research on Flerovium and elements 119 and 120 is also discussed.

  9. IVO, a device for In situ Volatilization and On-line detection of products from heavy ion reactions

    CERN Document Server

    Duellmann, C E; Eichler, R; Gäggeler, H W; Jost, D T; Piguet, D; Türler, A

    2002-01-01

    A new gaschromatographic separation system to rapidly isolate heavy ion reaction products in the form of highly volatile species is described. Reaction products recoiling from the target are stopped in a gas volume and converted in situ to volatile species, which are swept by the carrier gas to a chromatography column. Species that are volatile under the given conditions pass through the column. In a cluster chamber, which is directly attached to the exit of the column, the isolated volatile species are chemically adsorbed to the surface of aerosol particles and transported to an on-line detection system. The whole set-up was tested using short-lived osmium (Os) and mercury (Hg) nuclides produced in heavy ion reactions to model future chemical studies with hassium (Hs, Z=108) and element 112. By varying the temperature of the isothermal section of the chromatography column between room temperature and -80 deg. C, yield measurements of given species can be conducted, yielding information about the volatility o...

  10. Chemical experiments with superheavy elements.

    Science.gov (United States)

    Türler, Andreas

    2010-01-01

    Unnoticed by many chemists, the Periodic Table of the Elements has been extended significantly in the last couple of years and the 7th period has very recently been completed with eka-Rn (element 118) currently being the heaviest element whose synthesis has been reported. These 'superheavy' elements (also called transactinides with atomic number > or = 104 (Rf)) have been artificially synthesized in fusion reactions at accelerators in minute quantities of a few single atoms. In addition, all isotopes of the transactinide elements are radioactive and decay with rather short half-lives. Nevertheless, it has been possible in some cases to investigate experimentally chemical properties of transactinide elements and even synthesize simple compounds. The experimental investigation of superheavy elements is especially intriguing, since theoretical calculations predict significant deviations from periodic trends due to the influence of strong relativistic effects. In this contribution first experiments with hassium (Hs, atomic number 108), copernicium (Cn, atomic number 112) and element 114 (eka-Pb) are reviewed.

  11. Chemistry of superheavy elements

    International Nuclear Information System (INIS)

    Schaedel, M.

    2012-01-01

    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  12. Chemistry of the superheavy elements.

    Science.gov (United States)

    Schädel, Matthias

    2015-03-13

    The quest for superheavy elements (SHEs) is driven by the desire to find and explore one of the extreme limits of existence of matter. These elements exist solely due to their nuclear shell stabilization. All 15 presently 'known' SHEs (11 are officially 'discovered' and named) up to element 118 are short-lived and are man-made atom-at-a-time in heavy ion induced nuclear reactions. They are identical to the transactinide elements located in the seventh period of the periodic table beginning with rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) in groups 4, 5 and 6, respectively. Their chemical properties are often surprising and unexpected from simple extrapolations. After hassium (element 108), chemistry has now reached copernicium (element 112) and flerovium (element 114). For the later ones, the focus is on questions of their metallic or possibly noble gas-like character originating from interplay of most pronounced relativistic effects and electron-shell effects. SHEs provide unique opportunities to get insights into the influence of strong relativistic effects on the atomic electrons and to probe 'relativistically' influenced chemical properties and the architecture of the periodic table at its farthest reach. In addition, they establish a test bench to challenge the validity and predictive power of modern fully relativistic quantum chemical models. © 2015 The Author(s) Published by the Royal Society. All rights reserved.

  13. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LKNKTALITGGNGGIGLATAKLFVAEGAKVVITGRNKETLAAAAKELGPNALAVVADAT 60 ... Query: 146 LPHLNDNASIILNGSVISVLGIPGYSAYGAAKAGVRAMARIMA...SELSPRGIRVNVVAPGA 205 ... LPHLNDNASIILNGSVISVLGIPGYSAYGAAKAGVRAMARIMASELSPRGIRVNVVAPGA Sbjc...t: 121 LPHLNDNASIILNGSVISVLGIPGYSAYGAAKAGVRAMARIMASELSPRGIRVNVVAPGA 180 ... Query: 266 DGGAVA 271 ... DGGAVA Sbjct: 241 DGGAVA 246

  14. ORF Alignment: ch_oct10_gene_aa_db [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available reonine protein kinase KKIALRE (EC 2.7.1.-) ... [Cryptosporidium hominis] ... Length = 361 ... Query: 10 ... LNRYKTICE...IGEGAFGVVFKCMDLVTNEIVALKEFKTIYSDENENSYVTKNSANGKVNTN 69 ... LNRYKTICEIGEGAFGVVFKCMDL...VTNEIVALKEFKTIYSDENENSYVTKNSANGKVNTN Sbjct: 1 ... LNRYKTICEIGEGAFGVVFKCMDLVTNEIVALK

  15. ORF Alignment: NC_004668 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available s ... faecalis V583] ... Length = 156 ... Query: 151 NIVNTRIDERLIHGQVAGIWSTSLSTQRIIVANDEAATDPLQKS...SLRMAAPSSMRLSVLG 210 ... NIVNTRIDERLIHGQVAGIWSTSLSTQRIIVANDEAATDPLQKSSLRMA...APSSMRLSVLG Sbjct: 1 ... NIVNTRIDERLIHGQVAGIWSTSLSTQRIIVANDEAATDPLQKSSLRMAAPSSMRLSVLG 60 ... Query: 271 VLPEEEQIF

  16. Use of acoustic systems for underwater archaeology

    Digital Repository Service at National Institute of Oceanography (India)

    Vora, K.H.

    stream_size 2 stream_content_type text/plain stream_name J_Mar_Archaeol_2_71.pdf.txt stream_source_info J_Mar_Archaeol_2_71.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  17. Age-related prodiabetogenic effects of transgenic resistin in spontaneously hypertensive rats

    Czech Academy of Sciences Publication Activity Database

    Pravenec, Michal; Zídek, Václav; Landa, Vladimír; Kazdová, L.; Kurtz, T.

    2006-01-01

    Roč. 23, Suppl. 4 (2006), s. 271-271 ISSN 0742-3071. [World Diabetes Congress /19./. 03.12.2006-07.12.2006, Cape Town] R&D Projects: GA ČR(CZ) GA301/06/0028 Institutional research plan: CEZ:AV0Z50110509 Keywords : resistin * autocrine effects * transgenic Subject RIV: ED - Physiology

  18. Fresh water influx and particle flux variability in the Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Schafer, P.; Ittekkot, V.; Bartsch, M.; Nair, R.R.; Tiemann, J.

    stream_size 22 stream_content_type text/plain stream_name Particle_Flux_Ocean_Chapter_15_1996_271.pdf.txt stream_source_info Particle_Flux_Ocean_Chapter_15_1996_271.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...

  19. Search Results | Page 672 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 6711 - 6720 of 9602 ... ... Middle East (271) Apply Middle East filter · West Indies (271) Apply .... This problem highlights the linkages between the environmental, economic, ... Health Enterprise Architecture Laboratory (HEAL) ... The health informatics researcher is the architect responsible for ensuring that they do so.

  20. Moulting and moult quality in eye-stalk ablated penaeid prawn, Metapenaeus monoceros (Fabricius)

    Digital Repository Service at National Institute of Oceanography (India)

    Venkitaraman, P.R.; Sivadas, P.

    stream_size 3 stream_content_type text/plain stream_name 4_Kerala_Sci_Cong_Proc_1992_271.pdf.txt stream_source_info 4_Kerala_Sci_Cong_Proc_1992_271.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  1. Oriented stochastic data envelopment models: ranking comparison to stochastic frontier approach

    Czech Academy of Sciences Publication Activity Database

    Brázdik, František

    -, č. 271 (2005), s. 1-46 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : stochastic data envelopment analysis * linear programming * rice farm Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp271.pdf

  2. Disease: H01995 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available undborg disease (ULD), also known as progressive myoclonic epilepsy type 1 (EPM1), is an autosomal recessive...tatin B in progressive myoclonus epilepsy (EPM1) ... JOURNAL ... Science 271:1731-4 (1996) DOI:10.1126/science.271.5256.1731 ...

  3. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    International Nuclear Information System (INIS)

    Even, Julia

    2011-01-01

    Topic of this thesis is the development of experiments behind the gas-filled separator TASCA (TransActinide Separator and Chemistry Apparatus) to study the chemical properties of the transactinide elements. In the first part of the thesis, the electrodepositions of short-lived isotopes of ruthenium and osmium on gold electrodes were studied as model experiments for hassium. From literature it is known that the deposition potential of single atoms differs significantly from the potential predicted by the Nernst equation. This shift of the potential depends on the adsorption enthalpy of therndeposited element on the electrode material. If the adsorption on the electrode-material is favoured over the adsorption on a surface made of the same element as the deposited atom, the electrode potential is shifted to higher potentials. This phenomenon is called underpotential deposition. Possibilities to automatize an electro chemistry experiment behind the gas-filled separator were explored for later studies with transactinide elements. The second part of this thesis is about the in-situ synthesis of transition-metal-carbonyl complexes with nuclear reaction products. Fission products of uranium-235 and californium-249 were produced at the TRIGA Mainz reactor and thermalized in a carbon-monoxide containing atmosphere. The formed volatile metal-carbonyl complexes could be transported in a gas-stream. Furthermore, short-lived isotopes of tungsten, rhenium, osmium, and iridium were synthesised at the linear accelerator UNILAC at GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt. The recoiling fusion products were separated from the primary beam and the transfer products in the gas-filled separator TASCA. The fusion products were stopped in the focal plane of TASCA in a recoil transfer chamber. This chamber contained a carbon-monoxide - helium gas mixture. The formed metal-carbonyl complexes could be transported in a gas stream to various experimental setups. All

  4. Nuclear structure studies towards superheavy elements and perspectives with AGATA

    International Nuclear Information System (INIS)

    Korichi, A.

    2005-01-01

    A variety of theoretical approaches have been used to calculate the shell closure of spherical Super Heavy Elements (SHE) but the predictions of the location of the 'island of stability' vary from Z=114 to 120 and 126, with neutron numbers around N=172 or N=184 depending on the model employed. A deformed minimum around Z=108 and N=162 is predicted and an increase of the half-life of Hassium (Z=108) is experimentally observed when approaching the neutron number N=162. Super heavy nuclei are produced with very low cross-section (a few picobarns) and this makes their spectroscopic study impossible with today's beam intensities and detectors. However, important information can be obtained from the structure of mid-shell deformed nuclei (Z∼104) where selected single particle orbitals, which lie close to the spherical shell gap in SHE, are close to the Fermi level. The information will come from decay and in-beam spectroscopy. A promising area of progress, using the state-of-the art instruments, is represented by the observation of rotational gamma-ray transitions in No and Fm isotopes showing the deformed character of these nuclei. One of the objectives and focus of the nuclear structure community is related to the investigation of Single particle excitations beyond the N=152 neutron gap and collective properties of heavier systems towards Z∼104. The IN2P3-JINR collaboration has launched a project of electron and gamma-ray spectroscopy studies of heavy nuclei at the FLNR. This project benefits from the radioactive actinide targets uniquely available at Dubna and from the very intense stable beams provided by the U400 cyclotron. This offers a unique opportunity for the study of nuclei above Z=100 along an isotopic chain approaching N=162. In this contribution, the emphasis will be on the GABRIELA project and its issues. I will finally point out the perspectives with the new generation of gamma detectors such as AGATA

  5. Assessment of adherence to the CONSORT statement for quality of reports on randomized controlled trial abstracts from four high-impact general medical journals.

    Science.gov (United States)

    Ghimire, Saurav; Kyung, Eunjung; Kang, Wonku; Kim, Eunyoung

    2012-06-07

    The extended Consolidated Standards of Reporting Trials (CONSORT) Statement for Abstracts was developed to improve the quality of reports of randomized controlled trials (RCTs) because readers often base their assessment of a trial solely on the abstract. To date, few data exist regarding whether it has achieved this goal. We evaluated the extent of adherence to the CONSORT for Abstract statement for quality of reports on RCT abstracts by four high-impact general medical journals. A descriptive analysis of published RCT abstracts in The New England Journal of Medicine (NEJM), The Lancet, The Journal of American Medical Association (JAMA), and the British Medical Journal (BMJ) in the year 2010 was conducted by two reviewers, independently extracting data from a MEDLINE/PubMed search. We identified 271 potential RCT abstracts meeting our inclusion criteria. More than half of the abstracts identified the study as randomized in the title (58.7%; 159/271), reported the specific objective/hypothesis (72.7%; 197/271), described participant eligibility criteria with settings for data collection (60.9%; 165/271), detailed the interventions for both groups (90.8%; 246/271), and clearly defined the primary outcome (94.8%; 257/271). However, the methodological quality domains were inadequately reported: allocation concealment (11.8%; 32/271) and details of blinding (21.0%; 57/271). Reporting the primary outcome results for each group was done in 84.1% (228/271). Almost all of the abstracts reported trial registration (99.3%; 269/271), whereas reports of funding and of harm or side effects from the interventions were found in only 47.6% (129/271) and 42.8% (116/271) of the abstracts, respectively. These findings show inconsistencies and non-adherence to the CONSORT for abstract guidelines, especially in the methodological quality domains. Improvements in the quality of RCT reports can be expected by adhering to existing standards and guidelines as expressed by the CONSORT group.

  6. Structure and Bonding in Binuclear Metal Carbonyls. Classical Paradigms vs. Insights from Modern Theoretical Calculations

    Czech Academy of Sciences Publication Activity Database

    Ponec, Robert

    2015-01-01

    Roč. 1053, SI (2015), s. 195-213 ISSN 2210-271X Institutional support: RVO:67985858 Keywords : binuclear metal carbonyls * DAFH analysis * 18-electron rule Subject RIV: CC - Organic Chemistry Impact factor: 1.403, year: 2015

  7. Search Results | Page 28 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 8491 ... Bangladesh is undergoing a rapid demographic and epidemiological ... diseases and other chronic health conditions. ... This project will help prepare youth in East and Southern Africa for economic opportunities, and ...

  8. Prevalence of hepatitis B and C and relationship to liver damage in ...

    African Journals Online (AJOL)

    Immunology laboratory Uganda Case Western Reserve University Research Collaboration. 2. ... Makerere University Colleges of Veterinary Medicine, Animal Resources and Biosecurity. 5. .... The mean age was 27.1 years, while standard.

  9. Search Results | Page 28 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 8487 ... Strengthening response capacity to African infectious disease outbreaks. The 2014 Ebola outbreak in West Africa claimed the lives of tens of thousands ... of a global health institute in the Middle East and North Africa.

  10. 77 FR 15273 - Oklahoma: Final Authorization of State Hazardous Waste Management Program Revision

    Science.gov (United States)

    2012-03-15

    ...: Final Authorization of State Hazardous Waste Management Program Revision AGENCY: Environmental... hazardous waste management program. We authorized the following revisions: Oklahoma received authorization... its program revision in accordance with 40 CFR 271.21. The Oklahoma Hazardous Waste Management Act...

  11. Search Results | Page 28 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 8494 ... ... DETERMINANTS OF HEALTH HEALTH HUMAN RESOURCES ... Perspectives ... of senior and middle-management positions are held by women. ... urban violence reduction theories, strategies, and interventions.

  12. Epiphytic diatoms in lotic and lentic waters - diversity and representation of species complexes

    Czech Academy of Sciences Publication Activity Database

    Kollár, J.; Fránková, Markéta; Hašler, P.; Letáková, M.; Poulíčková, A.

    2015-01-01

    Roč. 15, č. 2 (2015), s. 259-271 ISSN 1802-5439 Institutional support: RVO:67985939 Keywords : diatoms * epiphyton * species comlexes * lotic and lentic waters Subject RIV: EF - Botanics Impact factor: 2.026, year: 2015

  13. Search Results | Page 28 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2009-01-01

    Results 271 - 280 of 1368 ... Enough foreign direct investment quickens economic growth everywhere ... to bank the unbanked. Published date. January 1, 2009. Papers ... The middle income trap is economic stagnation, recession or slow ...

  14. 77 FR 22806 - Proposed Extension of Existing Collection; Comment Request

    Science.gov (United States)

    2012-04-17

    ... annually. Total Burden Cost (capital/startup): $0. Total Burden Cost (operating/maintenance): $45,979... (Section 8(f) Payments) 1,425 ESA-100 (20 SFR 702.201) 840 LS-271 (Self Insurance Application) 60 LS-274...

  15. The Schenley Experiment: A Social History of Pittsburgh’s First Public High School

    OpenAIRE

    Gabrion, Laura

    2018-01-01

    Jake Oresick, The Schenley Experiment: A Social History of Pittsburgh’s First Public High School. University Park, PA: Pennsylvania State University Press, 2017. 222 pp. ISBN 978-0-271-07833-5. $19.95 (paperback).

  16. FACTORS INFLUENCING THE SELECTION OF DENTAL NURSING ...

    African Journals Online (AJOL)

    drclement

    to 85 dental nursing students from 3. Colleges ... products of mixed school. Teaching was the commonest job among 27.1% .... Social Science (SPSS version 15.0) ... Frequency Percent. Educational status. Father. Informal. 6. 7.1. Primary. 10.

  17. Publications | Page 28 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 6341 ... IDRC works with developing-country researchers and ... food and nutrition security for low- and middle-income households in Kenya and Uganda. ... of the work IDRC's Rural Poverty and Environment program has ...

  18. Křehká víla z bahna rybníků - puchýřka útlá

    Czech Academy of Sciences Publication Activity Database

    Šumberová, Kateřina; Ducháček, M.

    2014-01-01

    Roč. 61, č. 6 (2014), s. 265-271 ISSN 0044-4812 R&D Projects: GA AV ČR KJB600050803 Institutional support: RVO:67985939 Keywords : threatened species * wetlands * fishpond management Subject RIV: EF - Botanics

  19. Search Results | Page 28 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 282 ... Filter by type .... Moreover, conflict in one country tends to affect its neighbours, mainly through the flow of refugees and ... Cost of Conflicts in the Common Market for Eastern and Southern Africa (COMESA) Region.

  20. Zápis rumunských vlastních jmen s monofunkčním písmenem e v koncové slabice

    Czech Academy of Sciences Publication Activity Database

    Beneš, Martin

    2012-01-01

    Roč. 95, č. 5 (2012), s. 265-271 ISSN 0027-8203 Institutional support: RVO:68378092 Keywords : czech spelling * geographical proper names of Romain origin * orthography * personal proper names of Romain origin * pronunciation Subject RIV: AI - Linguistics

  1. Download this PDF file

    African Journals Online (AJOL)

    USER

    2015-03-23

    Mar 23, 2015 ... Ethiopian Journal of Environmental Studies & Management 8(3): 264 – 271, 2015. ... Federal University of Technology Minna, Niger State, Nigeria ... on the provision and delivery of healthcare to all, the spatial distribution of ...

  2. Neurological and Neurophysiological Findings in Workers with Chronic 2,3,7,8-Tetrachlorodibenzo-p-Dioxin Intoxication 50 Years After Exposure

    Czech Academy of Sciences Publication Activity Database

    Pelclová, D.; Urban, P.; Fenclová, Z.; Vlčková, Š.; Ridzoň, P.; Kupka, K.; Mecková, Z.; Bezdíček, O.; Navrátil, Tomáš; Rosmus, J.; Zakharov, S.

    Č. 122 (2), s. 271-277 ISSN 1742-7835 Institutional support: RVO:61388955 Keywords : neurological findings * intoxication * TCDD Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry

  3. MILITARY BASE CLOSURES: Questions Concerning the Proposed Sale of Housing at Mather Air Force Base

    National Research Council Canada - National Science Library

    1998-01-01

    This report responds to your request that we review the proposed negotiated sale of 1,271 surplus family housing units at Mather Air Force Base, California, to the Sacramento Housing and Redevelopment Agency (SHRA...

  4. Krajanská lidová léčba a ritualizované praktiky u Čechů z Ukrajiny a Kazachstánu přesídlených do České republiky

    Czech Academy of Sciences Publication Activity Database

    Beranská, Veronika

    2013-01-01

    Roč. 23, č. 4 (2013), s. 264-271 ISSN 0862-8351 Institutional support: RVO:68378076 Keywords : Ukraine * Kazakhstan * Czech Republic * migration * folk medicine * ethno-medicine * complementary medicine * compatriots Subject RIV: AC - Archeology, Anthropology, Ethnology

  5. Search Results | Page 28 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 869 ... Canada 850 Apply Canada filter · Mexico 218 Apply Mexico filter · United ... Apply WOMEN'S RIGHTS filter · ADMINISTRATIVE REFORM 16 Apply ... Growth and Economic Opportunities for Women 4 Apply Growth and ...

  6. Roubované polymerní kartáče

    Czech Academy of Sciences Publication Activity Database

    Riedel, Tomáš; Rodriguez-Emmenegger, Cesar; Pop-Georgievski, Ognen

    2015-01-01

    Roč. 94, č. 10 (2015), s. 580-582 ISSN 0042-4544 Institutional support: RVO:61389013 Keywords : polymer brushes * biosensors Subject RIV: CD - Macromolecular Chemistry http://casopis.vesmir.cz/clanky/cislo/cislo/271

  7. 77 FR 14012 - Eligible Telecommunications Carrier Designation for Participation in Mobility Fund Phase I

    Science.gov (United States)

    2012-03-08

    ...; DA 12-271] Eligible Telecommunications Carrier Designation for Participation in Mobility Fund Phase I... Wireless Telecommunications and Wireline Competition Bureaus describe the process and requirements for applicants seeking Eligible Telecommunications Carrier (ETC) Designation from the Commission for...

  8. Measurements of seismic vibrations induced by Quarry blasts at the Mostecká basin

    Czech Academy of Sciences Publication Activity Database

    Kaláb, Zdeněk

    -, č. 271 (2006), s. 49-58 ISSN 0372-9508 Institutional research plan: CEZ:AV0Z30860518 Keywords : seismic vibration * slope stability * quarry blast Subject RIV: DC - Siesmology, Volcanology, Earth Structure

  9. Search Results | Page 28 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 1130 ... Expanding Business Opportunities for African Youth in Agricultural Value ... As agriculture becomes more strategically important in the world, ... good for human health by improving food security, nutrition and income.

  10. Effects of elevated CO2 and ozone on phenolic glycosides of trembling aspen

    Science.gov (United States)

    James K. Nitao; Muraleedharan G. Nair; William J. Mattson; Daniel A. Herms; Bruce A. Birr; Mark D. Coleman; Terry M. Trier; J. G. Isebrands

    1996-01-01

    We tested the effects of elevated CO2 and ozone on concentrations of the phenolic glycosides salicortin and tremulacin in immature and mature foliage of the trembling aspen (Populus tremuloides) clones 216, 259, and 271.

  11. Search Results | Page 28 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 374 ... Helpdesk for Spanish Speaking Telecentre Communities in Peru and Latin America ... Gender Dimension in Solid Waste Management in Urban and ... of Advances and Challenges in the Reconciliation Process.

  12. Search Results | Page 28 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 1323 ... Increasing awareness of zoonotic diseases among health ... were manadated to be reserved for women in local level politics. ... this percentage is inverted for Indian Muslims, with most living in ... All rights reserved.

  13. Genomic evidence for divergence with gene flow in host races of the larch budmoth

    Czech Academy of Sciences Publication Activity Database

    Emelianov, I.; Marec, František; Mallet, J.

    2003-01-01

    Roč. 271, - (2003), s. 97-105 ISSN 0962-8452 Institutional research plan: CEZ:AV0Z5007907 Keywords : speciation * gene flow * selection Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.544, year: 2003

  14. Influence of continuous light and darkness on the secretory ...

    Indian Academy of Sciences (India)

    Unknown

    rent phases of the secretory process were demonstrated. (Srivastava 1999). ..... in the pineal supportive cells of deep sea fish, Nezumia liolepis (McNulty 1976) and .... factors as light and temperature. Melatonin and ... Brain Res. 52 271–296.

  15. Vom work Book Journal 2011, 2010 4th Edition PDF

    African Journals Online (AJOL)

    USER

    affecting human and animal health (Arshad et al., 2006 ... were restreaked on EMB or sheep blood agar .... Ph D. 273. Ahmed et al, Studies of E. coli Isolates from Diarrhoeic lamb 271 - 274 .... In: AMS 5350 Large Animal Digestive System.

  16. Non vidi nec fas. Afrodita Knidská v antické textové a obrazové tradici

    Czech Academy of Sciences Publication Activity Database

    Bažant, Jan

    -, č. 11 (2016), s. 28-40 ISSN 2453-7284 Institutional support: RVO:67985955 Keywords : Aphrodite * Praxiteles * legends Subject RIV: AB - History http://fff.truni.sk/index.php?mod=publication&detail=271

  17. Československo-jugoslávské vztahy v přelomovém roce 1929

    Czech Academy of Sciences Publication Activity Database

    Škerlová, Jana

    2014-01-01

    Roč. 100, č. 2 (2014), s. 271-296 ISSN 0037-6922 Institutional support: RVO:67985963 Keywords : political relations * Czechoslovakia * Kingdom of Serbs * Croats and Slovenes * Kingdom of Yugoslavia * Royal Dictatorship Subject RIV: AB - History

  18. 77 FR 27030 - North Pacific Fishery Management Council; Notice of Public Meetings

    Science.gov (United States)

    2012-05-08

    ... physically accessible to people with disabilities. Requests for sign language interpretation or other auxiliary aids should be directed to Gail Bendixen at 907-271-2809 at least 7 working days prior to the...

  19. 78 FR 59657 - North Pacific Fishery Management Council; Public Meeting

    Science.gov (United States)

    2013-09-27

    ... Accommodations These meetings are physically accessible to people with disabilities. Requests for sign language interpretation or other auxiliary aids should be directed to Gail Bendixen at (907) 271-2809 at least 7 working...

  20. Comparison of five tests for identification of Staphylococcus aureus from clinical samples

    NARCIS (Netherlands)

    A. Luijendijk (Ad); A.F. van Belkum (Alex); J.A.J.W. Kluytmans (Jan); H.A. Verbrugh (Henri)

    1996-01-01

    textabstractFive different laboratory tests for the identification of Staphylococcus aureus were compared. Analyses of 271 presumptive S. aureus strains, supplemented with 59 well-defined methicillin-resistant S. aureus (MRSA) isolates, were performed. Only the

  1. Sankcionovat

    Czech Academy of Sciences Publication Activity Database

    Černá, Anna

    2016-01-01

    Roč. 99, č. 5 (2016), s. 271-275 ISSN 0027-8203 R&D Projects: GA MŠk(CZ) LM2010013 Institutional support: RVO:68378092 Keywords : sanction * origin * different meanings * dictionary Subject RIV: AI - Linguistics

  2. Technical progress report. Private sector initiatives between the United States and Japan. January 1992 - December 1992

    International Nuclear Information System (INIS)

    1993-01-01

    OAK A271 This annual report for calendar year 1992 describes the efforts performed under the Private Sector Initiatives contract. The report also describes those efforts that have continued with private funding after being initiated under this contract

  3. GLDAS Noah Land Surface Model L4 3 Hourly 1.0 x 1.0 degree Subsetted V001

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set contains a series of land surface parameters simulated from the Noah 2.7.1 model in the Global Land Data Assimilation System (GLDAS). The data are in...

  4. COSTECH - HURIA JOURNAL VOL. 24 (2) COSTECH FINAL_NEW

    African Journals Online (AJOL)

    Prof Kigadye

    consecutive days; finally 6 animals were randomly picked from each treatment and slaughtered ... Organoleptic test was conducted and samples of the mutton, goat meat and ..... Asian-Australasian Journal of Animal Sciences 27(1): 55 –. 60.

  5. 78 FR 4391 - North Pacific Fishery Management Council; Public Meetings

    Science.gov (United States)

    2013-01-22

    ... Guard (USCG) Report (Report on Aleutian Island Risk Assessment) United States Fish & Wildlife Service... interpretation or other auxiliary aids should be directed to Gail Bendixen at (907) 271-2809 at least 7 working...

  6. Search Results | Page 28 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 8491 ... Una Hakika: Scaling Digital Solutions for Conflict Management in Kenya and Burma ... Adaptation Finance: Linking Research, Policy, and Business ... availability, marketing, and consumption of ultra-processed food ...

  7. 76 FR 4686 - Product Cancellation Order for Certain Pesticide Registrations

    Science.gov (United States)

    2011-01-26

    .... 004822-00533 Raid Reach & Kill Tetramethrin Outdoor Ant & Roach Permethrin. Killer. 008112-00001 Lion.... Tetramethrin Permethrin. 004822-00271 271 Raid Tetramethrin Roach & Ant Killer Permethrin. and Treatment...

  8. The mitochondrial genome and ribosomal operon of Brachycladium goliath (Digenea: Brachycladiidae) recovered from a stranded minke whale

    Czech Academy of Sciences Publication Activity Database

    Briscoe, A.G.; Bray, R. A.; Brabec, Jan; Littlewood, D. T. J.

    2016-01-01

    Roč. 65, č. 3 (2016), s. 271-275 ISSN 1383-5769 Institutional support: RVO:60077344 Keywords : Digenea * Balaenoptera acutorostrata * Cetacea * Hologenophore * NGS Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.744, year: 2016

  9. 78 FR 47048 - Notice of Availability of Final Environmental Impact Statement (Final EIS)

    Science.gov (United States)

    2013-08-02

    ... may be viewed online or during regular business hours at the following locations: 1. Online at www..., Anchorage, AK 99513. Ms. Grey may be contacted during business hours at (907) 271-5453 (telephone) and (907...

  10. Confirmation of a theory: reconstruction of an alluvial plain development in a flume experiment

    Czech Academy of Sciences Publication Activity Database

    Bertalan, L.; Tóth, C. A.; Szabó, G.; Nagy, G.; Kuda, František; Szabó, S.

    2016-01-01

    Roč. 70, č. 3 (2016), s. 271-285 ISSN 0014-0015 Institutional support: RVO:68145535 Keywords : fluvial geomorphology * flume experiment * avulsion Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 0.923, year: 2016

  11. Copepoda: Pandaridae

    African Journals Online (AJOL)

    1991-03-04

    ,27(1) finely striated marginal membrane is present along the anterior and lateral margins of the cephalothorax of D. latifolia (Figure 1 & 4c), which no doubt fonns an effective seal against the host tissue. Posteriorly, however ...

  12. Technical progress report. Private sector initiatives between the United States and Japan. January 1990 - December 1990

    International Nuclear Information System (INIS)

    1993-01-01

    OAK A271 This annual report for calendar year 1990 describes the efforts performed under the Private Sector Initiatives contract. The report also describes those efforts that have continued with private funding after being initiated under this contract

  13. 13 CFR 143.50 - Closeout.

    Science.gov (United States)

    2010-01-01

    ... Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention... extend this timeframe. These may include but are not limited to: (1) Final performance or progress report...

  14. 10 CFR 600.250 - Closeout.

    Science.gov (United States)

    2010-01-01

    ... Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention... extend this timeframe. These may include but are not limited to: (1) Final performance or progress report...

  15. 15 CFR 24.50 - Closeout.

    Science.gov (United States)

    2010-01-01

    ... Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention... extend this timeframe. These may include but are not limited to: (1) Final performance or progress report...

  16. 14 CFR 1273.50 - Closeout.

    Science.gov (United States)

    2010-01-01

    ... Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention... extend this timeframe. These may include but are not limited to: (1) Final performance or progress report...

  17. La temperatura alcanzada es casi un grado más frio que el universo, informó el centro de investigaciones CERN

    CERN Multimedia

    2007-01-01

    The first section of what will be the biggest particle accelerator in the world, the LHC, near Geneva, reached the temperature in which it will work: -271 degre Celsius, about one degree colder than the Universe. (1/2 page)

  18. Publications | Page 28 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 6333 ... ... institutions to build local capacity through funding, knowledge sharing, and training. ... Large-scale land deals can bring benefits such as jobs, ... and the Revolutionary Armed Forces of Colombia (FARC) progress, ...

  19. Rarotonga Sr/Ca and SST Reconstruction Data for 1726 to 1997

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A 271 year record of Sr/Ca variability in a coral from Rarotonga in the South Pacific gyre. Calibration with monthly sea surface temperature (SST) from satellite and...

  20. Replication of recently identified systemic lupus erythematosus genetic associations: a case-control study

    Czech Academy of Sciences Publication Activity Database

    Suarez-Gestal, M.; Calaza, M.; Endreffy, E.; Pullmann, R.; Ordi-Ros, J.; Sebastiani, D.G.; Růžičková, Šárka; Santos, J.M.; Papasteriades, C.; Marchini, M.; Skopouli, F.N.; Suarez, A.; Blanco, F.J.; D'Alfonso, S.; Bijl, M.; Carreira, P.; Witte, T.; Migliaresi, S.; Gomez-Reino, J.J.; Gonzalez, A.

    2009-01-01

    Roč. 11, č. 3 (2009), R69 ISSN 1478-6362 Keywords : Single nucleotide polymorphism susceptibility * sytemic lupus erythematosus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.271, year: 2009

  1. Prathap, Dr Gangan

    Indian Academy of Sciences (India)

    Date of birth: 6 June 1951. Specialization: Structural Mechanics, Finite Element Method, Information Science and Composite Materials Address: Honorary Professor, APJ Abdul Kalam Tech University, CET Campus, Thiruvananthapuram 695 016, Kerala Contact: Office: (0471) 278 5627. Residence: (0471) 271 1956

  2. Long-term trends in the ionosphere and upper atmosphere parameters

    Czech Academy of Sciences Publication Activity Database

    Bremer, J.; Alfonsi, L.; Pal, B.; Laštovička, Jan; Mikhailov, A. V.; Rogers, N.

    47 /suppl./, 2/3 (2004), s. 1009-1029 ISSN 1593-5213. [Final Meeting COST271 Action. Effects of the upper atmosphere on terrestrial and Earth-space communications (EACOS). Abingdon, 26.08.2004-27.08.2004] R&D Projects: GA MŠk OC 271.10 Institutional research plan: CEZ:AV0Z3042911 Keywords : long-term trends * ionosphere * upper atmosphere Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.413, year: 2004

  3. An Overview of Production Systems

    Science.gov (United States)

    1975-10-01

    DISTRIBUTED BY: Matonal Tochnica! Infonu srice U. S. DEPARTMENT OF COMMERCE 028143 Stanford Artificil Inteligence Laboratory October 1975 Memo AIM-271...ORGANIZATION NAMEL AND ADDRESS 18. PROGRAM ELEMENT. PROJECT. TASK Artificial Intelligence Laboratory AE OKUI UBR Stanford University ARPA Order 249...014-64011I j SEC-jRITY CLASSIFICATION OF THIS PAGE (When, Data bHISP011 A Stanford Artificial ktteligncs Laboratory October 1975 Memo AIM-271 Computer

  4. A questionnaire study about gonadal shield use of urologists

    OpenAIRE

    Ahmet Ali Sancaktutar; Tevfik Ziypak; Şenol Adanur; Haluk Söylemez; Cihat Hamidi; Yaşar Bozkurt; Murat Atar; Mehmet Nuri Bodakçi

    2012-01-01

    Objectives: Our aim is to reflect routines, awareness,and consciousness level of urologists about usage of gonadalshield (GS) in Turkey.Materials and methods: Because of this objective aquestionnaire which includes 15 questions was prepared.The questionnaire was delivered to urologists in a TurkishUrology congress. Data derived from 271 urologists byface to face interview were evaluated.Results: Participant were urologists (n=271), consistedof professors (n=33), associate professors (n= 36), ...

  5. Ürologların gonad kalkanı kullanımı hakkında bir anket çalışması

    OpenAIRE

    Sancaktutar, Ahmet Ali; Ziypak, Tevfik; Adanur, Şenol; Söylemez, Haluk; Hamidi, Cihat; Bozkurt, Yaşar; Atar, Murat; Bodakçi, Mehmet Nuri

    2015-01-01

    Objectives: Our aim is to reflect routines, awareness, and consciousness level of urologists about usage of gonadal shield (GS) in Turkey. Materials and methods: Because of this objective a questionnaire which includes 15 questions was prepared. The questionnaire was delivered to urologists in a Turkish Urology congress. Data derived from 271 urologists by face to face interview were evaluated. Results: Participant were urologists (n=271), consisted of professors (n=33), associate profe...

  6. Mapping selected general literature of international nursing.

    Science.gov (United States)

    Shams, Marie-Lise Antoun; Dixon, Lana S

    2007-01-01

    This study, part of a wider project to map the literature of nursing, identifies core journals cited in non-US nursing journals and determines the extent of their coverage by indexing services. Four general English-language journals were analyzed for format types and publication dates. Core titles were identified and nine bibliographic databases were scanned for indexing coverage. Findings show that 57.5% (13,391/23,271) of the cited references from the 4 core journals were to journal articles, 27.8% (6,471/23,271) to books, 9.5% (2,208/23,271) to government documents, 4.9% (1,131/23,271) to miscellaneous sources, and less than 1% (70/23,271) to Internet resources. Eleven journals produced one-third of the citations; the next third included 146 journals, followed by a dispersion of 1,622 titles. PubMed received the best database coverage scores, followed by CINAHL and Science Citation Index. None of the databases provided complete coverage of all 11 core titles. The four source journals contain a diverse group of cited references. The currency of citations to government documents makes these journals a good source for regulatory and legislative awareness. Nurses consult nursing and biomedical journals and must search both nursing and biomedical databases to cover the literature.

  7. Evaluation of acetone vapors toxicity on Plodia interpunctella (Hubner) (Lepidoptera: Pyralidae) eggs.

    Science.gov (United States)

    Pourmirza, Ali Asghr; Nasab, Fershteh Sadeghi; Zadeh, Abas Hossein

    2007-08-01

    The efficacy of acetone vapors against carefully aged eggs of Plodia interpunctella (Hubner) at 17+/-1 and 27+/-1 degrees C at different dosage levels of acetone over various exposure times was determined. Acetone was found to be toxic to Indian meal moth eggs. Considerable variation in the susceptibility of different age groups of eggs was apparent in the fiducial limits of the LD50 values. An inverse relationship between LD50 values and exposure times was observed in age groups of tested eggs. At 27+/-1 degrees C and 24 h exposure period, eggs aged 1-2 day-old were more tolerant to acetone than other age groups, followed by 0-1 day-old, 2-3 day-old and 3-4 day-old eggs. A similar pattern of susceptibility of eggs was observed at 72 h exposure. In all bioassays, eggs exposed to higher dosages of acetone developed at smaller rate. This was significant for the eggs, which were exposed to the highest dosage for 24 h. Increasing the temperature from 17+/-1 to 27+/-1 degrees C greatly increased the efficacy of acetone. At 27+/-1 degrees C eggs of P. interpunctella were killed by less than one-third of the dosage required for control at 17+/-1 degrees C. Acetone achieved 50% mortality with a dosage of 82.76 mg L(-1) in 1-2 day-old eggs at 27+/-1 degrees C. At this temperature hatching was retarded and greatly diminished when eggs aged 1-2 day-old were exposed to 80 mg L(-1) of acetone for the 24 h exposure period. There was no evidence of a hatch delay longer than the time spent under vapors for eggs exposed at 17+/-1 or 27+/-1 degrees C, indicating that some development must have occurred under fumigation.

  8. Planetary and gravity wave signatures in the F region ionosphere with impact on radio propagation predictions and variability

    Czech Academy of Sciences Publication Activity Database

    Altadill, D.; Apostolov, E. M.; Boška, Josef; Laštovička, Jan; Šauli, Petra

    2004-01-01

    Roč. 47, 2/3 (2004), s. 1109-1119 ISSN 1593-5213. [Final Meeting COST271 Action. Effects of the upper atmosphere on terrestrial and Earth-space communications (EACOS). Abingdon, 26.08.2004-27.08.2004] R&D Projects: GA MŠk OC 271.10; GA ČR GA205/01/1071; GA ČR GP205/02/P077 Institutional research plan: CEZ:AV0Z3042911 Keywords : ionosphere * planetary waves * gravity waves Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.413, year: 2004

  9. Alzheimer’s Disease in Social Media: Content Analysis of YouTube Videos

    Science.gov (United States)

    Tang, Weizhou; Olscamp, Kate; Friedman, Daniela B

    2017-01-01

    Background Approximately 5.5 million Americans are living with Alzheimer’s disease (AD) in 2017. YouTube is a popular platform for disseminating health information; however, little is known about messages specifically regarding AD that are being communicated through YouTube. Objective This study aims to examine video characteristics, content, speaker characteristics, and mobilizing information (cues to action) of YouTube videos focused on AD. Methods Videos uploaded to YouTube from 2013 to 2015 were searched with the term “Alzheimer’s disease” on April 30th, 2016. Two coders viewed the videos and coded video characteristics (the date when a video was posted, Uniform Resource Locator, video length, audience engagement, format, author), content, speaker characteristics (sex, race, age), and mobilizing information. Descriptive statistics were used to examine video characteristics, content, audience engagement (number of views), speaker appearances in the video, and mobilizing information. Associations between variables were examined using Chi-square and Fisher’s exact tests. Results Among the 271 videos retrieved, 25.5% (69/271) were posted by nonprofit organizations or universities. Informal presentations comprised 25.8% (70/271) of all videos. Although AD symptoms (83/271, 30.6%), causes of AD (80/271, 29.5%), and treatment (76/271, 28.0%) were commonly addressed, quality of life of people with AD (34/271, 12.5%) had more views than those more commonly-covered content areas. Most videos featured white speakers (168/187, 89.8%) who were adults aged 20 years to their early 60s (164/187, 87.7%). Only 36.9% (100/271) of videos included mobilizing information. Videos about AD symptoms were significantly less likely to include mobilizing information compared to videos without AD symptoms (23/83, 27.7% vs 77/188, 41.0% respectively; P=.03). Conclusions This study contributes new knowledge regarding AD messages delivered through YouTube. Findings of the current

  10. Book Review: A History of the Czechoslovak Ocean Shipping Company, 1948–1989: How a Small, Landlocked Country Ran Maritime Business During the Cold War

    DEFF Research Database (Denmark)

    Taudal Poulsen, René

    2016-01-01

    Review of: Lenka Krátká: A History of the Czechoslovak Ocean Shipping Company, 1948–1989: How a Small, Landlocked Country Ran Maritime Business During the Cold War. Stuttgart: Ibidem Verlag, 2015. x + 271 pp., tables, notes, bibliography. ISBN: 978-3-8382-0666-0, £23.90 (pbk).......Review of: Lenka Krátká: A History of the Czechoslovak Ocean Shipping Company, 1948–1989: How a Small, Landlocked Country Ran Maritime Business During the Cold War. Stuttgart: Ibidem Verlag, 2015. x + 271 pp., tables, notes, bibliography. ISBN: 978-3-8382-0666-0, £23.90 (pbk)....

  11. Ionospheric effects on terrestrial communications: Working Group 3 overview

    Czech Academy of Sciences Publication Activity Database

    Laštovička, Jan; Bourdillon, A.

    2004-01-01

    Roč. 47, 2/3 (2004), s. 1269-1277 ISSN 1593-5213. [Final Meeting COST271 Action. Effects of the upper atmosphere on terrestrial and Earth-space communications (EACOS). Abingdon, 26.08.2004-27.08.2004] R&D Projects: GA MŠk OC 271.10; GA AV ČR IBS3012007 Institutional research plan: CEZ:AV0Z3042911 Keywords : ionospheric reflection * telecommunications * gravity waves * planetary waves Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.413, year: 2004 http://www.annalsofgeophysics.eu/index.php/annals/article/view/3299/3345

  12. Alzheimer's Disease in Social Media: Content Analysis of YouTube Videos.

    Science.gov (United States)

    Tang, Weizhou; Olscamp, Kate; Choi, Seul Ki; Friedman, Daniela B

    2017-10-19

    Approximately 5.5 million Americans are living with Alzheimer's disease (AD) in 2017. YouTube is a popular platform for disseminating health information; however, little is known about messages specifically regarding AD that are being communicated through YouTube. This study aims to examine video characteristics, content, speaker characteristics, and mobilizing information (cues to action) of YouTube videos focused on AD. Videos uploaded to YouTube from 2013 to 2015 were searched with the term "Alzheimer's disease" on April 30th, 2016. Two coders viewed the videos and coded video characteristics (the date when a video was posted, Uniform Resource Locator, video length, audience engagement, format, author), content, speaker characteristics (sex, race, age), and mobilizing information. Descriptive statistics were used to examine video characteristics, content, audience engagement (number of views), speaker appearances in the video, and mobilizing information. Associations between variables were examined using Chi-square and Fisher's exact tests. Among the 271 videos retrieved, 25.5% (69/271) were posted by nonprofit organizations or universities. Informal presentations comprised 25.8% (70/271) of all videos. Although AD symptoms (83/271, 30.6%), causes of AD (80/271, 29.5%), and treatment (76/271, 28.0%) were commonly addressed, quality of life of people with AD (34/271, 12.5%) had more views than those more commonly-covered content areas. Most videos featured white speakers (168/187, 89.8%) who were adults aged 20 years to their early 60s (164/187, 87.7%). Only 36.9% (100/271) of videos included mobilizing information. Videos about AD symptoms were significantly less likely to include mobilizing information compared to videos without AD symptoms (23/83, 27.7% vs 77/188, 41.0% respectively; P=.03). This study contributes new knowledge regarding AD messages delivered through YouTube. Findings of the current study highlight a potential gap between available information

  13. Behaviour of the F1-region, and Es and spread-F phenomena at European middle latitudes

    Czech Academy of Sciences Publication Activity Database

    Pal, B.; Burešová, Dalia; Laštovička, Jan; Marcz, F.

    2004-01-01

    Roč. 47, 2/3 (2004), s. 1131-1143 ISSN 1593-5213. [Final Meeting COST271 Action. Effects of the upper atmosphere on terrestrial and Earth-space communications (EACOS). Abingdon, 26.08.2004-27.08.2004] R&D Projects: GA AV ČR IAA3042102; GA MŠk OC 271.10 Institutional research plan: CEZ:AV0Z3042911 Keywords : ionosphere-radio propagation * F1 region * ionospheric irregularities Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.413, year: 2004

  14. Ipeaiyeda et al (15)

    African Journals Online (AJOL)

    DELL

    have deleterious effect on human health on account of SO concentration. A strong positive ... proper management of the total environment, it is thoughtful to .... of solar radiation on the earth's surface. ... It is likely that cloud water that accumulates in this sampling .... Environment Modelling and Softwares. 27(1): 35 – 42.

  15. Socio-Demographic and Maternal Factors in Anaemia in Pregnancy ...

    African Journals Online (AJOL)

    Low educational attainment [Adjusted Odds Ratio (AOR)=2.13], being single or divorced [AOR=2.02], high parity [AOR=2.06], late booking [AOR=2.71] and short intervals between pregnancies [AOR=2.37] were significant predictors of anaemia in pregnancy. The high prevalence of anaemia in pregnancy related to low ...

  16. Histrionicotoxin alkaloids finally detected in an ant

    DEFF Research Database (Denmark)

    Jones, Tappey H.; Adams, Rachelle Martha Marie; Spande, Thomas F.

    2012-01-01

    Workers of the ant Carebarella bicolor collected in Panama were found to have two major poison-frog alkaloids, cis- and trans-fused decahydroquinolines (DHQs) of the 269AB type, four minor 269AB isomers, two minor 269B isomers, and three isomers of DHQ 271D. For the first time in an ant, however......) sp., were found to have a very similar DHQ complex but failed to show HTXs. Several new DHQ alkaloids of MW 271 (named in the frog as 271G) are reported from the above ants that have both m/z 202 and 204 as major fragment ions, unlike the spectrum seen for the poison-frog alkaloid 271D, which has...... only an m/z 204 base peak. Found also for the first time in skin extracts from the comparison frog Oophaga granulifera of Costa Rica is a trace DHQ of MW 273. It is coded as 273F in the frog; a different isomer is found in the ant....

  17. 77 FR 53214 - Announcement of Funding Awards; Service Coordinators in Multifamily Housing Program, Fiscal Year...

    Science.gov (United States)

    2012-08-31

    ...,104 Center, Inc. Center. AZ Casa Sierra Vista, Casa Sierra Vista.... 600-A E 25th St...... Yuma 30 190........... 246 176,271 Senior Citizens Avenue. Housing, LTD. NM New Mexico-American La Resolana 1025 Chelwood... Corporation. OH CRS, Ltd (Stern Hendy Clifton Place........ 900 Rue De La Paix... Cincinnati 183 375,387...

  18. Tangible and Intangible Rewards and Employee Creativity: The Mediating Role of Situational Extrinsic Motivation

    Science.gov (United States)

    Yoon, Hye Jung; Sung, Sun Young; Choi, Jin Nam; Lee, Kyungmook; Kim, Seongsu

    2015-01-01

    This study examined the effects of tangible and intangible forms of creativity-contingent rewards on employee creativity. Situation-specific intrinsic and extrinsic motivations were proposed as mediators of the reward-creativity link. Based on data collected from 271 employees and their supervisors, results revealed the following: (a) intangible…

  19. Using waterjet in reverse logistic operations in discarded munitions processing

    Czech Academy of Sciences Publication Activity Database

    Hloch, S.; Tozan, H.; Yagimli, M.; Valíček, Jan; Rokosz, K.

    2011-01-01

    Roč. 18, č. 2 (2011), s. 267-271 ISSN 1330-3651 Institutional research plan: CEZ:AV0Z30860518 Keywords : abrasive waterjet * anti tank bullet * automatic line Subject RIV: JQ - Machines ; Tools Impact factor: 0.347, year: 2011 http://hrcak.srce.hr/search/?q=Using+waterjet+in+reverse+logistic+operations+in+discarded+munitions+processing

  20. On reliability of system composed from parallel units subject to increasing load

    Czech Academy of Sciences Publication Activity Database

    Volf, Petr; Linka, A.

    2000-01-01

    Roč. 7, č. 4 (2000), s. 271-284 ISSN 0218-5393 R&D Projects: GA MŠk VS97084 Institutional research plan: AV0Z1075907 Keywords : reliability * mathematical statistics * parallel system Subject RIV: BB - Applied Statistics, Operational Research

  1. Studies on ascaridid, oxyurid and enoplid nematodes (Nematoda) from fishes of the Okavango River, Botswana

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Van As, L. L.

    2015-01-01

    Roč. 62, JUL 22 2015 (2015), s. 039 ISSN 1803-6465 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : helminth parasites, * taxonomy * new species, * Cucullanus * Cithariniella * Synodontisia * Galeiceps * freshwater fish * Africa Subject RIV: EG - Zoology Impact factor: 1.271, year: 2015

  2. Work and Rest Patterns and Psychomotor Vigilance Performance of Crewmemebers of the USS Jason Dunham: A Comparison of the 3/9 and 6/6 Watchstanding Schedules

    Science.gov (United States)

    2014-12-31

    4, 257–271. Albertsen, K., Rafnsdóttir, G. L., Grimsmo, A., Tómasson, K., & Kauppinen, K. (2008). Workhours and worklife balance . Scandinavian...consequences on balancing work and home life. Scientific evidence suggests that shift work has a negative influence on children’s well-being and on

  3. 76 FR 40118 - Spring 2011 Regulatory Agenda

    Science.gov (United States)

    2011-07-07

    ... way the economy, a sector of the economy, productivity, competition, jobs, the environment, [email protected] . Steve Fruh, Environmental Protection Agency, Air and Radiation, D243-02, RTP, NC 27711, Phone: 919 541-2837, Fax: 919 541-3207, E-mail: fruh.steve@epa.gov . RIN: 2060-AP69 271...

  4. Modulation of Phospholipase A2 Activity by Actin and Myosin.

    Science.gov (United States)

    1987-04-15

    cord vein. Thromb. Res. 18:787-795. 11. Knull. H.R.. W.F. Taylor. and W.W. Wells. 1974. Insulin effects on brain energy metabolism and the related...cells. Nature 271:549-551. I 14. Martin. T.W.. R.B. Wysolmerski. and D. Lagunoff. 1987. Phosphatidylcholine metabolism in endothelial cells: evidence for

  5. 78 FR 32161 - Oklahoma: Final Authorization of State Hazardous Waste Management Program Revision

    Science.gov (United States)

    2013-05-29

    ... Authorization of State Hazardous Waste Management Program Revision AGENCY: Environmental Protection Agency (EPA... waste management program. We authorized the following revisions: Oklahoma received authorization for... authorization of its program revision in accordance with 40 CFR 271.21. The Oklahoma Hazardous Waste Management...

  6. 78 FR 43842 - State of Kansas; Authorization of State Hazardous Waste Management Program

    Science.gov (United States)

    2013-07-22

    ... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R07-RCRA-2013-0447; FRL-9833-6] State of Kansas; Authorization of State Hazardous Waste Management Program AGENCY: Environmental Protection Agency... its hazardous waste program under the Resource Conservation and Recovery Act (RCRA). EPA proposes to...

  7. 78 FR 70255 - West Virginia: Final Authorization of State Hazardous Waste Management Program Revisions

    Science.gov (United States)

    2013-11-25

    ... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R03-RCRA-2013-0571; FRL-9903-07-Region 3] West Virginia: Final Authorization of State Hazardous Waste Management Program Revisions AGENCY... final authorization of revisions to its hazardous waste program under the Resource Conservation and...

  8. 76 FR 18927 - Oklahoma: Final Authorization of State Hazardous Waste Management Program Revision

    Science.gov (United States)

    2011-04-06

    ...: Final Authorization of State Hazardous Waste Management Program Revision AGENCY: Environmental... hazardous waste management program. We authorized the following revisions: Oklahoma received authorization... accordance with 40 CFR 271.21. The Oklahoma Hazardous Waste Management Act (``OHWMA'') provides the ODEQ with...

  9. Environmental, Health, and Safety Research Needs for Engineered Nanoscale Materials

    Science.gov (United States)

    2006-09-01

    tubes ), the report addresses concerns over potential environmental and health risks of nanomaterials. Following the publication of the RS... microfine titanium dioxide as physical UV filter, Int. J. Cosmetic Sci. 22(4), 271–283 (2000). J. Brant, H. Lecoanet, M. Hotze, M. Wiesner, Comparison of

  10. Socialism. Grade Ten, Unit Two, 10.2. Comprehensive Social Studies Curriculum for the Inner City.

    Science.gov (United States)

    Malone, Helen

    The socialism unit of the tenth grade level of the FICSS series (Focus on Inner City Social Studies -- see SO 008 271) explores a selected history of socialist thought and the theoretical model of socialism. Three case studies of socialism are explored: Great Britain, Sweden, and Israel. The case studies are designed to answer questions concerning…

  11. Spectrum of neurosurgical complications following medical tourism ...

    African Journals Online (AJOL)

    Background and objectives: The cost of medical care and availability of resources (human and facilities) which .... All the patients travelled by air lasting at least 6 hours, ... commercial airlines even for that had emergent clinical .... 5. Whittaker A: Pleasure and pain: Medical travel in. Asia. Glob Public Health 2008; 3:271. 6.

  12. Terrestrial gamma ray radiation in Cornwall

    International Nuclear Information System (INIS)

    Grainger, C.R.

    1986-01-01

    A report is given of an airborne survey of Cornwall using a scintillation counter to measure the natural radioactivity. This showed 271 sources of abnormal (much higher than national mean) levels of radioactivity. The effects of these on the population are discussed. (U.K.)

  13. Search Results | Page 28 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 875 ... This publication presents results of the research project "Avoiding Conflict Relapse through Inclusive Political Settlements and Statebuilding after Intra-State War: Opportunities, Approaches and Lessons ... Digital divide in Latin America : broadband price, quality and affordability in the region.

  14. Daphnia diversity in water bodies of the Po River Basin

    Czech Academy of Sciences Publication Activity Database

    Marková, Silvia; Maurone, C.; Racchetti, E.; Bartoli, M.; Rossi, V.

    2017-01-01

    Roč. 76, č. 2 (2017), s. 261-271 ISSN 1129-5767 Institutional support: RVO:67985904 Keywords : genetic diagnostic markers * invasive species * genetic differentiation Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biology (theoretical, mathematical, thermal, cryobiology, biological rhythm), Evolutionary biology Impact factor: 1.451, year: 2016

  15. The Use of Atmospheric Pressure Chemical Ionization Mass Spectrometry with High Performance Liquid Chromatography and Other Separation Techniques for Identification of Triacylglycerols

    Czech Academy of Sciences Publication Activity Database

    Řezanka, Tomáš; Sigler, Karel

    2007-01-01

    Roč. 3, - (2007), s. 252-271 ISSN 1573-4110 R&D Projects: GA ČR GA203/06/0219 Institutional research plan: CEZ:AV0Z50200510 Keywords : triacylglycerols * atmospheric presssure chemical ionization * mass spectrometry Subject RIV: EE - Microbiology, Virology Impact factor: 1.815, year: 2007

  16. Ultrastructure of the anterior organ and posterior funnel-shaped canal of Gyrocotyle urna Wagener, 1852 (Cestoda: Gyrocotylidea)

    Czech Academy of Sciences Publication Activity Database

    Poddubnaya, L. G.; Kuchta, Roman; Bristow, G.A.; Scholz, Tomáš

    2015-01-01

    Roč. 62, 2015 May 22 (2015), 027 ISSN 1803-6465 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : scanning electron microscopy * transmission electron microscopy * basal cestodes * ultrastructural characters * phylogeny Subject RIV: EG - Zoology Impact factor: 1.271, year: 2015

  17. Zoonotic mosquito-borne flaviviruses: worldwide presence of agents with proven pathogenicity and potential candidates of future emerging diseases

    Czech Academy of Sciences Publication Activity Database

    Weissenböck, H.; Hubálek, Zdeněk; Bakonyi, T.; Nowotny, N.

    2010-01-01

    Roč. 140, 3-4 (2010), s. 271-280 ISSN 0378-1135 Institutional research plan: CEZ:AV0Z60930519 Keywords : Flaviviridae * mosquitoes * Culicidae * zoonoses * arboviruses Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 3.256, year: 2010

  18. Adenosine triphosphate analogs can efficiently inhibit the Zika virus RNA-dependent RNA polymerase

    Czech Academy of Sciences Publication Activity Database

    Hercík, Kamil; Kozák, Jaroslav; Šála, Michal; Dejmek, Milan; Hřebabecký, Hubert; Zborníková, Eva; Smola, Miroslav; Růžek, Daniel; Nencka, Radim; Bouřa, Evžen

    2017-01-01

    Roč. 137, Jan (2017), s. 131-133 ISSN 0166-3542 R&D Projects: GA ČR GA15-09310S Institutional support: RVO:61388963 ; RVO:60077344 Keywords : hepatitis C virus * borne encephalitis virus * crystal structure Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 4.271, year: 2016

  19. Method for phenotypic detection of extended-spectrum beta-lactamases in enterobacter species in the routine clinical setting

    NARCIS (Netherlands)

    Stuart, J.C.; Diederen, B.; Al Naiemi, N.; Fluit, A.; Arents, N.; Thijsen, S.; Vlaminckx, B.; Mouton, J.W.; Leverstein-van Hall, M.

    2011-01-01

    In 271 Enterobacter blood culture isolates from 12 hospitals, extended-spectrum beta-lactamase (ESBL) prevalence varied between 0% and 30% per hospital. High prevalence was associated with dissemination, indicating the potential relevance of infection control measures. Screening with cefepime or

  20. Forms of vibration and structural changes in liquid state

    Czech Academy of Sciences Publication Activity Database

    Hlaváček, B.; Šesták, Jaroslav; Koudelka, L.; Mošner, P.; Mareš, Jiří J.

    2005-01-01

    Roč. 80, - (2005), s. 271-283 ISSN 1388-6150 Institutional research plan: CEZ:AV0Z10100521 Keywords : crossover temperature * deterministic chaos * glass transition * non-linear oscillators * solid-liquid transition Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.425, year: 2005

  1. Suitability of food plants for Oxycarenus lavaterae (Heteroptera: Lygaeidae), a mediterranean bug invasive in Central and South-East Europe

    Czech Academy of Sciences Publication Activity Database

    Kalushkov, P.; Nedvěd, Oldřich

    2010-01-01

    Roč. 63, č. 2 (2010), s. 271-276 ISSN 1310-1331 Grant - others:Bulgarian National Science Fund, Ministry of Education and Science(BG) B-1508 Institutional research plan: CEZ:AV0Z50070508 Keywords : Oxycarenus lavaterae * host plant specificity * fecundity Subject RIV: EH - Ecology, Behaviour Impact factor: 0.219, year: 2010

  2. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    The Central Dogma of Molecular Biology - A Retrospective after Fifty Years · Michel Morange · More Details Fulltext PDF. pp 248-258 General Article. Chemistry is Everygreen - 2008 Nobel Prize in Chemistry · Swagata Dasgupta · More Details Fulltext PDF. pp 259-271 Series Article. Snippets of Physics - Hubble Expansion ...

  3. 78 FR 57416 - Division of Longshore and Harbor Workers' Compensation Proposed Revision of Existing Collection...

    Science.gov (United States)

    2013-09-18

    ... annually. Total Burden Cost (capital/startup): $0. Total Burden Cost (operating/maintenance): $46,866...) 9,498 20 CFR 702.321 (Section 8(f) Payments) 1,425 ESA-100 (20 CFR 702.111, 702.201) 840 LS-271...

  4. Chimeric Antigen Receptors to CD276 for Treating Cancer | NCI Technology Transfer Center | TTC

    Science.gov (United States)

    This licensing opportunity from the National Cancer Institute concerns the development of CARs comprising an antigen-binding fragment derived from the MGA271 antibody. The resulting CARs can be used in adoptive cell therapy treatment for neuroblastoma and other tumors that express CD276.

  5. Serotonin and dopamine in the parabrachial nucleus of rats during conditioned taste aversion learning

    Czech Academy of Sciences Publication Activity Database

    Zach, P.; Křivánek, Jiří; Valeš, Karel

    2006-01-01

    Roč. 170, č. 2 (2006), s. 271-276 ISSN 0166-4328 R&D Projects: GA MŠk(CZ) 1M0517 Institutional research plan: CEZ:AV0Z5011922 Keywords : taste aversion * microdialysis * parabrachial nucleus Subject RIV: FH - Neurology Impact factor: 2.591, year: 2006

  6. Investigations of the 1 KHZ Sound Absorption in Sea Water.

    Science.gov (United States)

    1983-01-15

    York, 465 pages. Seward, T. M. (1974) Determination of the first ionization constant of silicic acid from quartz solubility in borate buffer...attenuation coefficient. J. Acoust. Soc. Am. 42, 270-271. Uppstrom, L (1968) A modified method for the determination of boron with curcumin and a simplified

  7. evaluation of the environmental noise levels in abuja municipality

    African Journals Online (AJOL)

    ABSTRACT. Background: Noise remains a nuisance which impacts negatively on the ..... Furthermore, Erikson et al postulated that a persistent noise level .... Hessel PA, Sluis-Cremer G K. Hearing loss in ... Ear & Hearing 2006; 27(1): 1-19. 13.

  8. Effects of Tropospheric O3 on Trembling Aspen and Interaction with CO2: Results From An O3-Gradient and a Face Experiment

    Science.gov (United States)

    D.F. Karnosky; B. Mankovska; K. Percy; R.E. Dickson; G.K. Podila; J. Sober; A. Noormets; G. Hendrey; Mark D. Coleman; M. Kubiske; K.S. Pregitzer; J.G. Isebrands

    1999-01-01

    Abstract. Over the years, a series of trembling aspen (Populus tremuloides Michx.) clones differing in O3 sensitivity have been identified from OTC studies. Three clones (216 and 271[(O3 tolerant] and 259 [O3 sensitive]) have been characterized for O3...

  9. Teachers' Mastery Goals: Using a Self-Report Survey to Study the Relations between Teaching Practices and Students' Motivation for Science Learning

    Science.gov (United States)

    Vedder-Weiss, Dana; Fortus, David

    2018-01-01

    Employing achievement goal theory (Ames "Journal of Educational psychology," 84(3), 261-271, 1992), we explored science teachers' instruction and its relation to students' motivation for science learning and school culture. Based on the TARGETS framework (Patrick et al. "The Elementary School Journal," 102(1), 35-58, 2001) and…

  10. 41 CFR 101-27.102 - Economic order quantity principle.

    Science.gov (United States)

    2010-07-01

    ... MANAGEMENT 27.1-Stock Replenishment § 101-27.102 Economic order quantity principle. The economic order quantity (EOQ) principle is a means for achieving economical inventory management. Application of the EOQ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Economic order quantity...

  11. 41 CFR 109-27.102 - Economic order quantity principle.

    Science.gov (United States)

    2010-07-01

    ... PROCUREMENT 27-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102 Economic order quantity principle. ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Economic order quantity principle. 109-27.102 Section 109-27.102 Public Contracts and Property Management Federal Property...

  12. The Lyman Alpha Reference Sample: Extended Lyman Alpha Halos Produced at Low Dust Content

    Czech Academy of Sciences Publication Activity Database

    Hayes, M.; Oestlin, G.; Schaerer, D.; Verhamme, A.; Mas-Hesse, J. M.; Adamo, A.; Atek, H.; Cannon, J.M.; Duval, F.; Guaita, L.; Herenz, E.Ch.; Kunth, D.; Laursen, P.; Melinder, J.; Orlitová, Ivana; Oti-Floranes, H.; Sandberg, A.

    2013-01-01

    Roč. 765, č. 2 (2013), L27/1-L27/6 ISSN 2041-8205 Institutional support: RVO:67985815 Keywords : cosmology observations * galaxies * evolution Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.602, year: 2013

  13. Download this PDF file

    African Journals Online (AJOL)

    Rita Wilkinson

    It is concluded that environmental pollution with heavy metals arising from various ... plastic food packaging to foodstuff may be categorized into three different, but inter-related, ..... Determination of Cadmium and Lead in different cigarette brands ... Chemistry-marine environmental modelling and analysis, Pp 271-277.

  14. Biophysical properties and cellular toxicity of covalent crosslinked oligomers of α-synuclein formed by photoinduced side-chain tyrosyl radicals

    Czech Academy of Sciences Publication Activity Database

    Borsarelli, C.D.; Falomir-Lockhart, L.J.; Ostatná, Veronika; Fauerbach, J.A.; Hsiao, H.-H.; Urlaub, H.; Paleček, Emil; Jares-Erijman, E.A.; Jovin, T.M.

    2012-01-01

    Roč. 53, č. 4 (2012), s. 1004-1015 ISSN 0891-5849 R&D Projects: GA AV ČR(CZ) KJB100040901 Institutional research plan: CEZ:AV0Z50040702 Keywords : Parkinson's disease * neurodegeneration * oxidative stress Subject RIV: BO - Biophysics Impact factor: 5.271, year: 2012

  15. The Relationship between Spirituality and the Use of Self-Regulation Strategies by Hospitalized Adult Oncology Patients

    Science.gov (United States)

    1991-01-01

    Titlebaum, 1988. Stoyva, 1977; Vines, 1988; Wood & Pesut, 1981; Zahourek , 1988). However, any behavior an individual uses to consciously modify a...Journal of Nursing Research, 3, 263-271. Zahourek , K. (1987). Clinical hypnosis in holistic healing. Holistic Nursing Practice, 2(1), 15-24. 76 APPENDIX A

  16. Annals of Medical and Health Sciences Research - Vol 4, No 2 (2014)

    African Journals Online (AJOL)

    Reservoir Complete Denture in a Patient with Xerostomia Secondary to Radiotherapy for Oral Carcinoma: A Case Report and Review of Literature · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. R Ladda, VO Kasat, SA Gangadhar, S Baheti, AJ Bhandari, 271-275.

  17. SEREN - a new SPH code for star and planet formation simulations Algorithms and tests

    Czech Academy of Sciences Publication Activity Database

    Hubber, D.A.; Batty, C.P.; McLeod, Andrew; Whitworth, A.

    2011-01-01

    Roč. 529, May (2011), A27/1-A27/28 ISSN 0004-6361 Institutional research plan: CEZ:AV0Z10030501 Keywords : hydrodynamics * numerical methods * star s formation Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.587, year: 2011

  18. Morbidity Pattern among under Five Children and Preventive ...

    African Journals Online (AJOL)

    The general distribution of ailments was malaria with 271 cases, diarrhea with 92 cases, pneumonia with 27 cases and upper respiratory tract infection with 30 cases. About 101(24.6%) of the children are wasted. and 309(75.2%) of the studied under five children were not. Knowledge about predisposing factors to morbidity ...

  19. 78 FR 14697 - Final Flood Elevation Determinations

    Science.gov (United States)

    2013-03-07

    ... Communities affected elevation above ground [caret] Elevation in meters (MSL) Modified Cecil County, Maryland... 1 to Stone Run At the Stone Run +271 Town of Rising Sun, confluence. Unincorporated Areas of Cecil County. Approximately 460 feet +359 downstream of Pierce Road. Tributary 2 to Stone Run At the Stone Run...

  20. Balones que inspiran

    Directory of Open Access Journals (Sweden)

    Daniel Samper Pizano

    2005-09-01

    Full Text Available Unión Magdalena "el fervor de un pueblo". Varios Autores. Universidad del Magdalena, Santa Marta, 2004, 271 págs., il. Rey de corazones. El Medellín, una pasión crónica. Varios autores. Medellín, Pregón Ediciones, 2004, 162 págs.

  1. 76 FR 58472 - North Pacific Fishery Management Council; Public Meeting

    Science.gov (United States)

    2011-09-21

    ... North Pacific Fishery Management Council's (Council) Pacific Northwest Crab Industry Advisory Committee. SUMMARY: The Pacific Northwest Crab Industry Advisory Committee will meet October 13, 2011 at the Leif...: (907) 271-2809. SUPPLEMENTARY INFORMATION: Agenda--Alaska Department of Fish & Game/ NMFS scientists...

  2. Search Results | Page 28 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 8491 ... Filter by type ... Gender 1310 Apply Gender filter · INFORMATION .... and account for close to two-thirds of strokes and one-half of heart disease ... born after 2010 are expected to suffer from diabetes over their lifetime.

  3. 75 FR 53321 - Prospective Grant of a Co-Exclusive License: Natural Plant Extracts From Incense Cedar as Pest...

    Science.gov (United States)

    2010-08-31

    ... Grant of a Co-Exclusive License: Natural Plant Extracts From Incense Cedar as Pest Control Agents and...,629,387, ``Compounds for Pest Control and Methods for Their Use,'' issued December 8, 2009; and U.S. Pat. No. 7,129,271, ``Compounds for Pest Control and Methods for Their Use,'' issued October 31, 2006...

  4. CPAP Tips

    Medline Plus

    Full Text Available ... 4:26 Philips Respironics Dream Station CPAP Machine Review - Duration: 8:29. The CPAP Shop 271,568 ... Philips Respironics Wisp Nasal CPAP Bilevel Mask Fitting Review Demonstration FreeCPAPAdvice com - Duration: 7:36. TheLankyLefty27 102, ...

  5. Additional observations on Philometra spp. (Nematoda: Philometridae) in marine fishes off Iraq, with the description of two new species

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Ali, A. H.

    2014-01-01

    Roč. 87, č. 3 (2014), s. 259-271 ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : systematic status * India * Philometridae Subject RIV: EA - Cell Biology Impact factor: 1.336, year: 2014

  6. Search Results | Page 28 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 369 ... ... Perspectives 1 Apply Perspectives filter · Training materials 1 Apply .... Alternative Public Service Delivery Models in Health, Water and ... Responsible and Sustainable Tourism : Strengthening Small-Scale Enterprise in Costa Rica ... Ethnic Relations in Guatemala : a New Educational Strategy.

  7. International Conference on Rehabilitation Engineering: Proceedings (2nd, Ottawa, Canada, June 17-22, 1984). Combined with RESNA 7th Annual Conference. Volume 4 = Conference internationale sur la technologie de reeducation fonctionnelle: compet rendu (2nd, Ottawa, Canada, Juin 17-22, 1984). Tenue parallelement a la RESNA 7e conference annuelle.

    Science.gov (United States)

    Rehabilitation Engineering Society of North America, Washington, DC.

    These proceedings contain 271 papers in English and 15 in French, representing research and development efforts in 19 countries. On the topic of wheelchairs, 28 papers address their design, performance, evaluation, and fabrication. The field of prosthetics and orthotics is represented by 33 papers discussing devices for upper extremities, lower…

  8. hca: an Arabidopsis mutant exhibiting unusual cambial activity and altered vascular patterning

    Czech Academy of Sciences Publication Activity Database

    Pineau, C.; Amandine, F.; Ranocha, P.; Jauneau, A.; Turner, S.; Lemonnier, G.; Renou, J.P.; Tarkowski, Petr; Sandberg, G.; Jouanin, L.; Sundberg, B.; Boudet, A.M.; Goffner, D.; Pichon, M.

    2005-01-01

    Roč. 44, č. 2 (2005), s. 271-289 ISSN 0960-7412 Institutional research plan: CEZ:AV0Z50380511 Keywords : Arabidopsis thaliana * cambium * secondary xylem Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 6.969, year: 2005

  9. DNA modifications by platinum antitumor drugs and its recognition by DNA-binding proteins

    Czech Academy of Sciences Publication Activity Database

    Brabec, Viktor

    2004-01-01

    Roč. 271, Suppl. 1 (2004), s. 90 ISSN 0014-2956. [Meeting of the Federation of the European Biochemical Societies /29./. 26.06.2004-01.07.2004, Warsaw] R&D Projects: GA ČR GA305/02/1552 Keywords : platinum drugs * DNA-protein interaction * NF-kappaB Subject RIV: BO - Biophysics

  10. 76 FR 78015 - National Institute on Alcohol Abuse and Alcoholism; Notice of Meeting

    Science.gov (United States)

    2011-12-15

    ... attendance limited to space available. Individuals who plan to attend and need special assistance, such as... applications and the discussions could disclose confidential trade secrets or commercial property such as... . (Catalogue of Federal Domestic Assistance Program Nos. 93.271, Alcohol Research Career Development Awards for...

  11. 75 FR 80511 - National Institute on Alcohol Abuse And Alcoholism; Notice of Closed Meeting

    Science.gov (United States)

    2010-12-22

    ... attendance limited to space available. Individuals who plan to attend and need special assistance, such as... applications and the discussions could disclose confidential trade secrets or commercial property such as... Domestic Assistance Program Nos.: 93.271, Alcohol Research Career Development Awards for Scientists and...

  12. 76 FR 39406 - National Institute on Alcohol Abuse and Alcoholism; Notice of Meeting

    Science.gov (United States)

    2011-07-06

    ... attendance limited to space available. Individuals who plan to attend and need special assistance, such as... applications and the discussions could disclose confidential trade secrets or commercial property such as.... (Catalogue of Federal Domestic Assistance Program Nos. 93.271, Alcohol Research Career Development Awards for...

  13. 75 FR 47819 - National Institute on Alcohol Abuse and Alcoholism; Notice of Closed Meeting

    Science.gov (United States)

    2010-08-09

    ... attendance limited to space available. Individuals who plan to attend and need special assistance, such as... applications and the discussions could disclose confidential trade secrets or commercial property such as... Domestic Assistance Program Nos.: 93.271, Alcohol Research Career Development Awards for Scientists and...

  14. Search Results | Page 28 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 420 ... Home Politics Abroad : Role of Lebanese Diaspora in Conflict, ... Gender and Work in the Middle East and North Africa : Research ... the mismatch between the abundance of qualified women in the ... Son Preference in China and India : Policy Interventions to address Discrimination against Girls.

  15. Efficient high power operation of erbium 3 µm fibre laser diode-pumped at 975 nm

    NARCIS (Netherlands)

    Jackson, S.D.; King, T.A.; Pollnau, Markus

    2000-01-01

    Efficient CW operation of a 2.71 um Er,Pr:ZBLAN double-clad fibre laser pumped with a single diode laser operating at a wavelength of 975 nm is described. A maximum output power of 0.5 W and a slope efficiency of 25% (with respect to the launched pump power) were obtained. Threshold pump powers of <

  16. On the penetration of aqueous solutions into pristine and radiation damaged polymers

    Czech Academy of Sciences Publication Activity Database

    Ghosh, S.; Klett, R.; Fink, D.; Dwivedi, K. K.; Vacík, Jiří; Hnatowicz, Vladimír; Červená, Jarmila

    1999-01-01

    Roč. 55, - (1999), s. 271-284 ISSN 0969-806X R&D Projects: GA ČR GA203/99/1626; GA ČR GA202/96/0077; GA AV ČR KSK1010601 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.512, year: 1999

  17. Equilibrium of phases with interfacial energy : a variational approach

    Czech Academy of Sciences Publication Activity Database

    Šilhavý, Miroslav

    2011-01-01

    Roč. 105, 1-2 (2011), s. 271-303 ISSN 0374-3535 Institutional research plan: CEZ:AV0Z10190503 Keywords : phase transitions * phase interface * interface polyconvexity Subject RIV: BA - General Mathematics Impact factor: 1.110, year: 2011 http://www.springerlink.com/content/w4p16v37t032v632/

  18. Perceptions of vocational interest : Self- and other-reports in student-parent dyads

    NARCIS (Netherlands)

    Holtrop, Djurre; Born, Marise Ph.; de Vries, Reinout Everhard

    2017-01-01

    The current study investigated how self- and other-ratings of vocational interests converge among student–parent dyads. Using the Personal Globe Inventory–Short, we obtained data from a pooled sample of 271 (high school senior and university) student–parent dyads. Participants rated their own

  19. Perceptions of vocational interest: Self- and other-reports in student-parent dyads

    NARCIS (Netherlands)

    Holtrop, Djurre; Born, Marise Ph; de Vries, Reinout E.

    The current study investigated how self- and other-ratings of vocational interests converge among student–parent dyads. Using the Personal Globe Inventory–Short, we obtained data from a pooled sample of 271 (high school senior and university) student–parent dyads. Participants rated their own

  20. Injury Severity Score coding: Data analyst v. emerging m-health ...

    African Journals Online (AJOL)

    benchmarking and quality improvement initiatives in the trauma ... We hypothesised that emerging mobile health (mhealth) technology could offer a costeffective alternative to the .... 33.98), including a mortality rate of 4.6% (95% CI 2.71 7.57).

  1. Genetic, Biochemical and Environmental Factors Associated with Pregnancy Outcomes in Newborns from the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Rössner ml., Pavel; Tabashidze, Nana; Dostál, Miroslav; Nováková, Zuzana; Chvátalová, Irena; Špátová, Milada; Šrám, Radim

    2011-01-01

    Roč. 119, č. 2 (2011), s. 265-271 ISSN 0091-6765 R&D Projects: GA MŽP(CZ) SP/1B3/50/07 Institutional research plan: CEZ:AV0Z50390512 Keywords : air pollution * biomarkers * genetic polymorphisms Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 7.036, year: 2011

  2. Crystal structure of vanadite: Refinement of anisotropic displacement parameters

    Czech Academy of Sciences Publication Activity Database

    Laufek, F.; Skála, Roman; Haloda, J.; Císařová, I.

    2006-01-01

    Roč. 51, 3-4 (2006), s. 271-275 ISSN 1210-8197 Institutional research plan: CEZ:AV0Z30130516 Keywords : anisotropic displacement parameter * crystal structure * single-crystal X-ray refinement * vanadinite Subject RIV: DB - Geology ; Mineralogy

  3. Beryllium doped p-type GaN grown by metal-organic chemical vapor depostion

    International Nuclear Information System (INIS)

    Al-Tahtamouni, T.M.; Sedhain, A.; Lin, J.Y.; Jiang, H.X.

    2010-01-01

    The authors report on the growth of Be-doped p-type GaN epilayers by metal-organic chmical vapor deposition (MOCVD). The electrical and optical properties of the Be-doped GaN epilayers were studied by Hall-effect measurements and photoluminescence (PL) spectroscopy. The PL spectra of Be-doped GaN epilayers ethibited two emission lines at 3.36 and 2.71 eV, which were obsent in undoped epilayers. The transition at 3.36 eV was at 3.36 and 2.71eV, which were absent in undoped epilayers. The transition at 3.36 eV was assigned to the transition of free electrons to the neutral Be acceptor Be d eg.. The transition at 2.71 eV was assigned to the transition of electrons bound to deep level donors to the Be d eg. acceptors. Three independent measurements: (a) resistivity vs. temperature, (b) PL peak positions between Be doped and undoped GaN and (c) activation energy of 2.71 eV transition all indicate that the Be energy level is between 120 and 140 meV above the valence band. This is about 20-40 meV shallower than the Mg energy level (160 meV) in GaN. It is thus concluded that Be could be an excellent acceptor dopant in nitride materials. (authors).

  4. Efimov effect in 2-neutron halo nuclei

    Indian Academy of Sciences (India)

    . B33, 563 (1970). [3] V Efimov, Comm. Nucl. Part. Phys. 19, 271 (1990). [4] Th Cornelius and W Glöckle, J. Chem. Phys. 85, 3906 (1986). B D Esry, C D Lin and C H Greene, Phys. Rev. A54, 394 (1996). J P D'Incao, H Suno and B D Esry, Phys.

  5. Collected Works of the 30th Chief of Staff, United States Army, June 1983 - June 1987

    Science.gov (United States)

    1987-06-01

    IV accessions remain at low lev•els: in fact. forces. these are historica ! lows for the Acfive Component. These increases in quaity, reflect the...Nanomntlaid Intemnanonal Affazs. CarMhse. PA 271 Ma;. M Aiddress Nx 101: Mhc~xne D~awx;n Associaton Memoria Day Seances. Ft Campbel KY 3’ %%ý 84 Address ftoe

  6. The 7B-1 mutation in tomato (Solanum lycopersicum L.) confers a blue light-specific lower sensitivity to coronatine, a toxin produced by Pseudomonas syringae pv. tomato

    Czech Academy of Sciences Publication Activity Database

    Bergougnoux, V.; Hlaváčková, V.; Plotzová, R.; Novák, Ondřej; Fellner, Martin

    2009-01-01

    Roč. 60, č. 4 (2009), s. 1219-1230 ISSN 0022-0957 Institutional research plan: CEZ:AV0Z50380511 Keywords : Blue light-specific response * COI1 * coronatine Subject RIV: EF - Botanics Impact factor: 4.271, year: 2009

  7. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 250 of 271 ... Vol 9, No 2 (2011), Prevalence of Cysticercus tenuicollis cysts in sheep slaughtered at ... breviflora Roberty fruit pulp and seeds on isolated rabbit ileum .... Vol 15, No 2 (2017), Swine farm infestation with Culicoides ...

  8. Přechylování příjmení v češtině jako případ jazykového managementu

    Czech Academy of Sciences Publication Activity Database

    Kopecký, Jakub

    2014-01-01

    Roč. 75, č. 4 (2014), s. 271-293 ISSN 0037-7031 R&D Projects: GA MŠk(CZ) LM2010013 Institutional support: RVO:68378092 Keywords : language management * feminine * derivation * surname Subject RIV: AI - Linguistics Impact factor: 0.375, year: 2014

  9. How Does the Political Nature of the Defense Acquisition Process Affect Cost Growth

    Science.gov (United States)

    2006-09-01

    using the following equations. 100*% k k k BCWP COCO = (5) Where: k = the kth year of DAES reporting and, kKk BCWPACWPCO −= (6) The...F-16 270 F-35 Joint Strike Fighter (JSF) 6 FAAD C2I 64 FAAD NLOS Fiber Optic Guided-Missile 7 FBCB2 19 FDS 60 FFG-7 271 Future Aircraft Carrier

  10. Comparison of individuals opting for BRCA1/2 or HNPCC genetic susceptibility testing with regard to coping, illness perceptions, illness experiences, family system characteristics and hereditary cancer distress

    NARCIS (Netherlands)

    van Oostrom, Iris; Meijers-Heijboer, Hanne; Duivenvoorden, Hugo J.; Brocker-Vriends, Annette H. J. T.; van Asperen, Christi J.; Sijmons, Rolf H.; Seynaeve, Caroline; Van Gool, Arthur R.; Klijn, Jan G. M.; Tibben, Aad

    Objective: To study differences between individuals opting for genetic cancer susceptibility testing of a known familial BRCA1/2 and HNPCC related germline mutation. Methods: Coping, illness perceptions, experiences with cancer in relatives and family system characteristics were assessed in 271

  11. Experience of parental cancer in childhood is a risk factor for psychological distress during genetic cancer susceptibility testing

    NARCIS (Netherlands)

    van Oostrom, I.; Meijers-Heijboer, H.; Duivenvoorden, H. J.; Bröcker-Vriends, A. H. J. T.; van Asperen, C. J.; Sijmons, R. H.; Seynaeve, C.; van Gool, A. R.; Klijn, J. G. M.; Tibben, A.

    2006-01-01

    This study explores the effect of age at the time of parental cancer diagnosis or death on psychological distress and cancer risk perception in individuals undergoing genetic testing for a specific cancer susceptibility. Cancer-related distress, worry and risk perception were assessed in 271

  12. EROI and the Icelandic society

    DEFF Research Database (Denmark)

    Atlason, Reynir Smari

    2018-01-01

    In this paper, the societal Energy Return on Investment (EROIsoc) is estimated for Iceland between 1960 and the present. The results indicate that the overall EROIsoc was around 27:1 in the early 1960s, and was volatile for a period of time before stabilizing at around 45:1 in 1974 after establis...

  13. An animal model of nonconvulsive status epilepticus: a contribution to clinical controversies

    Czech Academy of Sciences Publication Activity Database

    Kršek, Pavel; Mikulecká, Anna; Druga, Rastislav; Hliňák, Zdeněk; Kubová, Hana; Mareš, Pavel

    2001-01-01

    Roč. 42, č. 2 (2001), s. 171-180 ISSN 0013-9580 R&D Projects: GA ČR GA309/97/0552; GA AV ČR IAA7011603 Institutional research plan: CEZ:AV0Z5011922 Keywords : complex partial status epilepticus * pilocarpine * epileptic brain damage Subject RIV: ED - Physiology Impact factor: 3.271, year: 2001

  14. Developing College Students' Civic Identity: The Role of Social Perspective Taking and Sociocultural Issues Discussions

    Science.gov (United States)

    Johnson, Matthew

    2015-01-01

    The development of college students' civic identity is understudied, but worthy of attention because of its salience to many students and higher education's commitment to fostering an engaged citizenry. Using 45,271 participants from the 2009 Multi-Institutional Study of Leadership, this study uses structural equation modeling to explore…

  15. Single-Molecule Manipulation of Double-Stranded DNA Using Optical Tweezers: Interaction Studies of DNA with RecA and YOYO-1

    NARCIS (Netherlands)

    Bennink, Martin L.; Scharer, Orlando D.; Kanaar, Ronald; Sakata-Sogawa, Kumiko; Schins, J.M.; Kanger, Johannes S.; de Grooth, B.G.; Greve, Jan

    1999-01-01

    By using optical tweezers and a specially designed flow cell with an integrated glass micropipette, we constructed a setup similar to that of Smith et al. (Science 271:795-799, 1996) in which an individual double-stranded DNA (dsDNA) molecule can be captured between two polystyrene beads. The first

  16. Next-Generation Molecular Histology Using Highly Multiplexed Ion Beam Imaging (MIBI) of Breast Cancer Tissue Specimens for Enhanced Clinical Guidance

    Science.gov (United States)

    2015-07-01

    in soft tissue sarcoma . J Surg Oncol 2005;92:267–271. 3. Stack EC, Wang C, Roman KA, et al. Multiplexed immuno- histochemistry, imaging, and...Contributions: M.A., S.B., and R.F. conducted experiments and wrote the manuscript. M.H. designed and fabricated reagents. C.H. assisted in data acquisition and

  17. 48 CFR 1371.101 - Inspection and manner of doing work.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Inspection and manner of... DEPARTMENT SUPPLEMENTAL REGULATIONS ACQUISITIONS INVOLVING SHIP CONSTRUCTION AND SHIP REPAIR Provisions and Clauses 1371.101 Inspection and manner of doing work. Insert clause 1352.271-70, Inspection and Manner of...

  18. 6Li MAS NMR Study of Lithium Insertion into Hydrothermally Prepared Li-Ti-O Spinel

    Czech Academy of Sciences Publication Activity Database

    Krtil, Petr; Dědeček, Jiří; Kostlánová, Tereza; Brus, Jiří

    2004-01-01

    Roč. 7, č. 7 (2004), A163-A166 ISSN 1099-0062 R&D Projects: GA ČR GA203/03/0823 Institutional research plan: CEZ:AV0Z4040901 Keywords : lithium insertion * spinel * NMR Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.271, year: 2004

  19. "Životní cyklus" mlecích nástrojů z mladoneolitického sídelního areálu s rondelem ve Vchynicích, okr. Litoměřice

    Czech Academy of Sciences Publication Activity Database

    Řídký, Jaroslav; Půlpán, M.; Šreinová, B.; Šrein, V.; Drnovský, V.; Květina, Petr

    2014-01-01

    Roč. 66, č. 2 (2014), s. 271-309 ISSN 0323-1267 R&D Projects: GA ČR(CZ) GAP405/11/1590 Institutional support: RVO:67985912 Keywords : Late Neolithic * Stroke Pottery culture * stone tools * grinding stones Subject RIV: AC - Archeology, Anthropology, Ethnology

  20. 76 FR 79258 - Self-Regulatory Organizations; Chicago Mercantile Exchange, Inc.; Notice of Filing and Order...

    Science.gov (United States)

    2011-12-21

    ..., Forwards and Swaps); CME Chapter 260H (Cleared OTC U.S. Dollar/Russian Ruble (USD/RUB) Spot, Forwards and... positive or negative. This language had been adopted previously by CME for many of the cleared OTC FX NDF... 271H. These changes would add language to the cash settlement provisions in the rules governing four...

  1. Verified compilation of Concurrent Managed Languages

    Science.gov (United States)

    2017-11-01

    Communications Division Information Directorate This report is published in the interest of scientific and technical information exchange, and its...271, 2007. [85] Viktor Vafeiadis. Modular fine-grained concurrency verification. Technical Report UCAM-CL-TR- 726, University of Cambridge, Computer...VERIFIED COMPILATION OF CONCURRENT MANAGED LANGUAGES PURDUE UNIVERSITY NOVEMBER 2017 FINAL TECHNICAL REPORT APPROVED FOR PUBLIC RELEASE

  2. Discursive Hierarchical Patterning in Law and Management Cases

    Science.gov (United States)

    Lung, Jane

    2008-01-01

    This paper investigates the differences in the discursive patterning of cases in Law and Management. It examines a corpus of 271 Law and Management cases and discusses the kind of information that these two disciplines call for and how discourses are constructed in discursive hierarchical patterns. A discursive hierarchical pattern is a model…

  3. Molecular characterization of Danish Cryptosporidium parvum isolates

    DEFF Research Database (Denmark)

    Enemark, Heidi L.; Ahrens, Peter; Juel, Cynthia Dawn

    2002-01-01

    The genetic polymorphism among 271 Danish Cryptosporidium isolates of human and animal origin was studied by partial amplification and sequencing of the Cryptosporidium oocyst wall protein (COWP) gene, the 18S rDNA, and a microsatellite locus.dagger Furthermore, the microsatellite locus was studi...

  4. Comment on 'A Forecasting Equation for the Canada-US Dollar Real Exchange Rate'

    OpenAIRE

    Kollmann, Robert

    1993-01-01

    This paper is a comment on the paper 'A Forecasting Equation for the Canada-US Dollar Exchange Rate' (Robert Amano and Simon van Norden, Bank of Canada). The comment was published in: The Exchange Rate and the Economy, Proceedings of 1992 Bank of Canada Conference; Bank of Canada, 1993, Ottawa (ISBN 0-660-15195-2), pp. 266-271.

  5. Crystal structure, spectroscopic and theoretical studies on two Schiff base compounds of 2,6-dichlorobenzylidene-2,4-dichloroaniline and 2,4-dichlorobenzylidene-2,4-dichloroaniline

    Czech Academy of Sciences Publication Activity Database

    Soltani, A.; Ghari, F.; Khalaji, A.D.; Lemeski, E.T.; Fejfarová, Karla; Dušek, Michal; Shikhi, M.

    2015-01-01

    Roč. 139, Mar (2015), s. 271-278 ISSN 1386-1425 Grant - others:AV ČR(CZ) Praemium Academiae Keywords : Schiff base * single crystal structure analysis * DFT * Electronic properties Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.653, year: 2015

  6. 76 FR 61746 - Western Digital Technologies, Inc.: Hard Drive Development Engineering Group Irvine (Formerly at...

    Science.gov (United States)

    2011-10-05

    ... posted by the subject firm in Malaysia at the same time as the domestic layoffs. Additionally, the... imports of these articles from Malaysia. In a letter submitted to the Department on June 13, 2011, the... facilities overseas. AR 152, 212-218, 228-231, 244, 245-246, 271-279. After the design and development of the...

  7. Associations between witnessing parental violence and ...

    African Journals Online (AJOL)

    information concerning witnessing parental violence as a child, symptoms of depression during the current academic year. Logistic regression procedures were used to estimate odds ratios (OR) and 95% confidence intervals (95% CI). Results: Approximately 22.7% female students and 27.1% of the male students reported ...

  8. Enhanced personal protection at the PS

    CERN Multimedia

    Samuel Morier Genoud

    2013-01-01

    Pictures 03, 06, 07 08 : Pierre Ninin, deputy group leader of GS-ASE and responsible for the installation of the new PS complex safety system, in front of a new access control system.Pictures 10, 12 ,13 : View of Building 271, the future control centre of the new PS complex safety system.

  9. On some singular limits in damped radiation hydrodynamics

    Czech Academy of Sciences Publication Activity Database

    Blanc, X.; Ducomet, B.; Nečasová, Šárka

    2016-01-01

    Roč. 13, č. 2 (2016), s. 249-271 ISSN 0219-8916 R&D Projects: GA ČR GA13-00522S Institutional support: RVO:67985840 Keywords : compressible * Euler * damping Subject RIV: BA - General Mathematics Impact factor: 0.940, year: 2016 http://www.worldscientific.com/doi/10.1142/S0219891616500089

  10. Infection

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    2010373 Eosinophilic meningitis caused by Angiostrongylus cantonensis:a clinical and cerebrospinal fluid cytology report of 9 cases. GUAN Hongzhi(关鸿志),et al. Dept Neurol,PUMC & CAMS,Bejing 100730. Chin J Neurol 2010;43(4):268-271. Objective To report 9 cases of eosinophilic meningitis caused by Angiostrongylus cantonensis in Beijing,and to evaluate

  11. Does Cd36 gene play a key role in disturbed glucose and fatty acid metabolism in Prague hypertensive hypertriglyceridemic rats?

    Czech Academy of Sciences Publication Activity Database

    Kadlecová, Michaela; Čejka, Jakub; Zicha, Josef; Kuneš, Jaroslav

    2004-01-01

    Roč. 53, č. 3 (2004), s. 265-271 ISSN 0862-8408 R&D Projects: GA ČR GA305/03/0769; GA MŠk LN00A069 Institutional research plan: CEZ:AV0Z5011922 Keywords : hypertension * insulin resistance * metabolic syndrome Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.140, year: 2004

  12. Investigation of oxidation attack sites in sterols: Thermodynamics of hydrogen atom transfer

    Czech Academy of Sciences Publication Activity Database

    Škorňa, P.; Lengyel, Jozef; Rimarčík, J.; Klein, E.

    2014-01-01

    Roč. 1038, JUN 2014 (2014), s. 26-32 ISSN 2210-271X R&D Projects: GA ČR(CZ) GA14-27047S Institutional support: RVO:61388955 Keywords : sterol * steroid * oxidation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.545, year: 2014

  13. Reaction enthalpies of Osingle bondH bonds splitting-off in flavonoids: The role of non-polar and polar solvent

    Czech Academy of Sciences Publication Activity Database

    Vagánek, A.; Rimarčík, J.; Dropková, K.; Lengyel, Jozef; Klein, E.

    2014-01-01

    Roč. 1050, DEC 2014 (2014), s. 31-38 ISSN 2210-271X R&D Projects: GA ČR GA14-14082S Institutional support: RVO:61388955 Keywords : flavonoids * polyphenols * antioxidants Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.545, year: 2014

  14. The National Benchmark Test of quantitative literacy: Does it ...

    African Journals Online (AJOL)

    Windows User

    A total of 263,464 of these learners wrote this examination at the end of that year. On the .... it requires the activation of a range of enabling knowledge .... English. 197. 5.74. 708. 56.46. 821. 54.73 42 95.45 131 100 1,899. Xhosa. 1,271 37.01.

  15. Discrimination, Mastery, and Depressive Symptoms among African American Men

    Science.gov (United States)

    Watkins, Daphne C.; Hudson, Darrell L.; Caldwell, Cleopatra Howard; Siefert, Kristine; Jackson, James S.

    2011-01-01

    Purpose: This study examines the influence of discrimination and mastery on depressive symptoms for African American men at young (18-34), middle (35-54), and late (55+) adulthood. Method: Analyses are based on responses from 1,271 African American men from the National Survey of American Life (NSAL). Results: Discrimination was significantly…

  16. 76 FR 65530 - Alaska Native Claims Selection

    Science.gov (United States)

    2011-10-21

    ... 26; Secs. 33, 35, and 36. Containing 3,689 acres. T. 21 N., R. 47 W., Sec. 34. Containing 457.50.... FOR FURTHER INFORMATION CONTACT: The BLM by phone at 907-271-5960 or by e-mail at ak.blm.conveyance...

  17. 75 FR 69457 - Alaska Native Claims Selection

    Science.gov (United States)

    2010-11-12

    ..., AA-8102-30, AA-8102-31, AA-8102-32, AA-8102-33, AA-8102-34, AA-8102-47; LLAK965000-L14100000-KC0000-P... at 907-271-5960, by e-mail at ak[email protected] , or by telecommunication device (TTD...

  18. 75 FR 13297 - Alaska Native Claims Selection

    Science.gov (United States)

    2010-03-19

    ... for 118.47 acres, located southeast of the Native village of Hughes, Alaska. Notice of the decision...: The Bureau of Land Management by phone at 907-271-5960, or by e-mail at ak[email protected]ak.blm.gov...

  19. 76 FR 75899 - Alaska Native Claims Selection

    Science.gov (United States)

    2011-12-05

    ...., Tracts C, D and E; Sec. 36. Containing approximately 2,327 acres. T. 47 S., R. 60 W., Sec. 4, lots 1 to 4... phone at (907) 271-5960 or by email at ak[email protected] . Persons who use a Telecommunications...

  20. Species richness and above-ground biomass of poor and calcareous spring fens in the flysch West Carpatians, and their relationships to water and soil chemistry

    Czech Academy of Sciences Publication Activity Database

    Hájková, Petra; Hájek, Michal

    2003-01-01

    Roč. 75, - (2003), s. 271-287 ISSN 0032-7786 R&D Projects: GA ČR GA206/99/1240; GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6005908 Keywords : bryophytes * Central Europe * diversity Subject RIV: EF - Botanics

  1. 76 FR 14663 - Notice of Public Information Collection(s) Being Reviewed by the Federal Communications...

    Science.gov (United States)

    2011-03-17

    ....209, 53.211, and 53.213, Accounting Safeguards and Sections 260 and 271-276 of the Communications Act... reporting requirements, third party disclosure requirement, and recordkeeping requirement. Obligation to... party disclosure requirements). There is no change in the Commission's burden estimates. A Bell...

  2. Control of Hypertension in STULONG - Twenty Years Lasting Primary Preventive Study

    Czech Academy of Sciences Publication Activity Database

    Tomečková, Marie; Stanovská, Zuzana; Boudík, F.; Zvárová, Jana

    22 Suppl. 2, - (2004), s. 271 ISSN 0263-6352. [European Meeting on Hypertension /14./. 13.06.2004-17.06.2004, Paris] R&D Projects: GA MŠk LN00B107 Keywords : hypertension * primary preventive study Subject RIV: BB - Applied Statistics, Operational Research

  3. 78 FR 54149 - Airworthiness Directives; Rolls-Royce plc (RR) Turbofan Engines

    Science.gov (United States)

    2013-09-03

    ... Airworthiness Directives; Rolls-Royce plc (RR) Turbofan Engines AGENCY: Federal Aviation Administration (FAA... service information identified in this AD, contact Rolls-Royce plc, Corporate Communications, P.O. Box 31... per hour. Replacement parts are estimated to cost about $2,271 per engine. Based on these figures, we...

  4. morphological characteristics and classification of soils derived

    African Journals Online (AJOL)

    Prof. Ekwueme

    MORPHOLOGICAL CHARACTERISTICS AND CLASSIFICATION OF. SOILS DERIVED FROM DIVERSE PARENT MATERIALS IN CENTRAL. CROSS RIVER STATE, NIGERIA. 271. M. E. NSOR and I. J. IBANGA. (Received 5 October 2007; Revision Accepted 5 December 2007). ABSTRACT. Variation in soil characteristics ...

  5. Reassessing Spin-Coupled (Full Generalized Valence Bond) Descriptions of Ozone Using Three-Center Bond Indices.

    Czech Academy of Sciences Publication Activity Database

    Cooper, D.L.; Penotti, F.E.; Ponec, Robert

    2017-01-01

    Roč. 1116, Sl (2017), s. 40-49 ISSN 2210-271X Institutional support: RVO:67985858 Keywords : full GVB and spin-coupled * PI-system in O3 * domain-averaged fermi holes Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 1.549, year: 2016

  6. Cytokinin oxidase/dehydrogenase genes in barley and wheat. Cloning and heterologous expression

    Czech Academy of Sciences Publication Activity Database

    Galuszka, P.; Frébortová, Jitka; Werner, T.; Yamada, M.; Strnad, Miroslav; Schmülling, T.; Frébort, I.

    2004-01-01

    Roč. 271, č. 20 (2004), s. 3990-4002 ISSN 0014-2956 Institutional research plan: CEZ:AV0Z5038910 Keywords : cereals * cloning * cytokinin oxidase/dehydrogenase Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.260, year: 2004

  7. Phenolic acid content and radical scavenging activity of extracts from medlar (Mespilus germanica L.) fruit at different stages of ripening

    Czech Academy of Sciences Publication Activity Database

    Grúz, Jiří; Ayaz, F. A.; Torun, H.; Strnad, Miroslav

    2011-01-01

    Roč. 124, č. 1 (2011), s. 271-277 ISSN 0308-8146 R&D Projects: GA AV ČR KAN200380801 Institutional research plan: CEZ:AV0Z50380511 Keywords : Phenolic acids * HPLC * Mass spectrometry * Fruit * Ripening Subject RIV: EF - Botanics Impact factor: 3.655, year: 2011

  8. 41 CFR 109-27.102-50 - Systems contracting.

    Science.gov (United States)

    2010-07-01

    ...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-50 Systems contracting. Systems contracting may... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Systems contracting. 109-27.102-50 Section 109-27.102-50 Public Contracts and Property Management Federal Property Management...

  9. 41 CFR 109-27.102-1 - Applicability.

    Science.gov (United States)

    2010-07-01

    ...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-1 Applicability. Replenishment of inventories of... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Applicability. 109-27.102-1 Section 109-27.102-1 Public Contracts and Property Management Federal Property Management...

  10. 41 CFR 109-27.102-51 - Policy.

    Science.gov (United States)

    2010-07-01

    ...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-51 Policy. Systems contracting for supply... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Policy. 109-27.102-51 Section 109-27.102-51 Public Contracts and Property Management Federal Property Management Regulations...

  11. 41 CFR 101-27.101 - General.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true General. 101-27.101 Section 101-27.101 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 27-INVENTORY MANAGEMENT 27.1-Stock...

  12. 41 CFR 101-27.102-1 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Applicability. 101-27.102-1 Section 101-27.102-1 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 27-INVENTORY MANAGEMENT 27.1...

  13. Assessment set for evaluation of clinical outcomes in multiple sclerosis: psychometric properties

    Czech Academy of Sciences Publication Activity Database

    Řasová, K.; Martinková, Patrícia; Vyškovská, J.; Šedová, Michaela

    -, č. 3 (2012), s. 59-70 ISSN 1179-271X R&D Projects: GA MŠk(CZ) 1M06014 Grant - others:GA MZd(CZ) 1A8628 Institutional support: RVO:67985807 Keywords : outcome assessment * reproducibility of results * psychometric properties * test–retest reliability * internal consistency Subject RIV: FP - Other Medical Disciplines

  14. Differences between flocculating yeast and regular industrial yeast in transcription and metabolite profiling during ethanol fermentation

    Directory of Open Access Journals (Sweden)

    Lili Li

    2017-03-01

    Full Text Available Objectives: To improve ethanolic fermentation performance of self-flocculating yeast, difference between a flocculating yeast strain and a regular industrial yeast strain was analyzed by transcriptional and metabolic approaches. Results: The number of down-regulated (industrial yeast YIC10 vs. flocculating yeast GIM2.71 and up-regulated genes were 4503 and 228, respectively. It is the economic regulation for YIC10 that non-essential genes were down-regulated, and cells put more “energy” into growth and ethanol production. Hexose transport and phosphorylation were not the limiting-steps in ethanol fermentation for GIM2.71 compared to YIC10, whereas the reaction of 1,3-disphosphoglycerate to 3-phosphoglycerate, the decarboxylation of pyruvate to acetaldehyde and its subsequent reduction to ethanol were the most limiting steps. GIM2.71 had stronger stress response than non-flocculating yeast and much more carbohydrate was distributed to other bypass, such as glycerol, acetate and trehalose synthesis. Conclusions: Differences between flocculating yeast and regular industrial yeast in transcription and metabolite profiling will provide clues for improving the fermentation performance of GIM2.71.

  15. Impairment of mitochondrial function of rat hepatocytes by high fat diet and oxidative stress

    Czech Academy of Sciences Publication Activity Database

    Garnol, T.; Endlicher, R.; Kučera, O.; Drahota, Zdeněk; Červinková, Z.

    2014-01-01

    Roč. 63, č. 2 (2014), s. 271-274 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LL1204 Grant - others:Univerzita Karlova(CZ) PRVOUK P37/02 Institutional support: RVO:67985823 Keywords : hepatocytes * high fat diet * mitochondrial activities * ROS Subject RIV: ED - Physiology Impact factor: 1.293, year: 2014

  16. Development of the Ethmoidal Structures of the Endocranium in Discoglossus pictus (Anura: Discoglossidae)

    Czech Academy of Sciences Publication Activity Database

    Královec, K.; Roček, Zbyněk; Žáková, P.; Mužáková, V.

    2010-01-01

    Roč. 271, č. 9 (2010), s. 1078-1093 ISSN 0362-2525 Institutional research plan: CEZ:AV0Z30130516 Keywords : Anura * Discoglossidae * Discoglossus * development * cranium Subject RIV: EA - Cell Biology Impact factor: 1.773, year: 2010

  17. Obnova jezuitské koleje v Kutné Hoře

    Czech Academy of Sciences Publication Activity Database

    Frolík, Jan; Krejčík, J.; Muková, J.

    2011-01-01

    Roč. 71, č. 4 (2011), s. 266-271 ISSN 1210-5538 Institutional research plan: CEZ:AV0Z80020508 Keywords : Middle Ages * Kutná Hora * Jesuits Subject RIV: AC - Archeology, Anthropology, Ethnology http://www.npu.cz/download/1321956876/11-11-21-ZPP-04-11-Frolik-Krejcik-Mukova.pdf

  18. K Ramesha

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. K Ramesha. Articles written in Bulletin of Materials Science. Volume 34 Issue 2 April 2011 pp 271-277. Synthesis of new (Bi, La)3MSb2O11 phases (M = Cr, Mn, Fe) with KSbO3-type structure and their magnetic and photocatalytic properties · K Ramesha A S Prakash M Sathiya ...

  19. Serological survey of domestic animals for tick-borne encephalitis and Bhanja viruses in northeastern Hungary

    Czech Academy of Sciences Publication Activity Database

    Šikutová, Silvie; Hornok, S.; Hubálek, Zdeněk; Doležálková, I.; Juřicová, Zina; Rudolf, Ivo

    2009-01-01

    Roč. 135, 3-4 (2009), s. 267-271 ISSN 0378-1135 EU Projects: European Commission(XE) 10284 - EDEN Institutional research plan: CEZ:AV0Z60930519 Keywords : Tick-borne encephalitis * Bhanja virus * Cattle * Horse * Sheep * Hungary Subject RIV: EE - Microbiology, Virology Impact factor: 2.874, year: 2009

  20. Friends Also Matter: Examining Friendship Adjustment Indices as Moderators of Anxious-Withdrawal and Trajectories of Change in Psychological Maladjustment

    Science.gov (United States)

    Markovic, Andrea; Bowker, Julie C.

    2017-01-01

    The present study evaluated whether 3 indices of friendship adjustment (mutual friendship involvement, friendship stability, friendship quality) are important, but overlooked, moderators of the impact of anxious-withdrawal on trajectories of psychological maladjustment during early adolescence. Participants included 271 young adolescents (51%…

  1. Application of capillary electrochromatography using macroporous polyacrylamide columns for the analysis of lignans from seeds of Schisandra chinensis

    Czech Academy of Sciences Publication Activity Database

    Kvasničková, L.; Glatz, O.; Štěrbová, H.; Kahle, Vladislav; Slanina, J.; Musil, P.

    2001-01-01

    Roč. 916, 1-2 (2001), s. 265-271 ISSN 0021-9673 R&D Projects: GA ČR GA303/00/D062 Institutional research plan: CEZ:AV0Z4031919 Keywords : electrochromatography * Schisandra chinensis * plant materials Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.793, year: 2001

  2. Water SA - Vol 28, No 3 (2002)

    African Journals Online (AJOL)

    The importance of the river-estuary interface (REI) zone in estuaries · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. GC Bate, AK Whitfield, JB Adams, P Huizinga, TH Wooldridge, 271-280. http://dx.doi.org/10.4314/wsa.v28i3.4894 ...

  3. Annotated phyto-taxonomical & phyto-geographical publications on or of importance to the Malaysian flora

    NARCIS (Netherlands)

    NN,

    1949-01-01

    Baas Becking, L.G.M.: Notes on jungle trees I (Chron. Nat. 104, 1948, 271-277). Calculation of the age of the stand in the mountain forest reserve Tjibodas on Mt Gedeh, W. Java, by means of new measurements on the trees numbered by S.H. Koorders in 1890. By means of the losses (0.77% annually) the

  4. Stress And Strain Analysis of The Hip Joint Using FEM

    Czech Academy of Sciences Publication Activity Database

    Vaverka, M.; Návrat, Tomáš; Vrbka, M.; Florian, Z.; Fuis, Vladimír

    2006-01-01

    Roč. 14, 4-5 (2006), s. 271-279 ISSN 0928-7329 R&D Projects: GA ČR GA101/05/0136 Institutional research plan: CEZ:AV0Z20760514 Keywords : hip FEM surgace replacement pathological contact pressure stress * hip FEM surgace replacement pathological contact pressure stress Subject RIV: BO - Biophysics

  5. Human Babesiosis, Bolivia, 2013.

    Science.gov (United States)

    Gabrielli, Simona; Totino, Valentina; Macchioni, Fabio; Zuñiga, Freddy; Rojas, Patricia; Lara, Yuni; Roselli, Mimmo; Bartoloni, Alessandro; Cancrini, Gabriella

    2016-08-01

    To investigate human babesiosis in the Bolivian Chaco, in 2013 we tested blood samples from 271 healthy persons living in 2 rural communities in this region. Microscopy and PCR indicated that 3.3% of persons were positive for Babesia microti parasites (US lineage); seroprevalence was 45.7%. Appropriate screening should mitigate the risk for transfusion-associated babesiosis.

  6. The Relations between Teasing and Bullying and Middle School Standardized Exam Performance

    Science.gov (United States)

    Lacey, Anna; Cornell, Dewey; Konold, Timothy

    2017-01-01

    This study examined the relations between the schoolwide prevalence of teasing and bullying (PTB) and schoolwide academic performance in a sample of 271 Virginia middle schools. In addition, the study examined the mediating effects of student engagement. A three-step sequence of path models investigated associations between schoolwide PTB and…

  7. molluscum contagiosum virus infection amongst plwha in ibadan

    African Journals Online (AJOL)

    boaz

    inflammatory genital infections diagnosed were; genital warts-(35.0%), bacterial vaginosis (27.1%), trichomoniasis (10.0 %) and tinea cruris (0.5%). MC patients had higher viral load, low CD4count. (mean-85 cells/mm3) and more likely to be treatment experienced. TABLE 1: ODD RATIO FOR TREATMENT STATUS AND ...

  8. The Comparison of Predictors of Death Obsession within Two Cultures

    Science.gov (United States)

    Abdel-Khalek, Ahmed M.; Maltby, John

    2008-01-01

    The objective of the study was to compare various predictors of death obsession (i.e., anxiety, optimism, pessimism), and self-ratings of religiosity, physical health, mental health, happiness, and satisfaction with life, among 2 samples of college students recruited from two different cultures: Kuwait (n = 271) and United Kingdom (n = 205). The…

  9. File list: InP.CDV.05.AllAg.HUVEC [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available InP.CDV.05.AllAg.HUVEC hg19 Input control Cardiovascular HUVEC SRX220065,SRX294968,...271,SRX425273,SRX220068,SRX425270,SRX190192,SRX220067 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/InP.CDV.05.AllAg.HUVEC.bed ...

  10. The validity and reliability study of Hand Hygiene Belief Scale and Hand Hygiene Practices Inventory

    Directory of Open Access Journals (Sweden)

    Mevlude Karadag

    2016-06-01

    Conclusion: The adaptation of translated and ldquo;Hand Hygiene Belief Scale and Hand Hygiene Practices Inventory and rdquo; in Turkey is found to be reliable and valid to evaluate hand hygiene belief and practices. [Cukurova Med J 2016; 41(2.000: 271-284

  11. Biochemical evidence for the activation of distinct subsets of mitogen-activated protein kinases by voltage and defense-related stimuli

    Czech Academy of Sciences Publication Activity Database

    Link, V.; Hofmann, M.; Sinha, A.; Ehness, R.; Strnad, Miroslav; Roitsch, T.

    2002-01-01

    Roč. 128, č. 1 (2002), s. 271-281 ISSN 0032-0889 R&D Projects: GA MŠk OC 844.10 Institutional research plan: CEZ:AV0Z5038910 Keywords : TOBACCO SUSPENSION CULTURE * CYCLIN DEPENDENT KINASES * CYTOSOLIC CALCIUM ION Subject RIV: CE - Biochemistry Impact factor: 5.800, year: 2002

  12. 46 CFR 504.4 - Categorical exclusions.

    Science.gov (United States)

    2010-10-01

    ... FEDERAL MARITIME COMMISSION GENERAL AND ADMINISTRATIVE PROVISIONS PROCEDURES FOR ENVIRONMENTAL POLICY ANALYSIS § 504.4 Categorical exclusions. (a) No environmental analyses need be undertaken or environmental... foreign country. (19) Action taken on special docket applications pursuant to § 502.271 of this chapter...

  13. Vavraia culicis (Weiser, 1947) Weiser, 1977 revisited: cytological characterisation of a Vavraia culicis-like microsporidium isolated from mosquitoes in Florida and the establishment of Vavraia culicis floridensis subsp. n

    Czech Academy of Sciences Publication Activity Database

    Vávra, Jiří; Becnel, J. J.

    2007-01-01

    Roč. 54, č. 4 (2007), s. 259-271 ISSN 0015-5683 R&D Projects: GA ČR GA524/07/1003 Institutional research plan: CEZ:AV0Z60220518 Keywords : Vavraia * Aedes albopictus * mosquito es * parasites * microsporidia * ultrastructure Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.000, year: 2007

  14. Novedades en el diccionario (New Additions to the Dictionary)

    Science.gov (United States)

    Carnicer, Ramon

    1975-01-01

    A total of 271 items--words, phrases and affixes--were added to the common Spanish dictionary in the period between October and December 1974. This article lists the principal additions, each organized within a larger semantic category. (Text is in Spanish.) (TL)

  15. The Effect of Coping Knowledge on Emergency Preparedness in Elementary School Students

    Science.gov (United States)

    Kim, Shin-Jeong; Kang, So-Ra; Lee, Seung-Hee; Kang, Kyung-Ah

    2014-01-01

    The purpose of this study was to examine the effect of coping knowledge for emergency preparedness in Korean elementary school students. A school-based coping education program was provided seven times to 271 fourth- and fifth-grade students in two urban schools by researchers with the school nurses. The Process Model of Stress and Coping and…

  16. Some Diophantine equations from finite group theory: $\\Phi_m (x) = 2p^n -1$

    NARCIS (Netherlands)

    Luca, F.; Moree, P.; Weger, de B.M.M.

    2009-01-01

    We show that the equation in the title (with Fn the nth cyclotomic polynomial) has no integer solution with n = 1 in the cases (m, p) = (15, 41), (15, 5581), (10, 271). These equations arise in a recent group theoretical investigation by Z. Akhlaghi, M. Khatami and B. Khosravi.

  17. Some Diophantine equations from finite group theory: $\\Phi_m (x) = 2p^n -1$

    NARCIS (Netherlands)

    Luca, F.; Moree, P.; Weger, de B.M.M.

    2011-01-01

    We show that the equation in the title (with $\\Psi_m$ the $m$th cyclotomic polynomial) has no integer solution with $n \\geq 1$ in the cases (m,p) = (15,41), (15,5581), (10,271). These equations arise in a recent group theoretical investigation by Akhlaghi, Khosravi and Khatami.

  18. Integration of Multi-Tension Permeametry and Photogrammetric Textural Segmentation for Estimating Directional Permeability

    Science.gov (United States)

    2010-04-01

    conditions. Direct push optical methods could easily provide real-time high- resolution images useful for differentiating soil characteristics based on...Kozeny J. 1927. Uber Kapillare Leitung Des Wassers Im Boden. Sitz. Akad. Wissensh, 136:271–306. Lowry, W, N. Mason, And D. Merewether. 1999

  19. Social Adjustment of Deaf Early Adolescents at the Start of Secondary School: The Divergent Role of Withdrawn Behavior in Peer Status

    Science.gov (United States)

    Wolters, Nina; Knoors, Harry; Cillessen, Antonius H. N.; Verhoeven, Ludo

    2014-01-01

    This study examined the peer relationships and social behaviors of deaf adolescents in the first 2 years of secondary school. Peer nominations and ratings of peer status and behavior were collected longitudinally with 74 deaf and 271 hearing adolescents from Grade 7 to Grade 8. The predictions of deaf adolescents' peer status in Grade 8 from Grade…

  20. Morphological traits in nitrogen fixing heterocytous cyanobacteria: possible links between morphology and eco-physiology.

    Czech Academy of Sciences Publication Activity Database

    Pinto, P. D.; Kust, Andreja; Devercelli, M.; Kozlíková-Zapomělová, Eliška

    2016-01-01

    Roč. 764, č. 1 (2016), s. 271-281 ISSN 0018-8158 R&D Projects: GA ČR(CZ) GA14-18067S Institutional support: RVO:60077344 Keywords : traits * heterocyte * akinete * shape * size * phytoplankton Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.056, year: 2016

  1. Expression and location of mRNAs encoding multiple forms of secretory phospholipase A2 in the rat retina

    DEFF Research Database (Denmark)

    Kolko, Miriam; Christoffersen, Nanna R; Barreiro, Sebastian G

    2004-01-01

    of sPLA(2)s in neuronal signaling and survival [Kolko et al. (1996) J. Biol. Chem. 271: 32722-32728]. To date, no retinal sPLA(2)s have been cloned or characterized. We evaluated the existence and abundance of sPLA(2) subtypes in rat retina and explored their possible involvement in light...

  2. Securing the Aviation Transportation System

    Science.gov (United States)

    2007-12-01

    additional 100,000 airport workers who perform duties in sterile areas (the indoor gate area past the security check point).197 These same...containing thirteen handguns, an assault rifle and eight pounds of marijuana .270 However, two Federal Air Marshals were also onboard the aircraft.271

  3. Same- and Other-Sex Popularity and Preference during Early Adolescence

    Science.gov (United States)

    Bowker, Julie C.; Adams, Ryan E.; Bowker, Matthew H.; Fisher, Carrie; Spencer, Sarah V.

    2016-01-01

    This study examined the longitudinal and bidirectional relations between same-sex (SS) and other-sex (OS) popularity and preference across one school year. Participants were 271 sixth-grade students who completed peer nomination measures at three time points in their schools. Tests of cross-lagged autoregressive models indicated that SS popularity…

  4. Gclust Server: 85869 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available equence length 496 Representative annotation D-lactate dehydrogenase, part of the retrograde regulon which c...rograde regulon which consists of genes whose expression is stimulated by damage to...85869 SCE_YEL071W=DLD3 Cluster Sequences Related Sequences(271) 496 D-lactate dehydrogenase, part of the ret

  5. Crystal structure and magnetic properties of UO.sub.2./sub./permalloy thin films

    Czech Academy of Sciences Publication Activity Database

    Tereshina, Evgeniya; Daniš, S.; Springell, R.; Bao, Z.; Havela, L.; Caciuffo, R.

    2015-01-01

    Roč. 591, Sep (2015), s. 271-275 ISSN 0040-6090 R&D Projects: GA ČR GP13-25866P Institutional support: RVO:68378271 Keywords : exchange bias * permalloy * uranium dioxide Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.761, year: 2015

  6. Tropical Trametes lactinea is widely distributed in the eastern USA

    Czech Academy of Sciences Publication Activity Database

    Vlasák, Josef; Kout, J.

    2011-01-01

    Roč. 115, č. 1 (2011), s. 271-279 ISSN 0093-4666 Institutional research plan: CEZ:AV0Z50510513 Keywords : Basidiomycota, USA new record, taxonomy * USA new record * taxonomy Subject RIV: EF - Botanics Impact factor: 0.709, year: 2011

  7. 38 CFR 17.802 - Application provisions.

    Science.gov (United States)

    2010-07-01

    ..., (D) Names of at least two references of government or community groups whom the organization has... operating policies addressing structure for democratic self-government, expulsion policies for nonpayment... plans for use of the loan proceeds. (Authority: Sec. 8 of Pub. L. 102-54, 105 Stat. 271, 38 U.S.C. 501) ...

  8. Time to give in

    DEFF Research Database (Denmark)

    Agger Nielsen, Jeppe; Andersen, Kim Normann; Medaglia, Rony

    2009-01-01

    This paper presents the results of a survey on the opinions of Danish local government managers on the future use of IT after the merger of 271 municipalities into 100. Findings show that the highest expectations on the outcome of IT implementation are related to increased efficiency and to new a...

  9. Pollution: Problems and Solutions. Grade Nine, Unit One, 9.1 Comprehensive Social Studies Curriculum for the Inner City.

    Science.gov (United States)

    Jamison, Sandra; Campbell, Bruce

    The ninth grade unit of the FICSS series (Focus on Inner City Social Studies -- see SO 008 271) studies the economic and political realities of the inner city. This document, the first unit of the 9th grade section, deals with the ecological crises involving pollution and its causes. Specific problems include air pollution, pesticides, herbicides,…

  10. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. C S Jha. Articles written in Journal of Earth System Science. Volume 122 Issue 2 April 2013 pp 271-281. Landscape level assessment of critically endangered vegetation of Lakshadweep islands using geo-spatial techniques · C Sudhakar Reddy Bijan Debnath P Hari ...

  11. Hospital centralization and performance in Denmark - ten years on

    DEFF Research Database (Denmark)

    Christiansen, Terkel; Vrangbæk, Karsten

    2018-01-01

    Denmark implemented a major reform of the administrative and political structure in 2007 when the previous 13 counties were merged into five new regions and the number of municipalities was reduced from 271 to 98. A main objective was to create administrative units that were large enough to suppo...

  12. Hospital centralization and performanced in Denmark - ten years on

    DEFF Research Database (Denmark)

    Christiansen, Terkel; Vrangbæk, Karsten

    2017-01-01

    Denmark implemented a major reform of the administrative and political structure in 2007 when the previous 13 counties were merged into five new regions and the number of municipalities was reduced from 271 to 98. A main objective was to create administrative units that were large enough to suppo...

  13. Perspectives on halogen bonding and other sigma-hole interactions: Lex parsimoniae (Occam's Razor)

    Czech Academy of Sciences Publication Activity Database

    Politzer, P.; Riley, Kevin Eugene; Bulat, F. A.; Murray, J. S.

    2012-01-01

    Roč. 998, SI (2012), s. 2-8 ISSN 2210-271X Institutional research plan: CEZ:AV0Z40550506 Keywords : halogen bonding * alpha-Hole bonding * hydrogen bonding * electrostatics /polarization * dispersion * electrostatic potentials Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.139, year: 2012

  14. Ellipsometry investigation of perovskite/pyrochlore PZT thin film stacks

    Czech Academy of Sciences Publication Activity Database

    Deineka, Alexander; Glinchuk, M. D.; Jastrabík, Lubomír; Suchaneck, G.; Gerlach, G.

    2001-01-01

    Roč. 258, - (2001), s. 271-276 ISSN 0015-0193 R&D Projects: GA MŠk LN00A015; GA ČR GA202/00/1425 Institutional research plan: CEZ:AV0Z1010914 Keywords : ferroelectric film * depth profile * interface Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.471, year: 2001

  15. Application of a chlorophyll index derived from satellite data to ...

    African Journals Online (AJOL)

    Application of a chlorophyll index derived from satellite data to investigate the variability of phytoplankton in the Benguela ecosystem. H Demarcq, R Barlow, L Hutchings. Abstract. No Abstract. African Journal of Marine Science Vol.29(2) 2007: pp. 271-282. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD ...

  16. High-Frequency Network Activity, Global Increase in Neuronal Activity, and Synchrony Expansion Precede Epileptic Seizures in Vitro

    Czech Academy of Sciences Publication Activity Database

    Jiruška, P.; Csicsvari, J.; Powell, A.V.; Fox, J.E.; Chang, W.C.; Vreugdenhil, M.; Li, X.; Paluš, Milan; Bujan, A.F.; Dearden, R.W.; Jefferys, J. G. R.

    2010-01-01

    Roč. 30, č. 16 (2010), s. 5690-5701 ISSN 0270-6474 Institutional research plan: CEZ:AV0Z10300504 Keywords : mammalian hippocampus invitro * temporal - lobe epilepsy * nonsynaptic epileptogenesis * spatiotemporal dynamics * after-discharges * pyramidal cells * oscillations * rat * calcium * slice Subject RIV: FH - Neurology Impact factor: 7.271, year: 2010

  17. Waste water treatment of slaughterhouse through water treatment plants of stainless steel; Tratamiento de aguas residuales de mataderos mediante depuradoras compactas modulares de acero inoxidable

    Energy Technology Data Exchange (ETDEWEB)

    BaNales Sirvent, P.

    1997-06-01

    The object of this project was to develop an integral waste water treatment concept, based on compact module made of stainless steel, with a combination that allows to get performances according to given requirements stablished in the Community Directive 91/271/CEE (1991). The industrial pilot tests have been made in a slaughterhouse with a capacity of 20 tons per day. (Author)

  18. O modálních predikativech slovesného původu typu To přende, (se) patří... zbórat

    Czech Academy of Sciences Publication Activity Database

    Šipková, Milena

    2017-01-01

    Roč. 100, č. 4 (2017), s. 265-271 ISSN 0027-8203 R&D Projects: GA ČR(CZ) GA16-04648S Keywords : dialect * verbal modal predicatives * modal verbs * modalization * Dictionary of Czech Dialects Subject RIV: AI - Linguistics OBOR OECD: Linguistics

  19. Search Results | Page 28 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 1804 ... The prices of mobile phones and netbooks have plummeted, even as their penetration ... products, the tobacco industry still benefits from strong institutional support. ... Learning, Transparency and Relationship Building: Ethiopian Women Parliamentarians and Young Female University Students.

  20. 78 FR 35354 - Supreme Indiana Operations, Inc., Grant of Petition for Decision of Inconsequential Noncompliance

    Science.gov (United States)

    2013-06-12

    ... 2011, 97,271 Truck models manufactured between 2006 and 2011, for a total of approximately 107,250... to motor vehicle safety, and that its petition, to exempt from providing recall notification of noncompliance as required by 49 U.S.C. 30118 and remedying the recall noncompliance as required by 49 U.S.C...

  1. 77 FR 35104 - Notice of Request To Release Airport Property at Merrill Field Airport, Anchorage, AK

    Science.gov (United States)

    2012-06-12

    ... delivered to: Michelle Colby, Real Estate Services Manager, DOWL HKM, 4041 B Street, Anchorage, AK 99503...- 271-3665, email [email protected] or Michelle Colby, Real Estate Services Manager, DOWL HKM, 4041... Section 6.13 of the State of Alaska Right of Way Manual. This purchase offer was predicated on DOT&PF's...

  2. 78 FR 15338 - New York: Final Authorization of State Hazardous Waste Management Program Revisions

    Science.gov (United States)

    2013-03-11

    ... authorization of changes to its hazardous waste program under the Solid Waste Disposal Act, as amended, commonly... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R02-RCRA-2013-0144; FRL-9693-3] New York: Final Authorization of State Hazardous Waste Management Program Revisions AGENCY: Environmental...

  3. Morbidities, concordance, and predictors of preterm premature ...

    African Journals Online (AJOL)

    2015-12-05

    Dec 5, 2015 ... Background: Preterm premature rupture of membranes (PPROM) is a challenging complication of ... PROM (P < 0.000), latency period (P < 0.000), and birth weight (P < 0.001). ..... J Obstet Gynecol 2000;183:271‑6. 25. Mercer ...

  4. Lipothymia and Syncope—Aetiology and Outcome in a Prehospital Setting: A Retrospective Study

    DEFF Research Database (Denmark)

    Zwisler, Stine Thorhauge; Mikkelsen, Søren

    2012-01-01

    MECU runs registered, 678 were assignments in which the patients were diagnosed with lipothymia or syncope (3.8%). 578 patients (85%) were admitted to hospital. 278 of the patients were discharged directly from the emergency department, while 271 were admitted to a ward. 112 patients refused treatment...

  5. The novel brassinosteroid analog BR4848 inhibits angiogenesis in human endothelial cells and induces apoptosis in human cancer cells in vitro

    Czech Academy of Sciences Publication Activity Database

    Rárová, L.; Sedlák, David; Oklešťková, Jana; Steigerová, J.; Liebl, J.; Zahler, S.; Bartůněk, Petr; Kolář, Z.; Kohout, Ladislav; Kvasnica, Miroslav; Strnad, Miroslav

    2018-01-01

    Roč. 178 (2018), s. 263-271 ISSN 0960-0760 R&D Projects: GA MŠk(CZ) LO1204; GA MŠk LO1220; GA MŠk LM2015063 Institutional support: RVO:68378050 ; RVO:61389030 Keywords : Brassinosteroid analog * Cancer cell lines * Apoptosis * HUVEC * Angiogenesis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.561, year: 2016

  6. Highlights of the 30th International Conference on Antiviral Research

    Czech Academy of Sciences Publication Activity Database

    Andrei, G.; Carter, K.; Janeba, Zlatko; Sampath, A.; Schang, L. M.; Tarbet, E. B.; Vere Hodge, R. A.; Bray, M.; Esté, J. A.

    2017-01-01

    Roč. 145, Sep (2017), s. 184-196 ISSN 0166-3542 Institutional support: RVO:61388963 Keywords : chronic hepatitis C * dengue virus * in vitro Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 4.271, year: 2016

  7. Geochemical characteristics and petrogenesis of phonolites and trachytic rocks from the České Středohoří Volcanic Complex, the Ohře Rift, Bohemian Massif

    Czech Academy of Sciences Publication Activity Database

    Ackerman, Lukáš; Ulrych, Jaromír; Řanda, Zdeněk; Erban, V.; Hegner, E.; Magna, T.; Balogh, K.; Frána, Jaroslav; Lang, Miloš; Novák, Jiří Karel

    224/225, May (2015), s. 256-271 ISSN 0024-4937 R&D Projects: GA AV ČR IAA3048201 Institutional support: RVO:67985831 ; RVO:61389005 Keywords : phonolite * trachyte * Sr–Nd–Li isotopes * Cenozoic alkaline volcanism * Ohře (Eger) Rift * Bohemian Massif Subject RIV: DD - Geochemistry Impact factor: 3.723, year: 2015

  8. SINET: Ethiopian Journal of Science - Vol 22, No 2 (1999)

    African Journals Online (AJOL)

    ... evaluation of Phytomyza orobanchia (Diptera: Agromyzidae) as a controller of Orobanche spp in Ethiopia, EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A E M Elzein, J Kroschel, Assefa Admasu, Masresha Fetene, 271-282. http://dx.doi.org/10.4314/sinet.v22i2.

  9. Magnetic fabric and modeled strain distribution in the head of a nested granite diapir, the Melechov pluton, Bohemian Massif

    Czech Academy of Sciences Publication Activity Database

    Trubač, Jakub; Žák, J.; Chlupáčová, M.; Janoušek, V.

    2014-01-01

    Roč. 66, September (2014), s. 271-283 ISSN 0191-8141 Institutional support: RVO:67985831 Keywords : anisotropy of magnetic susceptibility (AMS) * diapir * emplecement * fabric * granite * strain Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 2.884, year: 2014

  10. 76 FR 33982 - Airworthiness Directives; Bombardier, Inc. Model CL-600-2C10 (Regional Jet Series 700, 701, & 702...

    Science.gov (United States)

    2011-06-10

    ... office between 9 a.m. and 5 p.m., Monday through Friday, except Federal holidays. The AD docket contains..., 139, 142, 145, 146, 266, 268, 271, 274, 276, 277, 280, 282 through 285 inclusive, 290, 292, 294, 297, 299, 307, 309, 320, 337, 400, 402, 403, 410, 412, 418, 421 through 428 inclusive, 430, 435 through 439...

  11. 76 FR 13536 - Airworthiness Directives; Bombardier, Inc. Model CL-600-2C10 (Regional Jet Series 700, 701, & 702...

    Science.gov (United States)

    2011-03-14

    ...., Monday through Friday, except Federal holidays. For service information identified in this proposed AD...., Monday through Friday, except Federal holidays. The AD docket contains this proposed AD, the regulatory..., 135, 139, 142, 145, 146, 266, 268, 271, 274, 276, 277, 280, 282 through 285 inclusive, 290, 292, 294...

  12. 78 FR 6202 - Airworthiness Directives; the Boeing Company

    Science.gov (United States)

    2013-01-30

    ... holidays. The AD docket contains this AD, the regulatory evaluation, any comments received, and other... inclusive and included in the applicability specified in AD 2009-16-07, Amendment 39-15990 (74 FR 41607... through YA019 inclusive, YA201 through YA203 inclusive, YA231 through YA242 inclusive, YA251, YA252, YA271...

  13. Yankee Nuclear Power Station. Semiannual operating report, January--June 1975

    International Nuclear Information System (INIS)

    1975-01-01

    The plant operated at power with brief shutdowns and load reductions during this period. Net electrical power generated was 741,551,035 MWh with the generator on line 4,271.30 hrs. Data is presented concerning power generation, shutdowns, corrective maintenance, chemistry and radiochemistry, occupational personnel radiation exposures, release of radioactive materials, and abnormal occurrences. (FS)

  14. Better Men? Gendered Culturalized Citizenship in Male Emancipation Projects in the Netherlands

    NARCIS (Netherlands)

    Huis, I.B. van; Gelfer, J.

    2014-01-01

    After a focus on migrant women’s emancipation (Roggeband & Verloo. Social Policy & Administration, 41(3), 271–288, 2007), migrant men have become a specific target group of culturalized citizenship politics as well. In the Netherlands, men are targeted on a national level as well as on the level of

  15. How many species of whipworms do we share? Whipworms from man and other primates form two phylogenetic lineages

    Czech Academy of Sciences Publication Activity Database

    Doležalová, J.; Oborník, Miroslav; Hajdušková, Eva; Jirků, Milan; Petrželková, Klára Judita; Bolechová, P.; Cutillas, C.; Callejón, R.; Jaroš, J.; Beránková, Z.; Modrý, David

    2015-01-01

    Roč. 62, December 3, 2015 (2015), s. 063 ISSN 1803-6465 R&D Projects: GA MŠk(CZ) EE2.3.30.0032; GA ČR GA206/09/0927 Institutional support: RVO:60077344 Keywords : Trichuris * phylogeny * diversity * zoonotic potential * humans Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.271, year: 2015

  16. How many species of whipworms do we share? Whipworms from man and other primates form two phylogenetic lineages

    Czech Academy of Sciences Publication Activity Database

    Doležalová, J.; Oborník, M.; Hajdušková, E.; Jirků, M.; Petrželková, Klára Judita; Bolechová, P.; Cutillas, C.; Callejon, R.; Jaroš, J.; Beránková, Z.; Modrý, D.

    2015-01-01

    Roč. 62, č. 063 (2015) ISSN 0015-5683 R&D Projects: GA ČR GA524/06/0264; GA ČR GA206/09/0927 Institutional support: RVO:68081766 Keywords : Trichuris * phylogeny * diversity * zoonotic potential * humans Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 1.271, year: 2015

  17. African Journal of AIDS Research - Vol 7, No 3 (2008)

    African Journals Online (AJOL)

    Bridging the gap between VCT and HIV/AIDS treatment uptake: perspectives from a mining-sector workplace in South Africa · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Anil Bhagwanjee, Inge Petersen, Olagoke Akintola, Gavin George, 271-279.

  18. 78 FR 29098 - Endangered and Threatened Wildlife; 90-Day Finding on a Petition To List Iliamna Lake Seals as a...

    Science.gov (United States)

    2013-05-17

    ... information (e.g., name, address, etc.), confidential business information, or otherwise sensitive information... Region, (907) 271-1332; Jon Kurland, NMFS Alaska Region, (907) 586-7638; or Lisa Manning, NMFS Office of..., abundance, reproductive success, age structure, distribution and population connectivity, habitat selection...

  19. Sporophytes of polysporangiate land plants from the early Silurian period may have been photosynthetically autonomous

    Czech Academy of Sciences Publication Activity Database

    Libertín, M.; Kvaček, J.; Bek, Jiří; Žárský, V.; Štorch, Petr

    2018-01-01

    Roč. 4, 30 April 2018 (2018), s. 269-271 ISSN 2055-026X Institutional support: RVO:67985831 Keywords : earliest vascular plant s * in situ spores * Silurian * polysporangiate plant s Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Paleontology Impact factor: 10.300, year: 2016

  20. Comparative genetic responses to climate for the varieties of Pinus ponderosa and Pseudotsuga menziesii: realized climate niches

    Science.gov (United States)

    Gerald E. Rehfeldt; Barry C. Jaquish; Javier Lopez-Upton; Cuauhtemoc Saenz-Romero; J. Bradley St Clair; Laura P. Leites; Dennis G. Joyce

    2014-01-01

    The Random Forests classification algorithm was used to predict the occurrence of the realized climate niche for two sub-specific varieties of Pinus ponderosa and three varieties of Pseudotsuga menziesii from presence-absence data in forest inventory ground plots. Analyses were based on ca. 271,000 observations for P. ponderosa and ca. 426,000 observations for P....

  1. 26 CFR 1.1491-1 - Imposition of tax.

    Science.gov (United States)

    2010-04-01

    ... Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Tax on Transfers to Avoid Income Tax § 1.1491-1 Imposition of tax. Section 1491 imposes an... partnership. The tax is in an amount equal to 271/2 percent of the excess of (a) the value of the stock or...

  2. 78 FR 54466 - Federal Open Market Committee; Domestic Policy Directive of July 30-31, 2013

    Science.gov (United States)

    2013-09-04

    ... percent. The Committee directs the Desk to undertake open market operations as necessary to maintain such... FEDERAL RESERVE SYSTEM Federal Open Market Committee; Domestic Policy Directive of July 30-31... 271), there is set forth below the domestic policy directive issued by the Federal Open Market...

  3. 78 FR 70945 - Federal Open Market Committee; Domestic Policy Directive of October 29-30, 2013

    Science.gov (United States)

    2013-11-27

    ...\\ percent. The Committee directs the Desk to undertake open market operations as necessary to maintain such... FEDERAL RESERVE SYSTEM Federal Open Market Committee; Domestic Policy Directive of October 29-30... 271), there is set forth below the domestic policy directive issued by the Federal Open Market...

  4. 78 FR 13673 - Federal Open Market Committee; Domestic Policy Directive of January 29-30, 2013

    Science.gov (United States)

    2013-02-28

    ... percent. The Committee directs the Desk to undertake open market operations as necessary to maintain such... FEDERAL RESERVE SYSTEM Federal Open Market Committee; Domestic Policy Directive of January 29-30... 271), there is set forth below the domestic policy directive issued by the Federal Open Market...

  5. 78 FR 22880 - Federal Open Market Committee; Domestic Policy Directive of March 19-20, 2013

    Science.gov (United States)

    2013-04-17

    ...\\ percent. The Committee directs the Desk to undertake open market operations as necessary to maintain such... FEDERAL RESERVE SYSTEM Federal Open Market Committee; Domestic Policy Directive of March 19-20... 271), there is set forth below the domestic policy directive issued by the Federal Open Market...

  6. 78 FR 43883 - Federal Open Market Committee; Domestic Policy Directive of June 18-19, 2013

    Science.gov (United States)

    2013-07-22

    ...\\ percent. The Committee directs the Desk to undertake open market operations as necessary to maintain such... FEDERAL RESERVE SYSTEM Federal Open Market Committee; Domestic Policy Directive of June 18-19... 271), there is set forth below the domestic policy directive issued by the Federal Open Market...

  7. 78 FR 33841 - Federal Open Market Committee; Domestic Policy Directive of April 30-May 1, 2013

    Science.gov (United States)

    2013-06-05

    ... from 0 to \\1/4\\ percent. The Committee directs the Desk to undertake open market operations as... FEDERAL RESERVE SYSTEM Federal Open Market Committee; Domestic Policy Directive of April 30-May 1... 271), there is set forth below the domestic policy directive issued by the Federal Open Market...

  8. Koncept polyfokálních sídel na příkladu vývoje obce Opařany na Táborsku

    Czech Academy of Sciences Publication Activity Database

    Dohnal, Martin

    2012-01-01

    Roč. 38, č. 2 (2012), s. 271-298 ISSN 0323-0988 R&D Projects: GA ČR(CZ) GAP410/11/1287 Keywords : urbanism * medieval settlement * Early Modern settlement * polyfocal settlement * 1400-1900 * Opařany (district of Tábor) Subject RIV: AC - Archeology, Anthropology, Ethnology

  9. Impact of elevated CO2 concentration on dynamics of leaf photosynthesis in Fagus sylvatica is modulated by sky conditions

    Czech Academy of Sciences Publication Activity Database

    Urban, Otmar; Klem, Karel; Holišová, Petra; Šigut, Ladislav; Šprtová, Miroslava; Teslová-Navrátilová, P.; Zitová, Martina; Špunda, Vladimír; Marek, Michal V.; Grace, J.

    2014-01-01

    Roč. 185, FEB 2014 (2014), s. 271-280 ISSN 0269-7491 R&D Projects: GA MŠk(CZ) LM2010007; GA ČR(CZ) GAP501/10/0340 Institutional support: RVO:67179843 Keywords : diurnal dynamics * DEPS * european beech * fluorescence * photorespiration * stomatal conductance * xanthophylls Subject RIV: GK - Forestry Impact factor: 4.143, year: 2014

  10. Characterisation of microsatellite loci in two species of lice, Polyplax serrata (Phthiraptera: Anoplura: Polyplacidae) and/nMyrsidea nesomimi (Phthiraptera: Amblycera: Menoponidae)

    Czech Academy of Sciences Publication Activity Database

    Martinů, Jana; Roubová, V.; Nováková, M.; Smith, V. S.; Hypša, Václav; Štefka, Jan

    2015-01-01

    Roč. 62, FEB 13 2015 (2015), 016 ISSN 1803-6465 R&D Projects: GA ČR GPP506/12/P529 Institutional support: RVO:60077344 Keywords : ectoparasite * population genetics * coevolution * Polypax * Myrsidea * evolution * Europe * Galapagos Subject RIV: EG - Zoology Impact factor: 1.271, year: 2015

  11. Marie Kovářová a výzkum tradičních svateb na Podblanicku

    Czech Academy of Sciences Publication Activity Database

    Petráňová, Lydia

    2010-01-01

    Roč. 50, č. 2 (2010), s. 271-284, 457 ISSN 0487-5648 Institutional research plan: CEZ:AV0Z90580513 Keywords : Podblanicko region * Benešov district * wedding rituals * wedding officers * wedding pastry Subject RIV: AC - Archeology, Anthropology, Ethnology

  12. 77 FR 47797 - Arkansas: Final Authorization of State Hazardous Waste Management Program Revisions

    Science.gov (United States)

    2012-08-10

    ... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R06-RCRA-2010-0307; FRL-9713-2] Arkansas: Final Authorization of State Hazardous Waste Management Program Revisions AGENCY: Environmental... authorization of the changes to its hazardous waste program under the Resource Conservation and Recovery Act...

  13. 76 FR 19004 - Oklahoma: Final Authorization of State Hazardous Waste Management Program Revisions

    Science.gov (United States)

    2011-04-06

    ... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R06-RCRA-2010-0307; FRL-9290-9] Oklahoma: Final Authorization of State Hazardous Waste Management Program Revisions AGENCY: Environmental... authorization of the changes to its hazardous waste program under the Resource Conservation and Recovery Act...

  14. 78 FR 32223 - Oklahoma: Final Authorization of State Hazardous Waste Management Program Revisions

    Science.gov (United States)

    2013-05-29

    ... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R06-RCRA-2012-0821; 9817-5] Oklahoma: Final Authorization of State Hazardous Waste Management Program Revisions AGENCY: Environmental Protection Agency (EPA... changes to its hazardous waste program under the Resource Conservation and Recovery Act (RCRA). EPA...

  15. 77 FR 38566 - Louisiana: Final Authorization of State Hazardous Waste Management Program Revisions

    Science.gov (United States)

    2012-06-28

    ... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA--R06-RCRA-2012-0367; FRL-9692-6] Louisiana: Final Authorization of State Hazardous Waste Management Program Revisions AGENCY: Environmental... authorization of the changes to its hazardous waste program under the Resource Conservation and Recovery Act...

  16. 78 FR 54200 - Virginia: Final Authorization of State Hazardous Waste Management Program Revisions

    Science.gov (United States)

    2013-09-03

    ... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R03-RCRA-2012-0294; FRL-9900-37-Region3] Virginia: Final Authorization of State Hazardous Waste Management Program Revisions AGENCY: Environmental... of revisions to its hazardous waste program under the Resource Conservation and Recovery Act (RCRA...

  17. 76 FR 37048 - Louisiana; Final Authorization of State Hazardous Waste Management Program Revisions

    Science.gov (United States)

    2011-06-24

    ... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R06-RCRA-2010-0307; FRL-9323-8] Louisiana; Final Authorization of State Hazardous Waste Management Program Revisions AGENCY: Environmental... authorization of the changes to its hazardous waste program under the Resource Conservation and Recovery Act...

  18. 77 FR 15343 - Oklahoma: Final Authorization of State Hazardous Waste Management Program Revisions

    Science.gov (United States)

    2012-03-15

    ... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R06-RCRA-2012-0054; FRL-9647-8] Oklahoma: Final Authorization of State Hazardous Waste Management Program Revisions AGENCY: Environmental... authorization of the changes to its hazardous waste program under the Resource Conservation and Recovery Act...

  19. Long-range pseudorapidity dihadron correlations in d plus Au collisions at root S-NN=200 GeV

    Czech Academy of Sciences Publication Activity Database

    Adamczyk, L.; Bielčík, J.; Bielčíková, Jana; Chaloupka, P.; Federič, Pavol; Rusňák, Jan; Rusňáková, O.; Šimko, Miroslav; Šumbera, Michal; Tlustý, David; Trzeciak, B. A.; Vértési, Robert

    2015-01-01

    Roč. 747, JUL (2015), s. 265-271 ISSN 0370-2693 R&D Projects: GA ČR GA13-20841S Institutional support: RVO:61389005 Keywords : STAR collaboration * heavy ion collisions * time projection chamber Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 4.787, year: 2015

  20. Macroparasites and their communities of the European eel Anguilla anguilla (Linnaeus) in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Scholz, Tomáš

    2015-01-01

    Roč. 62, JUN 30 2015 (2015), 033 ISSN 1803-6465 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Central Europe * Danube River basin * Elbe River basin * Oder River basin * fish * host specificity * parasite fauna * species diversity Subject RIV: EG - Zoology Impact factor: 1.271, year: 2015

  1. Measurement of the cosmic background radiation temperature at 6.3 cm

    International Nuclear Information System (INIS)

    Mandolesi, N.; Calzolari, P.; Cortiglioni, S.; Morigi, G.

    1984-01-01

    We present results of a measurement of the cosmic background radiation temperature at a wavelength of 6.3 cm. We obtained the value T/sub CBR/ = 2.71 +- 0.20 K. This is in good agreement with, and has a smaller error than, any previous measurement at equal or longer wavelengths

  2. Dicty_cDB: Contig-U13954-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 281 e-109 EU080331_1( EU080331 |pid:none) Phytophthora cuyabensis isolate PD... 294 e-109 EU079512_1( EU0795...D_0... 273 e-102 EU080357_1( EU080357 |pid:none) Phytophthora cuyabensis isolate PD... 271 e-102 CP000090_28

  3. Effect of a N, N’-disubstituted phenylenediamine stabilizer and SB/EPDM compatibilizer on toughness and morphology of blends of pre-aged polyethylene with high-impact polystyrene

    Czech Academy of Sciences Publication Activity Database

    Michálková, Danuše; Pospíšil, Jan; Fortelný, Ivan; Šlouf, Miroslav; Kruliš, Zdeněk

    2006-01-01

    Roč. 12, č. 22 (2006), s. 58-65 ISSN 0193-7197 R&D Projects: GA AV ČR IBS4050008 Institutional research plan: CEZ:AV0Z40500505 Keywords : recycling * compatibilization * stabilization Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.271, year: 2005

  4. Capillary electrochromatography of proteins and peptides (2006–2015)

    Czech Academy of Sciences Publication Activity Database

    Mikšík, Ivan

    2017-01-01

    Roč. 40, č. 1 (2017), s. 251-271 ISSN 1615-9306 R&D Projects: GA ČR(CZ) GA15-01948S Institutional support: RVO:67985823 Keywords : capillary electrochromatography * peptides * proteins Subject RIV: CB - Analytical Chemistry, Separation OBOR OECD: Analytical chemistry Impact factor: 2.557, year: 2016

  5. A prospective study of the impact of genetic susceptibility testing for BRCA1/2 or HNPCC on family relationships

    NARCIS (Netherlands)

    van Oostrom, Iris; Meijers-Heijboer, Hanne; Duivenvoorden, Hugo J.; Brocker-Vriends, Annette H. J. T.; van Asperen, Chhstl J.; Sijmons, Rolf H.; Seynaeve, Caroline; Van Gool, Arthur R.; Klijn, Jan G. M.; Riedijk, Samantha R.; van Dooren, Silvia; Tibben, Aad

    This study assessed the impact of genetic testing for cancer susceptibility on family relationships and determinants of adverse consequences for family relationships. Applicants for genetic testing of a known familial pathogenic mutation in BRCA1/2 or a HNPCC related gene (N = 271) rated the

  6. A prospective study of the impact of genetic susceptibility testing for BRCA1/2 or HNPCC on family relationships

    NARCIS (Netherlands)

    van Oostrom, Iris; Meijers-Heijboer, Hanne; Duivenvoorden, Hugo J.; Bröcker-Vriends, Annette H. J. T.; van Asperen, Christi J.; Sijmons, Rolf H.; Seynaeve, Caroline; van Gool, Arthur R.; Klijn, Jan G. M.; Riedijk, Samantha R.; van Dooren, Silvia; Tibben, Aad

    2007-01-01

    This study assessed the impact of genetic testing for cancer susceptibility on family relationships and determinants of adverse consequences for family relationships. Applicants for genetic testing of a known familial pathogenic mutation in BRCA1/2 or a HNPCC related gene (N=271) rated the

  7. A prospective study of the impact of genetic susceptibility testing for BRCA1/2 or HNPCC on family relationships.

    NARCIS (Netherlands)

    Oostrom, I.I.H. van; Meijers-Heijboer, H.; Duivenvoorden, H.J.; Brocker-Vriends, A.H.; Asperen, C.J. van; Sijmons, R.H.; Seynaeve, C.; Gool, A.R. van; Klijn, J.G.M.; Riedijk, S.R.; Dooren, S. van; Tibben, A.

    2007-01-01

    This study assessed the impact of genetic testing for cancer susceptibility on family relationships and determinants of adverse consequences for family relationships. Applicants for genetic testing of a known familial pathogenic mutation in BRCA1/2 or a HNPCC related gene (N=271) rated the

  8. 48 CFR 1371.113 - Department of Labor occupational safety and health standards for ship repair.

    Science.gov (United States)

    2010-10-01

    ... occupational safety and health standards for ship repair. 1371.113 Section 1371.113 Federal Acquisition... CONSTRUCTION AND SHIP REPAIR Provisions and Clauses 1371.113 Department of Labor occupational safety and health standards for ship repair. Insert clause 1352.271-82, Department of Labor Occupational Safety and Health...

  9. Viet Nam. Grade Six, Unit One. 6.1. Comprehensive Social Studies Curriculum for the Inner City.

    Science.gov (United States)

    Thompson, Fred

    This sixth grade unit is one of a sequential learning series of the Focus On Inner City Social Studies (FICSS) project developed in accordance with the needs and problems of an urban society. A description of the project is provided in SO 008 271. The units are designed to help students investigate the conditions under which people in other…

  10. 77 FR 67633 - North Pacific Fishery Management Council; Public Meetings

    Science.gov (United States)

    2012-11-13

    ... subsistence) NOAA Enforcement Report United States Coast Guard (USCG) Report (including Aleutian Island Risk Assessment) United State Fish & Wildlife (USFWL) Report International Pacific Halibut Commission (IPHC... sign language interpretation or other auxiliary aids should be directed to Gail Bendixen at (907) 271...

  11. Participants in School-Sponsored and Independent Sports: Perceptions of Self and Family.

    Science.gov (United States)

    Browne, Beverly A.; Francis, Sally K.

    1993-01-01

    Examined perceptions of social competence and family dynamics among adolescent participants in school-sponsored and independent sports (baseball and skateboarding). Findings from 271 adolescents revealed that perceptions of social competence were differentially related to degree of sports involvement and perceived skill but were not related to…

  12. Comparative Ultrastructure of Langerhans-Like Cells in Spleens of Ray-Finned Fishes (Actinopterygii)

    Czech Academy of Sciences Publication Activity Database

    Lovy, J.; Wright, G. M.; Speare, D. J.; Tyml, Tomáš; Dyková, Iva

    2010-01-01

    Roč. 271, č. 10 (2010), s. 1229-1239 ISSN 0362-2525 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : fish * cyprinidae * halibut * dendritic cells * Langerhans cell * Birbeck granules * ultrastructure Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.773, year: 2010

  13. Automated analysis of aircraft configurations for safe separation enabled by quantitative grading of results; presentation

    CSIR Research Space (South Africa)

    Jamison, Kevin

    2012-09-01

    Full Text Available perturbations of: • store mass and physical properties • ejector rack performance • aircraft release flight conditions • stations on aircraft • neighbouring stores – MIL-HDBK 1763: 271.4 – Results in a very large analysis matrix! From: Tutty, M...

  14. IN SEARCH OF THE ORIGINAL TEXT IN MARK 9:38

    African Journals Online (AJOL)

    “Teacher, we saw someone in your name driving out demons and we tried .... Luke.” Maybe Lagrange and Taylor and Cranfield deserve more attention. 5. ..... Justin). In the Revue Biblique (Hendriks 2007:266-271) I divided Mark 8:26 into five ...

  15. Geology and Re-Os molybdenite geochronology of the Kurišková U-Mo deposit (Western Carpathians, Slovakia)

    Czech Academy of Sciences Publication Activity Database

    Kohút, M.; Trubač, J.; Novotný, L.; Ackerman, Lukáš; Demko, R.; Bartalský, B.; Erban, V.

    2013-01-01

    Roč. 58, č. 3 (2013), s. 271-282 ISSN 1802-6222 R&D Projects: GA ČR GA13-15390S Institutional support: RVO:67985831 Keywords : U–Mo ore deposit * Re–Os * molybdenite geochronology * genetic model * Gemeric Unit * Western Carpathians Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.744, year: 2013

  16. Racial Differences in Attitudes toward Aging, Aging Knowledge, and Contact

    Science.gov (United States)

    Intrieri, Robert C.; Kurth, Maria L.

    2018-01-01

    The present study assessed knowledge of aging, attitudes toward aging, ageism, and contact with older adults in a sample of 271 Non-Hispanic White and African-American undergraduates. Research examining racial differences in knowledge of aging, attitudes toward aging, ageism, and contact with older adults has been sparse. Results for the current…

  17. Acidic and Catalytic Properties of Mo-MCM-22 in Methane Aromatization: An FTIR Study

    Czech Academy of Sciences Publication Activity Database

    Sobalík, Zdeněk; Tvarůžková, Zdenka; Wichterlová, Blanka; Fíla, V.; Špatenka, Š.

    2003-01-01

    Roč. 253, - (2003), s. 271-282 ISSN 0926-860X R&D Projects: GA ČR GA104/99/0432 Institutional research plan: CEZ:AV0Z4040901 Keywords : methane aromatization * FTIR technique * MCM-22 Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.825, year: 2003

  18. THE EFFECTS OF RARE EARTHS ON ACTIVITY AND SURFACE ...

    African Journals Online (AJOL)

    and the key step in H2 production by reforming of hydrocarbons for fuel cells. ... iron-chromium WGSR catalysts do not work well at low steam-to-gas ratios and ... The rate of hydrogen consumption was measured by a TCD. .... 2003, 215,. 271.

  19. Occurrence of the amphibian pathogen Batrachochytrium dendrobatidis in the Pacific Northwest.

    Science.gov (United States)

    C.A. Pearl; E.L. Bull; D.E. Green; J. Bowerman; M.J. Adams; A. Hyatt; W.H. Wente

    2007-01-01

    Chytridiomycosis (infection by the fungus Batrachochytrium dendrobatidis) is an emerging pathogen of amphibians that is associated with declines in at least four continents. We report results of disease screens from 271 field-sampled amphibians from Oregon and Washington. Chytridiomycosis was detected on 5 of 7 species and from 31 percent of all...

  20. A Biomathematical Model of the Restoring Effects of Caffeine on Cognitive Performance During Sleep Deprivation

    Science.gov (United States)

    2013-01-01

    Eddington, N.D., 2002. The rate of absorption and relative bioavailability of caffeine administered in chewing gum versus capsules to normal healthy...S., Dagan, Y., Shenkman, L., 2002. The effects of coffee consumption on sleep and melatonin secretion. Sleep Med. 3, 271–273. Syed, S.A., Kamimori

  1. Invaze netýkavky žláznaté v České republice

    Czech Academy of Sciences Publication Activity Database

    Skálová, Hana; Čuda, Jan

    2014-01-01

    Roč. 62, č. 2 (2014), s. 271-273 ISSN 0044-4812 R&D Projects: GA ČR GA206/07/0668 Institutional support: RVO:67985939 Keywords : plant species biology * reproduction * growth Subject RIV: EF - Botanics

  2. Stesys software for computer-assisted stereology

    Czech Academy of Sciences Publication Activity Database

    Karen, Petr; Kubínová, Lucie; Krekule, Ivan

    1998-01-01

    Roč. 47, č. 4 (1998), s. 271-278 ISSN 0862-8408 R&D Projects: GA ČR GA304/97/0420; GA AV ČR IAA5011504; GA AV ČR IAA5011810 Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.616, year: 1998

  3. AA, mating of BST magnet halves

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    The AA had 2 types of bending magnets: BLG (window-frame,long and narrow) and BST (H-type, short and wide). The BST had a steel length of 2.71 m, a "good field" width of 0.564 m, and a weight of about 75 t. Here we see the mating of two BST halves.

  4. Detection of αS2-casein variants in Chinese yak (Bos grunniens) by ...

    Indian Academy of Sciences (India)

    Lopez-Exposito I. and Recio I. 2008 Protective effect of milk pep- tides: antibacterial and antitumor properties. Adv. Exp. Med. Biol. 606, 271–293. McSweeney P. L. H. and Fox P. F. 2013 Advanced dairy chemistry, volume 1A: proteins: basic aspects, 4th edition. Springer Press,. New York, USA. Morgan P. E., Treweek T. M., ...

  5. Setting the stage for electron transfer: Molecular basis of ABTS-binding to four laccases from Trametes versicolor at variable pH and protein oxidation state

    DEFF Research Database (Denmark)

    Christensen, Niels Johan; Kepp, Kasper Planeta

    2014-01-01

    , very high (R2∼0.99) correlation was observed between logKm (ABTS) and binding-pocket charge due to sites 157, 161, 269, 271, and 333, i.e. laccases optimal for ABTS turnover have positively charged anchor points in their pockets. Our work also demonstrates how activity-constraints can markedly improve...

  6. Search Results | Page 28 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 439 ... The Alternative Water Systems Project seeks to develop a point-of-use safe ... simple sari cloth filtration and chlorine disinfection for the control of ... Both the social science literature and policymakers tend to take for ...

  7. 41 CFR 109-27.102-52 - Implementation.

    Science.gov (United States)

    2010-07-01

    ... contracting, and shall approve its implementation. In those instances where a cost benefit study has... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Implementation. 109-27...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-52 Implementation. (a) DOE OPMOs shall establish...

  8. Publications | Page 28 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 271 - 280 of 6389 ... Reducing poverty in Atlas Mountains. Wood is a scarce resource across North Africa, yet it is commonly used in rural areas as fuel for baking bread in traditional ovens. Rural households can burn through more than one tonne of firewood a year, threatening to deplete forests.

  9. Adoption of Integrated Pest Management among Cocoa Farmers in ...

    African Journals Online (AJOL)

    The determinants of adoption of IPM among cocoa farmers were investigated in Cross Rivers State, 271 trained cocoa farmers were systematically selected out of 2704 while in Osun State 107 were selected out of 1070. Structured questionnaire was used to obtain data on respondents' socio-economic characteristics, ...

  10. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Girish J Kotwal. Articles written in Journal of Biosciences. Volume 28 Issue 3 April 2003 pp 265-271 Articles. Vaccinia complement control protein: Multi-functional protein and a potential wonder drug · Purushottam Jha Girish J Kotwal · More Details Abstract Fulltext PDF. Vaccinia ...

  11. Reproducibility of [123I]PE2I binding to dopamine transporters with SPECT

    DEFF Research Database (Denmark)

    Ziebell, Morten; Thomsen, Gerda; Knudsen, Gitte M

    2007-01-01

    The iodinated cocaine derivative [(123)I]PE2I is a new selective ligand for in vivo studies of the dopamine transporter (DAT) with SPECT. Recently, a bolus/infusion (B/I) protocol for [(123)I]PE2I measurements of DAT density was established [Pinborg LH et al. J Nucl Med 2005;46:1119-271]. The aims...

  12. Zkoumání vlivu různého procentního plnění nanočásticemi na elektrické vlastnosti epoxidové pryskyřice

    Czech Academy of Sciences Publication Activity Database

    Hudec, Jiří; Neděla, Vilém; Polsterová, H.

    2015-01-01

    Roč. 60, č. 9 (2015), s. 268-271 ISSN 0447-6441 R&D Projects: GA ČR(CZ) GA14-22777S; GA MŠk ED0017/01/01; GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : epoxy resin * nanoparticles * oxides * spectral analysis * SEM Subject RIV: BH - Optics, Masers, Lasers

  13. synthesis, characterization and antibacterial studies of metal

    African Journals Online (AJOL)

    Preferred Customer

    Metal complexes of sulfadiazine with N-alkyl-N-phenyldithiocarbamate. Bull. Chem. Soc. Ethiop. 2013, 27(1). 81 character of the C−N bond, and this is responsible for the shift in the v(C−N) stretching vibrations. In dithiocarbamate complexes, the v(C−S) symmetrical and asymmetrical stretching vibrations are diagnostics of ...

  14. SAMJ

    African Journals Online (AJOL)

    admissions, with the most expensive 5% accounting for. 27.1 % of total variable ... value-for-money and cost-effectiveness being raised in both the private and the .... management and added doctor anXiety, but does not generate the same ...

  15. 7 CFR 3016.50 - Closeout.

    Science.gov (United States)

    2010-01-01

    ... are not limited to: (1) Final performance or progress report. (2) Financial Status Report (SF 269) or Outlay Report and Request for Reimbursement for Construction Programs (SF-271) (as applicable.) (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally...

  16. 45 CFR 92.50 - Closeout.

    Science.gov (United States)

    2010-10-01

    ... agencies may extend this timeframe. These may include but are not limited to: (1) Final performance or... Construction Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally-owned property report: In accordance with § 92.32(f), a...

  17. 36 CFR 1207.50 - Closeout.

    Science.gov (United States)

    2010-07-01

    ... limited to: (1) Final performance or progress report. (2) Financial Status Report (SF 269) or Outlay Report and Request for Reimbursement for Construction Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally...

  18. 32 CFR 33.50 - Closeout.

    Science.gov (United States)

    2010-07-01

    ..., Federal agencies may extend this timeframe. These may include but are not limited to: (1) Final... Reimbursement for Construction Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally-owned property report: In accordance...

  19. 38 CFR 43.50 - Closeout.

    Science.gov (United States)

    2010-07-01

    ..., Federal agencies may extend this timeframe. These may include but are not limited to: (1) Final... Reimbursement for Construction Programs (SF-271) (as applicable.) (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally-owned property report: In accordance...

  20. 29 CFR 97.50 - Closeout.

    Science.gov (United States)

    2010-07-01

    ... limited to: (1) Final performance or progress report. (2) Financial Status Report (SF 269) or Outlay Report and Request for Reimbursement for Construction Programs (SF-271) (as applicable.) (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally...