WorldWideScience

Sample records for hassium 269

  1. 7 CFR 1822.269 - Security.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 12 2010-01-01 2010-01-01 false Security. 1822.269 Section 1822.269 Agriculture..., Procedures, and Authorizations § 1822.269 Security. Each loan will be secured by a mortgage on the property purchased or improved with the loan, and a security interest in the funds held by the corporation in trust...

  2. 21 CFR 26.9 - Equivalence determination.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Equivalence determination. 26.9 Section 26.9 Food... Specific Sector Provisions for Pharmaceutical Good Manufacturing Practices § 26.9 Equivalence determination... document insufficient evidence of equivalence, lack of opportunity to assess equivalence or a determination...

  3. 12 CFR 269b.731 - Signature.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Signature. 269b.731 Section 269b.731 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM CHARGES OF UNFAIR LABOR PRACTICES General Rules § 269b.731 Signature. The original of each document filed shall be...

  4. 25 CFR 700.269 - Accounting for disclosures.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false Accounting for disclosures. 700.269 Section 700.269... Privacy Act § 700.269 Accounting for disclosures. (a) Maintenance of an accounting. (1) Where a record is... person or agency to whom the disclosure was made. (3) Accountings prepared under this section shall be...

  5. 14 CFR 171.269 - Marker beacon performance requirements.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Marker beacon performance requirements. 171.269 Section 171.269 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... Landing System (ISMLS) § 171.269 Marker beacon performance requirements. ISMLS marker beacon equipment...

  6. 12 CFR 269.9 - Mediation of negotiation impasses.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Mediation of negotiation impasses. 269.9 Section 269.9 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM POLICY ON LABOR RELATIONS FOR THE FEDERAL RESERVE BANKS § 269.9 Mediation of negotiation...

  7. 27 CFR 28.269 - Certification by district director of customs.

    Science.gov (United States)

    2010-04-01

    ... director of customs. 28.269 Section 28.269 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX... Export § 28.269 Certification by district director of customs. (a) Exportation. When the district director of customs is satisfied that merchandise described on the application, notice, or claim, TTB Form...

  8. 29 CFR 500.269 - Stay pending decision of the Secretary.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Stay pending decision of the Secretary. 500.269 Section 500.269 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR... Vacation of Order of Administrative Law Judge § 500.269 Stay pending decision of the Secretary. (a) The...

  9. 26 CFR 1.269-7 - Relationship of section 269 to sections 382 and 383 after the Tax Reform Act of 1986.

    Science.gov (United States)

    2010-04-01

    ... the principal purpose of an acquisition is the evasion or avoidance of Federal income tax. [T.D. 8388... 383 after the Tax Reform Act of 1986. 1.269-7 Section 1.269-7 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Items Not Deductible...

  10. 32 CFR 269.3 - Civil monetary penalty inflation adjustment.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Civil monetary penalty inflation adjustment. 269... DEFENSE (CONTINUED) MISCELLANEOUS CIVIL MONETARY PENALTY INFLATION ADJUSTMENT § 269.3 Civil monetary penalty inflation adjustment. The Department shall, not later than 180 days after the enactment of the...

  11. 12 CFR 269.1 - Definition of a labor organization.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Definition of a labor organization. 269.1... RESERVE SYSTEM POLICY ON LABOR RELATIONS FOR THE FEDERAL RESERVE BANKS § 269.1 Definition of a labor... to the terms or conditions of membership because of race, color, sex, creed, age or national origin. ...

  12. 26 CFR 1.269-5 - Time of acquisition of control.

    Science.gov (United States)

    2010-04-01

    ... no earlier with the principal purpose of evasion or avoidance of Federal income tax is made by... 1.269-5 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Items Not Deductible § 1.269-5 Time of acquisition of control. (a) In general. For...

  13. The Cryo-Thermochromatographic Separator (CTS) A new rapid separation and alpha-detection system for on-line chemical studies of highly volatile osmium and hassium (Z=108) tetroxides

    CERN Document Server

    Kirbach, U W; Gregorich, K E; Lee, D M; Ninov, V; Omtvedt, J P; Patin, J B; Seward, N K; Strellis, D A; Sudowe, R; Türler, A; Wilk, P A; Zielinski, P M; Hoffman, D C; Nitsche, H

    2002-01-01

    The Cryo-Thermochromatographic Separator (CTS) was designed and constructed for rapid, continuous on-line separation and simultaneous detection of highly volatile compounds of short-lived alpha-decaying isotopes of osmium and hassium (Hs, Z=108). A flowing carrier gas containing the volatile species is passed through a channel formed by two facing rows of 32 alpha-particle detectors, cooled to form a temperature gradient extending from 247 K at the channel entrance down to 176 K at the exit. The volatile species adsorb onto the SiO sub 2 -coated detector surfaces at a characteristic deposition temperature and are identified by their observed alpha-decay energies. The CTS was tested on-line with OsO sub 4 prepared from sup 1 sup 6 sup 9 sup - sup 1 sup 7 sup 3 Os isotopes produced in sup 1 sup 1 sup 8 sup , sup 1 sup 2 sup 0 Sn( sup 5 sup 6 Fe, 3,4,5n) reactions. An adsorption enthalpy for OsO sub 4 of -40.2+-1.5 kJ/mol on SiO sub 2 was deduced by comparing the measured deposition distribution with Monte Carlo...

  14. New clues to the evolutionary history of the main European paternal lineage M269

    DEFF Research Database (Denmark)

    Valverde, Laura; Illescas, Maria José; Villaescusa, Patricia

    2016-01-01

    The dissection of S116 in more than 1500 individuals from Atlantic Europe and the Iberian Peninsula has provided important clues about the controversial evolutionary history of M269. First, the results do not point to an origin of M269 in the Franco-Cantabrian refuge, owing to the lack of subline...... European peopling, as has been the case for the place of origin of M269.European Journal of Human Genetics advance online publication, 17 June 2015; doi:10.1038/ejhg.2015.114....

  15. 26 CFR 1.269B-1 - Stapled foreign corporations.

    Science.gov (United States)

    2010-04-01

    ... avoidance of U.S. income tax. A stapling of interests may have a principal purpose of tax avoidance even though the tax avoidance purpose is outweighed by other purposes when taken together. (3) Example. The....269B-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX...

  16. Significant Revisions to OSHA 29 CFR 1910.269.

    Science.gov (United States)

    Neitzel, Dennis K

    2015-06-01

    The updated OSHA 29 CFR 1910.269 requirements are significant for assisting employers in their efforts to protect their employees from electrical hazards. In addition, OSHA based these revisions on the latest consensus standards and improvements in electrical safety technology. Together, the updated regulation creates a unified and up-to-date set of requirements to help employers more effectively establish safe work practices to protect their workers.

  17. 40 CFR 761.269 - Sampling liquid PCB remediation waste.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Sampling liquid PCB remediation waste..., AND USE PROHIBITIONS Cleanup Site Characterization Sampling for PCB Remediation Waste in Accordance with § 761.61(a)(2) § 761.269 Sampling liquid PCB remediation waste. (a) If the liquid is single phase...

  18. Shock wave treatment in medicine; J. Biosci. 30 269–275

    Indian Academy of Sciences (India)

    Unknown

    269. Keywords. Acoustical energy; electromagnetic field; piezoelectric effect; shock wave ... life without being noticed. The sound of ... A typical pressure profile of a shock wave in the focus of an ... shock waves create low side effects on the way through muscles, fat- ... luation of the ESWT for orthopedic diseases many clini-.

  19. 32 CFR 269.4 - Cost of living adjustments of civil monetary penalties.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Cost of living adjustments of civil monetary... DEFENSE (CONTINUED) MISCELLANEOUS CIVIL MONETARY PENALTY INFLATION ADJUSTMENT § 269.4 Cost of living... increasing the maximum civil monetary penalty for each civil monetary penalty by the cost-of-living...

  20. The synthesis of the deformed superheavy elements 107 to 111

    International Nuclear Information System (INIS)

    Armbuster, P.

    1995-01-01

    By inflight separation, implantation into Si-detector arrays, and correlation analysis of subsequent α-decay chains many isotopes were discovered at GSI since 1980, among others the elements Nielsbohriurn, Hassium and Meitnerium. The sensitivity of the method allows to identify an element by one decay chain, as we demonstrated for the case of 266 Mt. After a break of our work during the time when the new accelerator system SIS-FRS-ESR was installed (1989-1993) at GSI, and many improvements of our system EZR-UNILAC-SHIP accomplished, we restarted element synthesis in 1994. The synthesis of the isotopes 269 110, 271 110, and 272 111 of the new elements Z--110 and Z=l11 was a first success at the end of 1994. This discovery is in the center of this presentation. The reaction mechanism, a one-step, cold and compact rearrangement process at a level of some 10 -36 cm 2 is discussed. Cross sections and excitation functions systematically studied allow to extrapolate to the next element Z=112, which seems not to be out of reach

  1. Decay properties of nuclei close to Z = 108 and N = 162

    International Nuclear Information System (INIS)

    Dvorak, Jan

    2007-01-01

    The goal of the research conducted in the frame of this thesis was to investigate the decay properties of the nuclides 269-271 Hs and their daughters using an improved chemical separation and detection system. Shell stabilization was predicted in the region around Z=108 and N=162 in calculations, taking into account possible higher orders of deformations of the nuclei. The nucleus 270 Hs with a closed proton and a closed neutron deformed shell, was predicted to be ''deformed doubly magic''. Nuclei around 270 Hs can be produced only via fusion reactions at picobarn levels, resulting in a production rates of few atoms per day. Investigating short-lived nuclei using rapid chemical separation and subsequent on-line detection methods provides an independent and alternative means to electromagnetic on-line separators. Chemical separation of Hs in the form of HsO 4 provides an excellent tool to study the formation reactions and nuclear structure in this region of the chart of nuclides due to a high overall efficiency and a very high purification factor. The goal was accomplished, as element 108, hassium, was produced in the reaction 248 Cm( 26 Mg,xn) 274-x Hs and chemically isolated. After gas phase separation of HsO 4 , 26 genetically linked decay chains have been observed. These were attributed to decays of three different Hs isotopes produced in the 3-5n evaporation channels. The known decay chain of 269 Hs, the 5n evaporation product, serves as an anchor point, thus allowing the unambiguous assignment of the observed decay chains to the 5n, 4n, and 3n channels, respectively. Decay properties of five nuclei have been unambiguously established for the first time, including the one for the the doubly-magic nuclide 270 Hs. This hassium isotope is the next doubly magic nucleus after the well known 208 Pb and the first experimentally observed even-even nucleus on the predicted N=162 neutron shell. The observed decay properties provide strong indications for enhanced nuclear

  2. Nuclei of dwarf spheroidal galaxies KKs 3 and ESO 269-66 and their counterparts in our Galaxy

    Science.gov (United States)

    Sharina, M. E.; Shimansky, V. V.; Kniazev, A. Y.

    2017-10-01

    We present the analysis of medium-resolution spectra obtained at the Southern African Large Telescope for nuclear globular clusters (GCs) in two dwarf spheroidal galaxies (dSphs). The galaxies have similar star formation histories, but they are situated in completely different environments. ESO 269-66 is a close neighbour of the giant S0 NGC 5128. KKs 3 is one of the few truly isolated dSphs within 10 Mpc. We estimate the helium abundance Y = 0.3, age = 12.6 ± 1 Gyr, [Fe/H] = -1.5, -1.55 ± 0.2 dex, and abundances of C, N, Mg, Ca, Ti, and Cr for the nuclei of ESO 269-66 and KKs 3. Our surface photometry results using Hubble Space Telescope images yield the half-light radius of the cluster in KKs 3, rh = 4.8 ± 0.2 pc. We demonstrate the similarities of medium-resolution spectra, ages, chemical compositions, and structure for GCs in ESO 269-66 and KKs 3 and for several massive Galactic GCs with [Fe/H] ∼ -1.6 dex. All Galactic GCs posses Extended Blue Horizontal Branches and multiple stellar populations. Five of the selected Galactic objects are iron-complex GCs. Our results indicate that the sample GCs observed now in different environments had similar conditions of their formation ∼1 Gyr after the Big Bang.

  3. Decay properties of nuclei close to Z = 108 and N = 162

    Energy Technology Data Exchange (ETDEWEB)

    Dvorak, Jan

    2007-07-12

    The goal of the research conducted in the frame of this thesis was to investigate the decay properties of the nuclides {sup 269-271}Hs and their daughters using an improved chemical separation and detection system. Shell stabilization was predicted in the region around Z=108 and N=162 in calculations, taking into account possible higher orders of deformations of the nuclei. The nucleus {sup 270}Hs with a closed proton and a closed neutron deformed shell, was predicted to be ''deformed doubly magic''. Nuclei around {sup 270}Hs can be produced only via fusion reactions at picobarn levels, resulting in a production rates of few atoms per day. Investigating short-lived nuclei using rapid chemical separation and subsequent on-line detection methods provides an independent and alternative means to electromagnetic on-line separators. Chemical separation of Hs in the form of HsO{sub 4} provides an excellent tool to study the formation reactions and nuclear structure in this region of the chart of nuclides due to a high overall efficiency and a very high purification factor. The goal was accomplished, as element 108, hassium, was produced in the reaction {sup 248}Cm({sup 26}Mg,xn){sup 274-x}Hs and chemically isolated. After gas phase separation of HsO{sub 4}, 26 genetically linked decay chains have been observed. These were attributed to decays of three different Hs isotopes produced in the 3-5n evaporation channels. The known decay chain of {sup 269}Hs, the 5n evaporation product, serves as an anchor point, thus allowing the unambiguous assignment of the observed decay chains to the 5n, 4n, and 3n channels, respectively. Decay properties of five nuclei have been unambiguously established for the first time, including the one for the the doubly-magic nuclide {sup 270}Hs. This hassium isotope is the next doubly magic nucleus after the well known {sup 208}Pb and the first experimentally observed even-even nucleus on the predicted N=162 neutron shell. The

  4. α-decay chains and cluster-decays of superheavy 269-27110 nuclei

    International Nuclear Information System (INIS)

    Sushil Kumar; Rajesh Kumar; Balasubramaniam, M.; Gupta, Raj K.

    2001-01-01

    Due to the availability of radioactive nuclear beams (RNB) and the advancement in accelerator technology, it is now possible to synthesize very heavy elements (Z> 100), called superheavy elements. It is a well established fact that these superheavy elements, due to their shorter lifetime, decay via successive alpha emissions and at a later stage undergo spontaneous fission. Several such decay chains are now observed. An attempt is made to fit all such known decay chains and the results of the three observed α-decay chains of Z=110 ( 269-271 10) nuclei are presented. The model used is the preformed cluster model (PCM). Also, an attempt is made for the first time to find the possibility of any branching to heavy-cluster emissions in these chains

  5. 26 CFR 1.269-4 - Power of district director to allocate deduction, credit, or allowance in part.

    Science.gov (United States)

    2010-04-01

    ... evasion or avoidance of Federal income tax for which the acquisition was made. The district director is..., DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Items Not Deductible § 1.269-4...(a), but only to such extent as he determines will not result in the evasion or avoidance of Federal...

  6. Evidence for the formation of sodium hassate(VIII)

    International Nuclear Information System (INIS)

    Zweidorf, A. von; Angert, R.; Bruechle, W.; Buerger, S.; Eberhardt, K.; Eichler, R.; Hummrich, H.; Jaeger, E.; Kling, H.O.; Kratz, J.V.; Kuczewski, B.; Langrock, G.; Mendel, M.; Rieth, U.; Schaedel, M.; Schausten, B.; Schimpf, E.; Thoerle, P.; Trautmann, N.; Tsukada, K.; Wiehl, N.; Wirth, G.

    2004-01-01

    Hassium, element 108, was produced in the fusion reaction between 26 Mg and 248 Cm. The hassium recoils were oxidized in-situ to a highly volatile oxide, presumably HsO 4 , and were transported in a mixture of He and O 2 to a deposition and detection system. The latter consisted of 16 silicon PIN-photodiodes facing a layer of NaOH, which served, in the presence of a certain partial pressure of water in the transport gas, as reactive surface for the deposition of the volatile tetroxides. Six correlated α-decay chains of Hs were detected in the first 5 detectors centred around detection position 3. In analogy to OsO 4 , which forms Na 2 [OsO 4 (OH) 2 ], an osmate(VIII), with aqueous NaOH, HsO 4 presumably was deposited as Na 2 [HsO 4 (OH) 2 ], a hassate(VIII). (orig.)

  7. Cytogenetics of Premature Ovarian Failure: An Investigation on 269 Affected Women

    Directory of Open Access Journals (Sweden)

    Simona Baronchelli

    2011-01-01

    Full Text Available The importance of X chromosome in the aetiology of premature ovarian failure (POF is well-known but in many cases POF still remains idiopathic. Chromosome aneuploidy increase is a physiological phenomenon related to aging, but the role of low-level sex chromosome mosaicism in ovarian function is still undiscovered. Standard cytogenetic analysis was carried out in a total of 269 patients affected by POF: 27 chromosomal abnormalities were identified, including X chromosome and autosomal structural and numerical abnormalities. In 47 patients with 46,XX karyotype we performed interphase FISH using X alpha-satellite probe in order to identify X chromosome mosaicism rate. Aneuploidy rate in the patient group was significantly higher than the general population group. These findings underline the importance of X chromosome in the aetiology of POF and highlight the potential role of low-level sex chromosome mosaicism in ovarian aging that may lead to a premature onset of menopause.

  8. Nuclei of dwarf spheroidal galaxies KKs3 and ESO269-66 and their counterparts in our Galaxy

    OpenAIRE

    Sharina, M. E.; Shimansky, V. V.; Kniazev, A. Y.

    2017-01-01

    We present the analysis of medium-resolution spectra obtained at the Southern African Large Telescope (SALT) for nuclear globular clusters (GCs) in two dwarf spheroidal galaxies (dSphs). The galaxies have similar star formation histories, but they are situated in completely different environments. ESO269-66 is a close neighbour of the giant S0 NGC5128. KKs3 is one of the few truly isolated dSphs within 10 Mpc. We estimate the helium abundance $Y=0.3$, $\\rm age=12.6\\pm1$ Gyr, $[Fe/H]=-1.5,-1.5...

  9. 17 CFR 269.5 - Form F-X, for appointment of agent for service of process by issuers registering securities on...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form F-X, for appointment of agent for service of process by issuers registering securities on Form F-8, F-9, F-10 or F-80 (§§ 239... INDENTURE ACT OF 1939 § 269.5 Form F-X, for appointment of agent for service of process by issuers...

  10. Inhibition of class IIa histone deacetylase activity by gallic acid, sulforaphane, TMP269, and panobinostat.

    Science.gov (United States)

    Choi, Sin Young; Kee, Hae Jin; Jin, Li; Ryu, Yuhee; Sun, Simei; Kim, Gwi Ran; Jeong, Myung Ho

    2018-05-01

    Histone deacetylase (HDAC) inhibitors are gaining increasing attention as potential therapeutics for cardiovascular diseases as well as cancer. We recently reported that the class II HDAC inhibitor, MC1568, and the phytochemical, gallic acid, lowered high blood pressure in mouse models of hypertension. We hypothesized that class II HDACs may be involved in the regulation of hypertension. The aim of this study was to determine and compare the effects of well-known HDAC inhibitors (TMP269, panobinostat, and MC1568), phytochemicals (gallic acid, sulforaphane, and piceatannol), and anti-hypertensive drugs (losartan, carvedilol, and furosemide) on activities of class IIa HDACs (HDAC4, 5, 7, and 9). The selective class IIa HDAC inhibitor, TMP269, and the pan-HDAC inhibitor, panobinostat, but not MC1568, clearly inhibited class IIa HDAC activities. Among the three phytochemicals, gallic acid showed remarkable inhibition, whereas sulforaphane presented mild inhibition of class IIa HDACs. Piceatannol inhibited only HDAC7 activity. As expected, the anti-hypertensive drugs losartan, carvedilol, and furosemide did not affect the activity of any class IIa HDAC. In addition, we evaluated the inhibitory effect of several compounds on the activity of class l HDACs (HDAC1, 2, 3, and 8) and class IIb HDAC (HDAC6). MC1568 did not affect the activities of HDAC1, HDAC2, and HDAC3, but it reduced the activity of HDAC8 at concentrations of 1 and 10 μM. Gallic acid weakly inhibited HDAC1 and HDAC6 activities, but strongly inhibited HDAC8 activity with effectiveness comparable to that of trichostatin A. Inhibition of HDAC2 activity by sulforaphane was stronger than that by piceatnnaol. These results indicated that gallic acid is a powerful dietary inhibitor of HDAC8 and class IIa/b HDAC activities. Sulforaphane may also be used as a dietary inhibitor of HDAC2 and class IIa HDAC. Our findings suggest that the class II HDAC inhibitor, MC1568, does not inhibit class IIa HDAC, but inhibits

  11. Infrared studies of H II regions: the Sharpless regions S148, 184, 198, 206 and 269

    International Nuclear Information System (INIS)

    Pismis, Paris

    1991-01-01

    We present the results of a combined near-infrared and IRAS mapping study of five H II regions for which fairly complete information at optical and radio wavelengths previously existed. The near-infrared observations, carried out with the 2.1-m telescope at Observatorio de San Pedro Martir (Mexico), allowed us to study the the stellar content at the core of each nebula, while an analysis of extended near-infrared emission zones showed these to arise mainly from ionized gas (S148 and S206) or through scattering and thermal emission from dust grains surrounding a massive young star (S269-IRS2). The analysis of IRAS data, on the other hand, suggests that two different populations of grains contribute to the observed 12- to 100-μm fluxes. (author)

  12. Molecular basis of adult-onset and chronic GM2 gangliosidoses in patients of Ashkenazi Jewish origin: Substitution of serine for glycine at position 269 of the α-subunit of β-hexosaminidase

    International Nuclear Information System (INIS)

    Paw, B.H.; Kaback, M.M.; Neufeld, E.F.

    1989-01-01

    Chronic and adult-onset G M2 gangliosidoses are neurological disorders caused by marked deficiency of the A isoenzyme of β-hexosaminidase; they occur in the Ashkenazi Jewish population, though less frequently than classic (infantile) Tay-Sachs disease. Earlier biosynthetic studies had identified a defective α-subunit that failed to associate with the β-subunit. The authors have now found a guanosine to adenosine transition at the 3' end of exon 7, which causes substitution of serine for glycine at position 269 of the α-subunit. An RNase protection assay was used to localize the mutation to a segment of mRNA from fibroblasts of a patient with the adult-onset disorder. That segment of mRNA (after reverse transcription) and a corresponding segment of genomic DNA were amplified by the polymerase chain reaction and sequenced by the dideoxy method. The sequence analysis, together with an assay based on the loss of a ScrFI restriction site, showed that the patient was a compound heterozygote who had inherited the 269 (Gly → Ser) mutation from his father and an allelic null mutation from his mother. The 269 (Gly → Ser) mutation, in compound heterozygosity with a presumed null allele, was also found in fetal fibroblasts with an association-defective phenotype and in cells from five patients with chronic G M2 gangliosidosis

  13. Alteraciones de la mucosa bucal causadas por la asociación entre el tabaco y los colutorios bucales con una concentración de alcohol del 26,9 % Alterations of the oral mucous membrane caused by the association between tobacco and the mouthwashes with an alcohol concentration of 26.9 %

    Directory of Open Access Journals (Sweden)

    Anna Christina Medeiros Fossati

    2006-09-01

    Full Text Available Se analizaron el epitelio y la capa de queratina de la mucosa oral de 15 ratas que durante 45 días fueron sometidas a una aplicación tópica de picadura de tabaco y de colutorio bucal con una concentración de alcohol del 26,9 %. Tras ese período, se extrajeron las mucosas y se les realizó un análisis histológico. Se observó una significativa disminución del espesor del epitelio y de la capa de queratina, lo que indica que la picadura asociada con colutorios bucales con alta concentración de alcohol, provoca la reducción del espesor de la capa de queratina y del epitelio de la boca.The epithelium and the keratin layer of the oral mucous membrane of 15 rats that were subjected to a topical application of cut tobacco and mouthwashes with an alcohol concentration of 26.9 % during 45 days were analyzed. After that period, the oral mucous membranes were removed and a histological analysis was made. It was observed a significant decrease of the thickness of the epithelium and of the keratin layer, which shows that cut tobbaco associated with collutories with a high concentration of alcohol causes the reduction of the thickness of the keratin layer and of the mouth epithelium.

  14. Molecular basis of adult-onset and chronic G sub M2 gangliosidoses in patients of Ashkenazi Jewish origin: Substitution of serine for glycine at position 269 of the. alpha. -subunit of. beta. -hexosaminidase

    Energy Technology Data Exchange (ETDEWEB)

    Paw, B.H.; Kaback, M.M.; Neufeld, E.F. (Univ. of California, Los Angeles (USA))

    1989-04-01

    Chronic and adult-onset G{sub M2} gangliosidoses are neurological disorders caused by marked deficiency of the A isoenzyme of {beta}-hexosaminidase; they occur in the Ashkenazi Jewish population, though less frequently than classic (infantile) Tay-Sachs disease. Earlier biosynthetic studies had identified a defective {alpha}-subunit that failed to associate with the {beta}-subunit. The authors have now found a guanosine to adenosine transition at the 3{prime} end of exon 7, which causes substitution of serine for glycine at position 269 of the {alpha}-subunit. An RNase protection assay was used to localize the mutation to a segment of mRNA from fibroblasts of a patient with the adult-onset disorder. That segment of mRNA (after reverse transcription) and a corresponding segment of genomic DNA were amplified by the polymerase chain reaction and sequenced by the dideoxy method. The sequence analysis, together with an assay based on the loss of a ScrFI restriction site, showed that the patient was a compound heterozygote who had inherited the 269 (Gly {yields} Ser) mutation from his father and an allelic null mutation from his mother. The 269 (Gly {yields} Ser) mutation, in compound heterozygosity with a presumed null allele, was also found in fetal fibroblasts with an association-defective phenotype and in cells from five patients with chronic G{sub M2} gangliosidosis.

  15. Laparoscopic versus open incisional hernia repair: a retrospective cohort study with costs analysis on 269 patients.

    Science.gov (United States)

    Soliani, G; De Troia, A; Portinari, M; Targa, S; Carcoforo, P; Vasquez, G; Fisichella, P M; Feo, C V

    2017-08-01

    To compare clinical outcomes and institutional costs of elective laparoscopic and open incisional hernia mesh repairs and to identify independent predictors of prolonged operative time and hospital length of stay (LOS). Retrospective observational cohort study on 269 consecutive patients who underwent elective incisional hernia mesh repair, laparoscopic group (N = 94) and open group (N = 175), between May 2004 and July 2014. Operative time was shorter in the laparoscopic versus open group (p costs were lower (p = 0.02). At Cox regression analysis adjusted for potential confounders, large wall defect (W3) and higher operative risk (ASA score 3-4) were associated with prolonged operative time, while midline hernia site was associated with increased hospital LOS. Open surgical approach was associated with prolongation of both operative time and LOS. Laparoscopic approach may be considered safely to all patients for incisional hernia repair, regardless of patients' characteristics (age, gender, BMI, ASA score, comorbidities) and size of the wall defect (W2-3), with the advantage of shorter operating time and hospital LOS that yields reduced total institutional costs. Patients with higher ASA score and large hernia defects are at risk of prolonged operative time, while an open approach is associated with longer duration of surgical operation and hospital LOS.

  16. Remaining Sites Verification Package for the 100-F-26:9, 1607-F2 Sanitary Sewer Pipelines. Attachment to Waste Site Reclassification Form 2008-029

    International Nuclear Information System (INIS)

    Capron, J.M.

    2008-01-01

    The 100-F-26:9 underground pipeline subsite consists of the sanitary sewers servicing the 105-F, 108-F, 184-F, 185-F, and 190-F buildings, and the 1700-F administration and service buildings (1704-F, 1707-F, 1707-FA, 1713-F, 1717-F, 1719-F, and 1722-F). In accordance with this evaluation, the confirmatory and verification sampling results support a reclassification of this site to Interim Closed Out. The current site conditions achieve the remedial action objectives and the corresponding remedial action goals established in the Remaining Sites ROD. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River

  17. Alteraciones de la mucosa bucal causadas por la asociación entre el tabaco y los colutorios bucales con una concentración de alcohol del 26,9 %

    Directory of Open Access Journals (Sweden)

    Anna Christina Medeiros Fossati

    Full Text Available Se analizaron el epitelio y la capa de queratina de la mucosa oral de 15 ratas que durante 45 días fueron sometidas a una aplicación tópica de picadura de tabaco y de colutorio bucal con una concentración de alcohol del 26,9 %. Tras ese período, se extrajeron las mucosas y se les realizó un análisis histológico. Se observó una significativa disminución del espesor del epitelio y de la capa de queratina, lo que indica que la picadura asociada con colutorios bucales con alta concentración de alcohol, provoca la reducción del espesor de la capa de queratina y del epitelio de la boca.

  18. Development of a SISAK extraction system for chemical studies of element 108, hassium

    Energy Technology Data Exchange (ETDEWEB)

    Samadani, F.; Alstad, J.; Bjoernstad, T.; Stavsetra, L.; Omtvedt, J.P. [Oslo Univ. (Germany). Dept. of Chemistry

    2010-07-01

    A liquid-liquid extraction system suitable for studies of chemical properties of Hs (element 108), in the form of HsO{sub 4}, was developed using {gamma}-emitting isotopes of its homologue Os. The system is targeted for the fast on-line extraction system SISAK, which operates in a continuous manner and is suitable for liquid-phase studies of transactinide elements. The distribution of OsO{sub 4} between various dilute NaOH solutions and toluene was studied. Both batch and SISAK on-line experiments were performed to develop an appropriate system. From analysis of the extraction curves equilibrium constants for the formation of the presumed complexes, Na[OsO{sub 4}(OH)] and Na{sub 2}[OsO{sub 4}(OH){sub 2}], were obtained: K{sub 1} = (1 {+-} 0.5) x 10{sup 4} and K{sub 2} = 12 {+-} 8, respectively. The SISAK system includes a liquid-scintillation detection system for {alpha} measurements. Due to quenching effects it is not possible to perform direct measurement of the aqueous phase {alpha}'s. Therefore, a two-stage extraction method that provides an indirect measurement of the activity in the aqueous phase was developed as part of the proposed system for Hs: Acidification of the raffinate from the first stage result in recovery of OsO{sub 4}, which is highly extractable into toluene. The yield of extraction in the second step, from 0.01 M NaOH solution after acidification with H{sub 2}SO{sub 4} solution, was (90 {+-} 3)%. (orig.)

  19. Development of a SISAK extraction system for chemical studies of element 108, hassium

    International Nuclear Information System (INIS)

    Samadani, F.; Alstad, J.; Bjoernstad, T.; Stavsetra, L.; Omtvedt, J.P.

    2010-01-01

    A liquid-liquid extraction system suitable for studies of chemical properties of Hs (element 108), in the form of HsO 4 , was developed using γ-emitting isotopes of its homologue Os. The system is targeted for the fast on-line extraction system SISAK, which operates in a continuous manner and is suitable for liquid-phase studies of transactinide elements. The distribution of OsO 4 between various dilute NaOH solutions and toluene was studied. Both batch and SISAK on-line experiments were performed to develop an appropriate system. From analysis of the extraction curves equilibrium constants for the formation of the presumed complexes, Na[OsO 4 (OH)] and Na 2 [OsO 4 (OH) 2 ], were obtained: K 1 = (1 ± 0.5) x 10 4 and K 2 = 12 ± 8, respectively. The SISAK system includes a liquid-scintillation detection system for α measurements. Due to quenching effects it is not possible to perform direct measurement of the aqueous phase α's. Therefore, a two-stage extraction method that provides an indirect measurement of the activity in the aqueous phase was developed as part of the proposed system for Hs: Acidification of the raffinate from the first stage result in recovery of OsO 4 , which is highly extractable into toluene. The yield of extraction in the second step, from 0.01 M NaOH solution after acidification with H 2 SO 4 solution, was (90 ± 3)%. (orig.)

  20. From bohrium to copernicium and beyond SHE research at SHIP

    Energy Technology Data Exchange (ETDEWEB)

    Münzenberg, G., E-mail: G.Muenzenberg@gsi.de [GSI Helmholtzzentrum für Schwerionenforschung, Planckstrasse 1, 64291 Darmstadt (Germany); Manipal Centre for Natural Sciences, Manipal University, Manipal 576104, Karnataka (India)

    2015-12-15

    Heavy-element research with SHIP at GSI is reviewed including the discovery of the chemical elements bohrium to copernicium, experimental developments, cold fusion of heavy ions, and the discovery of a shell region around hassium. Elements bohrium and heavier are located beyond the limit of liquid-drop stability. They exist by shell stabilization. A universal, sensitive, and fast method: in-flight separation and identification of single atomic nuclei has been developed with the velocity filter SHIP and the detector system to measure decay sequences of individual atoms. Research with single atomic nuclei including detection methods, identification, and physics results will be discussed. Experiments with actinide targets as well as prospects with NUSTAR at FAIR will be addressed.

  1. Pages 266 - 269.pmd

    African Journals Online (AJOL)

    Administrator

    Clinical Psychology, Shahrekord University of Medical Science, Shahrekord, Iran. Abstract. Background: Cancer ... support, health habits, spiritual/ philosophical view of life, and body image ..... with breast cancer [Phd thesis]. Tehran, Tehran.

  2. 12 CFR 269.5 - Elections.

    Science.gov (United States)

    2010-01-01

    ... by a labor organization that it has cards signed by at least thirty percent (30%) of the employees in... dissemination thereof, whether in oral, written, printed, graphic or visual form. (f) The Special Tribunal shall...

  3. IVO, a device for In situ Volatilization and On-line detection of products from heavy ion reactions

    CERN Document Server

    Duellmann, C E; Eichler, R; Gäggeler, H W; Jost, D T; Piguet, D; Türler, A

    2002-01-01

    A new gaschromatographic separation system to rapidly isolate heavy ion reaction products in the form of highly volatile species is described. Reaction products recoiling from the target are stopped in a gas volume and converted in situ to volatile species, which are swept by the carrier gas to a chromatography column. Species that are volatile under the given conditions pass through the column. In a cluster chamber, which is directly attached to the exit of the column, the isolated volatile species are chemically adsorbed to the surface of aerosol particles and transported to an on-line detection system. The whole set-up was tested using short-lived osmium (Os) and mercury (Hg) nuclides produced in heavy ion reactions to model future chemical studies with hassium (Hs, Z=108) and element 112. By varying the temperature of the isothermal section of the chromatography column between room temperature and -80 deg. C, yield measurements of given species can be conducted, yielding information about the volatility o...

  4. Chemical experiments with superheavy elements.

    Science.gov (United States)

    Türler, Andreas

    2010-01-01

    Unnoticed by many chemists, the Periodic Table of the Elements has been extended significantly in the last couple of years and the 7th period has very recently been completed with eka-Rn (element 118) currently being the heaviest element whose synthesis has been reported. These 'superheavy' elements (also called transactinides with atomic number > or = 104 (Rf)) have been artificially synthesized in fusion reactions at accelerators in minute quantities of a few single atoms. In addition, all isotopes of the transactinide elements are radioactive and decay with rather short half-lives. Nevertheless, it has been possible in some cases to investigate experimentally chemical properties of transactinide elements and even synthesize simple compounds. The experimental investigation of superheavy elements is especially intriguing, since theoretical calculations predict significant deviations from periodic trends due to the influence of strong relativistic effects. In this contribution first experiments with hassium (Hs, atomic number 108), copernicium (Cn, atomic number 112) and element 114 (eka-Pb) are reviewed.

  5. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    Energy Technology Data Exchange (ETDEWEB)

    Even, Julia

    2011-12-13

    Topic of this thesis is the development of experiments behind the gas-filled separator TASCA (TransActinide Separator and Chemistry Apparatus) to study the chemical properties of the transactinide elements. In the first part of the thesis, the electrodepositions of short-lived isotopes of ruthenium and osmium on gold electrodes were studied as model experiments for hassium. From literature it is known that the deposition potential of single atoms differs significantly from the potential predicted by the Nernst equation. This shift of the potential depends on the adsorption enthalpy of therndeposited element on the electrode material. If the adsorption on the electrode-material is favoured over the adsorption on a surface made of the same element as the deposited atom, the electrode potential is shifted to higher potentials. This phenomenon is called underpotential deposition. Possibilities to automatize an electro chemistry experiment behind the gas-filled separator were explored for later studies with transactinide elements. The second part of this thesis is about the in-situ synthesis of transition-metal-carbonyl complexes with nuclear reaction products. Fission products of uranium-235 and californium-249 were produced at the TRIGA Mainz reactor and thermalized in a carbon-monoxide containing atmosphere. The formed volatile metal-carbonyl complexes could be transported in a gas-stream. Furthermore, short-lived isotopes of tungsten, rhenium, osmium, and iridium were synthesised at the linear accelerator UNILAC at GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt. The recoiling fusion products were separated from the primary beam and the transfer products in the gas-filled separator TASCA. The fusion products were stopped in the focal plane of TASCA in a recoil transfer chamber. This chamber contained a carbon-monoxide - helium gas mixture. The formed metal-carbonyl complexes could be transported in a gas stream to various experimental setups. All

  6. Publications | Page 269 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, ... Just say the words and a stereotype comes to mind — a system of education that is “second best.” ... Rural women in the wired world.

  7. Galileo's Medicean Moons (IAU S269)

    Science.gov (United States)

    Barbieri, Cesare; Chakrabarti, Supriya; Coradini, Marcello; Lazzarin, Monica

    2010-11-01

    Preface; 1. Galileo's telescopic observations: the marvel and meaning of discovery George V. Coyne, S. J.; 2. Popular perceptions of Galileo Dava Sobel; 3. The slow growth of humility Tobias Owen and Scott Bolton; 4. A new physics to support the Copernican system. Gleanings from Galileo's works Giulio Peruzzi; 5. The telescope in the making, the Galileo first telescopic observations Alberto Righini; 6. The appearance of the Medicean Moons in 17th century charts and books. How long did it take? Michael Mendillo; 7. Navigation, world mapping and astrometry with Galileo's moons Kaare Aksnes; 8. Modern exploration of Galileo's new worlds Torrence V. Johnson; 9. Medicean Moons sailing through plasma seas: challenges in establishing magnetic properties Margaret G. Kivelson, Xianzhe Jia and Krishan K. Khurana; 10. Aurora on Jupiter: a magnetic connection with the Sun and the Medicean Moons Supriya Chakrabarti and Marina Galand; 11. Io's escaping atmosphere: continuing the legacy of surprise Nicholas M. Schneider; 12. The Jovian Rings Wing-Huen Ip; 13. The Juno mission Scott J. Bolton and the Juno Science Team; 14. Seeking Europa's ocean Robert T. Pappalardo; 15. Europa lander mission: a challenge to find traces of alien life Lev Zelenyi, Oleg Korablev, Elena Vorobyova, Maxim Martynov, Efraim L. Akim and Alexander Zakahrov; 16. Atmospheric moons Galileo would have loved Sushil K. Atreya; 17. The study of Mercury Louise M. Prockter and Peter D. Bedini; 18. Jupiter and the other giants: a comparative study Thérèse Encrenaz; 19. Spectroscopic and spectrometric differentiation between abiotic and biogenic material on icy worlds Kevin P. Hand, Chris McKay and Carl Pilcher; 20. Other worlds, other civilizations? Guy Consolmagno, S. J.; 21. Concluding remarks Roger M. Bonnet; Posters; Author index; Object index.

  8. Publications | Page 269 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Palestinian Refugees: Challenges of Repatriation and Development. The magnitude of the Palestinian refugee issue is difficult to fully grasp. The number of Palestinian Arabs who were initially displaced in 1948 has been estimated at anywhere from 520 000 to 914 000, depending on the source. Several.

  9. Twins born in different environments? Nuclei of two dSphs: isolated galaxy KKS3 and ESO269-66, a close neighbor of NGC5128

    Science.gov (United States)

    Sharina, Margarita; Karachentsev, Igor; Kniazev, Alexei

    2015-08-01

    The close vicinity of giant neighbors determines the environmental mechanisms that have been considered responsible for the evolution of dwarf spheroidal galaxies (dSphs). In the recent years, Karachentsev and collaborators have reported on the discovery of a few truly isolated dSphs in the Local volume. This study focuses on one of these unusual objects, KKs3 (MV=-12.3 mag). It contains a massive globular cluster (GC) (MV=-8.5 mag) near its optical center. We have performed the estimation of its radial velocity using a medium-resolution spectrum obtained with the RSS spectrograph at the Southern African Large Telescope (SALT). The signal-to-noise ratio in the spectrum was sufficient to estimate the age and metallicity for the GC using simple stellar population models, and the methods of full spectrum fitting and Lick index diagnostic diagrams. The results contribute to the knowledge about the origin of massive star clusters and their host dSphs.In the same way we have analyzed another luminous GC (MV=-10) in the center of ESO269-66 (MB=-15.4), a close dSph neighbor of the giant S0 Cen A. The cluster was observed with SALT in the same instrumental configuration. The structure and star formation histories of the two galaxies look rather similar. Both of them have experienced several star-forming events. The most recent ones occurred 1÷2 Gyr ago, and most powerful bursts happened 12÷14 Gyrs ago. Our analysis has shown that both GCs appear to be 1÷2 Gyr younger and 0.2÷0.3 dex more metal-rich than the most ancient metal-poor stars in the host dSphs. We examine signatures of multiple stellar population in the GCs using out data. Since central star-forming bursts were extended in time, the massive clusters might be considered as nuclei of the galaxies.

  10. Chemistry of superheavy elements

    International Nuclear Information System (INIS)

    Schaedel, M.

    2012-01-01

    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  11. 26 CFR 1.269-3 - Instances in which section 269(a) disallows a deduction, credit, or other allowance.

    Science.gov (United States)

    2010-04-01

    ... made must have been the evasion or avoidance of Federal income tax by securing the benefit of a... evasion or avoidance of Federal income tax: (1) A corporation or other business enterprise (or the... avoidance of Federal income tax. (2) A person or persons organize two or more corporations instead of a...

  12. JCSC_128_2_269-277_SI.docx

    Indian Academy of Sciences (India)

    Lnmr Lab

    Experimental – Materials; Experimental – NMR measurements and CHN elemental analysis; 1H, 13C, and 15N NMR spectra, Figures S1 – S10; Methods – UV-vis absorption spectroscopy (Figures S11 – S13); Methods .... Melting temperatures were determined as a maximum of the first derivative of the melting curves.

  13. Design and properties of silicon charged-particle detectors developed at the Institute of Electron Technology (ITE)

    Science.gov (United States)

    Wegrzecki, Maciej; Bar, Jan; Budzyński, Tadeusz; CieŻ, Michal; Grabiec, Piotr; Kozłowski, Roman; Kulawik, Jan; Panas, Andrzej; Sarnecki, Jerzy; Słysz, Wojciech; Szmigiel, Dariusz; Wegrzecka, Iwona; Wielunski, Marek; Witek, Krzysztof; Yakushev, Alexander; Zaborowski, Michał

    2013-07-01

    The paper discusses the design of charged-particle detectors commissioned and developed at the Institute of Electron Technology (ITE) in collaboration with foreign partners, used in international research on transactinide elements and to build personal radiation protection devices in Germany. Properties of these detectors and the results obtained using the devices are also presented. The design of the following epiplanar detector structures is discussed: ♢ 64-element chromatographic arrays for the COMPACT (Cryo On-line Multidetector for Physics And Chemistry of Transactinides) detection system used at the GSI Helmholtzzentrum für Schwerionenforschung in Darmstadt (GSI) for research on Hassium, Copernicium and Flerovium, as well as elements 119 and 120, ♢ 2-element flow detectors for the COLD (Cryo On-Line Detector) system used for research on Copernicium and Flerovium at the Joint Institute for Nuclear Research, Dubna, ♢ detectors for a radon exposimeter and sensors for a neutron dosimeter developed at the Institut für Strahlenschutz, Helmholtz Zentrum München. The design of planar detectors - single-sided and double-sided strip detectors for the Focal Plane Detector Box used at GSI for research on Flerovium and elements 119 and 120 is also discussed.

  14. Improving the reversibility of thermal denaturation and catalytic efficiency of Bacillus licheniformis α-amylase through stabilizing a long loop in domain B.

    Directory of Open Access Journals (Sweden)

    Zhu Li

    Full Text Available The reversibility of thermal denaturation and catalytic efficiency of Bacillus licheniformis α-amylase were improved through site-directed mutagenesis. By using multiple sequence alignment and PoPMuSiC algorithm, Ser187 and Asn188, which located within a long loop in Domain B of Bacillus licheniformis α-amylase, were selected for mutation. In addition, Ala269, which is adjacent to Ser187 and Asn188, was also investigated. Seven mutants carrying the mutations S187D, N188T, N188S, A269K, A269K/S187D, S187D/N188T, and A269K/S187D/N188T were generated and characterized. The most thermostable mutant, A269K/S187D/N188T, exhibited a 9-fold improvement in half-life at 95°C and pH 5.5, compared with that of the wild-type enzyme. Mutant A269K/S187D/N188T also exhibited improved catalytic efficiency. The catalytic efficiency of mutant A269K/S187D/N188T reached 5.87×103±0.17 g·L-1·s-1 at pH 5.5, which is 1.84-fold larger than the corresponding value determined for the wild-type enzyme. Furthermore, the structure analysis showed that immobilization of the loop containing Ser187 and Asn188 plays a significant role in developing the properties of Bacillus licheniformis α-amylase.

  15. Improving the reversibility of thermal denaturation and catalytic efficiency of Bacillus licheniformis α-amylase through stabilizing a long loop in domain B.

    Science.gov (United States)

    Li, Zhu; Duan, Xuguo; Chen, Sheng; Wu, Jing

    2017-01-01

    The reversibility of thermal denaturation and catalytic efficiency of Bacillus licheniformis α-amylase were improved through site-directed mutagenesis. By using multiple sequence alignment and PoPMuSiC algorithm, Ser187 and Asn188, which located within a long loop in Domain B of Bacillus licheniformis α-amylase, were selected for mutation. In addition, Ala269, which is adjacent to Ser187 and Asn188, was also investigated. Seven mutants carrying the mutations S187D, N188T, N188S, A269K, A269K/S187D, S187D/N188T, and A269K/S187D/N188T were generated and characterized. The most thermostable mutant, A269K/S187D/N188T, exhibited a 9-fold improvement in half-life at 95°C and pH 5.5, compared with that of the wild-type enzyme. Mutant A269K/S187D/N188T also exhibited improved catalytic efficiency. The catalytic efficiency of mutant A269K/S187D/N188T reached 5.87×103±0.17 g·L-1·s-1 at pH 5.5, which is 1.84-fold larger than the corresponding value determined for the wild-type enzyme. Furthermore, the structure analysis showed that immobilization of the loop containing Ser187 and Asn188 plays a significant role in developing the properties of Bacillus licheniformis α-amylase.

  16. Translations on Narcotics and Dangerous Drugs, Number 269

    Science.gov (United States)

    1976-10-28

    Combat of Traffickers 64 PANAMA Briefs Drug Trafficker’s Arrest 65 Drug Control Statistics 65 Three From U.S. 65 PERU Briefs State Drug Law 66...in Viru, Peru , was identified as Gabriel Eduardo Romero. The Cali police said that Romero had a record as a drug trafficker and that he is widely...Narino Battalion. Counsel for the defense alleged that Vega Perez suffers from diabetes and will there- by receive better medical treatment. The

  17. Dicty_cDB: VSK269 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6_1( EU494076 |pid:none) Scaptodrosophila lebanonensis vouc... 34 7.8 EU494077_1(... EU494077 |pid:none) Scaptodrosophila pattersoni vouche... 34 7.8 protein update 2009. 3.26 PSORT psg: 0.70

  18. 1935 15' Quad #269 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  19. 77 FR 269 - Matters Related to Patent Appeals

    Science.gov (United States)

    2012-01-04

    ... DEPARTMENT OF COMMERCE United States Patent and Trademark Office Matters Related to Patent Appeals ACTION: Proposed collection; comment request. SUMMARY: The United States Patent and Trademark Office... Matters Related to Patent Appeals comment'' in the subject line of the message. Mail: Susan K. Fawcett...

  20. Sealed bid auctions with ambiguity: an experimental study

    Czech Academy of Sciences Publication Activity Database

    Chen, Y.; Katuščák, Peter; Ozdenoren, E.

    -, č. 269 (2005), s. 1-75 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : sealed bid auctions * ambiguity * experiment Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp269.pdf

  1. Bioecology of subtidal region

    Digital Repository Service at National Institute of Oceanography (India)

    Parulekar, A.H.

    stream_size 2 stream_content_type text/plain stream_name Mar_Archaeol_2_69.pdf.txt stream_source_info Mar_Archaeol_2_69.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  2. Hydrographic characteristics and circulation in the Caribbean Sea during April and May 1990

    Digital Repository Service at National Institute of Oceanography (India)

    PrasannaKumar, S.; Murty, V.S.N.; Khan, A.A; Jones, M.A; Wagh, A; Desai, B.N.

    stream_size 12 stream_content_type text/plain stream_name Caribb_Mar_Stud_2_69.pdf.txt stream_source_info Caribb_Mar_Stud_2_69.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  3. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    International Nuclear Information System (INIS)

    Even, Julia

    2011-01-01

    Topic of this thesis is the development of experiments behind the gas-filled separator TASCA (TransActinide Separator and Chemistry Apparatus) to study the chemical properties of the transactinide elements. In the first part of the thesis, the electrodepositions of short-lived isotopes of ruthenium and osmium on gold electrodes were studied as model experiments for hassium. From literature it is known that the deposition potential of single atoms differs significantly from the potential predicted by the Nernst equation. This shift of the potential depends on the adsorption enthalpy of therndeposited element on the electrode material. If the adsorption on the electrode-material is favoured over the adsorption on a surface made of the same element as the deposited atom, the electrode potential is shifted to higher potentials. This phenomenon is called underpotential deposition. Possibilities to automatize an electro chemistry experiment behind the gas-filled separator were explored for later studies with transactinide elements. The second part of this thesis is about the in-situ synthesis of transition-metal-carbonyl complexes with nuclear reaction products. Fission products of uranium-235 and californium-249 were produced at the TRIGA Mainz reactor and thermalized in a carbon-monoxide containing atmosphere. The formed volatile metal-carbonyl complexes could be transported in a gas-stream. Furthermore, short-lived isotopes of tungsten, rhenium, osmium, and iridium were synthesised at the linear accelerator UNILAC at GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt. The recoiling fusion products were separated from the primary beam and the transfer products in the gas-filled separator TASCA. The fusion products were stopped in the focal plane of TASCA in a recoil transfer chamber. This chamber contained a carbon-monoxide - helium gas mixture. The formed metal-carbonyl complexes could be transported in a gas stream to various experimental setups. All

  4. Local predators attack exotic aphid Brachycaudus divaricatae in Lithuania

    Czech Academy of Sciences Publication Activity Database

    Danilov, J.; Rakauskas, R.; Havelka, Jan; Starý, Petr

    2016-01-01

    Roč. 69, č. 2 (2016), s. 263-269 ISSN 1721-8861 Institutional support: RVO:60077344 Keywords : Prunus * Aphids * Brachycaudus divaricatae Subject RIV: EH - Ecology, Behaviour Impact factor: 1.051, year: 2016 http://www.bulletinofinsectology.org/pdfarticles/vol69-2016-263-269danilov.pdf

  5. 77 FR 34281 - Airworthiness Directives; Schweizer Aircraft Corporation

    Science.gov (United States)

    2012-06-11

    ... Corporation AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of proposed rulemaking (NPRM... Corporation (Schweizer) Model 269D and Model 269D Configuration A helicopters. The type certificate for these models is currently held by Sikorsky Aircraft Corporation (Sikorsky). This proposal is prompted by...

  6. 12 CFR 269.4 - Determination of appropriate bargaining unit.

    Science.gov (United States)

    2010-01-01

    ... requesting a representation election signed by at least thirty percent (30%) of the employees in a unit which... the labor organization should disagree with the Special Tribunal's decision, the party in disagreement... percent (30%) of the employees in a unit claimed by a labor organization as appropriate or subsequently...

  7. All projects related to | Page 269 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Region: Brazil, South America, Canada, North and Central America, India, Far East Asia, South Korea, Central Asia, South Asia. Program: Networked Economies. Total Funding: CA$ 203,800.00. Adding A2K Principles to the UN Guidelines for Consumer Protection. Project. The United Nations (UN) Guidelines for Consumer ...

  8. Prevalence of Psittacine Beak and Feather Disease Virus and Avian Polyomavirus in Captivity Psittacines from Costa Rica

    DEFF Research Database (Denmark)

    Dolz, Gaby; Sheleby-Elías, Jessica; Romero-Zuñiga, Juan J.

    2013-01-01

    , shelters and rescue centers of wildlife in Costa Rica. They belonged to 19 species of psittacine birds. The most representative species in the sample were Ara macao (157), Ara ambigua (37), Amazona autumnalis (24), Amazon ochrocephala (21) and Ara ararauna (8). A prevalence of 19.7% (53/269) for PBFDV...... and 4.8% (13/269) for APV was determined using Polymerase Chain Reaction (PCR). In 3.3% (9/269) of the birds mixed infections were detected. Statistical analysis determined that psittacines living in shelters and rescue centers had a greater risk to be positive to PBFDV and APV than birds that were...

  9. 77 FR 34386 - Implementation of Federal Financial Report-Upcoming Mandatory Use of the Federal Financial Report...

    Science.gov (United States)

    2012-06-11

    ... of cumulative data only. Background The Office of Management and Budget has consolidated the Financial Status Report (FSR or SF-269/SF-269A) and the Federal Cash Transaction Report (FCTR or SF-272/SF..., 2010, CDC grantees have been required to report cash transaction data via the Payment Management System...

  10. 75 FR 54215 - Agency Request for Approval of a Previously Approved Information Collection(s): Uniform...

    Science.gov (United States)

    2010-09-03

    ... about our intention to request Office of Management and Budget (OMB) approval to renew a previously... because of management and oversight responsibilities of the agency imposed by OMB Circular 2 CFR 215 (A... Department has terminated Financial Status Report (SF-269 and SF-269A) and Federal Cash Transactions Report...

  11. 78 FR 4873 - Electrical Protective Equipment Standard and the Electric Power Generation, Transmission, and...

    Science.gov (United States)

    2013-01-23

    ... performing job duties. The training requirements of the Standard inform workers of the safety hazards of... this method, you must submit a copy of your comments and attachments to the OSHA Docket Office, Docket... Distribution Standard (Sec. 1910.269) Training Certification (Sec. 1910.269(a)(2)(vii)) This provision requires...

  12. 20 CFR 435.52 - Financial reporting.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Financial reporting. 435.52 Section 435.52... ORGANIZATIONS Post-Award Requirements Reports and Records § 435.52 Financial reporting. (a) Authorized forms... financial information from recipients: (1) SF-269 or SF-269A, Financial Status Report. (i) SSA requires...

  13. Separated Representations and Fast Algorithms for Materials Science

    Science.gov (United States)

    2007-10-29

    Quantum Chemisty , 127 (1999), pp. 143–269. [28] A. Smilde, R. Bro, and P. Geladi, Multi-way Analysis. Applications in the Chemical Sciences, John...Advances in highly correlated approaches. Advances in Quantum Chemisty , 127:143–269, 1999. [58] Age Smilde, Rasmus Bro, and Paul Geladi. Multi-way Analysis

  14. Chemistry of the superheavy elements.

    Science.gov (United States)

    Schädel, Matthias

    2015-03-13

    The quest for superheavy elements (SHEs) is driven by the desire to find and explore one of the extreme limits of existence of matter. These elements exist solely due to their nuclear shell stabilization. All 15 presently 'known' SHEs (11 are officially 'discovered' and named) up to element 118 are short-lived and are man-made atom-at-a-time in heavy ion induced nuclear reactions. They are identical to the transactinide elements located in the seventh period of the periodic table beginning with rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) in groups 4, 5 and 6, respectively. Their chemical properties are often surprising and unexpected from simple extrapolations. After hassium (element 108), chemistry has now reached copernicium (element 112) and flerovium (element 114). For the later ones, the focus is on questions of their metallic or possibly noble gas-like character originating from interplay of most pronounced relativistic effects and electron-shell effects. SHEs provide unique opportunities to get insights into the influence of strong relativistic effects on the atomic electrons and to probe 'relativistically' influenced chemical properties and the architecture of the periodic table at its farthest reach. In addition, they establish a test bench to challenge the validity and predictive power of modern fully relativistic quantum chemical models. © 2015 The Author(s) Published by the Royal Society. All rights reserved.

  15. 45 CFR 287.160 - What reports must a grantee file regarding financial operations?

    Science.gov (United States)

    2010-10-01

    ... Requirements § 287.160 What reports must a grantee file regarding financial operations? (a) Grantees will use SF-269A to make an annual financial report of expenditures for program activities and services. (b) Two annual financial reports will be due to the appropriate Regional Office. The interim SF-269A is...

  16. 36 CFR 1210.52 - Financial reporting.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Financial reporting. 1210.52....52 Financial reporting. (a) The following forms or such other forms as may be approved by OMB are authorized for obtaining financial information from recipients. (1) SF-269 or SF-269A, Financial Status...

  17. 2 CFR 215.52 - Financial reporting.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Financial reporting. 215.52 Section 215.52... Financial reporting. (a) The following forms or such other forms as may be approved by OMB are authorized for obtaining financial information from recipients. (1) SF-269 or SF-269A, Financial Status Report...

  18. 34 CFR 74.52 - Financial reporting.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Financial reporting. 74.52 Section 74.52 Education... and Records § 74.52 Financial reporting. (a) The following forms or other forms as may be approved by OMB are authorized for obtaining financial information from recipients. (1) SF-269 or SF-269A...

  19. 22 CFR 145.52 - Financial reporting.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Financial reporting. 145.52 Section 145.52....52 Financial reporting. (a) The following forms or such other forms as may be approved by OMB are authorized for obtaining financial information from recipients. (1) SF-269 or SF-269A, Financial Status...

  20. 41 CFR 105-72.602 - Financial reporting.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Financial reporting. 105... § 105-72.602 Financial reporting. (a) The following forms or such other forms as may be approved by OMB are authorized for obtaining financial information from recipients. (1) SF-269 or SF-269A, Financial...

  1. 24 CFR 84.52 - Financial reporting.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Financial reporting. 84.52 Section... Financial reporting. (a) The following forms or such other forms as may be approved by OMB are authorized for obtaining financial information from recipients. (1) SF-269 or SF-269A, Financial Status Report...

  2. Sulfhydryl oxidation of mutants with cysteine in place of acidic residues in the lactose permease.

    Science.gov (United States)

    Voss, J; Sun, J; Venkatesan, P; Kaback, H R

    1998-06-02

    To examine further the role of charge-pair interactions in the structure and function of lactose permease, Asp237 (helix VII), Asp240 (helix VII), Glu126 (cytoplasmic loop IV/V), Glu269 (helix VIII), and Glu325 (helix X) were replaced individually with Cys in a functional mutant devoid of Cys residues. Each mutant was then oxidized with H2O2 in order to generate a sulfinic and/or sulfonic acid at these positions. Due to the isosteric relationship between aspartate and sulfinate, in particular, and the lower pKa of the sulfinic and sulfonic acid side chains, oxidized derivatives of Cys are useful probes for examining the role of carboxylates. Asp237-->Cys or Asp240-->Cys permease is inactive, as shown previously, but H2O2 oxidation restores activity to an extent similar to that observed when a negative charge is reintroduced by other means. Glu126-->Cys, Glu269-->Cys, or Glu325-->Cys permease is inactive, but oxidation does not restore active lactose transport. The data are consistent with previous observations indicating that Asp237 and Asp240 are not critical for active lactose transport, while Glu126, Glu269, and Glu325 are irreplaceable. Although Glu269-->Cys permease does not transport lactose, the oxidized mutant exhibits significant transport of beta,D-galactosylpyranosyl 1-thio-beta,D-galactopyranoside, a property observed with Glu269-->Asp permease. The observation supports the idea that an acidic residue at position 269 is important for substrate recognition. Finally, oxidized Glu325-->Cys permease catalyzes equilibrium exchange with an apparent pKa of about 6.5, more than a pH unit lower than that observed with Glu325-->Asp permease, thereby providing strong confirmatory evidence that a negative charge at position 325 determines the rate of translocation of the ternary complex between the permease, substrate, and H+.

  3. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 89; Issue 3. Issue front cover thumbnail. Volume 89, Issue 3. September 2010, pages 269-390. Special issue - How is sex determined in insects? pp 269-270. Preface · J. Nagaraju Giuseppe Saccone · More Details Fulltext PDF. pp 271-277 Review Article. The role of the ...

  4. 43 CFR 12.952 - Financial reporting.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Financial reporting. 12.952 Section 12.952... Requirements § 12.952 Financial reporting. (a) The following forms or such other forms as may be approved by OMB are authorized for obtaining financial information from recipients. (1) SF-269 or SF-269A...

  5. 29 CFR 95.52 - Financial reporting.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Financial reporting. 95.52 Section 95.52 Labor Office of the... Records § 95.52 Financial reporting. (a) The following forms or such other forms as may be approved by OMB are authorized for obtaining financial information from recipients: (1) SF-269 or SF-269A, Financial...

  6. Arching Structures in Granular Sedimentary Deposits

    Czech Academy of Sciences Publication Activity Database

    Kulaviak, Lukáš; Hladil, Jindřich; Růžička, Marek; Drahoš, Jiří; Saint-Lary, L.

    2013-01-01

    Roč. 246, SEP (2013), s. 269-277 ISSN 0032-5910 R&D Projects: GA ČR GA104/07/1110; GA AV ČR IAAX00130702; GA MŠk(CZ) LG11014 Institutional support: RVO:67985858 ; RVO:67985831 Keywords : wet granulars * deposit * arching structure Subject RIV: CI - Industrial Chemistry, Chemical Engineering; DB - Geology ; Mineralogy (GLU-S) Impact factor: 2.269, year: 2013

  7. People and thing. CERN Courier, Nov 1986, v. 26(9)

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1986-11-15

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The design current of 1 ampere was achieved this summer at the 750 MeV vacuum ultra-violet storage ring of the US National Synchrotron Light Source at Brookhaven. The next International Symposium on Lepton and Photon Interactions at High Energies will be held in Hamburg, West Germany, from 27-31 July 1987. The second Lake Louise Winter Institute will be held from 16-22 February at Chateau Lake Louise, Canada.; The 32nd Scottish Universities' Summer School in Physics will be held from 9-29 August 1987 at the University of St. Andrews. Earlier this year an exhibition of photographs of great beauty was presented at CERN on the invitation of the Staff Association. Following the success of the Symposium on Cosmology, Astronomy and Particle Physics organized jointly by CERN and the European Southern Observatory (ESO), now a regular feature of the physics international physics calendar, ESO and CERN are organizing an International School on Astro-Particle Physics at the Ettore Majorana Centre for Scientific Culture, Erice, Sicily, from 5-25 January.

  8. People and thing. CERN Courier, Nov 1986, v. 26(9)

    International Nuclear Information System (INIS)

    Anon.

    1986-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The design current of 1 ampere was achieved this summer at the 750 MeV vacuum ultra-violet storage ring of the US National Synchrotron Light Source at Brookhaven. The next International Symposium on Lepton and Photon Interactions at High Energies will be held in Hamburg, West Germany, from 27-31 July 1987. The second Lake Louise Winter Institute will be held from 16-22 February at Chateau Lake Louise, Canada.; The 32nd Scottish Universities' Summer School in Physics will be held from 9-29 August 1987 at the University of St. Andrews. Earlier this year an exhibition of photographs of great beauty was presented at CERN on the invitation of the Staff Association. Following the success of the Symposium on Cosmology, Astronomy and Particle Physics organized jointly by CERN and the European Southern Observatory (ESO), now a regular feature of the physics international physics calendar, ESO and CERN are organizing an International School on Astro-Particle Physics at the Ettore Majorana Centre for Scientific Culture, Erice, Sicily, from 5-25 January

  9. 29 CFR 1910.269 - Electric power generation, transmission, and distribution.

    Science.gov (United States)

    2010-07-01

    ... accidental fall through the opening and to protect employees working in the space from objects entering the... attached to any one lifeline. (viii) Snaphooks may not be connected to loops made in webbing-type lanyards. (ix) Snaphooks may not be connected to each other. (h) Ladders, platforms, step bolts, and manhole...

  10. 26 CFR 1.269-1 - Meaning and use of terms.

    Science.gov (United States)

    2010-04-01

    ... deduction, a credit, an adjustment, an exemption, or an exclusion. (b) Evasion or avoidance. The phrase evasion or avoidance is not limited to cases involving criminal penalties, or civil penalties for fraud...-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX...

  11. 43 CFR 26.9 - Consideration and criteria for awarding grants.

    Science.gov (United States)

    2010-10-01

    ... consider the following: (a) The amount of grant funds allocated to the State. (b) The quality of the proposed program in terms of meeting program characteristics and objectives. (c) The overall cost per...

  12. 24 CFR 203.269 - Method of payment of periodic MIP.

    Science.gov (United States)

    2010-04-01

    ... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Mortgage Insurance Premiums..., that periodic MIP be remitted electronically. [60 FR 34138, June 30, 1995] Open-end Insurance Charges...

  13. Fast sex identification in wild mammals using PCR amplification of the Sry gene

    Czech Academy of Sciences Publication Activity Database

    Bryja, Josef; Konečný, A.

    2003-01-01

    Roč. 52, č. 3 (2003), s. 269-274 ISSN 0139-7893 R&D Projects: GA ČR GA524/01/1316; GA ČR GP206/02/P068 Institutional research plan: CEZ:AV0Z6093917 Keywords : sex identification * Sry gene * rodents Subject RIV: EG - Zoology Impact factor: 0.494, year: 2003 http://www.ivb.cz/folia/52/3/269-274.pdf

  14. Organic phthalocyanine films with high mobilities for efficient field-effect transistor switches

    Czech Academy of Sciences Publication Activity Database

    Schauer, F.; Zhivkov, I.; Nešpůrek, Stanislav

    266-269, 1-3 (2000), s. 999-1003 ISSN 0022-3093. [International Conference on Amorphous and Microcrystalline Semiconductors /18./. Snowbird, 23.08.1999-27.08.1999] R&D Projects: GA MŠk OC 518.10; GA AV ČR KSK2050602 Institutional research plan: CEZ:AV0Z4050913 Keywords : phthalocyanine * charge mobility * field-effect transistor Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.269, year: 2000

  15. AcEST: DK952456 [AcEST

    Lifescience Database Archive (English)

    Full Text Available xygenase OS=Polaromonas n... 31 6.4 >sp|Q5G269|NETR_PONPY Neurotrypsin OS=Pongo pygmaeus GN=PRSS12 PE=3 SV=1........done Score E Sequences producing significant alignments: (bits) Value sp|Q5G269|NETR_PONPY Neurotrypsin OS=Pongo pygmaeus GN=PRS...S12 PE... 25 3.4 sp|A1VRP1|T23O_POLNA Tryptophan 2,3-dio

  16. Penentuan Bilangan Asam Dan Bilangan Penyabunan Pada Asam Laurat Hasil Hidrolisis Palm Kernel Oil (PKO) Di PT Socimas Medan

    OpenAIRE

    Tobing, Windy.T.

    2012-01-01

    Has been performed analysis in which the specified number of acid value and saponification value in lauric acid from hydrolysis process of palm kernel oil in PT.Socimas. Analysis of the results obtained acid value 269,9 and saponification value 270,8. Thus the acid value and saponification value correspond to the standart value 269-275 for acid value, and 270-276 for saponification value in PT. Socimas. 092401017

  17. Superheavy element chemistry. Achievements and perspectives

    International Nuclear Information System (INIS)

    Schaedel, M.

    2007-01-01

    Superheavy elements have been synthesized and chemically characterized one-atom-at-a-time up to element 108. Presently, the quest for element 112 is one of the hottest topics in this field. The transactinide elements 104 to 108 are members of group 4 to 8 of the Periodic Table and element 112 belongs into group 12. Chemical properties of some of these elements, like elements 104 and 105, show stunning deviations from simple extrapolations within their respective group while others exhibit great similarities with their lighter homologues elements. First experiments to investigate seaborgium (Sg, element 106) in aqueous solution were performed. Again, in large international collaborations at the GSI, several gas-phase chemistry experiments were performed with hassium (Hs, element 108). Recently, the highly efficient and very clean separation of Hs was applied for nuclear studies of various Hs nuclides investigating their cross section and their nuclear decay properties in the region of the doubly-magic 270 Hs (Z=108, N=162). To overcome certain limitations of the presently used on-line chemical separations the new TransActinide Separation and Chemistry Apparatus (TASCA) - with a gas-filled recoil separator as a front-end tool - was designed and built at the GSI in a collaborative effort. Presently in its commissioning phase, TASCA shall be a key instrument for a big leap into quantitatively and qualitatively new experiments in the region of superheavy elements. (author)

  18. : tous les projets | Page 269 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: FOOD CROPS, FOOD SECURITY, WETLANDS, ENVIRONMENTAL HEALTH, AGRICULTURAL POLICY, ENVIRONMENTAL POLICY. Région: Uganda, North of Sahara, South of Sahara. Programme: Agriculture et sécurité alimentaire. Financement total : CA$ 400,000.00. Gestion des milieux humides en vue d'une ...

  19. The influence of IS1301 in the capsule biosynthesis locus on meningococcal carriage and disease.

    Directory of Open Access Journals (Sweden)

    Elisabeth Kugelberg

    2010-02-01

    Full Text Available Previously we have shown that insertion of IS1301 in the sia/ctr intergenic region (IGR of serogroup C Neisseria meningitidis (MenC isolates from Spain confers increased resistance against complement-mediated killing. Here we investigate the significance of IS1301 in the same location in N. meningitidis isolates from the UK. PCR and sequencing was used to screen a collection of more than 1500 meningococcal carriage and disease isolates from the UK for the presence of IS1301 in the IGR. IS1301 was not identified in the IGR among vaccine failure strains but was frequently found in serogroup B isolates (MenB from clonal complex 269 (cc269. Almost all IS1301 insertions in cc269 were associated with novel polymorphisms, and did not change capsule expression or resistance to human complement. After excluding sequence types (STs distant from the central genotype within cc269, there was no significant difference for the presence of IS1301 in the IGR of carriage isolates compared to disease isolates. Isolates with insertion of IS1301 in the IGR are not responsible for MenC disease in UK vaccine failures. Novel polymorphisms associated with IS1301 in the IGR of UK MenB isolates do not lead to the resistance phenotype seen for IS1301 in the IGR of MenC isolates.

  20. Histrionicotoxin alkaloids finally detected in an ant

    DEFF Research Database (Denmark)

    Jones, Tappey H.; Adams, Rachelle Martha Marie; Spande, Thomas F.

    2012-01-01

    Workers of the ant Carebarella bicolor collected in Panama were found to have two major poison-frog alkaloids, cis- and trans-fused decahydroquinolines (DHQs) of the 269AB type, four minor 269AB isomers, two minor 269B isomers, and three isomers of DHQ 271D. For the first time in an ant, however......) sp., were found to have a very similar DHQ complex but failed to show HTXs. Several new DHQ alkaloids of MW 271 (named in the frog as 271G) are reported from the above ants that have both m/z 202 and 204 as major fragment ions, unlike the spectrum seen for the poison-frog alkaloid 271D, which has...... only an m/z 204 base peak. Found also for the first time in skin extracts from the comparison frog Oophaga granulifera of Costa Rica is a trace DHQ of MW 273. It is coded as 273F in the frog; a different isomer is found in the ant....

  1. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available uery: 210 VEIITPENAIKGITKSISDRRGFIIQQQPLEGTPFQQIHGNIPLIEIFGFETDIRTFSRG 269 ... VEIITPENAIKGITKSISDRRG...FIIQQQPLEGTPFQQIHGNIPLIEIFGFETDIRTFSRG Sbjct: 1 ... VEIITPENAIKGITKSISDRRGFIIQQQPLEGTPFQQIHGNIPLIEIFGFETDIRTFSRG 60 ...

  2. Dicty_cDB: VSK446 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSK446 (Link to dictyBase) - - - Contig-U15105-1 VSK446E (Link... Clone ID VSK446 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15105-1 Original site URL http://dict... r... 269 4e-71 AF402813_1( AF402813 |pid:none) Ictalurus punctatus 40S ribosomal ... 269 4e-71 FJ196315_1( ....00 84.0 %: cytoplasmic 12.0 %: mitochondrial 4.0 %: nuclear >> prediction for VSK446 is cyt 5' end seq. ID

  3. Energirenovering af større bygninger

    DEFF Research Database (Denmark)

    Mortensen, Lone Hedegaard; Birck Laustsen, Jacob; Vorre, Mette Havgaard

    involverede parter i et renoveringsprojekt om, hvordan energirenoveringsprojekter gennemføres i alle faser. SBi-anvisning 269 kan bruges som styringsredskab for bygherrer og kravgrundlag for rådgivere, entreprenører og andre parter, der leverer ydelser til bygherren. For institutioner, der stiller kapital til......​SBi-anvisning 269 omhandler metode og proces for gennemførelse af energirenoveringsprojekter for større bygninger fra idefase til driftsfase. Større bygninger omfatter etageboliger, bygninger til privat handel- og service samt offentlige institutioner. Anvisningen giver vejledning for de...

  4. Sexual and gender minority identity disclosure during undergraduate medical education: "in the closet" in medical school.

    Science.gov (United States)

    Mansh, Matthew; White, William; Gee-Tong, Lea; Lunn, Mitchell R; Obedin-Maliver, Juno; Stewart, Leslie; Goldsmith, Elizabeth; Brenman, Stephanie; Tran, Eric; Wells, Maggie; Fetterman, David; Garcia, Gabriel

    2015-05-01

    To assess identity disclosure among sexual and gender minority (SGM) students pursuing undergraduate medical training in the United States and Canada. From 2009 to 2010, a survey was made available to all medical students enrolled in the 176 MD- and DO-granting medical schools in the United States and Canada. Respondents were asked about their sexual and gender identity, whether they were "out" (i.e., had publicly disclosed their identity), and, if they were not, their reasons for concealing their identity. The authors used a mixed-methods approach and analyzed quantitative and qualitative survey data. Of 5,812 completed responses (of 101,473 eligible respondents; response rate 5.7%), 920 (15.8%) students from 152 (of 176; 86.4%) institutions identified as SGMs. Of the 912 sexual minorities, 269 (29.5%) concealed their sexual identity in medical school. Factors associated with sexual identity concealment included sexual minority identity other than lesbian or gay, male gender, East Asian race, and medical school enrollment in the South or Central regions of North America. The most common reasons for concealing one's sexual identity were "nobody's business" (165/269; 61.3%), fear of discrimination in medical school (117/269; 43.5%), and social or cultural norms (110/269; 40.9%). Of the 35 gender minorities, 21 (60.0%) concealed their gender identity, citing fear of discrimination in medical school (9/21; 42.9%) and lack of support (9/21; 42.9%). SGM students continue to conceal their identity during undergraduate medical training. Medical institutions should adopt targeted policies and programs to better support these individuals.

  5. ORF Alignment: NC_004354 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHH 180 ... Query: 269 SRIVEHSQVRLECRADANPSDVRYRWFI...NDEPIIGGQKTEMVIRNVTRKFHDAIVKCEVQ 328 ... SRIVEHSQVRLECRADANPSDVRYRWFINDEPIIGGQKTEMVIRNVTRKFHDAIVKCEVQ... Sbjct: 241 SRIVEHSQVRLECRADANPSDVRYRWFINDEPIIGGQKTEMVIRNVTRKFHDAIVKCEVQ 300 ... Query: 389 GTSTNLTFSVSNETAGRYY

  6. ORF Alignment: NC_005126 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available RYVRFCTTIKNDRAVVIFPGRSESYVKYSEVAFDFYHLGYDIF 60 ... Query: 149 GGFLLRHSQVFDAAALCAPMFGINFPMPRWLATFLVNRAEKRPDMRNHY...AVFTGKWRPLP 208 ... GGFLLRHSQVFDAAALCAPMFGINFPMPRWLATFLVNRAEKRPDMRNHYAVFTG...KWRPLP Sbjct: 121 GGFLLRHSQVFDAAALCAPMFGINFPMPRWLATFLVNRAEKRPDMRNHYAVFTGKWRPLP 180 ... Query: 269 KASEDKVVNNCRL

  7. Phosphorylation of human aquaporin 2 (AQP2) allosterically controls its interaction with the lysosomal trafficking protein LIP5.

    Science.gov (United States)

    Roche, Jennifer Virginia; Survery, Sabeen; Kreida, Stefan; Nesverova, Veronika; Ampah-Korsah, Henry; Gourdon, Maria; Deen, Peter M T; Törnroth-Horsefield, Susanna

    2017-09-01

    The interaction between the renal water channel aquaporin-2 (AQP2) and the lysosomal trafficking regulator-interacting protein LIP5 targets AQP2 to multivesicular bodies and facilitates lysosomal degradation. This interaction is part of a process that controls AQP2 apical membrane abundance in a vasopressin-dependent manner, allowing for urine volume adjustment. Vasopressin regulates phosphorylation at four sites within the AQP2 C terminus (Ser 256 , Ser 261 , Ser 264 , and Thr 269 ), of which Ser 256 is crucial and sufficient for AQP2 translocation from storage vesicles to the apical membrane. However, whether AQP2 phosphorylation modulates AQP2-LIP5 complex affinity is unknown. Here we used far-Western blot analysis and microscale thermophoresis to show that the AQP2 binds LIP5 in a phosphorylation-dependent manner. We constructed five phospho-mimicking mutants (S256E, S261E, S264E, T269E, and S256E/T269E) and a C-terminal truncation mutant (ΔP242) that lacked all phosphorylation sites but retained a previously suggested LIP5-binding site. CD spectroscopy indicated that wild-type AQP2 and the phospho-mimicking mutants had similar overall structure but displayed differences in melting temperatures possibly arising from C-terminal conformational changes. Non-phosphorylated AQP2 bound LIP5 with the highest affinity, whereas AQP2-ΔP242 had 20-fold lower affinity as determined by microscale thermophoresis. AQP2-S256E, S261E, T269E, and S256E/T269E all had reduced affinity. This effect was most prominent for AQP2-S256E, which fits well with its role in apical membrane targeting. AQP2-S264E had affinity similar to non-phosphorylated AQP2, possibly indicating a role in exosome excretion. Our data suggest that AQP2 phosphorylation allosterically controls its interaction with LIP5, illustrating how altered affinities to interacting proteins form the basis for regulation of AQP2 trafficking by post-translational modifications. © 2017 by The American Society for

  8. ORF Alignment: NC_003197 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Salmonella typhimurium LT2] ... Length = 269 ... Query: 23 ... PFHILAKPIGPACNLACRYCYYPQGETPVEKMNESTLE...IFICRYIAAQPASAREINFVWQ 82 ... PFHILAKPIGPACNLACRYCYYPQGETPVEKMNESTLEIF...ICRYIAAQPASAREINFVWQ Sbjct: 1 ... PFHILAKPIGPACNLACRYCYYPQGETPVEKMNESTLEIFICRYIAAQPASAREINFVWQ 60 ... Query: 143

  9. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GPACNLACRYCYYPQGETPVEKMNESTLEVFICRYIAAQPASAREINFVWQ 82 ... PFHILAKPIGPACNLACRYCYYPQGETPVEKMNESTLEVFIC...RYIAAQPASAREINFVWQ Sbjct: 1 ... PFHILAKPIGPACNLACRYCYYPQGETPVEKMNESTLEVFICRYIAAQPASAREINFVWQ 60 ... Query: 143 GS... ... Choleraesuis str. SC-B67] ... Length = 269 ... Query: 23 ... PFHILAKPI

  10. Transforming growth factor-β1 induces expression of human coagulation factor XII via Smad3 and JNK signaling pathways in human lung fibroblasts.

    Science.gov (United States)

    Jablonska, Ewa; Markart, Philipp; Zakrzewicz, Dariusz; Preissner, Klaus T; Wygrecka, Malgorzata

    2010-04-09

    Coagulation factor XII (FXII) is a liver-derived serine protease involved in fibrinolysis, coagulation, and inflammation. The regulation of FXII expression is largely unknown. Transforming growth factor-beta1 (TGF-beta1) is a multifunctional cytokine that has been linked to several pathological processes, including tissue fibrosis by modulating procoagulant and fibrinolytic activities. This study investigated whether TGF-beta1 may regulate FXII expression in human lung fibroblasts. Treatment of human lung fibroblasts with TGF-beta1 resulted in a time-dependent increase in FXII production, activation of p44/42, p38, JNK, and Akt, and phosphorylation and translocation into the nucleus of Smad3. However, TGF-beta1-induced FXII expression was repressed only by the JNK inhibitor and JNK and Smad3 antisense oligonucleotides but not by MEK, p38, or phosphoinositide 3-kinase blockers. JNK inhibition had no effect on TGF-beta1-induced Smad3 phosphorylation, association with Smad4, and its translocation into the nucleus but strongly suppressed Smad3-DNA complex formation. FXII promoter analysis revealed that the -299/+1 region was sufficient for TGF-beta1 to induce FXII expression. Sequence analysis of this region detected a potential Smad-binding element at position -272/-269 (SBE-(-272/-269)). Chromatin immunoprecipitation and streptavidin pulldown assays demonstrated TGF-beta1-dependent Smad3 binding to SBE-(-272/-269). Mutation or deletion of SBE-(-272/-269) substantially reduced TGF-beta1-mediated activation of the FXII promoter. Clinical relevance was demonstrated by elevated FXII levels and its co-localization with fibroblasts in the lungs of patients with acute respiratory distress syndrome. Our results show that JNK/Smad3 pathway plays a critical role in TGF-beta1-induced FXII expression in human lung fibroblasts and implicate its possible involvement in pathological conditions characterized by elevated TGF-beta1 levels.

  11. 17 CFR 269.10 - Form TH-Notification of reliance on temporary hardship exemption.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form TH-Notification of....10 Form TH—Notification of reliance on temporary hardship exemption. Form TH shall be filed by any...: For Federal Register citations affecting Form TH, see the List of CFR Sections Affected, which appears...

  12. A novel nonsense mutation of the GPR143 gene identified in a Chinese pedigree with ocular albinism.

    Directory of Open Access Journals (Sweden)

    Naihong Yan

    Full Text Available BACKGROUND: The purpose of this study was to elucidate the molecular basis of ocular albinism type I in a Chinese pedigree. METHODOLOGY/PRINCIPAL FINDINGS: Complete ophthalmologic examinations were performed on 4 patients, 7 carriers and 17 unaffected individuals in this five-generation family. All coding exons of four-point-one (4.1, ezrin, radixin, moesin (FERM domain-containing 7 (FRMD7 and G protein-coupled receptor 143 (GPR143 genes were amplified by polymerase chain reaction (PCR, sequenced and compared with a reference database. Ocular albinism and nystagmus were found in all patients of this family. Macular hypoplasia was present in the patients including the proband. A novel nonsense hemizygous mutation c.807T>A in the GPR143 gene was identified in four patients and the heterozygous mutation was found in seven asymptomatic individuals. This mutation is a substitution of tyrosine for adenine which leads to a premature stop codon at position 269 (p.Y269X of GPR143. CONCLUSIONS/SIGNIFICANCE: This is the first report that p.Y269X mutation of GPR143 gene is responsible for the pathogenesis of familial ocular albinism. These results expand the mutation spectrum of GPR143, and demonstrate the clinical characteristics of ocular albinism type I in Chinese population.

  13. Basolateral cholesterol depletion alters Aquaporin-2 post-translational modifications and disrupts apical plasma membrane targeting.

    Science.gov (United States)

    Moeller, Hanne B; Fuglsang, Cecilia Hvitfeldt; Pedersen, Cecilie Nøhr; Fenton, Robert A

    2018-01-01

    Apical plasma membrane accumulation of the water channel Aquaporin-2 (AQP2) in kidney collecting duct principal cells is critical for body water homeostasis. Posttranslational modification (PTM) of AQP2 is important for regulating AQP2 trafficking. The aim of this study was to determine the role of cholesterol in regulation of AQP2 PTM and in apical plasma membrane targeting of AQP2. Cholesterol depletion from the basolateral plasma membrane of a collecting duct cell line (mpkCCD14) using methyl-beta-cyclodextrin (MBCD) increased AQP2 ubiquitylation. Forskolin, cAMP or dDAVP-mediated AQP2 phosphorylation at Ser269 (pS269-AQP2) was prevented by cholesterol depletion from the basolateral membrane. None of these effects on pS269-AQP2 were observed when cholesterol was depleted from the apical side of cells, or when MBCD was applied subsequent to dDAVP stimulation. Basolateral, but not apical, MBCD application prevented cAMP-induced apical plasma membrane accumulation of AQP2. These studies indicate that manipulation of the cholesterol content of the basolateral plasma membrane interferes with AQP2 PTM and subsequently regulated apical plasma membrane targeting of AQP2. Copyright © 2017 Elsevier Inc. All rights reserved.

  14. 77 FR 14832 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2012-03-13

    ... workers from Kelly Services. 81,269 Cummins Filtration, A Cookeville, TN...... December 11, 2011...,302 American Technical Huntington Station, February 6, 2011. Ceramics New York Office, NY. AVX...

  15. K problému odpovědnosti u Ágnes Hellerové

    Czech Academy of Sciences Publication Activity Database

    Hála, Vlastimil

    2012-01-01

    Roč. 67, č. 4 (2012), s. 269-281 ISSN 0046-385X Institutional support: RVO:67985955 Keywords : Á. Heller * ethics * moral philosophy * responsibility * autonomy Subject RIV: AA - Philosophy ; Religion

  16. Nález zásobnic ze střední doby hradištní u závrtu ZMF (Tetín, okr. Beroun)

    Czech Academy of Sciences Publication Activity Database

    Vencl, Slavomil

    2015-01-01

    Roč. 19, č. 1 (2015), s. 263-269 ISSN 1214-3553 Institutional support: RVO:67985912 Keywords : Middle Hillfort Period * storage jars * Bohemian Karst Subject RIV: AC - Archeology, Anthropology, Ethnology

  17. Effect of caffeine on the expression of a major X-ray induced protein in human tumor cells

    Energy Technology Data Exchange (ETDEWEB)

    Hughes, E.N.; Boothman, D.A. (Univ. of Pennsylvania School of Medicine, Philadelphia (USA))

    1991-03-01

    We have examined the effect of caffeine on the concomitant processes of the repair of potentially lethal damage (PLD) and the synthesis of X-ray-induced proteins in the human malignant melanoma cell line, Ul-Mel. Caffeine administered at a dose of 5mM after X radiation not only inhibited PLD repair but also markedly reduced the level of XIP269, a major X-ray-induced protein whose expression has been shown to correlate with the capacity to repair PLD. The expression of the vast majority of other cellular proteins, including seven other X-ray-induced proteins, remained unchanged following caffeine treatment. A possible role for XIP269 in cell cycle delay following DNA damage by X irradiation is discussed.

  18. Mosquito cell line C6/36 shows resistence to Cyt1Aa6

    Czech Academy of Sciences Publication Activity Database

    Zhang, L.; Huang, E.; Tang, B.; Guan, X.; Gelbič, Ivan

    2012-01-01

    Roč. 50, č. 4 (2012), s. 265-269 ISSN 0019-5189 R&D Projects: GA MŠk 2B08003 Grant - others:National Nature Science Foundation of China(CN) 31071745; Science Foundation of the Ministry of Education of China(CN) 20093515110010; Science Foundation of the Ministry of Education of China(CN) 20093515120010; Transformation Fund for Agricultural Science and Technology Achievements(CN) 2010GB2C400212; Fujian Colleges and Universities for the Development of the West Strait(CN) 0b08b005 Institutional research plan: CEZ:AV0Z50070508 Keywords : Bacillus thuringiensis * C6/36 cells * indirect immunofluorescence assay Subject RIV: ED - Physiology Impact factor: 1.195, year: 2012 http://nopr.niscair.res.in/bitstream/123456789/13748/1/IJEB%2050(4)%20265-269.pdf

  19. 20 CFR 437.50 - Closeout.

    Science.gov (United States)

    2010-04-01

    ...) Final request for payment (SF-270) (if applicable). (iv) Invention disclosure (if applicable). (v... are not limited to: (i) Final performance or progress report. (ii) Financial Status Report (SF 269) or...

  20. Influence of plasma density and plasma sheath dynamics on the ion implantation by plasma immersion technique

    OpenAIRE

    Ensinger, Wolfgang

    1996-01-01

    Influence of plasma density and plasma sheath dynamics on the ion implantation by plasma immersion technique / B. Rauschenbach ... - In: Nuclear instruments and methods in physics research. B. 113. 1996. S. 266-269

  1. Genetic differentiation of watermelon landraces in Mozambique ...

    African Journals Online (AJOL)

    Ezedom Theresa

    2013-09-04

    Sep 4, 2013 ... country, were analysed to assess their genetic differentiation. Ninety-six accessions (269 .... In view of developing national and regional strategies ... with fluorescent labelling of the products according to Schuelke. (2000).

  2. Aulacoseira kruegeriana (Bacillariophyta, Coscinodiscophyceae): a new centric diatom from high-elevation Andean streams of Bolivia

    Czech Academy of Sciences Publication Activity Database

    Morales, E. A.; Rivera, S. F.; Rubin, S. D. C.; Vis, M. L.; Houk, Václav

    2015-01-01

    Roč. 30, č. 3 (2015), s. 269-277 ISSN 0269-249X Institutional support: RVO:67985939 Keywords : centric diatoms * taxonomy * valve ultrastructure Subject RIV: EF - Botanics Impact factor: 1.868, year: 2015

  3. Article

    African Journals Online (AJOL)

    2010-12-03

    Dec 3, 2010 ... Continuing education in geriatrics for rural health care providers in ... Nursing Officer, Continuing Professional Development, Mulago National Referral and Teaching Hospital, ..... Nurs Educ Today 2006;26(4):269-276. 15.

  4. Kodanik / Luciano Canfora ; tõlk. Kattri Türk

    Index Scriptorium Estoniae

    Canfora, Luciano

    2001-01-01

    Linnriikide poliitilised süsteemid ja sotsiaal-majanduslikud raamid. Lisad: Herodotos. Ajalugu, III, 80-82 ; Ateena kodakondsuse andmine samostlastele ; Plutarchos Periklesest ; Pseudo-Xenophon. Ateena riigikord, II ; Aristoteles. Poliitika, 126-269 ; Thukidides II, IV

  5. Cadmium and lead contamination in japonica rice grains and its variation among the different locations in southeast China

    International Nuclear Information System (INIS)

    Cheng Fangmin; Zhao Ningchun; Xu Haiming; Li Yi; Zhang Wenfang; Zhu Zhiwei; Chen Mingxue

    2006-01-01

    On the basis of a large-scale survey with 269 sampling sites and a field experiment with 12 cultivars grown at 3 ecologically different locations, Cadmium (Cd) and lead (Pb) contamination in milled rice grains and its variation among different locations were investigated in the area of southeast China. The objective of this study was mainly to assess the present situation of Cd and Pb contamination in rice grains harvested locally and find out the variation of Cd and Pb background levels in rice grains among the diverse regional locations. The results showed that: a) Cd concentrations in milled rice grains ranged from trace (below 10 ng/g) to 340 ng/g, with the means of 81.4 ng/g (AM) and 55.2 ng/g (GM) for the 269 samples, whereas Pb concentrations ranged from trace (below 10 ng/g) to 1136 ng/g, with the means of 113.5 ng/g (AM) and 51.0 ng/g (GM), respectively. High frequency was observed for both the Cd and Pb concentrations ranging from trace to 200 ng/g, with 95.9% for Cd and 84.8% for Pb, respectively. b) ANOVA for the AMs and GMs among 269 sampling sites indicated that there were significant differences among the different spatial locations in Cd or Pb concentrations. c) The Cd concentrations in milled rice grains were poorly correlated with Pb concentration among the 269 sampling sites surveyed, and no significant difference (P > 0.05) in the AMs or GMs of Cd and Pb concentration was observed among different cities within a range of the same provinces, only with an exception for 1-2 provinces. d) Variance analysis of Cd, Pb concentrations for 12 rice cultivars grown in three locations showed that the great difference in coefficients of variation (CV) was observed both among cultivars grown in the same location and among locations of cultivars planted, in which locations showed much more contribution to the variation of Cd or Pb concentration in milled rice grains as compared with cultivars

  6. SECAGEM DE SEMENTES DE SOJA EM SILO COM DISTRIBUIÇÃO RADIAL DO FLUXO DE AR: I. MONITORAMENTO FÍSICO DRYING OF SOYBEAN SEEDS IN A RADIAL AIR FLOW DRYER: I. PHYSICAL MONITORING

    Directory of Open Access Journals (Sweden)

    LUIZ CARLOS MIRANDA

    1999-11-01

    Full Text Available O trabalho foi desenvolvido com o objetivo de avaliar a evolução física do processo de remoção de água das sementes em secador estacionário, com cilindro central perfurado e distribuição radical de ar. A pesquisa foi conduzida com sementes de soja, variando o fluxo (26,9, 28,4 e 33,2 m³/minuto/t e a temperatura do ar insuflado (42, 46 e 50ºC, considerando a posição das sementes (17, 34 e 51 cm em relação ao cilindro de insuflação e o tempo de secagem (zero a doze horas, com intervalos de duas horas. Foram caracterizados o ar ambiente, o ar insuflado, as temperaturas e os teores de água da massa, as velocidades e curvas de secagem. As avaliações realizadas destacaram vantagens físicas operacionais da combinação de 28,4 m³/minuto/t com 46ºC e o contrário, com a combinação de 26,9 m³/minuto/t com 42ºC.The purpose of this research was to study several physical parameters of soybean seed drying submitted to stationary process with radial air distribution by combining different air flows (26.9, 28.4 and 33.2 m³/minute/ton and temperatures (42, 46 and 50ºC, considering seed positions in the seed mass (17, 34 and 51 cm in relation to the insuflation cylinder and drying periods (zero to twelve hours with two-hour intervals. Environmental air, insuflation air, seed temperatures, moisture content of seeds, drying speed and drying curves were characterized. Considering the evaluated parameters during the drying process, the physical advantages of the combination of 28.4 m³/minute/ton with 46ºC, and the desadvantage of the combination of 26.9 m³/minute/ton with 42ºC were observed.

  7. Calix[4]arenes Containing a Ureido Functionality on the Lower Rim as Highly Efficient Receptors for Anion Recognition.

    Czech Academy of Sciences Publication Activity Database

    Klejch, T.; Slavíček, J.; Hudeček, O.; Eigner, V.; Gutierrez, Natalia Andrea; Cuřínová, Petra; Lhoták, P.

    2016-01-01

    Roč. 40, č. 9 (2016), s. 7935-7942 ISSN 1144-0546 Institutional support: RVO:67985858 Keywords : calix[4]arene * anion recognition * receptors Subject RIV: CC - Organic Chemistry Impact factor: 3.269, year: 2016

  8. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    269 ... Symmetry energy; density dependence; nuclear matter. Abstract. The nuclear symmetry energy is a fundamental quantity important for studying the structure of systems as diverse as the atomic nucleus and the neutron star. Considerable ...

  9. 76 FR 52565 - Drawbridge Operation Regulation; Illinois Waterway, Joliet, IL

    Science.gov (United States)

    2011-08-23

    ...: If you have questions on this rule, call or email Eric A. Washburn, Bridge Administrator, Western Rivers, Coast Guard; telephone (314) 269-2378, e-mail [email protected] uscg.mil . If you have questions on...

  10. Re-launch of Phytocoenologia: new profile for the classic vegetation ecology journal

    Czech Academy of Sciences Publication Activity Database

    Bergmeier, E.; Dengler, J.; Janišová, M.; Jansen, F.; Krestov, P.; Roleček, Jan; Walker, D. A.; Willner, W.

    2015-01-01

    Roč. 45, 1-2 (2015), s. 1-10 ISSN 0340-269X Institutional support: RVO:67985939 Keywords : vegetation classification * new journal policy * editorial Subject RIV: EH - Ecology, Behaviour Impact factor: 1.828, year: 2015

  11. Mechanisms of metal toxicity in plants

    Czech Academy of Sciences Publication Activity Database

    Küpper, Hendrik; Andresen, Elisa

    2016-01-01

    Roč. 8, č. 3 (2016), s. 269-285 ISSN 1756-5901 Institutional support: RVO:60077344 Keywords : Hyperaccumulator thlaspi-caerulescens * Induced oxidative stress * Iron toxicity Subject RIV: CE - Biochemistry Impact factor: 3.975, year: 2016

  12. Microsporidia in a woodland pool I. Lanatospora costata sp. n. (Opisthosporidia, Microsporidia), parasite of Megacyclops viridis (Crustacea, Copepoda): fine structure and molecular phylogeny

    Czech Academy of Sciences Publication Activity Database

    Vávra, Jiří; Hyliš, M.; Fiala, Ivan; Refardt, D.; Larsson, J.I.R.

    2016-01-01

    Roč. 55, č. 4 (2016), s. 269-280 ISSN 0065-1583 Institutional support: RVO:60077344 Keywords : microsporidian parasite * Megacyclops viridis * SSU rRNA Subject RIV: EE - Microbiology, Virology Impact factor: 1.481, year: 2016

  13. Binding of low molecular mass compounds to proteins studied by liquid chromatographic techniques

    Czech Academy of Sciences Publication Activity Database

    Cserháti, T.; Forgács, E.; Deyl, Zdeněk; Mikšík, Ivan; Eckhardt, Adam

    2003-01-01

    Roč. 17, č. 6 (2003), s. 353-360 ISSN 0269-3879 Institutional research plan: CEZ:AV0Z5011922 Keywords : protein binding Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 1.269, year: 2003

  14. Offspring sex ratio variation in relation to brood size and mortality in a promiscuous species: the Aquatic Warbler Acrocephalus paludicola

    Czech Academy of Sciences Publication Activity Database

    Dyrcz, A.; Sauer-Gurth, H.; Tkadlec, Emil; Wink, M.

    2004-01-01

    Roč. 146, č. 2 (2004), s. 269-280 ISSN 0019-1019 Institutional research plan: CEZ:AV0Z6093917 Keywords : adaptive modification * birds * reproduction Subject RIV: EG - Zoology Impact factor: 1.206, year: 2004

  15. Butenolides from Plant-Derived Smoke: Natural Plant-Growth Regulators with Antagonistic Actions on Seed Germination

    Czech Academy of Sciences Publication Activity Database

    Light, M. E.; Burger, B. V.; Staerk, D.; Kohout, Ladislav; van Staden, J.

    2010-01-01

    Roč. 73, č. 2 (2010), s. 267-269 ISSN 0163-3864 Institutional research plan: CEZ:AV0Z40550506 Keywords : butenolides * karrikins * brassinosteroids Subject RIV: CC - Organic Chemistry Impact factor: 2.872, year: 2010

  16. Každodenní život městských protestantských komunit pozdního 18. století. Brno a nové Město na Moravě

    Czech Academy of Sciences Publication Activity Database

    Bolom-Kotari, Sixtus

    2014-01-01

    Roč. 33, č. 1 (2014), s. 269-298 ISSN 0231-7443 Institutional support: RVO:67985963 Keywords : 1781 * Brno * Nové Město na Moravě * Edict of Tolerance * Enlightenment * Protestantism Subject RIV: AB - History

  17. 29 CFR 780.708 - A country elevator is located near and serves farmers.

    Science.gov (United States)

    2010-07-01

    ... or pledged to the Government under a price-support program. Country elevators customarily receive.... Kan.) 14 WH Cases 269; Tobin v. Flour Mills, 185 F. 2d 596; Holt v. Barnesville Elevator Co., 145 F...

  18. Potential vorticity field in the Bay of Bengal during southwest monsoon

    Digital Repository Service at National Institute of Oceanography (India)

    Murty, V.S.N.; Rao, D.P.

    theta), potential vorticity distribution is complex due to wind and freshwater forcings. The beta -effect dominates the potential vorticity field on 26.9 sigma theta isopycnal. The field of potential vorticity closely follows that of circulation...

  19. Networks of neurons, networks of genes: An integrated view of memory consolidation

    Czech Academy of Sciences Publication Activity Database

    Miyashita, T.; Kubík, Štěpán; Lewandowski, G.; Guzowski, J. F.

    2008-01-01

    Roč. 89, č. 3 (2008), s. 269-284 ISSN 1074-7427 Institutional research plan: CEZ:AV0Z50110509 Keywords : hippocampus * immediate-early genes * arc Subject RIV: FH - Neurology Impact factor: 3.757, year: 2008

  20. 2003 Reson 8101ER Multibeam Sonar Data from Cruise OES-03-07/AHI-03-07, Data Set Name Guam.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Reson 8101ER multibeam Data were collected between 22-26 September 2003 (JD 265-269) aboard NOAA Survey Launch Acoustic Habitat Investigator (AHI) at Guam Island in...

  1. Lurking: a challenge or a fruitful strategy? A comparison between lurkers and active participants in an online corporate community of practice

    NARCIS (Netherlands)

    Mirjam, Neelen; Sibren, Fetter

    2011-01-01

    Neelen, M., & Fetter, S. (2010). Lurking: a challenge or a fruitful strategy? A comparison between lurkers and active participants in an online corporate community of practice. International Journal of Knowledge and Learning, 6(4), 269-284.

  2. In-silico driven engineering of enantioselectivity of a penicillin G acylase towards active pharmaceutical ingredients

    Czech Academy of Sciences Publication Activity Database

    Grulich, Michal; Brezovský, J.; Štěpánek, Václav; Palyzová, Andrea; Marešová, Helena; Zahradník, Jiří; Kyslíková, Eva; Kyslík, Pavel

    2016-01-01

    Roč. 133, Supplement 1 (2016), s. 53-59 ISSN 1381-1177 Institutional support: RVO:61388971 Keywords : Docking experiments * Enantioselectivity * Penicillin G acylase Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 2.269, year: 2016

  3. 28 Comparative Study of Open Mesh Repair and Desarda's No ...

    African Journals Online (AJOL)

    user

    2006-12-02

    Dec 2, 2006 ... Methods: This is a retrospective study of 269 hernias operated by the ... principle and this concept of physiological repair of inguinal hernia ... laparoscopic repairs or the patients given .... 11 obstructed and 17 bilateral hernias.

  4. Environnement sanitaire de l'enfant dans la region centrale du Togo ...

    African Journals Online (AJOL)

    The early-learning games (36.5%) and games of skill (26.9%) were the most used traditional ... and social development, but favourable to various pathologic outbreaks mostly targets of the strategy of PCIMNE ... AJOL African Journals Online.

  5. The how of WOW: a guide to giving a speech that will positively blow 'em away

    National Research Council Canada - National Science Library

    Carlson, Tony

    2005-01-01

    ... Your Speech 249 Appendix D- How About the ROI? 265 Index 269 ... 11182$ CNTS 01-19-05 10:15:57 PS PAGE vi AcknowledgmentsAcknowledgments In the general chatter after a major speech given by a client ...

  6. Cash flow vs. collateral-based credit: performance of micro, small and medium-sized firms in transition economies

    Czech Academy of Sciences Publication Activity Database

    Cassano, F.; Joeveer, K.; Švejnar, Jan

    2013-01-01

    Roč. 21, č. 2 (2013), s. 269-300 ISSN 0967-0750 Institutional support: RVO:67985998 Keywords : micro, small and medium-sized enterprises * bank credit * firm performance Subject RIV: AH - Economics Impact factor: 0.755, year: 2013

  7. Chemical Interactions of Surface-Active Agents with Growing Resorcinol-Formaldehyde Gels

    Czech Academy of Sciences Publication Activity Database

    Jirglová, Hana; Maldonato-Hódar, F. J.

    2010-01-01

    Roč. 26, č. 20 (2010), s. 16103-16109 ISSN 0743-7463 Institutional research plan: CEZ:AV0Z40400503 Keywords : chemical interactions * FTIR * physical chemistry Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.269, year: 2010

  8. Impact of phase I or phase II enzyme polymorphisms on lymphocyte DNA adducts in subjects exposed to urban air pollution and environmental tobacco smoke

    Czech Academy of Sciences Publication Activity Database

    Georgiadis, P.; Demopoulos, N. A.; Topinka, Jan; Stephanou, G.; Stoikidou, M.; Bekyrou, M.; Katsouyianni, K.; Šrám, Radim; Autrup, H.; Kyrtopoulos, S. A.

    2004-01-01

    Roč. 149, 1-3 (2004), s. 269-280 ISSN 0378-4274 Institutional research plan: CEZ:AV0Z5039906 Keywords : DNA adducts Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 2.571, year: 2004

  9. Laccase-catalyzed dimerization of glycosylated lignols

    Czech Academy of Sciences Publication Activity Database

    Bassanini, I.; Gavezzotti, P.; Monti, D.; Krejzová, Jana; Křen, Vladimír; Riva, S.

    2016-01-01

    Roč. 134, SI (2016), s. 295-301 ISSN 1381-1177 R&D Projects: GA MŠk(CZ) LD15085 Institutional support: RVO:61388971 Keywords : Biocatalysis * Biooxidation * Laccase Subject RIV: CE - Biochemistry Impact factor: 2.269, year: 2016

  10. Cloud MicroAtlas∗

    Indian Academy of Sciences (India)

    ∗Any resemblance to the title of David Mitchell's book is purely intentional! RESONANCE | March 2017. 269 .... The most comprehensive reference we know of on the subject of cloud microphysics is the book .... Economic and. Political Weekly ...

  11. Psychosocial constructs and postintervention changes in physical activity and dietary outcomes in a lifestyle intervention, HUB City Steps, 2010

    Science.gov (United States)

    Purpose: To examine relationships among psychosocial constructs (PSC) of behavior change and post-intervention changes in physical activity (PA) and dietary outcomes. Design: Non-controlled, pre- post-experimental intervention. Setting: Midsized, southern United States city. Subjects: 269 prima...

  12. Training Programme for Supervisors. An Element in Quality Assurance of the Construction Industry.

    Science.gov (United States)

    Lo, Tommy Y.

    1998-01-01

    A customized program on concrete technology for the construction industry in Hong Kong is based on the ISO 9000 quality management system. More than 269 students have been trained; 48.7% of enrollment comes from concrete suppliers. (SK)

  13. By, With, and Through: The Theory and Practice of Special Operations Capacity-Building

    Science.gov (United States)

    2014-12-01

    agricultural matters; legal and immigration matters; and, developmental and humanitarian aid matters.”109 Ultimately, short of war, the Department...Cone ( Chile , Argentina, Brazil, Uruguay, Paraguay).269 Within these regions, USSOUTHCOM focused intently on partnership, engagement, and capacity

  14. Genetic polymorphisms in DNA repair and oxidative stress pathways may modify the association between body size and postmenopausal breast cancer

    Czech Academy of Sciences Publication Activity Database

    McCullough, L. E.; Eng, S. M.; Bradshaw, P. T.; Cleveland, R. J.; Steck, S. E.; Terry, M. B.; Shen, J.; Crew, K.D.; Rössner ml., Pavel; Ahn, J.; Ambrosone, Ch.B.; Teitelbaum, S. L.; Neugut, A. I.; Santella, R. M.; Gammon, M. D.

    2015-01-01

    Roč. 25, č. 4 (2015), s. 263-269 ISSN 1047-2797 Institutional support: RVO:68378041 Keywords : breast cancer * body mass index * oxidative stress * DNA repair * Epidemiology Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.335, year: 2015

  15. Znalost pomístních jmen v Jemnici a ve Lhoticích

    Czech Academy of Sciences Publication Activity Database

    Konečná, Hana

    2010-01-01

    Roč. 51, č. 1 (2010), s. 269-298 ISSN 1211-4413 R&D Projects: GA ČR GA405/08/0703 Institutional research plan: CEZ:AV0Z90610518 Keywords : anoikonyms * Jemnice * Lhotice * survey Subject RIV: AI - Linguistics

  16. : tous les projets | Page 639 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: INFORMATION TECHNOLOGY, TELECOMMUNICATIONS NETWORKS, COMPUTER PROGRAMS, SOFTWARE ENGINEERING, UNIVERSITIES. Région: North of Sahara, South of Sahara, Morocco. Financement total : CA$ 269,138.00. Plate-forme d'outils en logiciel libre pour l'enseignement supérieur. Projet.

  17. Feeding ecology and phylogenetic structure of a complex neotropical termite assemblage, revealed by nitrogen stable isotope ratios

    Czech Academy of Sciences Publication Activity Database

    Bourguignon, T.; Šobotník, Jan; Lepoint, G.; Martin, J. M.; Hardy, O. J.; Dejean, A.; Roisin, Y.

    2011-01-01

    Roč. 36, č. 2 (2011), s. 261-269 ISSN 0307-6946 Institutional research plan: CEZ:AV0Z40550506 Keywords : diet diversity * feeding groups * Isoptera * phylogenetic autocorrelation Subject RIV: CC - Organic Chemistry Impact factor: 1.995, year: 2011

  18. Organoclays with Carbosilane Dendrimers Containing Ammonium or Phosphonium Groups.

    Czech Academy of Sciences Publication Activity Database

    Müllerová, Monika; Šabata, Stanislav; Matoušek, J.; Kormunda, M.; Holubová, J.; Bálková, R.; Petričkovič, Roman; Koštejn, M.; Kupčík, Jaroslav; Fajgar, Radek; Strašák, Tomáš

    2018-01-01

    Roč. 42, č. 2 (2018), s. 1187-1196 ISSN 1144-0546 Institutional support: RVO:67985858 Keywords : organic -inorganic nanocomposites * layered silicates * thermal-stability Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 3.269, year: 2016

  19. http://www.bioline.org.br/js 15 Practices of Makerere University ...

    African Journals Online (AJOL)

    jen

    anatomy dissection are fundamental to the learning of human anatomy and eventual practice of medicine. ... Results:The overall response rate was 26.9%. Of the 82 ... manual and dissecting show significant sexual bias. There is a need to ...

  20. Significance of uniaxial and hydrostatic pressure studies on ancient oceanic rocks in tectonics

    Digital Repository Service at National Institute of Oceanography (India)

    Sarma, K.V.L.N.S.; Ramana, Y.V.

    showed the lowest value of compressive strength (45 MPa) and pyroxenite gave the highest value (269 MPa), while meta volcanics exhibited narrow limits of 58 to 245 MPa. Standard correlations were obtained for compressive strength to G/P ratio...

  1. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    . Articles written in Journal of Earth System Science. Volume 124 Issue 1 February 2015 pp 269-281. Climate change and its role in forecasting energy demand in buildings: A case study of Douala City, Cameroon · Modeste Kameni ...

  2. Fullerene decomposition induced by near-infrared laser radiation studied by real-time turbidimetry

    Czech Academy of Sciences Publication Activity Database

    Juha, Libor; Ehrenberg, B.; Couris, S.; Koudoumas, E.; Hamplová, Věra; Pokorná, Zdeňka; Müllerová, Andrea; Pavel, Miroslav

    1999-01-01

    Roč. 313, - (1999), s. 431-436 ISSN 0009-2614 R&D Projects: GA MŠk ME 328 Institutional research plan: CEZ:AV0Z1010914 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.269, year: 1999

  3. Diffusive Mixing of Polymers Investigated by Raman Microspectroscopy and Microrheology

    Czech Academy of Sciences Publication Activity Database

    Jonáš, Alexandr; De Luca, A.C.; Pesce, G.; Rusciano, G.; Sasso, A.; Caserta, S.; Guido, S.; Marrucci, G.

    2010-01-01

    Roč. 26, č. 17 (2010), s. 14223-14230 ISSN 0743-7463 Institutional research plan: CEZ:AV0Z20650511 Keywords : mutual diffusion * interfacial-tension * immiscible polymers * blends Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 4.269, year: 2010

  4. Two 1 : 1 binding modes for distamycin in the minor groove of d(GGCCAATTGG)

    Czech Academy of Sciences Publication Activity Database

    Uytterhoeven, K.; Šponer, Jiří; Van Meervelt, L.

    2002-01-01

    Roč. 269, č. 12 (2002), s. 2868-2877 ISSN 0014-2956 R&D Projects: GA MŠk LN00A016 Keywords : distamycin * drug-DNA complex * minor groove binder Subject RIV: BO - Biophysics Impact factor: 2.999, year: 2002

  5. Tropical Journal of Pharmaceutical Research - Vol 16, No 2 (2017)

    African Journals Online (AJOL)

    Biosynthesis of lovastatin using agro-industrial wastes as carrier substrates · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Sadia Javed, Munazzah Meraj, Saqib Mahmood, Arruje Hameed, Farah Naz, Sameera Hassan, Rao Irfan, 263-269.

  6. Alloy hardening of a smectic A liquid crystal doped with gold nanoparticles

    Czech Academy of Sciences Publication Activity Database

    Oswald, P.; Milette, J.; Relaix, S.; Reven, L.; Dequidt, A.; Lejček, Lubor

    2013-01-01

    Roč. 103, AUG (2013), "46004-p1"-"46004-p6" ISSN 0295-5075 Institutional support: RVO:68378271 Keywords : smectic A liquid crystals * gold nanoparticles * edge dislocation * precipitation hardening Subject RIV: BK - Fluid Dynamics Impact factor: 2.269, year: 2013

  7. Accumulation of heavy metals by .I.in vitro./I. cultures of plants

    Czech Academy of Sciences Publication Activity Database

    Kališová-Špirochová, I.; Punčochářová, J.; Kafka, Z.; Kubal, M.; Soudek, Petr; Vaněk, Tomáš

    2003-01-01

    Roč. 3, - (2003), s. 269-276 ISSN 1567-7230 R&D Projects: GA MŠk OC 837.10 Institutional research plan: CEZ:AV0Z4055905 Keywords : heavy metals * phytoremediation * sunflower Subject RIV: DK - Soil Contamination ; De-contamination incl. Pesticides

  8. Simulation of Seed Digestion by Birds: How Does It Reflect the Real Passage Through a Pigeon's Gut?

    Czech Academy of Sciences Publication Activity Database

    Vazačová, Kristýna; Münzbergová, Zuzana

    2013-01-01

    Roč. 48, č. 2 (2013), s. 257-269 ISSN 1211-9520 R&D Projects: GA ČR GAP505/10/0593 Institutional support: RVO:67985939 Keywords : Canary Islands * endozoochory * scarification Subject RIV: EF - Botanics Impact factor: 1.612, year: 2013

  9. Formation of Rh-Au core-shell nanoparticles on TiO.sub.2./sub.(110) surface studied by STM and LEIS

    Czech Academy of Sciences Publication Activity Database

    Óvari, L.; Berkó, A.; Balázs, N.; Majzik, Zsolt; Kiss, J.

    2010-01-01

    Roč. 26, č. 3 (2010), s. 2167-2175 ISSN 0743-7463 Institutional research plan: CEZ:AV0Z10100521 Keywords : surface diffusion of gold * STM * LEIS Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.269, year: 2010

  10. Taxislužba - příklad tržní nedokonalosti a regulace

    Czech Academy of Sciences Publication Activity Database

    Benáček, Vladimír

    2007-01-01

    Roč. 2007, č. 5 (2007), s. 5-10 ISSN 1214-1720 R&D Projects: GA ČR GA403/05/2769 Keywords : market imperfections Subject RIV: AH - Economics http://www.socioweb.cz/index.php?disp=temata&shw=269&lst=117

  11. The bubble distribution in glass refining channels

    Czech Academy of Sciences Publication Activity Database

    Němec, Lubomír; Cincibusová, P.

    2005-01-01

    Roč. 49, č. 4 (2005), s. 269-277 ISSN 0862-5468 Institutional research plan: CEZ:AV0Z40320502 Keywords : glass fining * bubble distribution s models * horizontal channel Subject RIV: CA - Inorganic Chemistry Impact factor: 0.463, year: 2005

  12. Coping a rezistencia voči mobbingu v kontexte paradigmatického prístupu

    Czech Academy of Sciences Publication Activity Database

    Vitková, M.; Zábrodská, Kateřina

    2014-01-01

    Roč. 58, č. 3 (2014), s. 254-269 ISSN 0009-062X R&D Projects: GA ČR GA14-02098S Institutional support: RVO:68081740 Keywords : coping * rezistencia * mobbing Subject RIV: AN - Psychology Impact factor: 0.239, year: 2014

  13. Mapping the ribonucleolytic active site of bovine seminal ribonuclease. The binding of pyrimidinyl phosphonucleotide inhibitors

    Czech Academy of Sciences Publication Activity Database

    Dossi, K.; Tsirkone, V.G.; Hayes, J.M.; Matoušek, Josef; Poučková, P.; Souček, J.; Zadinová, M.; Zographos, S.E.; Leonidas, D.D.

    2009-01-01

    Roč. 44, č. 11 (2009), s. 4496-4508 ISSN 0223-5234 Institutional research plan: CEZ:AV0Z50450515 Keywords : bovine seminal ribonuclease * antitumor agent Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.269, year: 2009

  14. Enantiomeric separation of triacylglycerols containing polyunsaturated fatty acids with 18 carbon atoms

    Czech Academy of Sciences Publication Activity Database

    Řezanka, Tomáš; Nedbalová, L.; Sigler, Karel

    2016-01-01

    Roč. 1467, October (2016), s. 261-269 ISSN 0021-9673 R&D Projects: GA ČR GA14-00227S Institutional support: RVO:61388971 Keywords : Chiral triacylglycerols * Enantiomers * Regioisomers Subject RIV: EE - Microbiology, Virology Impact factor: 3.981, year: 2016

  15. Histological aspects of the small intestine under variable feed restriction: The effects of short and intense restriction on a growing rabbit model

    Czech Academy of Sciences Publication Activity Database

    Makovický, P.; Tůmová, E.; Volek, Z.; Makovický, P.; Vodička, Pavel

    2014-01-01

    Roč. 8, č. 5 (2014), s. 1623-1627 ISSN 1792-0981 R&D Projects: GA MZd(CZ) NT13424 Institutional support: RVO:68378041 Keywords : histopathology * nutrition * rabbit Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.269, year: 2014

  16. Biswas, Dr Gautam

    Indian Academy of Sciences (India)

    Specialization: Enhancement of Heat Transfer, Computational Fluid Dynamics, Bubble Growth in Film Boiling, Free Surface Flows, Turbulence& Turbomachinery Address: Director, Indian Institute of Technology, Guwahati 781 039, Assam Contact: Office: (0361) 269 0401, (0361) 258 2005. Residence: (0361) 258 4001

  17. Integrating Professional Development across the Curriculum: An Effectiveness Study

    Science.gov (United States)

    Ciarocco, Natalie J.; Dinella, Lisa M.; Hatchard, Christine J.; Valosin, Jayde

    2016-01-01

    The current study empirically tested the effectiveness of a modular approach to integrating professional development across an undergraduate psychology curriculum. Researchers conducted a two-group, between-subjects experiment on 269 undergraduate psychology students assessing perceptions of professional preparedness and learning. Analysis…

  18. Nevada Isostatic Gravity Grid

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A 2 kilometer Isostatic anomaly grid for the state of Nevada. Number of columns is 269 and number of rows is 394. The order of the data is from the lower left to the...

  19. Why and how people engage in social comparison while learning social skills in groups.

    NARCIS (Netherlands)

    Buunk, Abraham (Bram); Cohen-Schotanus, J; Nek, R.H.

    This study was conducted among 269 medical students who participated in educational training groups. Self-evaluation was the most important motive to engage in social comparison with other group members, followed by, respectively, self-enhancement and self-improvement. Upward comparisons (i.e., with

  20. Five-Year Follow-Up of Supportive Psychodynamic Psychotherapy in First-Episode Psychosis

    DEFF Research Database (Denmark)

    Harder, Susanne; Køster, Anne; Valbak, Kristian

    2014-01-01

    up for 5 years (N = 269). The SPP targeted interpersonal relationships, emotion regulation, social cognition, and self-coherence. RESULTS: Significant between-group effects in favor of SPP+ST on social functioning, overall symptoms, and positive psychotic symptoms were found during the period...

  1. 7 CFR 1290.9 - Reporting and oversight requirements.

    Science.gov (United States)

    2010-01-01

    ... project with telephone number and e-mail address. (c) A final SF-269A “Financial Status Report (Short Form... 1290.9 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE SPECIALTY...

  2. Electrorheology of polyaniline, carbonized polyaniline, and their core-shell composites

    Czech Academy of Sciences Publication Activity Database

    Sedlacik, M.; Pavlinek, V.; Mrlik, M.; Morávková, Zuzana; Hajná, Milena; Trchová, Miroslava; Stejskal, Jaroslav

    2013-01-01

    Roč. 101, 15 June (2013), s. 90-92 ISSN 0167-577X R&D Projects: GA ČR GA202/09/1626 Institutional support: RVO:61389013 Keywords : polyaniline * carbonization * carbonized polyaniline Subject RIV: BK - Fluid Dynamics Impact factor: 2.269, year: 2013

  3. Comment on Award on Jurisdiction in Binder Case Appealed at the Czech Courts

    Czech Academy of Sciences Publication Activity Database

    Balaš, Vladimír

    -, č. 2 (2011), s. 269-286 ISSN 1805-0565. E-ISSN 1805-0999 R&D Projects: GA ČR GA407/09/0760 Institutional research plan: CEZ:AV0Z70680506 Keywords : investment dispute * arbitration * revision of award Subject RIV: AG - Legal Sciences

  4. Opium notně vyčichlé? Náboženské procesy pozdní moderny v západní a východní Evropě

    Czech Academy of Sciences Publication Activity Database

    Nešpor, Zdeněk

    2007-01-01

    Roč. 14, 2-3 (2007), s. 269-304 ISSN 1210-7050 R&D Projects: GA ČR GA403/06/0574 Institutional research plan: CEZ:AV0Z70280505 Keywords : Sociology of Religion * Czech Religion * European Religion Subject RIV: AO - Sociology, Demography

  5. Factors influencing adherence to guidelines in general practice

    NARCIS (Netherlands)

    Stewart, RE; Vroegop, S; van der Werf, GT; Meyboom-de Jong, B; Kamps, G.

    2003-01-01

    Objectives: To identify and assess the effects of general practitioner and patient characteristics on global adherence to pharmacotherapeutic guidelines. Methods: In a cross-sectional study in the northern Netherlands, a two-level multilevel model was applied to patients (n = 269,067) in 190

  6. Anodic Oxidation of 18 Halogenated and/or Methylated Derivatives of CB(11)Hu(12)(-)

    Czech Academy of Sciences Publication Activity Database

    Wahab, Abdul; Douvris, C.; Klíma, J.; Šembera, Filip; Ugolotti, Juri; Kaleta, Jiří; Ludvík, J.; Michl, Josef

    2017-01-01

    Roč. 56, č. 1 (2017), s. 269-276 ISSN 0020-1669 Institutional support: RVO:61388963 Keywords : weakly coordinating anions * dodecamethylcarba-closo-dodecaboranyl * icosahedral carborane anions Subject RIV: CA - Inorganic Chemistry OBOR OECD: Inorganic and nuclear chemistry Impact factor: 4.857, year: 2016

  7. Trace elements monitored with neutron activation analysis durig neurodegeneration in brains of mutant mice

    Czech Academy of Sciences Publication Activity Database

    Kranda, Karel; Kučera, Jan; Bäurle, J.

    2006-01-01

    Roč. 269, č. 3 (2006), s. 555-559 ISSN 0236-5731 Institutional research plan: CEZ:AV0Z10480505 Keywords : trace elements * neutron activation analysis * brain neurodegeneration * mutant mice Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.509, year: 2006

  8. Levitation at 90.2 K and its applications

    Czech Academy of Sciences Publication Activity Database

    Muralidhar, M.; Sakai, N.; Jirsa, Miloš; Murakami, M.; Hirabayashi, I.

    2008-01-01

    Roč. 6, 3/4 (2008), s. 269-291 ISSN 1067-6147 Institutional research plan: CEZ:AV0Z10100520 Keywords : ternary superconductors * LREBa 2 Cu 3 O y * critical currents * vortex pinning * nanoscopic defects Subject RIV: BM - Solid Matter Physics ; Magnetism

  9. Anti-platelet aggregation of mixtures of betulinic oleanolic and ...

    African Journals Online (AJOL)

    on human embryonic kidney (HEK293) and hepatocellular carcinoma (HEPG2) cell lines ... exhibited low cytotoxic effect on both HEK293 cells (IC50: 724.43, 269.08 and 407.89 mg/mL ..... Triterpenes from the stem bark of Protorhus longifolia.

  10. Vokalická kvantita v rukopise T Starých letopisů českých

    Czech Academy of Sciences Publication Activity Database

    Černá, Alena M.

    2015-01-01

    Roč. 138, 3/4 (2015), s. 269-298 ISSN 0024-4457 R&D Projects: GA ČR(CZ) GBP405/12/G148 Institutional support: RVO:68378092 Keywords : vocalic quantity * Old Czech Annals * lexicon * Older Czech * manuscript Subject RIV: AI - Linguistics

  11. Oktoober oli kasumiteenimise kuu / Fredy-Edwin Esse ; kommenteerinud Kristjan Hänni

    Index Scriptorium Estoniae

    Esse, Fredy-Edwin

    2010-01-01

    Nii Tallinna kui ka Vilniuse börs kuulusid oktoobris maailma kümne enim tõusnud aktsiaturu hulka, Tallinna börs on viimase nelja kuu jooksul kasvanud 26,9%. Kõige rohkem tõusis oktoobris Shanghai börs. Kallinemisest toorainete turul

  12. Jing Tong Yu Shu, a traditional Chinese medicine, suppresses IL-1β ...

    African Journals Online (AJOL)

    Zhang et al. 2953. Tropical ... Purpose: To evaluate the effect of a traditional Chinese medicine, Jing Tong Yu Shu (JTYS) on endometriosis in a ..... Flower A, Liu JP, Chen S, Lewith G, Little P. Chinese ... Mol Hum Reprod 2000; 6: 269-275. 18.

  13. C,N-Chelated Organotin(IV) Azides: Synthesis, Structure and Use within the Click Chemistry.

    Czech Academy of Sciences Publication Activity Database

    Švec, P.; Bartoš, K.; Růžičková, Z.; Cuřínová, Petra; Dušek, L.; Turek, J.; de Proft, F.; Růžička, A.

    2016-01-01

    Roč. 40, č. 7 (2016), s. 5808-5817 ISSN 1144-0546 Grant - others:FWO(BE) 12T6615N Institutional support: RVO:67985858 Keywords : organotin(IV)azides * click chemistry * chelation Subject RIV: CC - Organic Chemistry Impact factor: 3.269, year: 2016

  14. Myths and realities of female-perpetrated terrorism

    NARCIS (Netherlands)

    Jacques, Karen; Taylor, Paul J

    2013-01-01

    The authors examined the backgrounds and social experiences of female terrorists to test conflicting accounts of the etiology of this offending group. Data on 222 female terrorists and 269 male terrorists were examined across 8 variables: age at first involvement, educational achievement, employment

  15. Computing the Gromov hyperbolicity of a discrete metric space

    KAUST Repository

    Fournier, Hervé

    2015-02-12

    We give exact and approximation algorithms for computing the Gromov hyperbolicity of an n-point discrete metric space. We observe that computing the Gromov hyperbolicity from a fixed base-point reduces to a (max,min) matrix product. Hence, using the (max,min) matrix product algorithm by Duan and Pettie, the fixed base-point hyperbolicity can be determined in O(n2.69) time. It follows that the Gromov hyperbolicity can be computed in O(n3.69) time, and a 2-approximation can be found in O(n2.69) time. We also give a (2log2⁡n)-approximation algorithm that runs in O(n2) time, based on a tree-metric embedding by Gromov. We also show that hyperbolicity at a fixed base-point cannot be computed in O(n2.05) time, unless there exists a faster algorithm for (max,min) matrix multiplication than currently known.

  16. A Novel Series of Highly Potent 2,6,9-Trisubstituted Purine Cyclin-Dependent Kinase Inhibitors

    Czech Academy of Sciences Publication Activity Database

    Gucký, T.; Jorda, Radek; Zatloukal, M.; Bazgier, V.; Berka, K.; Řezníčková, Eva; Béres, T.; Strnad, Miroslav; Kryštof, Vladimír

    2013-01-01

    Roč. 56, č. 15 (2013), s. 6234-6247 ISSN 0022-2623 R&D Projects: GA ČR GAP305/12/0783; GA ČR GD203/09/H046 Grant - others:GA MŠk(CZ) ED0007/01/01; GA MŠk(CZ) ED2.1.00/03.0058; GA MŠk(CZ) EE2.3.20.0017 Program:ED; ED; EE Institutional research plan: CEZ:AV0Z50380511 Keywords : CHRONIC LYMPHOCYTIC- LEUKEMIA * DINACICLIB SCH 727965 * CELL-CYCLE Subject RIV: ED - Physiology Impact factor: 5.480, year: 2013

  17. 2,6,9-Trisubstituted purines as CRK3 kinase inhibitors with antileishmanial activity in vitro

    Czech Academy of Sciences Publication Activity Database

    Řezníčková, Eva; Popa, Alexandr; Gucký, Tomáš; Zatloukal, Marek; Havlíček, Libor; Bazgier, Václav; Berka, K.; Jorda, Radek; Popa, Igor; Nasereddin, A.; Jaffe, Ch. L.; Kryštof, Vladimír; Strnad, Miroslav

    2015-01-01

    Roč. 25, č. 11 (2015), s. 2298-2301 ISSN 0960-894X R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Purine * Cyclin-dependent kinase * Leishmania Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.486, year: 2015

  18. Structure-guided investigation of lipopolysaccharide O-antigen chain length regulators reveals regions critical for modal length control.

    Science.gov (United States)

    Kalynych, Sergei; Ruan, Xiang; Valvano, Miguel A; Cygler, Miroslaw

    2011-08-01

    The O-antigen component of the lipopolysaccharide (LPS) represents a population of polysaccharide molecules with nonrandom (modal) chain length distribution. The number of the repeat O units in each individual O-antigen polymer depends on the Wzz chain length regulator, an inner membrane protein belonging to the polysaccharide copolymerase (PCP) family. Different Wzz proteins confer vastly different ranges of modal lengths (4 to >100 repeat units), despite having remarkably conserved structural folds. The molecular mechanism responsible for the selective preference for a certain number of O units is unknown. Guided by the three-dimensional structures of PCPs, we constructed a panel of chimeric molecules containing parts of two closely related Wzz proteins from Salmonella enterica and Shigella flexneri which confer different O-antigen chain length distributions. Analysis of the O-antigen length distribution imparted by each chimera revealed the region spanning amino acids 67 to 95 (region 67 to 95), region 200 to 255, and region 269 to 274 as primarily affecting the length distribution. We also showed that there is no synergy between these regions. In particular, region 269 to 274 also influenced chain length distribution mediated by two distantly related PCPs, WzzB and FepE. Furthermore, from the 3 regions uncovered in this study, region 269 to 274 appeared to be critical for the stability of the oligomeric form of Wzz, as determined by cross-linking experiments. Together, our data suggest that chain length determination depends on regions that likely contribute to stabilize a supramolecular complex.

  19. Akvabela a krasoplavec

    Czech Academy of Sciences Publication Activity Database

    Černá, Anna

    2005-01-01

    Roč. 88, č. 5 (2005), s. 268-269 ISSN 0027-8203 R&D Projects: GA AV ČR 1ET200610406 Institutional research plan: CEZ:AV0Z90610521 Keywords : loan word * word formation * derivation of feminine forms from masculine Subject RIV: AI - Linguistics

  20. SUBJECT INDEX

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    granulite belt, India: structural and petrochemical evidences attesting to their relict nature. 337. Earth systems. Earth support systems: Threatened? Why? What can we do? 269. Earthquake source. Earthquake source model using strong motion dis- placement as response of finite elastic media. 9. Eastern Dharwar Craton.

  1. Acid deposition: a select review 1852-1990. 2. Effects on materials and health; abatement strategies and programmes

    Energy Technology Data Exchange (ETDEWEB)

    Longhurst, J.W.S.; Raper, D.W.; Lee, D.S.; Heath, B.A.; Conlan, B.; King, H.J. (Manchester Metropolitan University, Manchester (United Kingdom). Atmospheric Research and Information Centre)

    1993-10-01

    Part 2 of this review is concerned with the impact of acid deposits and their precursors on materials and human health, and with the control technologies and programmes introduced as a consequence of the environmental impacts of acid deposition. 269 refs., 8 figs., 8 tabs.

  2. Zaba: a novel miniature transposable element present in genomes of legume plants

    Czech Academy of Sciences Publication Activity Database

    Macas, Jiří; Neumann, Pavel; Požárková, Dana

    2003-01-01

    Roč. 269, - (2003), s. 624-631 ISSN 1617-4615 R&D Projects: GA ČR GA521/00/0655 Institutional research plan: CEZ:AV0Z5051902 Keywords : DNA * transposable elements * ZABA Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.240, year: 2003

  3. Chemical degradation of trimethyl phosphate as surrogate for organo-phosporus pesticides on nanostructured metal oxides

    Czech Academy of Sciences Publication Activity Database

    Štengl, Václav; Henych, Jiří; Matys Grygar, Tomáš; Pérez, Raul

    2015-01-01

    Roč. 61, JAN (2015), s. 259-269 ISSN 0025-5408 R&D Projects: GA ČR(CZ) GAP106/12/1116 Institutional support: RVO:61388980 Keywords : Nanostructured oxides * Stoichiometric degradation * Trimethyl phosphate Subject RIV: CA - Inorganic Chemistry Impact factor: 2.435, year: 2015

  4. Data of evolutionary structure change: 1CG5A-2QU0C [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available D> C 2QU0C ence>YFPHF-DLSHGence> 0 A C VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQT...n> 1CG5 A 1CG5A ence>VNLQA-FTPVT...line> THR CA 269 2QU0 C 2QU...0C ence>CHLPNDFTPAVence> HHHH HHH

  5. Redescription of Heliconema africanum (Linstow, 1899) n. comb. (Nematoda: Physalopteridae), a nematode parasite of freshwater eels (Anguilla spp.) in South Africa

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Taraschewski, H.; Weyl, O.L.F.

    2013-01-01

    Roč. 85, č. 3 (2013), s. 263-269 ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Parasitic nematode * Heliconema * South Africa Subject RIV: EA - Cell Biology Impact factor: 1.035, year: 2013

  6. Download this PDF file

    African Journals Online (AJOL)

    GB

    2014-01-01

    Jan 1, 2014 ... women are dependent on others for self-care activities than men (5). The fact that .... 98.1. 1.9. MARITAL STATUS: Divorced. Married. Widowed. 2. 36. 14. 3.8. 69.2. 26.9 ... had lower motor performance. This is in line with.

  7. Exploiting Chemical Libraries, Structure, and Genomics in the Search for Kinase Inhibitors

    NARCIS (Netherlands)

    Gray, Nathanael S.; Wodicka, Lisa; Thunnissen, Andy-Mark W.H.; Norman, Thea C.; Kwon, Soojin; Espinoza, F. Hernan; Morgan, David O.; Barnes, Georjana; LeClerc, Sophie; Meijer, Laurent; Kim, Sung-Hou; Lockhart, David J.; Schultz, Peter G.

    1998-01-01

    Selective protein kinase inhibitors were developed on the basis of the unexpected binding mode of 2,6,9-trisubstituted purines to the adenosine triphosphate-binding site of the human cyclin-dependent kinase 2 (CDK2). By iterating chemical library synthesis and biological screening, potent inhibitors

  8. Approximation of Common Fixed Points of a Finite

    African Journals Online (AJOL)

    Computer1

    GLOBAL JOURNAL OF MATHEMATICAL SCIENCES VOL. .... Donatus I. Igbokwe, Department of Mathematics, University of Uyo, Uyo, Nigeria ...... Journal of Mathematical Analysis and Application, 20, 197-228. ... Sequence for a class of Nonlinear Operators, Bulletin of Korean Mathematical Society, 39(2), 269 – 276. Hicks ...

  9. Higher Doses of (+)MK-801 (Dizocilpine) Induced Mortality and Procedural but Not Cognitive Deficits in Delayed Testing in the Active Place Avoidance With Reversal on the Carousel

    Czech Academy of Sciences Publication Activity Database

    Lobellová, Veronika; Brichtová, Eva; Petrásek, Tomáš; Valeš, Karel; Stuchlík, Aleš

    2015-01-01

    Roč. 64, č. 2 (2015), s. 269-275 ISSN 0862-8408 R&D Projects: GA MZd(CZ) NT13386 Institutional support: RVO:67985823 Keywords : Dizocilpine * (+)MK-801 * active place avoidance * Carousel * Long-Evans rats Subject RIV: FH - Neurology Impact factor: 1.643, year: 2015

  10. Accumulation of phosphorus in nests of red wood ants .i.Formica s. str../i

    Czech Academy of Sciences Publication Activity Database

    Frouz, Jan; Kalčík, Jiří; Cudlín, Pavel

    2005-01-01

    Roč. 42, - (2005), s. 269-275 ISSN 0003-455X Institutional research plan: CEZ:AV0Z60660521; CEZ:AV0Z6087904 Keywords : accumulation of phosphorus * nests of ants * red wood ants Subject RIV: EH - Ecology, Behaviour Impact factor: 0.992, year: 2005

  11. Do arbuscular mycorrhizal fungi stabilize litter-derived carbon in soil?

    Czech Academy of Sciences Publication Activity Database

    Verbruggen, E.; Jansa, Jan; Hammer, E.C.; Rilling, M.C.

    2016-01-01

    Roč. 104, č. 1 (2016), s. 261-269 ISSN 0022-0477 R&D Projects: GA MŠk(CZ) LK11224 Institutional support: RVO:61388971 Keywords : isotopes * litter decomposition * plant- soil (below-ground) interactions Subject RIV: EE - Microbiology, Virology Impact factor: 5.813, year: 2016

  12. Does visual impairment lead to additional disability in adults with intellectual disabilities? A cross-sectional study

    NARCIS (Netherlands)

    Evenhuis, H.M.; Sjoukes, L.; Koot, H.M.; Kooijman, A.C.

    2009-01-01

    Background: This study addresses the question to what extent visual impairment leads to additional disability in adults with intellectual disabilities (ID). Method: In a multi-centre cross-sectional study of 269 adults with mild to profound ID, social and behavioural functioning was assessed with

  13. Does visual impairment lead to additional disability in adults with intellectual disabilities?

    NARCIS (Netherlands)

    Sjoukes, L.; Koot, H. M.; Kooijman, A. C.; Evenhuis, H.

    This study addresses the question to what extent visual impairment leads to additional disability in adults with intellectual disabilities (ID). In a multi-centre cross-sectional study of 269 adults with mild to profound ID, social and behavioural functioning was assessed with observant-based

  14. Does visual impairment lead to additional disability in adults with intellectual disabilities?

    NARCIS (Netherlands)

    Evenhuis, H.M.; Sjoukes, L.; Koot, H.M.; Kooijman, A.C.

    2009-01-01

    Background: This study addresses the question to what extent visual impairment leads to additional disability in adults with intellectual disabilities (ID). Method: In a multi-centre cross-sectional study of 269 adults with mild to profound ID, social and behavioural functioning was assessed with

  15. Arginine vasopressin and its analogues--the influence of position 2 modification with 3,3-diphenylalanine enantiomers. Highly potent V2 agonists

    Czech Academy of Sciences Publication Activity Database

    Kwiatkowska, A.; Sobolewski, D.; Prahl, A.; Borovičková, Lenka; Slaninová, Jiřina; Lammek, B.

    2009-01-01

    Roč. 44, č. 7 (2009), s. 2862-2867 ISSN 0223-5234 Institutional research plan: CEZ:AV0Z40550506 Keywords : arginine vasopressin analogues * AVP * 3,3-diphenylalanine enantiomers * V2 agonists * antidiuretic activity Subject RIV: CC - Organic Chemistry Impact factor: 3.269, year: 2009

  16. Sporophytes of polysporangiate land plants from the early Silurian period may have been photosynthetically autonomous

    Czech Academy of Sciences Publication Activity Database

    Libertín, M.; Kvaček, J.; Bek, Jiří; Žárský, V.; Štorch, Petr

    2018-01-01

    Roč. 4, 30 April 2018 (2018), s. 269-271 ISSN 2055-026X Institutional support: RVO:67985831 Keywords : earliest vascular plant s * in situ spores * Silurian * polysporangiate plant s Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Paleontology Impact factor: 10.300, year: 2016

  17. Social Intelligence and Communication Competence: Predictors of Students' Intercultural Sensitivity

    Science.gov (United States)

    Bosuwon, Takwa

    2017-01-01

    This study investigated the level of intercultural sensitivity of foreign international undergraduates and its possible predictors. Sample participants included 269 foreign international undergraduates of both government and private universities in Thailand. The research instrument was the three-page survey constructed questionnaire based on the…

  18. 36 CFR 1207.50 - Closeout.

    Science.gov (United States)

    2010-07-01

    ... limited to: (1) Final performance or progress report. (2) Financial Status Report (SF 269) or Outlay Report and Request for Reimbursement for Construction Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally...

  19. 29 CFR 97.50 - Closeout.

    Science.gov (United States)

    2010-07-01

    ... limited to: (1) Final performance or progress report. (2) Financial Status Report (SF 269) or Outlay Report and Request for Reimbursement for Construction Programs (SF-271) (as applicable.) (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally...

  20. 44 CFR 13.50 - Closeout.

    Science.gov (United States)

    2010-10-01

    ... limited to: (1) Final performance or progress report. (2) Financial Status Report (SF 269) or Outlay Report and Request for Reimbursement for Construction Programs (SF-271) (as applicable.) (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally...

  1. 41 CFR 105-71.150 - Closeout.

    Science.gov (United States)

    2010-07-01

    ... limited to: (1) Final performance or progress report. (2) Financial Status Report (SF 269) or Outlay Report and Request for Reimbursement for Construction Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally...

  2. Detection of Campylobacter jejuni and other potential pathogens in travellers' diarrhoea in Bangladesh

    NARCIS (Netherlands)

    Speelman, P.; Struelens, M. J.; Sanyal, S. C.; Glass, R. I.

    1983-01-01

    To determine the distribution of pathogens associated with travellers' diarrhoea in Bangladesh, we have studied 269 expatriates who presented with diarrhoea to our clinic, over a one-year period. Patients were interviewed about their history of diarrhoea and a stool specimen examined for parasites

  3. Breeding and foraging behaviour and habitat characteristics of the ...

    African Journals Online (AJOL)

    aggressiveness towards intruding conspecifics. Of the 269 prey items observed, 71.5% were invertebrates, 7.5% vertebrates, and 21.0% unidentified. Earthworms and centipedes represented the most numerous prey-types taken, representing 55% and 21% of the identified prey, respectively. Three nests were located in

  4. Investigation of Attitudinal Differences among Individuals of Different Employment Status

    Science.gov (United States)

    2010-10-28

    be included in order to statistically control for common method variance (see Podsakoff , MacKenzie, Lee, & Podsakoff , 2003). Results Hypotheses 1...social identity theory. Social Psychology Quarterly, 58, 255-269. Podsakoff , P. M., MacKenzie, S. B., Lee, J., & Podsakoff , N. P. (2003). Common method

  5. 7 CFR 3430.56 - Financial reporting.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Financial reporting. 3430.56 Section 3430.56... reporting. (a) SF-269, Financial Status Report. Unless stated differently in the award terms and conditions... requirement. (f) Additional reporting requirements. CSREES may require additional financial reporting...

  6. Isolation and expression of the Pneumocystis carinii thymidylate synthase gene

    DEFF Research Database (Denmark)

    Edman, U; Edman, J C; Lundgren, B

    1989-01-01

    The thymidylate synthase (TS) gene from Pneumocystis carinii has been isolated from complementary and genomic DNA libraries and expressed in Escherichia coli. The coding sequence of TS is 891 nucleotides, encoding a 297-amino acid protein of Mr 34,269. The deduced amino acid sequence is similar...

  7. G A Adebayo

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. G A Adebayo. Articles written in Pramana – Journal of Physics. Volume 64 Issue 2 February 2005 pp 269-279 Research Articles. Structures and autocorrelation functions of liquid Al and Mg modelled via Lennard-Jones potential from molecular dynamics simulation.

  8. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. L A Hussain. Articles written in Pramana – Journal of Physics. Volume 64 Issue 2 February 2005 pp 269-279 Research Articles. Structures and autocorrelation functions of liquid Al and Mg modelled via Lennard-Jones potential from molecular dynamics simulation.

  9. A team-level investigation of the relationship between leader-member-exchange (LMX) differentiation and commitment and performance

    NARCIS (Netherlands)

    Le Blanc, P.M.; González-Romá, V.

    2012-01-01

    Although the differential treatment of team members by their leader is at the heart of Leader–Member Exchange (LMX) theory, empirical studies exploring the role of within-team LMX differentiation in relation to team outcomes are still relatively scarce. This study among 269 Dutch secondary school

  10. 75 FR 42814 - Boston & Maine Corporation―Abandonment Exemption―in Essex, Middlesex, and Suffolk Counties, MA

    Science.gov (United States)

    2010-07-22

    ... DEPARTMENT OF TRANSPORTATION Surface Transportation Board [Docket No. AB 32 (Sub-No. 71X)] Boston & Maine Corporation[horbar]Abandonment Exemption[horbar]in Essex, Middlesex, and Suffolk Counties, MA..., extending from milepost 2.69 to milepost 12.43, in Saugus, Essex, Middlesex, and Suffolk Counties, Mass. The...

  11. 76 FR 4348 - Labor-Management Cooperation Grant Program Information Collection Request

    Science.gov (United States)

    2011-01-25

    ...: Application for Federal Assistance (SF-424), Accounting System and Financial Capability Questionnaire (LM-3), Request for Advance or Reimbursement SF-270 (LM- 6), Financial Status Report SF-269a (LM-7), Project... the estimated time per response is 60 minutes. The Accounting System and Financial Capability...

  12. 76 FR 70384 - Drawbridge Operation Regulation; Black River, La Crosse, WI

    Science.gov (United States)

    2011-11-14

    ... two-hour notification. The proposed change is for drawspan operation by remote operator, opening..., Western Rivers, (314) 269-2378, email [email protected] . If you have questions on viewing or.... Viewing Comments and Documents To view comments, as well as documents mentioned in this preamble as being...

  13. A review of the development of portable laser induced breakdown spectroscopy and its applications

    Czech Academy of Sciences Publication Activity Database

    Rakovský, Jozef; Čermák, P.; Musset, O.; Veis, P.

    2014-01-01

    Roč. 101, NOV 2014 (2014), s. 269-287 ISSN 0584-8547 R&D Projects: GA ČR GA13-11635S Institutional support: RVO:61388955 Keywords : Fiber laser * Fieldable LIBS * Laser-induced breakdown spectroscopy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.176, year: 2014

  14. Marine Caulobacters. Isolation, Characterization and Assessing the Potential for Genetic Experimentation.

    Science.gov (United States)

    1987-01-01

    grants from the Washington SeaGrant Program, the Office of Naval Research (N00014-81-C-0570) and the California Toxic Substances Research and Teaching ...negative bacteria. Biotechnology _, 269-275. 45.ZoBell, C.E. (1946) Marine microbiology: a monograph on hydrobacteriology. Chronica Botanica Co., Waltham

  15. Observing purchase-related parent-child communication in retail environments: a developmental and socialization perspective

    NARCIS (Netherlands)

    Buijzen, M.; Valkenburg, P.M.

    2008-01-01

    In a quantitative observation study, we unobtrusively examined purchase-related communication between 0- to 12-year-old children and their parents (N= 269 dyads) during supermarket and toy store visits. The aims of the study were to determine (a) the development of purchase-related parent-child

  16. PAR-2, IL-4R, TGF-beta and TNF-alpha in bronchoalveolar lavage distinguishes extrinsic allergic alveolitis from sarcoidosis

    Czech Academy of Sciences Publication Activity Database

    Matěj, R.; Smětáková, M.; Vašáková, M.; Nováková, J.; Šterclová, M.; Kukal, J.; Olejár, Tomáš

    2014-01-01

    Roč. 8, č. 2 (2014), s. 533-538 ISSN 1792-0981 Institutional support: RVO:67985823 Keywords : sarcoidosis * extrinsic allergic alveolitis * interleukin 4 receptor * transforming growth factor beta * tumor necrosis factor alpha * proteinase activated receptor 2 Subject RIV: EC - Immunology Impact factor: 1.269, year: 2014

  17. Project Aprendizaje. Final Evaluation Report 1992-93.

    Science.gov (United States)

    Clark, Andrew

    This report provides evaluative information regarding the effectiveness of Project Aprendizaje, a New York City program that served 269 Spanish-speaking students of limited English proficiency (LEP). The project promoted parent and community involvement by sponsoring cultural events, such as a large Latin American festival. Students developed…

  18. Remarks on Gurariĭ spaces

    Czech Academy of Sciences Publication Activity Database

    Garbulińska, J.; Kubiś, Wieslaw

    2011-01-01

    Roč. 26, č. 2 (2011), s. 235-269 ISSN 0213-8743 Institutional research plan: CEZ:AV0Z10190503 Keywords : Gurarii space * almost linear isometry Subject RIV: BA - General Mathematics http://www.eweb.unex.es/eweb/extracta/Vol-26-2/abstract_26J2Kubis.pdf

  19. Evolution of paleostress fields and brittle deformation in Hronov-Poříčí Fault Zone, Bohemian Massif

    Czech Academy of Sciences Publication Activity Database

    Nováková, Lucie

    2014-01-01

    Roč. 58, č. 2 (2014), s. 269-288 ISSN 0039-3169 R&D Projects: GA ČR GA205/09/1244 Institutional support: RVO:67985891 Keywords : paleostress analysis * tectonic history * faulting * active tectonics Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.806, year: 2014

  20. Recovery rates, serotypes, and antimicrobial susceptibility patterns of Salmonellae isolated from cloacal swabs of wild Nile crocodiles (Crocodylus niloticus) in Zimbabwe

    DEFF Research Database (Denmark)

    Madsen, Mogens; Hangartner, P.; West, K.

    1998-01-01

    Samples from the cloaca and the ventral skin surface of 67 Nile crocodiles (Crocodylus niloticus) captured in four uninhabited areas at Lake Kariba, Zimbabwe, were cultured for Salmonella. All the skin samples tested negative for Salmonella, whereas 18 of 67 (26.9%) cloacal samples grew Salmonell...

  1. intra-species variation of the properties of gum exudates from acacia ...

    African Journals Online (AJOL)

    a

    . 1997, 11, 493. 22. Food Chemicals Codex III. Acacia (Gum arabic), National Academy of Sciences,. Washington D.C.; 1981, p 7. 23. Mhinzi, G.S.; Mosha, D.M.S. J. Chem. Soc. Pak. 1993, 15, 269. 24. Mhinzi, G.S.; Mosha, D.M.S. J.Food Sci.

  2. Characterization of CTL Recognized Epitopes on Human Breast Tumors

    Science.gov (United States)

    1996-09-01

    M., DePaoli-Roach, A. A., and Newton, A. C. (1994) 54. Klopman, G., Srivastava, S., Kolossvary, I., Epand, R. F., Ahmed , N., and J. Biol. Chem. 269...opacification requiring steroids or antibiotics antibiotics Dry eye Normal Reqi artificial - Requires enucleation teami Glaucoma No change Yes Nr

  3. Individual Differences in Trajectories of Emotion Regulation Processes: The Effects of Maternal Depressive Symptomatology and Children's Physiological Regulation

    Science.gov (United States)

    Blandon, Alysia Y.; Calkins, Susan D.; Keane, Susan P.; O'Brien, Marion

    2008-01-01

    Trajectories of emotion regulation processes were examined in a community sample of 269 children across the ages of 4 to 7 using hierarchical linear modeling. Maternal depressive symptomatology (Symptom Checklist-90) and children's physiological reactivity (respiratory sinus arrhythmia [RSA]) and vagal regulation ([delta]RSA) were explored as…

  4. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. O akinlade. Articles written in Pramana – Journal of Physics. Volume 64 Issue 2 February 2005 pp 269-279 Research Articles. Structures and autocorrelation functions of liquid Al and Mg modelled via Lennard-Jones potential from molecular dynamics simulation.

  5. Data of evolutionary structure change: 1AIGN-1AIJS [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available ignment> 0 n> 1AIG n>N 1AI...RO CA 208 LEU CA 267 ALA CA 286 LYS CA 269 ...n> 1AIJ n>S 1AIJS...1AIGN-1AIJS 1AIG 1AIJ N S ------------ALLSFERKYRVPGGTL-------VGGN...LFDFWVGPFYVGFFGVATFFFAALGIILIAWSAVLQGTWNPQ-------LISVYPPALEYGLGG-APLAKGGLWQIITICATGAFVSWALREVEICRKLGIGYHIPFAFAFAI

  6. Responses of private and public schools to voucher funding

    Czech Academy of Sciences Publication Activity Database

    Filer, Randall K.; Münich, Daniel

    2013-01-01

    Roč. 34, June (2013), s. 269-285 ISSN 0272-7757 R&D Projects: GA ČR(CZ) GBP402/12/G130 Institutional support: RVO:67985998 Keywords : educational finance * government expenditures and education * occupational choice Subject RIV: AH - Economics Impact factor: 1.146, year: 2013

  7. 77 FR 21476 - Final Flood Elevation Determinations

    Science.gov (United States)

    2012-04-10

    ... State Highway 115. Black River Approximately 9,000 feet +268 City of Pocahontas, downstream of the... the confluence with +269 City of Pocahontas, the Black River. Unincorporated Areas of Randolph County...). Swan Creek At the confluence with +69 City of Lambertville. the Delaware River. Approximately 40 feet...

  8. U.S. National Defense Acquisition and Budgetary Policy in an International Perspective

    Science.gov (United States)

    2011-12-03

    arsenal. London, UK: Sphere. (Original work published 1981). Kalinina, N., & Kozyulin, V. (2010, Winter). Russian defense industry: Feet of clay ...Mirages over the Andes: Peru , France, the United States, and military jet procurement in the 1960s. The Pacific Historical Review, 71(2), 269–300

  9. WEST AFRICAN JOURNAL OF MEDICINE

    African Journals Online (AJOL)

    evaluate intra-oral pressure (IOP), mean oral air flow (MOAF) and laryngeal ... in patients compared with control subjects was also noted. CONCLUSION:Our results ... treatment and thereby posing additional difficulties in .... Dopamine deficiency induces a dysfunction of .... Hearing Research 1969, 12: 246–269. 2. Darley FL ...

  10. Entomopathogenic fungi associated with Ixodes ricinus ticks

    DEFF Research Database (Denmark)

    Kalsbeek, Vibeke; Frandsen, F.; Steenberg, Tove

    1995-01-01

    to the Hyphomycetes. Paecilomyces farinosus and Verticillium lecanii were the predominant species. Other species, found only on engorged females were: Beauveria bassiana, B. brongniartii, P. fumosoroseus and V. araneanrm. Eight out of 1833 ticks collected from the vegetation and three out of 269 engorged nymphs were...

  11. 78 FR 40200 - Duke Energy Carolinas, LLC, Oconee Nuclear Station Units 1, 2, and 3; Independent Spent Fuel...

    Science.gov (United States)

    2013-07-03

    ... NUCLEAR REGULATORY COMMISSION [Docket Nos. 72-1004, 72-40, 50-269, 50-270, and 50-287; NRC-2013-0135] Duke Energy Carolinas, LLC, Oconee Nuclear Station Units 1, 2, and 3; Independent Spent Fuel Storage Installation; Environmental Assessment and Finding of No Significant Impact AGENCY: Nuclear...

  12. 78 FR 45575 - Duke Energy Carolinas, LLC; Oconee Nuclear Station Units 1, 2, and 3; Independent Spent Fuel...

    Science.gov (United States)

    2013-07-29

    ... NUCLEAR REGULATORY COMMISSION [Docket Nos.: 72-1004, 72-40, 50-269, 50-270, 50-287; and NRC-2013- 0135] Duke Energy Carolinas, LLC; Oconee Nuclear Station Units 1, 2, and 3; Independent Spent Fuel Storage Installation AGENCY: Nuclear Regulatory Commission. ACTION: Exemption; issuance. SUMMARY: The NRC...

  13. Search Results | Page 4 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 31 - 40 of 101 ... ... Growth and Economic Opportunities for Women 2 Apply Growth ... Mobilizing Social Science in the Arab World: Knowledge, ... in Muslim-majority countries where conservative interpretations of ... The Economic Research Forum (ERF) is a Cairo-based regional economics research network with 269 ...

  14. 7 CFR 3016.50 - Closeout.

    Science.gov (United States)

    2010-01-01

    ... are not limited to: (1) Final performance or progress report. (2) Financial Status Report (SF 269) or Outlay Report and Request for Reimbursement for Construction Programs (SF-271) (as applicable.) (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally...

  15. Simulations of the DARPA Suboff Submarine Including Self-Propulsion with the E1619 Propeller

    Science.gov (United States)

    2012-01-01

    Young and Kinnas (2003) to evaluate supercavitating and surface-piercing propellers. The simulation’s predicted results compare well with experimental...Young Y, Kinnas S. 2003. Analysis of supercavitating and surface-piercing propeller flows via BEM. Comput. Mech. 32, 269-280. Yu-cun P, Huai-xin Z

  16. The effect of farrowing duration on maternal behavior of hyperprolific sows in organic outdoor production

    DEFF Research Database (Denmark)

    Thorsen, Cecilie Kobek; Schild, Sarah-Lina Aagaard; Rangstrup-Christensen, Lena

    2017-01-01

    The relationship between biosecurity and digital dermatitis (DD) was evaluated in 8,269 cows from a convenience sample of 39 freestall dairy herds. The hypothesis was that poor implementation of biosecurity was associated with higher within-herd prevalence of DD. All lactating cows were scored as...

  17. Forfriskende syn på bæredygtighed (Refreshing view on sustainability)

    DEFF Research Database (Denmark)

    Nørgaard, Jørgen

    2009-01-01

    The article is a review of a Danish book, 'Sustainability- Nature shows the Way', on 269 pages presenting a view on sustainability different from usual. A system's sustainablity is based on thermodynamics' available work, for living systems multiplied with a genetic information factor. This ascri...... reversing deforestation....

  18. Effect of addition of a second metal in Mo/ZSM-5 catalyst for methane aromatization reaction under elevated pressures

    Czech Academy of Sciences Publication Activity Database

    Fíla, V.; Bernauer, Milan; Bernauer, B.; Sobalík, Zdeněk

    2015-01-01

    Roč. 256, č. 2 (2015), s. 269-275 ISSN 0920-5861 Grant - others:EU 7th Framework Program(XE) NMP3-LA-2009-229183 Institutional support: RVO:61388955 Keywords : methane * aromatization * metal dopants Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015

  19. Conducting polymer hydrogels

    Czech Academy of Sciences Publication Activity Database

    Stejskal, Jaroslav

    2017-01-01

    Roč. 71, č. 2 (2017), s. 269-291 ISSN 0366-6352 R&D Projects: GA ČR(CZ) GA16-02787S Institutional support: RVO:61389013 Keywords : aerogel * conducting polymers * conductivity Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 1.258, year: 2016

  20. The Allegory of Dynastic Succession on the Facade of the Prague Belvedere (1538-1550)

    Czech Academy of Sciences Publication Activity Database

    Bažant, Jan

    -, č. 2 (2017), s. 269-282 ISSN 0567-8269 Institutional support: RVO:67985955 Keywords : Renaissance art * Ferdinand I * Prague * allegory Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  1. Exploring communication challenges due to language and cultural ...

    African Journals Online (AJOL)

    culture have on communication in the workplace and to emphasise the importance of .... resource for innovation and adaptability (Ely & Thomas 2001: 269). ... African workplace. In addition to these groups, there are others that are intermingled, causing a greater diversity of cultures influenced by other 'primary' cultures.

  2. Whole plantar nerve conduction study with disposable strip electrodes.

    Science.gov (United States)

    Hemmi, Shoji; Kurokawa, Katsumi; Nagai, Taiji; Okamoto, Toshio; Murakami, Tatsufumi; Sunada, Yoshihide

    2016-02-01

    A new method to evaluate whole plantar nerve conduction with disposable strip electrodes (DSEs) is described. Whole plantar compound nerve action potentials (CNAPs) were recorded at the ankle. DSEs were attached to the sole for simultaneous stimulation of medial and lateral plantar nerves. We also conducted medial plantar nerve conduction studies using an established method and compared the findings. Whole plantar CNAPs were recorded bilaterally from 32 healthy volunteers. Mean baseline to peak amplitude for CNAPs was 26.9 ± 11.8 μV, and mean maximum conduction velocity was 65.8 ± 8.3 m/s. The mean amplitude of CNAPs obtained by our method was 58.2% higher than that of CNAPs obtained by the Saeed method (26.9 μV vs. 17.0 μV; P < 0.0001). The higher mean amplitude of whole plantar CNAPs obtained by our method suggests that it enables CNAPs to be obtained easily, even in elderly people. © 2015 Wiley Periodicals, Inc.

  3. Role of multiple phosphorylation sites in the COOH-terminal tail of aquaporin-2 for water transport: evidence against channel gating

    DEFF Research Database (Denmark)

    Moeller, Hanne B; Macaulay, Nanna; Knepper, Mark A

    2009-01-01

    demonstrated that lack of phosphorylation at S256, S261, S264, or S269 had no effect on AQP2 unit water transport. Similarly, no effect on AQP2 unit water transport was observed for the 264D and 269D forms, indicating that phosphorylation of the COOH-terminal tail of AQP2 is not involved in gating......Arginine vasopressin (AVP)-regulated phosphorylation of the water channel aquaporin-2 (AQP2) at serine 256 (S256) is essential for its accumulation in the apical plasma membrane of collecting duct principal cells. In this study, we examined the role of additional AVP-regulated phosphorylation sites...... in the COOH-terminal tail of AQP2 on protein function. When expressed in Xenopus laevis oocytes, prevention of AQP2 phosphorylation at S256A (S256A-AQP2) reduced osmotic water permeability threefold compared with wild-type (WT) AQP2-injected oocytes. In contrast, prevention of AQP2 single phosphorylation at S...

  4. Scoping paper on new CDM baseline methodology for cross-border power trade

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2011-07-01

    Poeyry has been sub-contracted by Carbon Limits, under the African Development Bank CDM Support Programme, to prepare a new CDM baseline methodology for cross border trade, based on a transmission line from Ethiopia to Kenya. The first step in that process is to review the response of the UNFCCC, particularly the Methodologies Panel ('Meth Panel') of the CDM Executive Board, to the various proposals on cross-border trade and interconnection of grids. This report reviews the Methodology Panel and Executive Board decisions on 4 requests for revisions of ACM2 'Consolidated baseline methodology for grid-connected electricity generation from renewable sources', and 5 proposed new baseline methodologies (NM255, NM269, NM272, NM318, NM342), all of which were rejected. We analyse the reasons the methodologies were rejected, and whether the proposed draft Approved Methodology (AM) that the Methodology Panel created in response to NM269 and NM272 is a suitable basis for a new methodology proposal.(auth)

  5. Nuclear structure studies towards superheavy elements and perspectives with AGATA

    International Nuclear Information System (INIS)

    Korichi, A.

    2005-01-01

    A variety of theoretical approaches have been used to calculate the shell closure of spherical Super Heavy Elements (SHE) but the predictions of the location of the 'island of stability' vary from Z=114 to 120 and 126, with neutron numbers around N=172 or N=184 depending on the model employed. A deformed minimum around Z=108 and N=162 is predicted and an increase of the half-life of Hassium (Z=108) is experimentally observed when approaching the neutron number N=162. Super heavy nuclei are produced with very low cross-section (a few picobarns) and this makes their spectroscopic study impossible with today's beam intensities and detectors. However, important information can be obtained from the structure of mid-shell deformed nuclei (Z∼104) where selected single particle orbitals, which lie close to the spherical shell gap in SHE, are close to the Fermi level. The information will come from decay and in-beam spectroscopy. A promising area of progress, using the state-of-the art instruments, is represented by the observation of rotational gamma-ray transitions in No and Fm isotopes showing the deformed character of these nuclei. One of the objectives and focus of the nuclear structure community is related to the investigation of Single particle excitations beyond the N=152 neutron gap and collective properties of heavier systems towards Z∼104. The IN2P3-JINR collaboration has launched a project of electron and gamma-ray spectroscopy studies of heavy nuclei at the FLNR. This project benefits from the radioactive actinide targets uniquely available at Dubna and from the very intense stable beams provided by the U400 cyclotron. This offers a unique opportunity for the study of nuclei above Z=100 along an isotopic chain approaching N=162. In this contribution, the emphasis will be on the GABRIELA project and its issues. I will finally point out the perspectives with the new generation of gamma detectors such as AGATA

  6. 76 FR 26606 - Drawbridge Operation Regulation; Illinois Waterway, Near Morris, IL

    Science.gov (United States)

    2011-05-09

    ... through Friday, except Federal holidays. FOR FURTHER INFORMATION CONTACT: If you have questions on this rule, call or e-mail Eric A. Washburn, Bridge Administrator, Western Rivers, Coast Guard; telephone (314) 269-2378, e-mail [email protected] . If you have questions on viewing the docket, call Renee...

  7. 77 FR 40265 - Drawbridge Operation Regulation; Tennessee River, Decatur, AL

    Science.gov (United States)

    2012-07-09

    ... p.m., Monday through Friday, except Federal holidays. FOR FURTHER INFORMATION CONTACT: If you have questions on this rule, call or email Eric A. Washburn, Bridge Administrator, Western Rivers, Coast Guard; telephone 314-269-2378, email [email protected] . If you have questions on viewing the docket, call...

  8. Pursuit of Muscularity in Adolescent Boys: Relations among Biopsychosocial Variables and Clinical Outcomes

    Science.gov (United States)

    Cafri, Guy; van den Berg, Patricia; Thompson, J. Kevin

    2006-01-01

    Adolescent boys (n = 269) were assessed for levels of several risky behaviors related to the pursuit of muscularity, including substance use (anabolic steroids, prohormones, and ephedrine) dieting to gain weight, and symptoms of muscle dysmorphia (MD). The association between these behaviors and a variety of putative biological, psychological, and…

  9. Abelovu cenu v roce 2005 získal Peter Lax

    Czech Academy of Sciences Publication Activity Database

    Křížek, Michal

    2005-01-01

    Roč. 50, č. 4 (2005), s. 265-269 ISSN 0032-2423 R&D Projects: GA MŠk(CZ) 1P05ME749 Institutional research plan: CEZ:AV0Z10190503 Keywords : Lax-Milgram lemma * Lax-Wendroff theorem * Korteweg-de Vries equation Subject RIV: BA - General Mathematics

  10. Effect of shear rate on aggregate size and structure in the process of aggregation and at steady state

    Czech Academy of Sciences Publication Activity Database

    Bubáková, Petra; Pivokonský, Martin; Filip, Petr

    2013-01-01

    Roč. 235, February (2013), s. 540-549 ISSN 0032-5910 R&D Projects: GA ČR GAP105/11/0247 Institutional support: RVO:67985874 Keywords : aggregation * aggregate size * fractal dimension * shear rate * steady state * time evolution Subject RIV: BK - Fluid Dynamics Impact factor: 2.269, year: 2013

  11. Photo-production of neutral kaons on C-12 in the threshold region

    Czech Academy of Sciences Publication Activity Database

    Watanabe, T.; Bydžovský, Petr; Dobashi, K.; Endo, S.; Fujii, Y.; Hashimoto, O.; Ishikawa, T.; Itoh, K.; Kanda, H.

    2007-01-01

    Roč. 651, č. 4 (2007), s. 269-274 ISSN 0370-2693 R&D Projects: GA ČR GA202/05/2142 Institutional research plan: CEZ:AV0Z10480505 Keywords : photo-production * neutral kaon * quasi-free reaction Subject RIV: BE - Theoretical Physics Impact factor: 4.189, year: 2007

  12. Isolation and RFLP genotyping of toxoplasma gondii in free-range chicken(Gallus domesticus) in Grenada, West Indies, revealed widespread and dominance of clonal type III parasites

    Science.gov (United States)

    The objectives of the present cross sectional study were to estimate the prevalence and to isolate and genotype Toxoplasma gondii in free range chickens from Grenada, West Indies. Using the modified agglutination test, antibodies to T. gondii were found in 39 (26.9%) of 145 free-range chickens with ...

  13. OUGENE

    DEFF Research Database (Denmark)

    Pan, Xiaoyong; Shen, Hong-Bin

    2016-01-01

    -expression and various diseases. In this study, we presented a comprehensive disease-associated over- and under-expressed gene database (OUGene) based on our proposed text mining pipeline and several open curated databases. It contains total 41,269 unique associations between 7,238 over- or under-expressed genes and 1...

  14. Clonal vs leaf-height-seed (LHS) traits: which are filtered more strongly across habitats?

    Czech Academy of Sciences Publication Activity Database

    E.-Vojtkó, A.; Freitag, M.; Bricca, A.; Martello, F.; Compañ, J. M.; Küttim, M.; Kun, R.; de Bello, Francesco; Klimešová, Jitka; Götzenberger, Lars

    2017-01-01

    Roč. 52, 3-4 (2017), s. 269-281 ISSN 1211-9520 R&D Projects: GA ČR(CZ) GA16-15012S Institutional support: RVO:67985939 Keywords : environmental filtering * functional diversity * clonal traits Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 1.017, year: 2016

  15. Does Anger Regulation Mediate the Discrimination-Mental Health Link among Mexican-Origin Adolescents? A Longitudinal Mediation Analysis Using Multilevel Modeling

    Science.gov (United States)

    Park, Irene J. K.; Wang, Lijuan; Williams, David R.; Alegría, Margarita

    2017-01-01

    Although prior research has consistently documented the association between racial/ethnic discrimination and poor mental health outcomes, the mechanisms that underlie this link are still unclear. The present 3-wave longitudinal study tested the mediating role of anger regulation in the discrimination-mental health link among 269 Mexican-origin…

  16. The influence of social capital on individual health: is it the neighbourhood or the network?

    NARCIS (Netherlands)

    Mohnen, S.M.; Völker, B.; Flap, H.; Subramanian, S.V.; Groenewegen, P.P.

    2015-01-01

    We examined the influence of both individual and neighbourhood social capital on individual health and analysed whether effects of one type of social capital are contingent upon the other. The Dutch 'Housing and Living Survey' (WoON 2006, n = 53,269) was used and combined with information on

  17. The Influence of Social Capital on Individual Health : Is it the Neighbourhood or the Network?

    NARCIS (Netherlands)

    Mohnen, Sigrid M.; Volker, Beate; Flap, Henk; Subramanian, S. V.; Groenewegen, Peter P.

    2015-01-01

    We examined the influence of both individual and neighbourhood social capital on individual health and analysed whether effects of one type of social capital are contingent upon the other. The Dutch 'Housing and Living Survey' (WoON 2006, n = 53,269) was used and combined with information on

  18. Cash flow vs. collateral-based credit: performance of micro, small and medium-sized firms in transition economies

    Czech Academy of Sciences Publication Activity Database

    Cassano, F.; Joeveer, K.; Švejnar, Jan

    2013-01-01

    Roč. 21, č. 2 (2013), s. 269-300 ISSN 0967-0750 R&D Projects: GA ČR GAP402/10/2130 Institutional support: PRVOUK-P23 Keywords : micro, small and medium-sized enterprises * bank credit * firm performance Subject RIV: AH - Economics Impact factor: 0.755, year: 2013

  19. Simulace elktronově optických systémů s vysokým proudem ve svazku

    Czech Academy of Sciences Publication Activity Database

    Zelinka, Jiří; Oral, Martin; Radlička, Tomáš

    2017-01-01

    Roč. 62, č. 10 (2017), s. 266-269 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : space charge * electron emission * self-consistent simulation * aberation polynomial Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering OBOR OECD: Particles and field physics

  20. Solid Waste Management: A List of Available Literature, October 1972.

    Science.gov (United States)

    Environmental Protection Agency, Cincinnati, OH.

    Listed are 269 solid waste management publications available from the U. S. Environmental Protection Agency (EPA). There are EPA publications reporting on results of the research, development, and demonstrations in progress as authorized by the Solid Waste Disposal Act of 1965. Certain conference proceedings, findings of various commissions and…

  1. Complex modulation of peptidolytic activity of cathepsin D by sphingolipids

    Czech Academy of Sciences Publication Activity Database

    Žebrakovská, Iva; Máša, Martin; Srp, Jaroslav; Horn, Martin; Vávrová, K.; Mareš, Michael

    2011-01-01

    Roč. 1811, č. 12 (2011), s. 1097-1104 ISSN 1388-1981 R&D Projects: GA AV ČR IAA400550705 Institutional research plan: CEZ:AV0Z40550506 Keywords : sphingolipid * phospholipid * inhibition * activation * cathepsin D * enzyme regulation Subject RIV: CE - Biochemistry Impact factor: 5.269, year: 2011

  2. Antileukotrienic phenethylamido derivatives of arylalkanoic acids in the treatment of ulcerative colitis

    Czech Academy of Sciences Publication Activity Database

    Junek, R.; Kverka, Miloslav; Jandera, A.; Panajotová, V.; Šatinský, D.; Macháček, M.; Kuchař, M.

    2009-01-01

    Roč. 44, č. 1 (2009), s. 332-344 ISSN 0223-5234 R&D Projects: GA ČR GD310/03/H147 Institutional research plan: CEZ:AV0Z50200510 Keywords : N-Phenethyl-2-arylacetamides * Antileukotrienic activity * QSAR Subject RIV: EC - Immunology Impact factor: 3.269, year: 2009

  3. Prediction of maximal heart rate: comparison using a novel and ...

    African Journals Online (AJOL)

    Prediction of maximal heart rate: comparison using a novel and conventional equation. LR Keytel, E Mukwevho, MA Will, M Lambert. Abstract. No Abstract. African Journal for Physical, Health Education, Recreation and Dance Vol. 11(3) 2005: 269-277. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL ...

  4. Untitled

    Indian Academy of Sciences (India)

    Waring's problem, on I (k) in, and an analogous function (Chowla), 269. Wood, lignin and wood-cellulose, X-ray studies (Nilakantan), 166. X-ray analysis of the structure of a fibrous modification of tourmaline (Swamy and Iyengar), 419. X-ray studies of wood, lignin and wood-cellulose (Nilakantan), 166.

  5. to view fulltext PDF

    Indian Academy of Sciences (India)

    Operation of CANDU power reactor in thorium self-sufficient fuel cycle. 143. Bharti Arun see Dua ... design and modeling of accelerator driven systems. 269 ..... On non-extensive nature of thermal con- ductivity. 61 ... catalytic vapor decomposition (CVD) method: ... Heavy density liquid metal spallation tar- get studies for ...

  6. 40 CFR 35.6670 - Financial reports.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Financial reports. 35.6670 Section 35... Actions Reports Required Under A Cooperative Agreement § 35.6670 Financial reports. (a) General. The...) Financial Status Report—(1) Content. (i) The Financial Status Report (SF-269) must include financial...

  7. 45 CFR 74.52 - Financial reporting.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Financial reporting. 74.52 Section 74.52 Public..., AND COMMERCIAL ORGANIZATIONS Post-Award Requirements Reports and Records § 74.52 Financial reporting. (a) The following forms are used for obtaining financial information from recipients: (1) SF-269 or...

  8. Artificial intelligence techniques for embryo and oocyte classification.

    Science.gov (United States)

    Manna, Claudio; Nanni, Loris; Lumini, Alessandra; Pappalardo, Sebastiana

    2013-01-01

    One of the most relevant aspects in assisted reproduction technology is the possibility of characterizing and identifying the most viable oocytes or embryos. In most cases, embryologists select them by visual examination and their evaluation is totally subjective. Recently, due to the rapid growth in the capacity to extract texture descriptors from a given image, a growing interest has been shown in the use of artificial intelligence methods for embryo or oocyte scoring/selection in IVF programmes. This work concentrates the efforts on the possible prediction of the quality of embryos and oocytes in order to improve the performance of assisted reproduction technology, starting from their images. The artificial intelligence system proposed in this work is based on a set of Levenberg-Marquardt neural networks trained using textural descriptors (the local binary patterns). The proposed system was tested on two data sets of 269 oocytes and 269 corresponding embryos from 104 women and compared with other machine learning methods already proposed in the past for similar classification problems. Although the results are only preliminary, they show an interesting classification performance. This technique may be of particular interest in those countries where legislation restricts embryo selection. One of the most relevant aspects in assisted reproduction technology is the possibility of characterizing and identifying the most viable oocytes or embryos. In most cases, embryologists select them by visual examination and their evaluation is totally subjective. Recently, due to the rapid growth in our capacity to extract texture descriptors from a given image, a growing interest has been shown in the use of artificial intelligence methods for embryo or oocyte scoring/selection in IVF programmes. In this work, we concentrate our efforts on the possible prediction of the quality of embryos and oocytes in order to improve the performance of assisted reproduction technology

  9. A Psychometric Evaluation of the Self-Presentational Efficacy Scale

    Science.gov (United States)

    Lamarche, Larkin; Gammage, Kimberley L.; Sullivan, Philip J.; Gabriel, David A.

    2013-01-01

    This study examined the psychometric properties of the Self-Presentational Efficacy Scale (SPES) developed by Gammage, Hall, and Martin Ginis (2004). University students (196 men and 269 women) completed the SPES and measures of social physique anxiety, fear of negative evaluation, and physical activity. Participants also completed the SPES a…

  10. Occurrence of Philometra lateolabracis (Nematoda: Philometridae) in the gonads of marine perciform fishes in the Mediterranean region

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Glamuzina, B.; Marino, G.; Merella, P.; Di Cave, D.

    2003-01-01

    Roč. 53, č. 3 (2003), s. 267-269 ISSN 0177-5103 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z6022909 Keywords : parasitic nematode * Philometra lateolabracis * marine fish Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.263, year: 2003

  11. AUTHOR INDEX

    Indian Academy of Sciences (India)

    during pre-monsoon season: A case study based on sat- ellite data and regional climate model. 269. Anand R ... Development of regional wheat VI-LAI models using. Resourcesat-1 .... Impact of additional surface observation network on short range .... 795. Sahu P. Threat of land subsidence in and around Kolkata City.

  12. Acharya Nachiketa Multi-model ensemble schemes for predicting ...

    Indian Academy of Sciences (India)

    during pre-monsoon season: A case study based on sat- ellite data and regional climate model. 269. Anand R ... Development of regional wheat VI-LAI models using. Resourcesat-1 .... Impact of additional surface observation network on short range .... 795. Sahu P. Threat of land subsidence in and around Kolkata City.

  13. Weak tidal correlation of NW-Bohemia/Vogtland earthquake swarms

    Czech Academy of Sciences Publication Activity Database

    Fischer, Tomáš; Kalenda, Pavel; Skalský, Lumír

    2006-01-01

    Roč. 424, č. 3-4 (2006), s. 259-269 ISSN 0040-1951 R&D Projects: GA AV ČR IAA3012308 Institutional research plan: CEZ:AV0Z30460519 Keywords : Earth tides * earthquake swarm * triggered earthquakes Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.675, year: 2006

  14. Alpha-production channels in 6Li+159Tb at energies around the Coulomb barrier

    International Nuclear Information System (INIS)

    Pradhan, M.K.; Mukherjee, A.; Roy, S.; Basu, P.; Goswami, A.; Saha Sarkar, M.; Kshetri, R.; Roy Chowdhury, R.; Ray, M.; Santra, S.; Kailas, S.; Parkar, V.V.; Palit, R.

    2010-01-01

    In order to investigate what are the dominant processes that might contribute to the inclusive α-particle channels, very recently measurements have been performed by the characteristic γ-ray method for the system 6 Li+ 159 Tb at energies below and above the Coulomb barrier (V B = 26.9 MeV)

  15. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences. INDRANIL BISWAS. Articles written in Proceedings – Mathematical Sciences. Volume 111 Issue 3 August 2001 pp 263-269. Stability of Picard Bundle Over Moduli Space of Stable Vector Bundles of Rank Two Over a Curve · Indranil Biswas Tomás L Gómez.

  16. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 110; Issue 4. Volume 110, Issue 4. December 2001, pages 267-463. Recent Researchers in Petrology and Geochemistry. pp 267-267. Preface · S Bhattacharya J Ganguly · More Details Fulltext PDF. pp 269-285. Earth support systems: Threatened? Why? What can ...

  17. Review of invasive grapevine aphid, Aphis illinoisensis Shimer, and native parasitoids in the Mediterranean (Hemiptera, Aphididae; Hymenoptera, Braconidae, Aphidiinae)

    Czech Academy of Sciences Publication Activity Database

    Havelka, Jan; Shukshuk, A. H.; Ghaliow, M. E.; Laamari, M.; Kavallieratos, N. G.; Tomanović, Ž.; Rakhshani, E.; Pons, X.; Starý, Petr

    2011-01-01

    Roč. 63, č. 1 (2011), s. 269-274 ISSN 0354-4664 Grant - others:Ministry of Science and Technological Development of the Republic of Serbia(CS) 43001 Institutional research plan: CEZ:AV0Z50070508 Keywords : invasions * Aphis illinoisensis * grapevine Subject RIV: EH - Ecology, Behaviour Impact factor: 0.360, year: 2011

  18. 45 CFR 287.165 - What are the data collection and reporting requirements for Public Law 102-477 Tribes that...

    Science.gov (United States)

    2010-10-01

    ...-269A to BIA. (b) Information regarding program and financial operations of a NEW Program administered... 45 Public Welfare 2 2010-10-01 2010-10-01 false What are the data collection and reporting... EMPLOYMENT WORKS (NEW) PROGRAM Data Collection and Reporting Requirements § 287.165 What are the data...

  19. Heritability of the Number of Teeth in Middle-Aged and Older Danish Twins

    DEFF Research Database (Denmark)

    Kurushima, Y; Silventoinen, K; Dokkedal, U

    2017-01-01

    Tooth loss is a common health concern in older adults. We aimed to estimate the relative contributions of genetic and environmental factors to the variation in the number of teeth in middle-aged and older populations using a population-based cohort of Danish twins. The study included 5,269 Danish...

  20. Effects of pressure and temperature on the self-assembled fully hydrated nanostructures of monoolein-oil systems

    Czech Academy of Sciences Publication Activity Database

    Yaghmur, A.; Kriechbaum, M.; Amenitsch, H.; Steinhart, Miloš; Laggner, P.; Rappolt, M.

    2010-01-01

    Roč. 26, č. 2 (2010), s. 1177-1185 ISSN 0743-7463 R&D Projects: GA ČR GA202/09/2078 Institutional research plan: CEZ:AV0Z40500505 Keywords : lyotropic lipid mesophases * X-ray-diffraction * bicontinuous cubic phases Subject RIV: CD - Macromolecular Chemistry Impact factor: 4.269, year: 2010

  1. Photodynamic Efficiency of Porphyrins Encapsulated into Polysilsesquioxanes

    Czech Academy of Sciences Publication Activity Database

    Rychtáriková, Renata; Šabata, Stanislav; Hetflejš, Jiří; Kuncová, Gabriela

    2012-01-01

    Roč. 66, č. 4 (2012), s. 269-277 ISSN 0366-6352 R&D Projects: GA MŠk ME 892; GA MŠk(CZ) LC06070 Institutional research plan: CEZ:AV0Z40720504 Keywords : porphyrin * immobilization * specific surface area Subject RIV: CC - Organic Chemistry Impact factor: 0.879, year: 2012

  2. On the coupling between precipitation and potential evapotranspiration: contributions to decadal drought anomalies in the Southwest China

    Science.gov (United States)

    Shanlei Sun; Haishan Chen; Weimin Ju; Guojie Wang; Ge Sun; Jin Huang; Hedi Ma; Chujie Gao; Wenjian Hua; Guixia Yan

    2016-01-01

    Under the exacerbation of climate change, cli· mate extreme events. especially for drought, happened frequently and intensively across the globe with greater spatial differences. We used the Standardized Precipitation-Evapotranspiration Index computed from the routine meteorological observations at 269 sites in Southwest China (SWC) to study the drought characteristics...

  3. Factorial Validity and Invariance Testing of the Exercise Dependence Scale-Revised in Swedish and Portuguese Exercisers

    Science.gov (United States)

    Lindwall, Magnus; Palmeira, Antonio

    2009-01-01

    The present study investigated the factorial validity and factorial invariance of the 21-item Exercise Dependence Scale-Revised using 162 Swedish and 269 Portuguese exercisers. In addition, the prevalence of exercise dependence symptoms and links to exercise behavior, gender, and age in the two samples was also studied. Confirmatory factor…

  4. Rheumatic manifestations among HIV positive adults attending the ...

    African Journals Online (AJOL)

    Rheumatic manifestations among HIV positive adults attending the Infectious ... diseases seen depend on a number of factors such as, the CD4 count, HLA status ... population were commonest finding followed by HIV associated arthritis at 4.3%. ... affected with the knees (28.8%) and ankles (26.9%) contributing the highest.

  5. Effect of hydrophobic interactions on properties and stability of DNA-polyelectrolyte complexes

    Czech Academy of Sciences Publication Activity Database

    Filippov, Sergey K.; Koňák, Čestmír; Kopečková, P.; Starovoytova, Larisa; Špírková, Milena; Štěpánek, Petr

    2010-01-01

    Roč. 26, č. 7 (2010), s. 4999-5006 ISSN 0743-7463 R&D Projects: GA ČR GA202/09/2078 EU Projects: European Commission(XE) 512087 - GIANT Institutional research plan: CEZ:AV0Z40500505 Keywords : DNA * polyplex * cholesterol Subject RIV: BO - Biophysics Impact factor: 4.269, year: 2010

  6. Journal of Fundamental and Applied Sciences - Vol 7, No 2 (2015)

    African Journals Online (AJOL)

    Prevalence and antibiotic resistance of Staphylococci isolated from Kolea Hospital (Algeria) · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. MN Boukhatem, MA Ferhat, RH Mohamed, N Lalaoui, 260-269. http://dx.doi.org/10.4314/jfas.v7i2.8 ...

  7. Sexual and geographical variation in life history parameters of the shorthorn sculpin

    NARCIS (Netherlands)

    Luksenburg, JA; Pedersen, T

    2002-01-01

    A total of 293 shorthorn sculpins Myoxocephalus scorpius from Tromso, northern Norway, were sampled between November 1998 and April 1999 to determine sex, total length, age, growth, maturity and mortality. Females grew to larger sizes (L-infinity=26.9 v. 18.5 cm), matured later (2 v. 1 year of age)

  8. Trematode diversity in freshwater fishes of the Globe I: ‘Old World’

    Czech Academy of Sciences Publication Activity Database

    Scholz, Tomáš; Besprozvannykh, V. V.; Boutorina, T.E.; Choudhury, A.; Cribb, T.H.; Ermolenko, A. V.; Faltýnková, Anna; Shedko, M.B.; Shimazu, T.; Smit, N.J.

    2016-01-01

    Roč. 93, č. 3 (2016), s. 257-269 ISSN 0165-5752 R&D Projects: GA ČR(CZ) GBP505/12/G112; GA ČR GA15-14198S Institutional support: RVO:60077344 Keywords : life cycle * Digenea * parasite communite Subject RIV: EG - Zoology Impact factor: 1.181, year: 2016

  9. Teacher Retention and Satisfaction: A Comparison of M.A.T. and B.S./B.A. Graduates in Teacher Education.

    Science.gov (United States)

    Matthes, William A.; Duffy, William E.

    1989-01-01

    Reports on characteristics, career patterns, and career satisfaction of 269 teacher education graduates, 1966-1976, who completed either a bachelors degree or an M.A. in teaching. Finds that career satisfaction was related to degree program completed (masters vs. bachelors) and to school locale (rural vs. suburban). Contains 19 references. (SV)

  10. Bipteria vetusta n. sp. – an old parasite in an old host: tracing the origin of myxosporean parasitism in vertebrates

    Czech Academy of Sciences Publication Activity Database

    Kodádková, Alena; Bartošová-Sojková, Pavla; Holzer, Astrid S.; Fiala, Ivan

    2015-01-01

    Roč. 45, č. 4 (2015), s. 269-276 ISSN 0020-7519 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Myxosporean evolution * Molecular clock * Bipteria * Holocephali * Vertebrate host * Cartilaginous fish * Phylogeny * Co-evolution Subject RIV: EG - Zoology Impact factor: 4.242, year: 2015

  11. 77 FR 268 - Marine Mammals; File No. 15682

    Science.gov (United States)

    2012-01-04

    ... Mammals; File No. 15682 AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and Atmospheric... been issued under the authority of the Marine Mammal Protection Act of 1972, as amended (16 U.S.C. 1361 et seq.), the regulations governing the taking and importing of marine mammals (50 CFR [[Page 269...

  12. 36 CFR 1206.82 - What is the format and content of the financial report?

    Science.gov (United States)

    2010-07-01

    ... content of the financial report? 1206.82 Section 1206.82 Parks, Forests, and Public Property NATIONAL... Grant Administration § 1206.82 What is the format and content of the financial report? Grant recipients must submit financial reports on Standard Form 269, if there is program income to report, or Standard...

  13. 49 CFR 19.52 - Financial reporting.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Financial reporting. 19.52 Section 19.52... Requirements Reports and Records § 19.52 Financial reporting. (a) The following forms or such other forms as may be approved by OMB are authorized for obtaining financial information from recipients. (1) SF-269...

  14. 24 CFR 203.443 - Insurance premium.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance premium. 203.443 Section... premium. All of the provisions of §§ 203.260 through 203.269 1 concerning mortgage insurance premiums... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE...

  15. Effects of Age and Schooling on Intellectual Performance: Estimates Obtained from Analysis of Continuous Variation in Age and Length of Schooling

    Science.gov (United States)

    Cliffordson, Christina; Gustafsson, Jan-Eric

    2008-01-01

    The effects of age and schooling on different aspects of intellectual performance, taking track of study into account, are investigated. The analyses were based on military enlistment test scores, obtained by 48,269 males, measuring Fluid ability (Gf), Crystallized intelligence (Gc), and General visualization (Gv) ability. A regression method,…

  16. Antiproliferative activity of olomoucine II, a novel 2,6,9-trisubstituted purine cyclin-dependent kinase inhibitor

    Czech Academy of Sciences Publication Activity Database

    Kryštof, Vladimír; McNae, I. W.; Walkinshaw, M. D.; Fischer, P.M.; Müller, P.; Vojtešek, B.; Orság, Martin; Havlíček, Libor; Strnad, Miroslav

    2005-01-01

    Roč. 62, č. 15 (2005), s. 1763-1771 ISSN 1420-682X R&D Projects: GA ČR GP204/03/D231 Institutional research plan: CEZ:AV0Z50380511 Keywords : olomoucine II * roscovitine * cyclin-dependent kinase inhibitor Subject RIV: CE - Biochemistry Impact factor: 4.582, year: 2005

  17. The Simulation of Energy Distribution of Electrons Detected by Segmental Ionization Detector in High Pressure Conditions of ESEM

    Czech Academy of Sciences Publication Activity Database

    Neděla, Vilém; Konvalina, Ivo; Oral, Martin; Hudec, Jiří

    2015-01-01

    Roč. 21, S4 (2015), s. 264-269 ISSN 1431-9276 R&D Projects: GA ČR(CZ) GA14-22777S Institutional support: RVO:68081731 Keywords : electron-gas interactions * Monte Carlo simulation * signal amplification * segmented ionization detector Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.730, year: 2015

  18. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Baby P S Chakrapani. Articles written in Journal of Biosciences. Volume 33 Issue 2 June 2008 pp 269-277 Articles. Development and evaluation of an in vivo assay in Caenorhabditis elegans for screening of compounds for their effect on cytochrome P450 expression · Baby P S ...

  19. Toward Practical Verification of Outsourced Computations Using Probabilistically Checkable Proofs (PCPs)

    Science.gov (United States)

    2010-07-12

    Germany, 1999. [8] L. Babai, L. Fortnow, L. A. Levin, and M. Szegedy. Checking Computations in Polylogarithmic Time. In STOC, 1991. [9] A. Ben- David ...their work. J. ACM, 42(1):269–291, 1995. [12] D. Chaum , C. Crépeau, and I. Damgard. Multiparty unconditionally secure protocols. In STOC, 1988. [13

  20. The pig as an experimental model for clinical craniofacial research

    Czech Academy of Sciences Publication Activity Database

    Štembírek, Jan; Kyllar, M.; Putnová, I.; Stehlík, L.; Buchtová, Marcela

    2012-01-01

    Roč. 46, č. 4 (2012), s. 269-279 ISSN 0023-6772 R&D Projects: GA ČR(CZ) GP304/08/P289 Institutional research plan: CEZ:AV0Z50450515 Keywords : platelet rich plasma * streptococcus suis serotype 2 * implant surface coatings Subject RIV: EG - Zoology Impact factor: 1.257, year: 2012

  1. 76 FR 69168 - Airworthiness Directives; Airbus Airplanes

    Science.gov (United States)

    2011-11-08

    ...-1225; Directorate Identifier 2010-NM-269-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for certain Airbus Model A300 B4-2C, B4-103..., contact Airbus SAS-EAW (Airworthiness Office), 1 Rond Point Maurice Bellonte, 31707 Blagnac Cedex, France...

  2. Public perception of the Antarctic Wilderness: Surveys from an educated, environmentally knowledgeable European community

    Science.gov (United States)

    Tina Tin; Kees Bastmeijer; Jessica O' Reilly; Patrick Maher

    2011-01-01

    In 2007 and 2008, students from Tilburg University (the Netherlands) collected 269 responses on a questionnaire about Antarctica and its management. Respondents in the Netherlands clearly supported protecting Antarctica as a wilderness, and acknowledged Antarctica's importance as part of the global climate system and as a science laboratory for the benefit of...

  3. Physico-chemical characterization and cytotoxicity studies of seed ...

    African Journals Online (AJOL)

    GREGO

    2007-04-02

    Apr 2, 2007 ... saponification values were 88.40 and 195.58, respectively. The peroxide and acid values were 4.6 and. 2.69, respectively. Brine shrimp lethality bioassay of petroleum ether and methanol extracts of the seeds showed that the extracts were moderately cytotoxic at high concentration. The LC50 values using.

  4. Impact of Vestibular Lesions on Allocentric Navigation and Interval Timing: The Role of Self-Initiated Motion in Spatial-Temporal Integration

    Czech Academy of Sciences Publication Activity Database

    Dallal, N. L.; Yin, B.; Nekovářová, Tereza; Stuchlík, Aleš; Meck, W. H.

    2015-01-01

    Roč. 3, 3-4 (2015), s. 269-305 ISSN 2213-445X R&D Projects: GA MŠk(CZ) LH14053 Institutional support: RVO:67985823 Keywords : peak-interval procedure * interval timing * radial-arm maze * magnitude representation * dorsolateral striatum * self-initiated movement * hippocampus * cerebellum * time perception * allocentric navigation Subject RIV: FH - Neurology

  5. Induction of microspore-derived embryos by anther culture in ...

    African Journals Online (AJOL)

    ajl yemi

    2011-11-28

    Nov 28, 2011 ... obtained from A269, one of the genotypes tolerant to low temperature. The anthers cultured from April to May, gave the ... microspores in each anther and numerous haploid plants can be obtained from a single anther. ... in Turkey can be observed in several regions in both open fields and greenhouses.

  6. A semi-empirical model for predicting crown diameter of cedrela ...

    African Journals Online (AJOL)

    A semi-empirical model relating age and breast height has been developed to predict individual tree crown diameter for Cedrela odorata (L) plantation in the moist evergreen forest zones of Ghana. The model was based on field records of 269 trees, and could determine the crown cover dynamics, forecast time of canopy ...

  7. Use of new composite materials for the determination of Cu, Cd, Mo, As, and Sb in biological samples by radiochemical neutron activation analysis

    Czech Academy of Sciences Publication Activity Database

    Lučaníková, M.; Kučera, Jan; Šebesta, F.; John, J.

    2006-01-01

    Roč. 269, č. 2 (2006), s. 463-468 ISSN 0236-5731 R&D Projects: GA ČR(CZ) GA203/04/0943 Institutional research plan: CEZ:AV0Z10480505 Keywords : radiochemical neutron activation analysis * separation using composite materials Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.509, year: 2006

  8. Development of a radiochemical neutron activation analysis procedure for determination of rhenium in biological and environmental samples at ultratrace level

    Czech Academy of Sciences Publication Activity Database

    Kučera, Jan; Byrne, A. R.; Mizera, Jiří; Lučaníková, M.; Řanda, Zdeněk

    2006-01-01

    Roč. 269, č. 2 (2006), s. 251-257 ISSN 0236-5731 R&D Projects: GA ČR(CZ) GA203/04/0943 Institutional research plan: CEZ:AV0Z10480505 Keywords : radiochemical neutron activation analysis * rhenium * biological and environmental samples Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.509, year: 2006

  9. 77 FR 38859 - Governors' Designees Receiving Advance Notification of Transportation of Certain Shipments of...

    Science.gov (United States)

    2012-06-29

    ... of Transportation of Certain Shipments of Nuclear Waste and Spent Fuel On January 6, 1982 (47 FR 596 and 47 FR 600), the U.S. Nuclear Regulatory Commission (NRC) published in the Federal Register final... Conservation, State of Alaska, 555 Cordova Street, Anchorage, AK 99501, (907) 269- 1099, 24 hours: (907) 457...

  10. Medical Informatics Impact of Information Society in Health Care Development

    Czech Academy of Sciences Publication Activity Database

    Zvárová, Jana

    2005-01-01

    Roč. 9, - (2005), s. 269-274 ISSN 1335-2393. [YBERC 2005. Young Biomedical Engineers and Researchers Conference. Stará Lesná, 13.07.2005-15.07.2005] Institutional research plan: CEZ:AV0Z10300504 Keywords : medical informatics * information society * telemedicine * education * research and development Subject RIV: BD - Theory of Information

  11. 77 FR 8275 - Notice of Meeting, Rio Grande Natural Area Commission

    Science.gov (United States)

    2012-02-14

    ... Specialist, BLM Front Range District Office, 3028 East Main, Canon City, CO 81212. Phone: (719) 269-8553... Federal Information Relay Service (FIRS) at 1-800-877-8339 to contact the above individual during normal... minutes for the Commission Meeting will be maintained in the San Luis Valley Field Office and will be...

  12. 77 FR 21584 - Notice of Meeting, Rio Grande Natural Area Commission

    Science.gov (United States)

    2012-04-10

    ... Front Range District Office, 3028 East Main, Ca[ntilde]on City, CO 81212. Phone: (719) 269-8553. Email... Information Relay Service (FIRS) at 1- 800-877-8339 to contact the above individual during normal business.... Summary minutes for the Commission Meeting will be maintained in the San Luis Valley Field Office and will...

  13. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... Home; Journals; Journal of Astrophysics and Astronomy. M. Ferricha-Alami. Articles written in Journal of Astrophysics and Astronomy. Volume 36 Issue 2 June 2015 pp 269-280. Tree Level Potential on Brane after Planck and BICEP2 · M. Ferricha-Alami A. Safsafi L. Lahlou H. Chakir M. Bennai.

  14. 30 CFR 725.23 - Reports.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Reports. 725.23 Section 725.23 Mineral... REGULATIONS REIMBURSEMENTS TO STATES § 725.23 Reports. (a) The agency shall, for each grant made under this part, submit semiannually to the Director or his authorized designee a Financial Status Report, SF 269...

  15. Positron lifetime studies of 100-MeV oxygen irradiated Pb-doped Bi-2223 superconductors

    NARCIS (Netherlands)

    Banerjee, T.; Viswanath, R.N.; Kanjilal, D.; Kumar, R.; Ramasamy, S.

    2000-01-01

    Positron lifetime studies have been carried out for unirradiated and 100-MeV oxygen ion irradiated Pb-doped Bi-2223 superconductors. The analysis of positron lifetime spectra revealed three lifetime components: a short lifetime, τ1 = 153–196 ps; an intermediate lifetime, τ2 = 269–339 ps; and a long

  16. 30 CFR 735.26 - Reports.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Reports. 735.26 Section 735.26 Mineral... AND ENFORCEMENT § 735.26 Reports. (a) The agency shall, for each grant made under this part, submit semiannually to the Director or his authorized designee a Financial Status Report, Form 269 for non...

  17. Trachydiscus minutus, a New Biotechnological Source of Eicosapentaenoic acid

    Czech Academy of Sciences Publication Activity Database

    Řezanka, Tomáš; Petránková, Mirka; Cepák, Vladislav; Přibyl, Pavel; Sigler, Karel; Cajthaml, Tomáš

    2010-01-01

    Roč. 55, č. 3 (2010), s. 265-269 ISSN 0015-5632 R&D Projects: GA MŠk 1M0571 Institutional research plan: CEZ:AV0Z50200510; CEZ:AV0Z60050516 Keywords : MICROALGA ISOCHRYSIS-GALBANA * NANNOCHLOROPSIS SP * PHAEODACTYLUM-TRICORNUTUM Subject RIV: EE - Microbiology, Virology Impact factor: 0.977, year: 2010

  18. Description of a novel eukaryotic deoxyuridine 5'-triphosphate nucleotidohydrolase in Leishmania major

    DEFF Research Database (Denmark)

    Camacho, A; Arrebola, R; Pena Diaz, Javier

    1997-01-01

    A Leishmania major full-length cDNA encoding a functional dUTP nucleotidohydrolase (dUTPase; EC 3.6.1.23) was isolated from a cDNA expression library by genetic complementation of dUTPase deficiency in Escherichia coli. The cDNA contained an open reading frame that encoded a protein of 269 amino...

  19. Observing Purchase-Related Parent-Child Communication in Retail Environments: A Developmental and Socialization Perspective

    Science.gov (United States)

    Buijzen, Moniek; Valkenburg, Patti M.

    2008-01-01

    In a quantitative observation study, we unobtrusively examined purchase-related communication between 0- to 12-year-old children and their parents (N = 269 dyads) during supermarket and toy store visits. The aims of the study were to determine (a) the development of purchase-related parent-child communication (i.e., children's purchase influence…

  20. ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. 9990 East Cent. Afr. J ...

    African Journals Online (AJOL)

    Hp 630 Dual Core

    Saiful Miah and James Catto. BPH and prostate cancer risk. Indian J Urol 2014; 30(2):. 214 218. 2. De Marzo AM, Platz EA, Sutcliffe S et al. Inflammation in prostate carcinogenesis Nat Rev. Cancer 2007; 7: 256 269. 3. Dennis LK, Lynch CF, Torner JC. Epidemiologic association between prostatitis and prostate cancer.

  1. Book review Biogeochemistry of Marine Systems By Pierre William ...

    African Journals Online (AJOL)

    Blackwell Publishing, 9600 Garsington Road, Oxford, OX4 2DQ, UK. CRC Press, Boca Raton, USA Hardback and paperback available, 334 pages, 269 illustrations. Hardback ISBN 1814 27 3279; price £99.50. Paperback ISBN 063 2055 567; price US$64.95. African Journal of Aquatic Science 2005, 30(1): 91 ...

  2. 882 lakes of the Cordillera Blanca: An inventory, classification, evolution and assessment of susceptibility to outburst floods

    Czech Academy of Sciences Publication Activity Database

    Emmer, Adam; Klimeš, Jan; Mergili, M.; Vilímek, V.; Cochachin, A.

    2016-01-01

    Roč. 147, DEC (2016), s. 269-279 ISSN 0341-8162 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:67985891 ; RVO:67179843 Keywords : high mountain lakes * GLOFs * environmental change * natural dams * Huascarán NP Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 3.191, year: 2016

  3. Completing Records-Based Research Within the Military: A User’s Guide

    Science.gov (United States)

    2013-03-01

    40:2072–2077, 2012. 13. Scher, D. L., Belmont, P. J., Jr., Mountcastle, S., et al. The incidence of primary hip osteoarthritis in active duty US...B. S., et al. Guidelines were developed for data collection from medical records for use in retrospective analyses. J. Clin. Epidemiol. 58:269–274

  4. A SIFT Study of the Reactions of H3O+, NO+ and O2+ with Hydrogen Peroxide and Peroxyacetic Acid

    Czech Academy of Sciences Publication Activity Database

    Španěl, Patrik; Diskin, A. M.; Wang, T.; Smith, D.

    2003-01-01

    Roč. 228, - (2003), s. 269-283 ISSN 1387-3806 R&D Projects: GA ČR GA202/03/0827; GA ČR GA203/02/0737 Institutional research plan: CEZ:AV0Z4040901 Keywords : SIFT * hydrogen peroxide * peroxyacetic acid Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.361, year: 2003

  5. Setting the stage for electron transfer: Molecular basis of ABTS-binding to four laccases from Trametes versicolor at variable pH and protein oxidation state

    DEFF Research Database (Denmark)

    Christensen, Niels Johan; Kepp, Kasper Planeta

    2014-01-01

    , very high (R2∼0.99) correlation was observed between logKm (ABTS) and binding-pocket charge due to sites 157, 161, 269, 271, and 333, i.e. laccases optimal for ABTS turnover have positively charged anchor points in their pockets. Our work also demonstrates how activity-constraints can markedly improve...

  6. Structural study of Mason-Pfizer monkey virus protease

    Czech Academy of Sciences Publication Activity Database

    Veverka, V.; Bauerová, Helena; Hrabal, R.; Pichová, Iva

    2002-01-01

    Roč. 269, - (2002), s. 57-58 ISSN 0014-2956. [Meeting of the Federation of European Biochemical Societies /28./. 20.10.2002-25.10.2002, Istanbul] R&D Projects: GA ČR GA203/00/1241 Institutional research plan: CEZ:AV0Z4055905 Keywords : Mason-Pfizer monkey virus Subject RIV: CE - Biochemistry

  7. Astrochronology of the Late Turonian: implications for the behavior of the carbon cycle at the demise of peak greenhouse

    Czech Academy of Sciences Publication Activity Database

    Laurin, Jiří; Čech, S.; Uličný, David; Štaffen, Z.; Svobodová, Marcela

    2014-01-01

    Roč. 394, May (2014), s. 254-269 ISSN 0012-821X R&D Projects: GA ČR GAP210/10/1991; GA MŠk LH12041 Institutional support: RVO:67985530 ; RVO:67985831 Keywords : Turonian * Coniacian * Milankovitch * astrochronology * carbon isotopes * carbon cycle Subject RIV: DB - Geology ; Mineralogy Impact factor: 4.734, year: 2014

  8. 22 CFR 518.52 - Financial reporting.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Financial reporting. 518.52 Section 518.52... Requirements Reports and Records § 518.52 Financial reporting. (a) The following forms or such other forms as may be approved by OMB are authorized for obtaining financial information from recipients. (1) SF-269...

  9. The Experience of Soviet Medicine in World War II 1941-1945. Volume I.

    Science.gov (United States)

    1982-02-25

    countries. The low percentage of neuropsychological patients in the Soviet Army is evidence of the achievements of pre- war years of the Soviet people...unsplinted 269 I I II I fracture did not bother them. To the question of the physician about =npn.aints, they most often pointed out hunger . As early

  10. Atherosclerotic ischemic renal disease. Diagnosis and prevalence in an hypertensive and/or uremic elderly population

    Directory of Open Access Journals (Sweden)

    Rossi Michele

    2003-02-01

    Full Text Available Abstract Background Atherosclerotic ischemic renal disease is a frequent cause of end-stage renal failure leading to dialysis among the elderly; Its prevalence is inferred from autopsy or retrospective arteriographic studies. This study has been conducted on 269 subjects over 50 with hypertension and/or CRF, unrelated to other known causes of renal disease. Methods All 269 patients were studied either by color-flow duplex sonography (n = 238 or by renal scintigraphy (n = 224, and 199 of the 269 patients were evaluated using both of these techniques. 40 patients, found to have renal artery stenosis (RAS, were subjected to 3D-contrast enhancement Magnetic Resonance Angiography (MRA and/or Selective Angiography (SA. An additional 23 cases, negative both to scintigraphy and to ultrasound study, underwent renal angiography (MRA and/or SA. Results Color-duplex sonography, carried out in 238 patients, revealed 49 cases of RAS. MR or SA was carried out in 35 of these 49 patients, and confirmed the diagnosis in 33. Color-duplex sonography showed a PPV value of 94.3% and NPV of 87.0% while renal scintigraphy, carried out in 224 patients, had a PPV of 72.2% and a NPV of 29.4%. Patients with RAS showed a higher degree of renal insufficiency compared to non stenotic patients while there were no differences in proteinuria. RAS, based on color-duplex sonography studies, was present in 11% of patients in the age group 50–59, 18% in the 60–69 and 23% at age 70 and above. Conclusions A relatively large percentage of the elderly population with renal insufficiency and/or hypertension is affected by RAS and is at risk of developing end-stage renal failure. Color-duplex ultrasonography is a valid routine method of investigation of population at risk for renal artery stenosis.

  11. Molecular cloning and genomic organization of a second probable allatostatin receptor from Drosophila melanogaster

    DEFF Research Database (Denmark)

    Lenz, C; Williamson, M; Grimmelikhuijzen, C J

    2000-01-01

    We (C. Lenz et al. (2000) Biochem. Biophys. Res. Commun. 269, 91-96) and others (N. Birgül et al. (1999) EMBO J. 18, 5892-5900) have recently cloned a Drosophila receptor that was structurally related to the mammalian galanin receptors, but turned out to be a receptor for a Drosophila peptide bel...

  12. Autopoietic Automata: Complexity Issues in Offspring-Producing Evolving Processes

    Czech Academy of Sciences Publication Activity Database

    Wiedermann, Jiří

    2007-01-01

    Roč. 383, č. 2-3 (2007), s. 260-269 ISSN 0304-3975 R&D Projects: GA AV ČR 1ET100300517 Institutional research plan: CEZ:AV0Z10300504 Keywords : autopoietic automata * self-reproducing automata * interactive Turing machine * simulation * computational complexity Subject RIV: IN - Informatics, Computer Science Impact factor: 0.735, year: 2007

  13. The Use and Abuse of Cell Phones and Text Messaging in the Classroom: A Survey of College Students

    Science.gov (United States)

    Tindell, Deborah R.; Bohlander, Robert W.

    2012-01-01

    As the use of mobile devices, such as cell phones, has proliferated in academic settings in recent years, new challenges are faced by institutions of higher education and their faculties. The authors surveyed 269 college students from 21 academic majors at a small northeastern university to gain a better understanding of the frequency and manner…

  14. Weak tidal correlation of NW-Bohemia/Vogtland earthquake swarms

    Czech Academy of Sciences Publication Activity Database

    Fischer, Tomáš; Kalenda, Pavel; Skalský, Lumír

    2006-01-01

    Roč. 424, č. 3-4 (2006), s. 259-269 ISSN 0040-1951 R&D Projects: GA AV ČR IAA3012308 Institutional research plan: CEZ:AV0Z30120515; CEZ:AV0Z30460519 Keywords : Earth tides * earthquake swarm * triggered earthquakes Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.675, year: 2006

  15. STABILITY: AN INVESTIGATION OF AS(III)/AS(V) STABILITY IN IRON RICH DRINKING WATER MATRICES

    Science.gov (United States)

    Arsenic in drinking water is predominantly inorganic arsenic. The two oxidation states of inorganic arsenic are As(III)(pKa=9.3) and As(V)(pKa2=6.9). The distribution of As(III) and AS(V) in a water is dependent on the redox potential of the water. The actual distribution can ...

  16. Utilization of organic nitrogen by arbuscular mycorrhizal fungi-is there a specific role for protists and ammonia oxidizers?

    Czech Academy of Sciences Publication Activity Database

    Bukovská, Petra; Bonkowski, M.; Konvalinková, Tereza; Beskid, Olena; Hujslová, Martina; Püschel, David; Řezáčová, Veronika; Gutierrez-Nunez, M.S.; Gryndler, Milan; Jansa, Jan

    2018-01-01

    Roč. 28, č. 3 (2018), s. 269-283 ISSN 0940-6360 R&D Projects: GA ČR(CZ) GA18-04892S; GA MŠk(CZ) LK11224 Institutional support: RVO:61388971 Keywords : N-15-labeling * Metatranscriptomics * Organic nitrogen (N) Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 3.047, year: 2016

  17. Detection of the impact of early Holocene hunter-gatherers on vegetation in the Czech Republic, using multivariate analysis of pollen data

    Czech Academy of Sciences Publication Activity Database

    Kuneš, P.; Pokorný, Petr; Šída, P.

    2008-01-01

    Roč. 17, č. 3 (2008), s. 269-287 ISSN 0939-6314 R&D Projects: GA AV ČR IAAX00020701 Institutional research plan: CEZ:AV0Z80020508 Keywords : Mesolithic * pollen indicators * human impact Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 1.845, year: 2008 http://www.springerlink.com/content/c18141287713quqx/

  18. Spatially resolved characterization of electrostatic fluctuations in the scrape-off layer of the CASTOR tokamak

    Czech Academy of Sciences Publication Activity Database

    Devynck, P.; Bonhomme, G.; Martines, E.; Stöckel, Jan; Van Oost, G.; Voitsekhovitch, I.; Adámek, Jiří; Azeroual, A.; Doveil, F.; Ďuran, Ivan; Gravier, E.; Gunn, J.; Hron, Martin

    2005-01-01

    Roč. 47, č. 2 (2005), s. 269-280 ISSN 0741-3335 R&D Projects: GA ČR GA202/03/0786 Grant - others:GA - INTAS 2001 2056 Institutional research plan: CEZ:AV0Z20430508 Keywords : tokamak * plasma * turbulence Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.902, year: 2005

  19. Working group report: Neutrino physics

    Indian Academy of Sciences (India)

    olation. PACS No. 14.6.q. 1. Introduction. It was decided to cover a myriad of topics for discussion and work in the neu- trino physics working group, rather than restrict ourselves to any one focal theme. 269 ..... [8] Super-Kamiokande Collaboration: K Abe et al, Phys. Rev. Lett. 97, 171801 (2006), hep-ex/0607059.

  20. Classification of inland Bolboschoenus-dominated vegetation in Central Europe

    Czech Academy of Sciences Publication Activity Database

    Hroudová, Zdenka; Hrivnák, R.; Chytrý, M.

    2009-01-01

    Roč. 39, č. 2 (2009), s. 205-215 ISSN 0340-269X R&D Projects: GA AV ČR IAA6005905; GA ČR GA521/04/0997 Institutional research plan: CEZ:AV0Z60050516 Keywords : vegetation classification * saline vegetation * freshwater inland communities Subject RIV: EF - Botanics Impact factor: 0.674, year: 2009

  1. Effect of Herbal Immunodulator on Body weight gain in immunosuppressed broiler birds

    Directory of Open Access Journals (Sweden)

    S.G. Mode

    Full Text Available The herbal immunomodulator was evaluated in immunosupressed broiler birds in terms of body weight gain. The treatment with Ocimum sanctum and Emblica officinalis @ 3 gm /kg feed for 2 weeks were found to be effective immunomodulator in increasing body weight gain in broiler birds. [Vet World 2009; 2(7.000: 269-270

  2. Sequence Classification: 768696 [

    Lifescience Database Archive (English)

    Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|17554128|ref|NP_498099.1| the gene is express...ed protein retains C2H2 zinc-finger at its N-terminal region (162.6 kD) (3G269) || http://www.ncbi.nlm.nih.gov/protein/17554128 ...

  3. Europe remains optimistic, in spite of the German collapse; Europa. Deutschland zum Trotz - optimistischer

    Energy Technology Data Exchange (ETDEWEB)

    Epp, Baerbel

    2010-12-14

    More than 269 producers of solar thermal systems participated in the ISOL autumn inquiry. This is about one fifth more than in spring 2010. The index reflects the market conditions worldwide: There were record sales in Brazil, a collapsed market in Canada and Germany, a slight downward trend in Austria, and careful optimism in Italy.

  4. A mixed mood - depending on the region

    Energy Technology Data Exchange (ETDEWEB)

    Epp, Baerbel

    2011-07-01

    A considerable 269 solar thermal manufacturers took part in the ISOL autumn survey - a good 20 percent more than in the spring of 2010. The index reflects the market development worldwide: record sales in Brazil, a market setback in Canada and Germany, a slight downward trend in Austria and cautious optimism in Italy. (orig.)

  5. Structure of montmorillonite cointercalated with stearic acid and octadecylamine: Modeling, diffraction, IR spectroscopy

    Czech Academy of Sciences Publication Activity Database

    Čapková, P.; Pospíšil, M.; Valášková, M.; Měřínská, D.; Trchová, Miroslava; Sedláková, Zdeňka; Weiss, Z.; Šimoník, J.

    2006-01-01

    Roč. 300, č. 1 (2006), s. 264-269 ISSN 0021-9797 R&D Projects: GA ČR GA205/05/2548; GA ČR GP205/03/D111 Institutional research plan: CEZ:AV0Z40500505 Keywords : polymer-clay nanocomposite * intercalation * montmorillonite Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.233, year: 2006

  6. Quality of Academic Advising at UNO: Results of Student and Faculty Surveys.

    Science.gov (United States)

    ESS Reports, 1988

    1988-01-01

    This report presents the results of a student/faculty survey on the academic advising process at the University of Nebraska at Omaha, and highlights issues in improving the advising process. The survey included 195 recent graduates, 269 existing students, and 207 faculty and professional advisors. The study found that 70.8% of students were…

  7. Implementation of Wetting and Drying in NCOM: Description and Validation Test Report

    Science.gov (United States)

    2015-08-04

    inundation in Charleston Harbor during Hurricane Hugo 1989, Ocean Modelling, 20, 252– 269. Zimmermann, M., and M.M. Prescott (2014). Smooth Sheet...against, (c) several coastal regions that have notable WAD areas, i.e., San Francisco Bay, Chesapeake Bay, and Cook Inlet in Alaska, and (d) Hurricane ...Inlet, Alaska . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 3.8 Hurricane Ike

  8. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. A Ahmed Morsy. Articles written in Pramana – Journal of Physics. Volume 67 Issue 2 August 2006 pp 269-276 Research Articles. Determination of thorium and uranium contents in soil samples using SSNTD's passive method · T A Salama U Seddik T M Dsoky A Ahmed Morsy ...

  9. Ultraviolet and green parts of the colour spectrum affect egg rejection in the song thrush (Turdus philomelos)

    Czech Academy of Sciences Publication Activity Database

    Honza, Marcel; Polačiková, Lenka; Procházka, Petr

    2007-01-01

    Roč. 92, č. 2 (2007), s. 269-276 ISSN 0024-4066 R&D Projects: GA AV ČR IAA600930605; GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60930519 Keywords : brood parasitism * cuckoo * egg appearance * evolution of mimicry * reflectance Subject RIV: EG - Zoology Impact factor: 2.368, year: 2007

  10. Optimal foraging and predator-prey dynamics III

    Czech Academy of Sciences Publication Activity Database

    Křivan, Vlastimil; Eisner, Jan

    2003-01-01

    Roč. 63, - (2003), s. 269-279 ISSN 0040-5809 R&D Projects: GA ČR GA201/03/0091; GA MŠk LA 101 Institutional research plan: CEZ:AV0Z5007907 Keywords : Optimal foraging theory * adaptive behavior * predator-prec population dynamics Subject RIV: EH - Ecology, Behaviour Impact factor: 2.261, year: 2003

  11. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. T A Salama. Articles written in Pramana – Journal of Physics. Volume 67 Issue 2 August 2006 pp 269-276 Research Articles. Determination of thorium and uranium contents in soil samples using SSNTD's passive method · T A Salama U Seddik T M Dsoky A Ahmed Morsy R ...

  12. Spontaneous regression of tumour and the role of microbial infection - possibilities for cancer treatment

    Czech Academy of Sciences Publication Activity Database

    Kučerová, Petra; Červinková, Monika

    2016-01-01

    Roč. 27, č. 4 (2016), s. 269-277 ISSN 0959-4973 R&D Projects: GA MŠk ED2.1.00/03.0124 Institutional support: RVO:67985904 Keywords : bacillus Calmette-Guérin vaccine * cancer * Clostridium spp. * Coley´s toxin * microorganisms Subject RIV: FD - Oncology ; Hematology Impact factor: 2.320, year: 2016

  13. Body Size Perceptions and Weight Status of Adults in a Nigerian ...

    African Journals Online (AJOL)

    mass index (BMI) (25–26.9 kg/m2): About 50% of men and. 30% of women. ... body weight perception of adults in the Nigerian rural community. A large ... [7] Blacks were more satisfied with their body .... Differences between self and people perceptions were ..... body image in accordance with reigning values, which equate.

  14. Spread of the West Nile virus vector Culex modestus and the potential malaria vector Anopheles hyrcanus in central Europe

    Czech Academy of Sciences Publication Activity Database

    Votýpka, Jan; Šeblová, V.; Rádrová, J.

    2008-01-01

    Roč. 33, č. 2 (2008), s. 269-277 ISSN 1081-1710 R&D Projects: GA ČR GP206/05/P045; GA MŠk(CZ) LC06009 Institutional research plan: CEZ:AV0Z60220518 Keywords : mosquitoes * WNV * Czech Republic * climate change Subject RIV: EE - Microbiology, Virology Impact factor: 1.057, year: 2008

  15. B-11-NMR shielding effects in the closo borane series: sensitivity of shifts and their additivity

    Czech Academy of Sciences Publication Activity Database

    Štíbr, Bohumil

    2017-01-01

    Roč. 41, č. 23 (2017), s. 14452-14456 ISSN 1144-0546 R&D Projects: GA ČR(CZ) GA16-01618S Institutional support: RVO:61388980 Keywords : nmr-spectra * vibrational-spectra * carborane derivatives * decaborate anion * heteroboranes Subject RIV: CA - Inorganic Chemistry OBOR OECD: Inorganic and nuclear chemistry Impact factor: 3.269, year: 2016

  16. Effects of spray drying and size reduction of edible bird's nest on in-vitro digestibility

    Science.gov (United States)

    Muslim, Masitah; Babji, Abdul Salam; Mustapha, Wan Aida Wan

    2015-09-01

    The purpose of this study is to determine the effects of spray drying and size reduction of edible bird's nest (EBN) on in-vitro digestibility respectively. Sample prepared were EBN microparticulates; 710 µm (EBN710), 300 µm (EBN300) and 38 µm (EBN38), EBN spray died (EBNSD) and raw EBN (EBNraw) as control. Protein content and solubility were determined before the samples being subjected to in-vitro digestibility. Protein content of EBN710 (55.37±0.269%), EBN300 (56.57±0.163%) EBN38 (56.77±0.021%) and EBNraw (55.46±0.269%) was not significantly different (p>0.05) but EBNSD (60.33b+0.346%) was the highest (pDigestibility of EBN300 (88.43±0.95%) was higher (pDigestibility of EBN microparticulates and spray dried powder were all lower (pdigestibility could be due to the nature of EBN protein as glycoprotein. Proteolytic (tryptic) digestion of native glycoprotein is often incomplete due to ste aric hindrance from the presence of bulky oligosaccharides.

  17. [Clinical and histopathological characterization of oral leukoplakia in patients with HIV infection].

    Science.gov (United States)

    Schmidt-Westhausen, A M; Reichart, P A; Gross, U

    1999-03-01

    The aim of this study was to assess the prevalence of oral leukoplakia (OL) in HIV-positive patients and to evaluate the clinical and histopathological features and the presence of Candida hyphae and viral infections (HSV 1, 2, HPV, EBV and CMV) by immunocytochemical methods using mono- or polyclonal antibodies. A total of 269 HIV-seropositive patients, (222 men, median age 36.7 years and 47 women, median age 32 years) were registered. OL occurred in 20/269 (7.4%) patients (men, smokers, median age 38 years); the non-homogeneous form was observed in 11%. A lesional biopsy specimen was obtained from 8/20 patients. Specimens did not show signs of epithelial dysplasia. Candida hyphae were evident in 2/8 cases. Two patients tested positive for HPV and CMV; antibodies against EBV, HSV1 and 2 were negative. In conclusion, the prevalence of OL is comparatively high in this group of HIV-seropositive patients (7.4% vs. 0.9-2.2%). Moreover, the mean age of the study group at the time of diagnosis for OL was lower (38 years vs. 60 years).

  18. Examining University Students' Anger and Satisfaction with Life

    Science.gov (United States)

    Çevik, Gülsen Büyüksahin

    2017-01-01

    The current research aims to study university students' levels of anger and satisfaction with life, based on gender, years of attendance, accommodation, and whether they experience adjustment problems. The current research participants included a total of 484 individuals (X-bar age = 22.56; SD = 1.72; range = 19-37), with 269 (55.6%) males and 215…

  19. Acyclic nucleoside bisphosphonates: Synthesis and properties of chiral 2-amino-4,6-bis[(phosphonomethoxy)alkoxy]pyrimidines

    Czech Academy of Sciences Publication Activity Database

    Doláková, Petra; Dračínský, Martin; Masojídková, Milena; Šolínová, Veronika; Kašička, Václav; Holý, Antonín

    2009-01-01

    Roč. 44, č. 6 (2009), s. 2408-2424 ISSN 0223-5234 R&D Projects: GA MŠk 1M0508 Grant - others:NIH(US) 1UC1AIO62540-01 Institutional research plan: CEZ:AV0Z40550506 Keywords : acyclic nucleoside phosphonates * pyrimidine * bisphosphonates Subject RIV: CC - Organic Chemistry Impact factor: 3.269, year: 2009

  20. Fulltext PDF

    Indian Academy of Sciences (India)

    On some problems of the maximum entropy ansatz. 365. Banerjee A. Coupled dilaton and electromagnetic field in cylindrically symmetric spacetime. 337. Baruah G D see Borah Rita Moni. 269. Bassi Monika. Transition probabilities for two-photon. H(½×–¾×) and He(½1×–2. 1×) transitions: A partial-closure approach. 377.

  1. Assessing Risk Markers in Intimate Partner Femicide and Severe Violence: A New Assessment Instrument

    Science.gov (United States)

    Echeburua, Enrique; Fernandez-Montalvo, Javier; de Corral, Paz; Lopez-Goni, Jose J.

    2009-01-01

    The aim of this study is to develop a scale to predict intimate partner femicide and severe violence. The sample consists of 1,081 batterer men who were reported to the police station. First, the most significant differences between the severe violence group (n = 269) and the less severe violence group (n = 812) in sociodemographic variables are…

  2. National Centers for Environmental Prediction

    Science.gov (United States)

    Dynamics, doi:10.1007/s00382-017-3587-z, 2017. 2016 Chattopadhyay R., Suryachandra A. Rao, Sabeerali C.T Applied Climatology, 125, August 2016, DOI:10.1007/s00704-015-1521-z, 413-426. Chaudhari, H.S., Hazra, A :10.1007/s00704-015-1515, 253-269. Chowdary J.S., Parekh A., Kakatkar R., Gnanaseelan C., Srinivas G

  3. The Evaluation of Pre­-Service Preschool Teachers' Knowledge about the Concept of Environment

    Science.gov (United States)

    Ahi, Berat; Alisinanoglu, Fatma

    2015-01-01

    The purpose of the research is to evaluate pre-­service preschool teachers' knowledge about environment by analyzing their drawings about it. 70 first grade, 99 second grade, 56 third grade and 44 fourth grade, with a total of 269 students have been evaluated in this research. This qualitative research was made with social structuralism vision.…

  4. Formalised classification of the annual herb vegetation of wetlands (Isoëto-Nano-Juncetea class) in the Czech Republic and Slovakia (Central Europe)

    Czech Academy of Sciences Publication Activity Database

    Šumberová, Kateřina; Hrivnák, R.

    2013-01-01

    Roč. 43, 1-2 (2013), s. 13-40 ISSN 0340-269X R&D Projects: GA AV ČR KJB600050803; GA ČR GA206/09/0329 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : wetland vegetation * syntaxonomical revision * fishpond management Subject RIV: EF - Botanics Impact factor: 0.393, year: 2013

  5. Comparison of glow argon plasma-induced surface changes of thermoplastic polymers

    Czech Academy of Sciences Publication Activity Database

    Reznickova, A.; Kolská, Z.; Hnatowicz, Vladimír; Stopka, Pavel; Svorcik, V.

    2011-01-01

    Roč. 269, č. 2 (2011), s. 83-88 ISSN 0168-583X R&D Projects: GA ČR GA106/09/0125; GA MŠk(CZ) LC06041 Institutional research plan: CEZ:AV0Z10480505; CEZ:AV0Z40320502 Keywords : POLYSTYRENE SURFACES * POLYETHYLENE * DISCHARGE Subject RIV: JI - Composite Materials Impact factor: 1.211, year: 2011

  6. Carcinogenicity of Embedded Tungsten Alloys in Mice

    Science.gov (United States)

    2011-03-01

    formation as a result of embedded metal from a lawn mower blade (Saruwatari et al. 2009) and a chain saw blade (Osawa et al. 2006), respectively. In both...granuloma attributable to a piece of lawn - mower blade. Clin Exp Dermatol 34:e268–e269 Schins RP, Borm PJ (1999) Mechanisms and mediators in coal dust induced

  7. 2516-IJBCS-Article-Pascal Bazongo

    African Journals Online (AJOL)

    hp

    développement au Burkina Faso s'est intéressé au Jatropha curcas L. comme source d'énergie et de durabilité des productions. ... Faso became interested in Jatropha curcas L. as a source of energy and sustainability of production. To assess the influence of ..... Revue des Energies Renouvelables,. 12(2):. 269. -. 278.

  8. 1513-IJBCS-Article - Malik Leye

    African Journals Online (AJOL)

    hp

    3Sénégalaise d'Energies Vertes S.A. (SEV) BP : 440, Louga, Sénégal. *Auteur correspondant, E-mail: elhadjmalickleye@yahoo.fr, Tel: +221 77 556 82 96. RESUME ...... la mycorhization sur la croissance et le développement de Jatropha curcas L. Revue des Energies Renouvelables, 12(2):. 269–278. Manga AGB. 2005.

  9. Diurnal deviations in the relationship between CO2 efflux and temperature: A case study

    Czech Academy of Sciences Publication Activity Database

    Dařenová, Eva; Pavelka, Marian; Acosta, Manuel

    2014-01-01

    Roč. 123, DEC (2014), s. 263-269 ISSN 0341-8162 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0073; GA MŠk(CZ) LM2010007 Institutional support: RVO:67179843 Keywords : norway spruce forest * Q10 * R10 * soil respiration * chamber technique Subject RIV: DI - Air Pollution ; Quality Impact factor: 2.820, year: 2014

  10. The effects of adhesive forces on the collision behavior of polyolefin particles

    Czech Academy of Sciences Publication Activity Database

    Ledvinková, Blanka; Kosek, J.

    2013-01-01

    Roč. 243, July (2013), s. 27-39 ISSN 0032-5910 R&D Projects: GA ČR GA103/09/2066 Institutional support: RVO:67985874 Keywords : adhersive forces * agglomeration * chain entanglement * discrete element method * gas polymerization Subject RIV: BK - Fluid Dynamics Impact factor: 2.269, year: 2013 http://www.sciencedirect.com/science/article/pii/S0032591013002362

  11. The effectiveness of selected housing subsidies in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Lux, Martin; Sunega, Petr; Boelhouwer, P.

    2009-01-01

    Roč. 24, č. 3 (2009), s. 249-269 ISSN 1566-4910 R&D Projects: GA ČR GA403/09/1915 Institutional research plan: CEZ:AV0Z70280505 Keywords : Housing policy * Welfare economics * Subsidy effectiveness Subject RIV: AH - Economics http://www.springerlink.com/content/y8km555k622v8vu0/

  12. Academic Advising at UNO. Report of the 1991 Student Survey.

    Science.gov (United States)

    Crawford, A. E.

    1991-01-01

    A study was done of student perception of academic advising at the University of Nebraska, Omaha (UNO). The study surveyed 638 students who participated in the early registration process for the Fall 1991 semester. Of those students, 269 were men and 369 were women and 8.3 percent were members of a minority group. The study instrument was the…

  13. CYCLIC STRAIN LOCALIZATION IN CAST NICKEL BASED SUPERALLOY INCONEL 792-5A AT ROOM TEMPERATURE

    Czech Academy of Sciences Publication Activity Database

    Petrenec, Martin; Man, Jiří; Obrtlík, Karel; Polák, Jaroslav

    308/2005, č. 86 (2005), s. 269-274 ISSN 1429-6055. [Metody oceny struktury oraz wlasności materialów i wyrobów. Ustroń-Jaszowiec, 07.12.2005-09.12.2005] Institutional research plan: CEZ:AV0Z20410507 Keywords : low cycle fatigue * superalloy * cyclic strain localization Subject RIV: JL - Materials Fatigue, Friction Mechanics

  14. New Soliton-like Solutions and Multi-soliton Structures for Broer-Kaup System with Variable Coefficients

    International Nuclear Information System (INIS)

    Ji Mingjun; Lue Zhuosheng

    2005-01-01

    By using the further extended tanh method [Phys. Lett. A 307 (2003) 269; Chaos, Solitons and Fractals 17 (2003) 669] to the Broer-Kaup system with variable coefficients, abundant new soliton-like solutions and multi-soliton-like solutions are derived. Based on the derived multi-soliton-like solutions which contain arbitrary functions, some interesting multi-soliton structures are revealed.

  15. Leapfrogging into new territory: How Mascarene ridged frogs diversified across Africa and Madagascar to maintain their ecological niche

    Czech Academy of Sciences Publication Activity Database

    Zimkus, B. M.; Lawson, L. P.; Barej, M. F.; Barratt, C. D.; Channing, A.; Dash, K. M.; Dehling, J. M.; Du Preez, L.; Gehring, P.-S.; Greenbaum, E.; Gvoždík, Václav; Harvey, J.; Kielgast, J.; Kusamba, C.; Nagy, Z. T.; Pabijan, M.; Penner, J.; Rödel, M.-O.; Vences, M.; Lötters, S.

    2017-01-01

    Roč. 106, January (2017), s. 254-269 ISSN 1055-7903 R&D Projects: GA ČR GJ15-13415Y Institutional support: RVO:68081766 Keywords : Amphibia * Historical biogeography * Pan-African * Phylogeny * Ptychadena * Species delimitation * Species distribution modeling Subject RIV: EG - Zoology OBOR OECD: Biology (theoretical, mathematical, thermal, cryobiology, biological rhythm), Evolutionary biology Impact factor: 4.419, year: 2016

  16. Optical properties of double-layer structure phthalocyanine-tetracyanoquinodimethane

    Czech Academy of Sciences Publication Activity Database

    Bortchagovsky, E. G.; Kazantseva, Z. I.; Koshets, I. A.; Nešpůrek, Stanislav; Jastrabík, Lubomír

    2004-01-01

    Roč. 460, 1-2 (2004), s. 269-273 ISSN 0040-6090 R&D Projects: GA AV ČR IAA1050901; GA AV ČR KSK4050111 Institutional research plan: CEZ:AV0Z4050913 Keywords : organic semiconductors * ellipsometry * optical spectroscopy Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.647, year: 2004

  17. Anodic Oxidation of 18 Halogenated and/or Methylated Derivatives of CB(11)Hu(12)(-)

    Czech Academy of Sciences Publication Activity Database

    Wahab, Abdul; Douvris, C.; Klíma, Jiří; Šembera, F.; Ugolotti, J.; Kaleta, J.; Ludvík, Jiří; Michl, J.

    2017-01-01

    Roč. 56, č. 1 (2017), s. 269-276 ISSN 0020-1669 R&D Projects: GA ČR GAP206/11/0727 Institutional support: RVO:61388955 Keywords : WEAKLY COORDINATING ANIONS * DODECAMETHYLCARBA-CLOSO-DODECABORANYL * ICOSAHEDRAL CARBORANE ANIONS Subject RIV: CG - Electrochemistry OBOR OECD: Electrochemistry (dry cells, batteries, fuel cells, corrosion metals, electrolysis) Impact factor: 4.857, year: 2016

  18. A Technical History of the SEI

    Science.gov (United States)

    2017-01-01

    more effec- tively use scarce assurance resources. The theory is borrowing and extending concepts from law, philosophy, artificial intelligence , and...Consequence: Enterprise Risk Management and Security Improvement 189 The SEI Contribution 190 References 190 Cybersecurity Engineering 192 The...Provides Benefits 267 The SEI Contribution 267 References 267 8 Forensics 269 Introduction to Computer Forensics: Digital Intelligence and

  19. Perceptions about the acceptability and prevalence of HIV testing ...

    African Journals Online (AJOL)

    HIV counselling and testing (HCT) is considered important because it is an entry point to a comprehensive continuum of care for HIV/AIDS. The South African Department of Health launched an HCT campaign in April 2010, and this reached 13,269,746 people by June 2011, of which 16% tested HIV positive and 400,000 of ...

  20. Adipokinetic hormones control amylase activity in the cockroach (Periplaneta americana) gut

    Czech Academy of Sciences Publication Activity Database

    Bodláková, K.; Jedlička, Pavel; Kodrík, Dalibor

    2017-01-01

    Roč. 24, č. 2 (2017), s. 259-269 ISSN 1672-9609 R&D Projects: GA ČR GA14-07172S Institutional support: RVO:61388963 ; RVO:60077344 Keywords : AKH * AKH receptor * amylase * enzyme * gene expression * midgut Subject RIV: ED - Physiology OBOR OECD: Entomology; Biochemistry and molecular biology (BC-A) Impact factor: 2.026, year: 2016

  1. Ciguatoxins Evoke Potent CGRP Release by Activation of Voltage-Gated Sodium Channel Subtypes Na(V)1.9, Na(V)1.7 and Na(V)1.1

    Czech Academy of Sciences Publication Activity Database

    Touška, Filip; Sattler, S.; Malsch, P.; Lewis, R. J.; Reeh, P. W.; Zimmermann, K.

    2017-01-01

    Roč. 15, č. 9 (2017), č. článku 269. ISSN 1660-3397 Institutional support: RVO:67985823 Keywords : voltage-gated calcium channels * calcitonin-gene related peptide * tetrodotoxin * TTX * P-CTX-1 * TRPA1 * TRPC5 * neuropathic pain * neurogenic inflammation Subject RIV: FH - Neurology OBOR OECD: Neurosciences (including psychophysiology Impact factor: 3.503, year: 2016

  2. Synthesis of Pt/C Fuel Cell Electrocatalysts: Residual Content of Chloride and Activity in Oxygen Reduction.

    Czech Academy of Sciences Publication Activity Database

    Kaluža, Luděk; Larsen, M.J.; Morales, I.J.; Cavaliere, S.; Jones, D.J.; Roziere, J.; Kallistová, Anna; Dytrych, Pavel; Gulková, Daniela; Odgaard, M.

    2016-01-01

    Roč. 7, č. 4 (2016), s. 269-275 ISSN 1868-2529 R&D Projects: GA MŠk(CZ) 7HX13003 EU Projects: European Commission(XE) 303466 - IMMEDIATE Institutional support: RVO:67985858 ; RVO:67985831 Keywords : catalysts * membrane * Pt(111) Subject RIV: CF - Physical ; Theoretical Chemistry; CA - Inorganic Chemistry (GLU-S) Impact factor: 2.398, year: 2016

  3. 76 FR 40754 - Duke Energy Carolinas, LLC Catawba Nuclear Station, Units 1 and 2; McGuire Nuclear Station, Units...

    Science.gov (United States)

    2011-07-11

    ... NUCLEAR REGULATORY COMMISSION [NRC-2011-0100; Docket Nos. 50-413 and 50-414; Docket Nos. 50-369 and 50-370; Docket Nos. 50-269, 50-270, And 50-287] Duke Energy Carolinas, LLC Catawba Nuclear Station, Units 1 and 2; McGuire Nuclear Station, Units 1 and 2; Oconee Nuclear Station, Units 1, 2, and 3; Notice...

  4. 76 FR 24538 - Duke Energy Carolinas, LLC; Catawba Nuclear Station, Units 1 and 2; McGuire Nuclear Station...

    Science.gov (United States)

    2011-05-02

    ... NUCLEAR REGULATORY COMMISSION [Docket Nos. 50-413 and 50-414; NRC-2011-0100; Docket Nos. 50-369 and 50-370; Docket Nos. 50-269, 50-270, and 50-287] Duke Energy Carolinas, LLC; Catawba Nuclear Station, Units 1 and 2; McGuire Nuclear Station, Units 1 and 2; Oconee Nuclear Station, Units 1, 2, and 3...

  5. Pore formation by the Bordetella adenylate cyclase toxin in lipid bilayer membranes: Role of voltage and pH

    Czech Academy of Sciences Publication Activity Database

    Knapp, O.; Maier, E.; Mašín, Jiří; Šebo, Peter; Benz, R.

    2008-01-01

    Roč. 1778, č. 1 (2008), s. 260-269 ISSN 0005-2736 R&D Projects: GA AV ČR(CZ) IAA5020406 Grant - others:XE(XE) QLK2-CT-1999-00556 Institutional research plan: CEZ:AV0Z50200510 Keywords : adenylate cyclase toxin * act * voltage Subject RIV: EE - Microbiology, Virology Impact factor: 4.180, year: 2008

  6. Sporulation of four arbuscular mycorrhizal fungi isolates inside dead seed cavities and glass capillaries

    Czech Academy of Sciences Publication Activity Database

    Rydlová, Jana; Batkhuugyin, Enkhtuya; Vosátka, Miroslav

    2004-01-01

    Roč. 36, - (2004), s. 269-284 ISSN 0334-5114 R&D Projects: GA AV ČR KSK6005114; GA ČR GA526/99/P032; GA MŠk OC 838.10 Institutional research plan: CEZ:AV0Z6005908 Keywords : Chenopodium album seeds * Glomus * indigenous AMF isolates Subject RIV: EF - Botanics Impact factor: 0.682, year: 2004

  7. Structure of micelles formed by highly asymmetric polystyrene-b-polydimethylsiloxane and polystyrene-b-poly[5-(N,N-diethylamino)isoprene] diblock copolymers

    Czech Academy of Sciences Publication Activity Database

    Giacomelli, F. C.; Riegel, I. C.; Štěpánek, Petr; Petzhold, C. L.; Ninago, M. D.; Satti, A. J.; Ciolino, A. E.; Villar, M. A.; Schmidt, V.; Giacomelli, C.

    2010-01-01

    Roč. 26, č. 18 (2010), s. 14494-14501 ISSN 0743-7463 R&D Projects: GA ČR GA202/09/2078 Grant - others:AV ČR(CZ) ASCR/CONICET 2012CZ006 Institutional research plan: CEZ:AV0Z40500505 Keywords : dynamic light-scattering * block-copolymers * selective solvent Subject RIV: BO - Biophysics Impact factor: 4.269, year: 2010

  8. The relation between evil and transcendence: new possibilities ...

    African Journals Online (AJOL)

    In this article I will analyse the concept of evil in terms of the typology of transcendence that was developed by Wessel Stoker. I will argue that there are, within the (post-) modern discourse, and ... This notion of evil may enhance our ethical responsibility towards it. South African Journal of Philosophy 2014, 33(3): 259–269 ...

  9. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. U Seddik. Articles written in Pramana – Journal of Physics. Volume 67 Issue 2 August 2006 pp 269-276 Research Articles. Determination of thorium and uranium contents in soil samples using SSNTD's passive method · T A Salama U Seddik T M Dsoky A Ahmed Morsy R El- ...

  10. Increasing Impact of Technology in Higher Education

    Science.gov (United States)

    Utah System of Higher Education, 2016

    2016-01-01

    For Fall 2016, of the 175,509 students enrolled in the Utah System of Higher Education at third week, 69,535 (39.6 %) are participating in some form of technology delivered instruction. Of that total, 54,269 (30.9%) enrolled in at least one online class. Despite availability of online courses and degrees, students prefer using online courses to…

  11. 78 FR 18334 - JAL Hydro, LLC; Notice of Preliminary Permit Application Accepted for Filing and Soliciting...

    Science.gov (United States)

    2013-03-26

    ... existing 26.9-acre Natick Pond with operating elevation of about 48.5 feet above mean sea level (msl); (3) a new 130-foot-long, 20-foot-wide, 6-foot-deep concrete intake channel; (4) a new 10-foot-high, 20... on the Commission's Web site http://www.ferc.gov/docs-filing/efiling.asp . Commenters can submit...

  12. Sociální koheze. Teorie, koncepty a analytická východiska

    Czech Academy of Sciences Publication Activity Database

    Šafr, Jiří; Bayer, Ivo; Sedláčková, Markéta

    2008-01-01

    Roč. 44, č. 2 (2008), s. 247-269 ISSN 0038-0288 R&D Projects: GA MPS 1J028/04-DP2 Institutional research plan: CEZ:AV0Z70280505 Keywords : social cohesion * collective social capital * inclusion/exclusion Subject RIV: AO - Sociology, Demography Impact factor: 0.427, year: 2008 http://dlib.lib.cas.cz/2778/

  13. 269. Veinte años de experiencia con homoinjertos vasculares criopreservados en la infección vascular

    Directory of Open Access Journals (Sweden)

    E. Quintana

    2012-04-01

    Conclusiones: Este estudio a largo plazo contribuye a mantener la indicación para el implante de homoinjertos vasculares criopreservados en las infecciones vasculares. Los resultados demuestran un comportamiento satisfactorio en esta población multimórbida.

  14. Tubin, Eduard. Sonate pour violon et piano dans le mode phrygien / Pierre Gervasoni

    Index Scriptorium Estoniae

    Gervasoni, Pierre

    1995-01-01

    Uuest heliplaadist "Tubin, Eduard. Sonate pour violon et piano dans le mode phrygien. Ballade pour piano en forme de Chaconne sur un theme de Mart Saar. Sonate pour saxophone alto et piano. Le Chant des soldats enrepli. Ave Maria. Societe Chorale Estudiantine de Lund, Neeme Järvi. BIS-CD 269, distribution Harmonia Mundi (CD: 161 F), 1984/85.TT: 1h 03'46"

  15. Bent-core mesogens with an aromatic unit at the terminal position

    Czech Academy of Sciences Publication Activity Database

    Bajzikova, K.; Svoboda, J.; Novotná, Vladimíra; Pociecha, D.; Gorecka, E.

    2017-01-01

    Roč. 41, č. 11 (2017), s. 4672-4679 ISSN 1144-0546 R&D Projects: GA ČR GA16-12150S; GA ČR GA15-02843S Institutional support: RVO:68378271 Keywords : bent- core mesogens * liquid crystals Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 3.269, year: 2016

  16. The nucleocytosolic and chloroplast cycle in the green chlorococcal alga Scenedesmus obliquus (Chlorophyceae, Chlorococcales) grown under various temperatures

    Czech Academy of Sciences Publication Activity Database

    Cepák, Vladislav; Přibyl, Pavel; Vítová, Milada; Zachleder, Vilém

    2007-01-01

    Roč. 46, č. 3 (2007), s. 263-269 ISSN 0031-8884 R&D Projects: GA MŠk ME 575; GA ČR(CZ) GA204/03/1113; GA MŠk(CZ) 1M0571 Institutional research plan: CEZ:AV0Z60050516; CEZ:AV0Z50200510 Keywords : Scenedesmus * cell cycle * temperature Subject RIV: EF - Botanics Impact factor: 1.358, year: 2007

  17. Trisubstituted purine inhibitors of PDGFR alpha and their antileukemic activity in the human eosinophilic cell line EOL-1

    Czech Academy of Sciences Publication Activity Database

    Malínková, Veronika; Řezníčková, Eva; Jorda, Radek; Gucký, T.; Kryštof, Vladimír

    2017-01-01

    Roč. 25, č. 24 (2017), s. 6523-6535 ISSN 0968-0896 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : dependent kinase inhibitors * src tyrosine kinase * 2,6,9-trisubstituted purines * therapeutic target * potent inhibitor * imatinib * leukemia * mutations * mutant * domain Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Hematology Impact factor: 2.930, year: 2016

  18. Effect of flecainide on atrial fibrillatory rate in a large animal model with induced atrial fibrillation

    DEFF Research Database (Denmark)

    Hesselkilde, Eva Z.; Carstensen, Helena; Haugaard, Maria M.

    2017-01-01

    caused a decrease in AFR in all animals and restored sinus rhythm in the animals with induced AF. In the control animals, AFR increased from 269 ± 36 fpm to a plateau of 313 ± 14 fpm before decreasing to 288 ± 28 fpm during the last 10% of the AF episodes preceding spontaneous conversion (P 

  19. probabilistic approach to structural appraisal of a building during

    African Journals Online (AJOL)

    ES Obe

    predict the reliability of concrete in a structure under construction, a case study ... target reliability index value of 3.7 for concrete for safety class 1 BKR[1] and less than ..... Control. Cube strength. Grade 15. 15. 17.56. 2.69. 15.33. Normal. Design mix. * fa = 0.33 × 15 = 5.10N/mm2. 2. Ranganathan, R. (1999). Structural Relia-.

  20. Studying dynamic events in the developing myocardium

    Czech Academy of Sciences Publication Activity Database

    Vostárek, František; Šaňková, Barbora; Sedmera, David

    2014-01-01

    Roč. 115, č. 2-3 (2014), s. 261-269 ISSN 0079-6107 R&D Projects: GA ČR(CZ) GAP302/11/1308; GA ČR(CZ) GA13-12412S Institutional support: RVO:67985823 Keywords : optical mapping * calcium imaging * high-speed cameras * embryo * heart * cardiac conduction system Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery Impact factor: 2.274, year: 2014

  1. Observation of the suppression of the flux of cosmic rays above 4x10(19) eV

    NARCIS (Netherlands)

    Abraham, J.; Abreu, P.; Aglietta, M.; Aguirre, C.; Allard, D.; Allekotte, I.; Allen, J.; Allison, P.; Alvarez-Muniz, J.; Ambrosio, M.; Anchordoqui, L.; Andringa, S.; Anzalone, A.; Aramo, C.; Argiro, S.; Arisaka, K.; Armengaud, E.; Arneodo, F.; Arqueros, F.; Asch, T.; Asorey, H.; Assis, P.; Atulugama, B. S.; Aublin, J.; Ave, M.; Avila, G.; Backer, T.; Badagnani, D.; Barbosa, A. F.; Barnhill, D.; Barroso, S. L. C.; Baughman, B.; Bauleo, P.; Beatty, J. J.; Beau, T.; Becker, B. R.; Becker, K. H.; Bellido, J. A.; BenZvi, S.; Berat, C.; Bergmann, T.; Bernardini, P.; Bertou, X.; Biermann, P. L.; Billoir, P.; Blanch-Bigas, O.; Blanco, F.; Blasi, P.; Bleve, C.; Mer, H. Blu; Bohacova, M.; Bonifazi, C.; Bonino, R.; Brack, J.; Brogueira, P.; Brown, W. C.; Buchholz, P.; Bueno, A.; Burton, R. E.; Busca, N. G.; Caballero-Mora, K. S.; Cai, B.; Camin, D. V.; Caramete, L.; Caruso, R.; Carvalho, W.; Castellina, A.; Catalano, O.; Cataldi, G.; Cazon, L.; Cester, R.; Chauvin, J.; Chiavassa, A.; Chinellato, J. A.; Chou, A.; Chudoba, J.; Chye, J.; Clark, P. D. J.; Clay, R. W.; Colombo, E.; Conceicao, R.; Connolly, B.; Contreras, F.; Coppens, J.; Cordier, A.; Cotti, U.; Coutu, S.; Covault, C. E.; Creusot, A.; Criss, A.; Cronin, J.; Curutiu, A.; Dagoret-Campagne, S.; Daumiller, K.; Dawson, B. R.; de Almeida, R. M.; de Donato, C.; de Jong, S. J.; De La Vega, G.; Junior, W. J. M. de Mello; de Mello Neto, J. R. T.; De Mitri, I.; de Souza, V.; del Peral, L.; Deligny, O.; Della Selva, A.; Delle Fratte, C.; Dembinski, H.; Di Giulio, C.; Diaz, J. C.; Diep, P. N.; Dobrigkeit, C.; D'Olivo, J. C.; Dong, P. N.; Dornic, D.; Dorofeev, A.; dos Anjos, J. C.; Dova, M. T.; D'Urso, D.; Dutan, I.; DuVernois, M. A.; Engel, R.; Epele, L.; Escobar, C. O.; Etchegoyen, A.; Luis, P. Facal San; Falcke, H.; Farrar, G.; Fauth, A. C.; Fazzini, N.; Ferrer, F.; Ferrero, A.; Fick, B.; Filevich, A.; Filipcic, A.; Fleck, I.; Fracchiolla, C. E.; Fulgione, W.; Garcia, B.; Gamez, D. Garcia; Garcia-Pinto, D.; Garrido, X.; Geenen, H.; Gelmini, G.; Gemmeke, H.; Ghia, P. L.; Giller, M.; Glass, H.; Gold, M. S.; Golup, G.; Albarracin, F. Gomez; Berisso, M. Gomez; Goncalves, P.; do Amaral, M. Goncalves; Gonzalez, D.; Gonzalez, J. G.; Gonzalez, M.; Gora, D.; Gorgi, A.; Gouffon, P.; Grassi, V.; Grillo, A. F.; Grunfeld, C.; Guardincerri, Y.; Guarino, F.; Guedes, G. P.; Gutierrez, J.; Hague, J. D.; Halenka, V.; Hamilton, J. C.; Hansen, P.; Harari, D.; Harmsma, S.; Harton, J. L.; Haungs, A.; Hauschildt, T.; Healy, M. D.; Hebbeker, T.; Hebrero, G.; Heck, D.; Hojvat, C.; Holmes, V. C.; Homola, P.; Horandel, J. R.; Horneffer, A.; Hrabovsky, M.; Huege, T.; Hussain, M.; Iarlori, M.; Insolia, A.; Ionita, F.; Italiano, A.; Kaducak, M.; Kampert, K. H.; Karova, T.; Kasper, P.; Kegl, B.; Keilhauer, B.; Kemp, E.; Kieckhafer, R. M.; Klages, H. O.; Kleifges, M.; Kleinfeller, J.; Knapik, R.; Knapp, J.; Koang, D. -H.; Krieger, A.; Kroemer, O.; Kuempel, D.; Kunka, N.; Kusenko, A.; La Rosa, G.; Lachaud, C.; Lago, B. L.; Lebrun, D.; Lebrun, P.; Lee, J.; de Oliveira, M. A. Leigui; Letessier-Selvon, A.; Leuthold, M.; Lhenry-Yvon, I.; Lopez, R.; Aguera, A. Lopez; Bahilo, J. Lozano; Lucero, A.; Garcia, R. Luna; Maccarone, M. C.; Macolino, C.; Maldera, S.; Mancarella, G.; Mancenido, M. E.; Mandat, D.; Mantsch, P.; Mariazzi, A. G.; Maris, I. C.; Falcon, H. R. Marquez; Martello, D.; Martinez, J.; Bravo, O. Martinez; Mathes, H. J.; Matthews, J.; Matthews, J. A. J.; Matthiae, G.; Maurizio, D.; Mazur, P. O.; McCauley, T.; McEwen, M.; McNeil, R. R.; Medina, M. C.; Medina-Tanco, G.; Melo, D.; Menichetti, E.; Menschikov, A.; Meurer, C.; Meyhandan, R.; Micheletti, M. I.; Miele, G.; Miller, W.; Mollerach, S.; Monasor, M.; Ragaigne, D. Monnier; Montanet, F.; Morales, B.; Morello, C.; Moreno, J. C.; Morris, C.; Mostafa, M.; Muller, M. A.; Mussa, R.; Navarra, G.; Navarro, J. L.; Navas, S.; Necesal, P.; Nellen, L.; Newman-Holmes, C.; Newton, D.; Nhung, P. T.; Nierstenhoefer, N.; Nitz, D.; Nosek, D.; Nozka, L.; Oehlschlaeger, J.; Ohnuki, T.; Olinto, A.; Olmos-Gilbaja, V. M.; Ortiz, M.; Ortolani, F.; Ostapchenko, S.; Otero, L.; Pacheco, N.; Selmi-Dei, D. Pakk; Palatka, M.; Pallotta, J.; Parente, G.; Parizot, E.; Parlati, S.; Pastor, S.; Patel, M.; Paul, T.; Pavlidou, V.; Payet, K.; Pech, M.; Pekala, J.; Pelayo, R.; Pepe, I. M.; Perrone, L.; Pesce, R.; Petrera, S.; Petrinca, P.; Petrov, Y.; Pichel, A.; Piegaia, R.; Pierog, T.; Pimenta, M.; Pinto, T.; Pirronello, V.; Pisanti, O.; Platino, M.; Pochon, J.; Privitera, P.; Prouza, M.; Quel, E. J.; Rautenberg, J.; Redondo, A.; Reucroft, S.; Revenu, B.; Rezende, F. A. S.; Ridky, J.; Riggi, S.; Risse, M.; Riviere, C.; Rizi, V.; Roberts, M.; Robledo, C.; Rodriguez, G.; Martino, J. Rodriguez; Rojo, J. Rodriguez; Rodriguez-Cabo, I.; Rodriguez-Frias, M. D.; Ros, G.; Rosado, J.; Roth, M.; Rouille-d'Orfeuil, B.; Roulet, E.; Rovero, A. C.; Salamida, F.; Salazar, H.; Salina, G.; Sanchez, F.; Santander, M.; Santo, C. E.; Santos, E. M.; Sarazin, F.; Sarkar, S.; Sato, R.; Scherini, V.; Schieler, H.; Schmidt, A.; Schmidt, F.; Schmidt, T.; Scholten, O.; Schovanek, P.; Schroeder, F.; Schulte, S.; Schuessler, F.; Sciutto, S. J.; Scuderi, M.; Segreto, A.; Semikoz, D.; Settimo, M.; Shellard, R. C.; Sidelnik, I.; Siffert, B. B.; Sigl, G.; De Grande, N. Smetniansky; Smialkowski, A.; Smida, R.; Smith, A. G. K.; Smith, B. E.; Snow, G. R.; Sokolsky, P.; Sommers, P.; Sorokin, J.; Spinka, H.; Squartini, R.; Strazzeri, E.; Stutz, A.; Suarez, F.; Suomijaervi, T.; Supanitsky, A. D.; Sutherland, M. S.; Swain, J.; Szadkowski, Z.; Takahashi, J.; Tamashiro, A.; Tamburro, A.; Tarutina, T.; Tascau, O.; Tcaciuc, R.; Thao, N. T.; Thomas, D.; Ticona, R.; Tiffenberg, J.; Timmermans, C.; Tkaczyk, W.; Peixoto, C. J. Todero; Tome, B.; Tonachini, A.; Torres, I.; Travnicek, P.; Tripathi, A.; Tristram, G.; Tscherniakhovski, D.; Tuci, V.; Tueros, M.; Tunnicliffe, V.; Ulrich, R.; Unger, M.; Urban, M.; Galicia, J. F. Valdes; Valino, I.; Valore, L.; van den Berg, A. M.; van Elewyck, V.; Vazquez, R. A.; Veberic, D.; Veiga, A.; Velarde, A.; Venters, T.; Verzi, V.; Videla, M.; Villasenor, L.; Vorobiov, S.; Voyvodic, L.; Wahlberg, H.; Wahrlich, P.; Wainberg, O.; Walker, P.; Warner, D.; Watson, A. A.; Westerhoff, S.; Wieczorek, G.; Wiencke, L.; Wilczynska, B.; Wilczynski, H.; Wileman, C.; Winnick, M. G.; Wu, H.; Wundheiler, B.; Yamamoto, T.; Younk, P.; Zas, E.; Zavrtanik, D.; Zavrtanik, M.; Zaw, I.; Zepeda, A.; Ziolkowski, M.

    2008-01-01

    The energy spectrum of cosmic rays above 2.5 x 10(18) eV, derived from 20 000 events recorded at the Pierre Auger Observatory, is described. The spectral index gamma of the particle flux, J proportional to E(-gamma), at energies between 4 x 10(18) eV and 4 x 10(19) eV is 2.69 +/- 0.02(stat) +/-

  2. Advanced Graphical Software for Assignments of Transitions in Rovibrational Spectra

    Czech Academy of Sciences Publication Activity Database

    Lodyga, W.; Kreglewski, M.; Pracna, Petr; Urban, Štěpán

    2007-01-01

    Roč. 243, č. 2 (2007), s. 182-188 ISSN 0022-2852 R&D Projects: GA AV ČR IAA400400504; GA AV ČR 1ET400400410 Institutional research plan: CEZ:AV0Z40400503 Keywords : assigments of high-resolution molecular spectra * combination difference chacking * Loomis-Wood algorithm Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.269, year: 2007

  3. Tremor analysis by decomposition of acceleration into gravity and inertial acceleration using inertial measurement unit

    Czech Academy of Sciences Publication Activity Database

    Šprdlík, Otakar; Hurák, Z.; Hoskovcová, M.; Ulmanová, O.; Růžička, E.

    2011-01-01

    Roč. 6, č. 3 (2011), s. 269-289 ISSN 1746-8094 R&D Projects: GA MŠk(CZ) 1M0567 Institutional research plan: CEZ:AV0Z10750506 Keywords : Tremor * Accelerometer * Inertial measurementunit * Gravitational artifact * Regression * Tremor ratingscale Subject RIV: BC - Control Systems Theory Impact factor: 1.000, year: 2011 http://library.utia.cas.cz/separaty/2011/TR/sprdlik-0350248.pdf

  4. A new possible way of anthracycline cytostatics decontamination

    Czech Academy of Sciences Publication Activity Database

    Štenglová Netíková, I. R.; Slušná, Michaela; Tolasz, Jakub; Šťastný, Martin; Popelka, Štěpán; Štengl, Václav

    2017-01-01

    Roč. 41, č. 10 (2017), s. 3975-3985 ISSN 1144-0546 Institutional support: RVO:61388980 ; RVO:61389013 Keywords : performance liquid-chromatography * sulfur mustard * photocatalytic degradation * antineoplastic agents * aqueous-solution * warfare agents * doxorubicin * anticancer Subject RIV: CA - Inorganic Chemistry ; CD - Macromolecular Chemistry (UMCH-V) OBOR OECD: Inorganic and nuclear chemistry ; Polymer science (UMCH-V) Impact factor: 3.269, year: 2016

  5. Formulation and Evaluation of Bioadhesive Cyproheptadine Tablets ...

    African Journals Online (AJOL)

    Results: The shear stress of 3 % solution of HPMC was greater than that of an equivalent concentration of Carbopol 934P. The values of K, n, R2 and detachment force for the optimized formulation (F0) were 0.269, 0.696, 0.964 and 0.066 Newton (N), respectively, and showed good correlation with the predicted values, thus ...

  6. Klíčové faktory určující chemickou diverzitu aluviálních vod

    Czech Academy of Sciences Publication Activity Database

    Pithart, David; Pechar, Libor

    3,21, 2-3 (2004), s. 269-273 ISSN 1212-0731. [Agroregion 2004. České Budějovice, 06.09.2004-07.09.2004] R&D Projects: GA MŽP SM/640/18/03; GA ČR GA206/01/1113 Institutional research plan: CEZ:AV0Z6087904 Keywords : riparian zone * alluvial pools * water chemistry Subject RIV: DA - Hydrology ; Limnology

  7. 76 FR 80433 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing of Proposed Rule Change To List...

    Science.gov (United States)

    2011-12-23

    ... products linked to the performance of underlying commodities and currencies.\\8\\ \\6\\ See Securities Exchange... Contracts are based on, but not directly proportional to, gross domestic product (``GDP''). The positions...:00 pm Cocoa 0.42 ICE 4:00 am-2:00 pm Sugar 3.58 ICE 3:30 am-2:00 pm Cotton 2.69 ICE 9:00 pm-2:30 pm...

  8. Search for patterns by combining cosmic-ray energy and arrival directions at the Pierre Auger Observatory

    Czech Academy of Sciences Publication Activity Database

    Aab, A.; Abreu, P.; Aglietta, M.; Boháčová, Martina; Chudoba, Jiří; Ebr, Jan; Mandát, Dušan; Nečesal, Petr; Palatka, Miroslav; Pech, Miroslav; Prouza, Michael; Řídký, Jan; Schovánek, Petr; Trávníček, Petr; Vícha, Jakub

    2015-01-01

    Roč. 75, č. 6 (2015), s. 269 ISSN 1434-6044 R&D Projects: GA MŠk(CZ) LG13007; GA MŠk(CZ) 7AMB14AR005; GA ČR(CZ) GA14-17501S Institutional support: RVO:68378271 Keywords : Pierre Auger Observatory * detector * cosmic rays Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.912, year: 2015

  9. Employing contingent and inferred valuation methods to evaluate the conservation of olive groves and associated ecosystem services in Andalusia (Spain)

    Czech Academy of Sciences Publication Activity Database

    Torres-Miralles, M.; Grammatikopoulou, Ioanna; Rescia, A. J.

    2017-01-01

    Roč. 26, AUG (2017), s. 258-269 ISSN 2212-0416 Institutional support: RVO:86652079 Keywords : social-ecological system * agricultural landscape * public preferences * management * benefits * perspectives * opportunity * insights * values * areas * Agricultural landscape * Economic valuation * Protected area * Social perception * Sustainable management Subject RIV: EH - Ecology, Behaviour OBOR OECD: Environmental sciences (social aspects to be 5.7) Impact factor: 4.072, year: 2016

  10. Optimization of Fit for Mass Customized Apparel Ordering Using Fit Preference and Self Measurement.

    Science.gov (United States)

    2000-01-01

    in significance and definition for both consumers and manufacturers. Fit preference involves an individualized bias toward a particular look, size...Committee. Bishton, D. (1984). The sweatshop report. Birmingham: AFFOR. 268 269 Bjerve, S. & Doksum, K. (1993). Correlation curves: Measures of...anthropometry methods. New York: John Wiley & Sons. Rosenbaum, R. & Schilling D. (1997). In sweatshops , wages are the issue. The Corporate Examiner

  11. Optimization of decay kinetics of YAG:Ce single crystal scintillators for S(T)EM electron detectors

    Czech Academy of Sciences Publication Activity Database

    Schauer, Petr

    2011-01-01

    Roč. 269, č. 21 (2011), s. 2572-2577 ISSN 0168-583X R&D Projects: GA ČR GAP102/10/1410 Institutional research plan: CEZ:AV0Z20650511 Keywords : scintillation detector * electron microscope * cathodoluminescence * YAG:Ce single crystal scintillator * decay time * afterglow * kinetic model * SEM * STEM Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.211, year: 2011

  12. : tous les projets | Page 150 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Forum de recherche économique - Financement de base 2012-2014. Projet. Le Forum de recherche économique (ERF) est un réseau régional de recherche économique établi au Caire, qui compte 269 chercheurs affiliés. Date de début : 22 janvier 2013. End Date: 22 janvier 2016. Sujet: MIDDLE EAST, NORTH AFRICA, ...

  13. Evaluation of noni (Morinda citrifolia volatile profile by dynamic headspace and gas chromatography-mass spectrometry Avaliação do perfil de voláteis em noni (Morinda citrifolia por headspace dinâmico e cromatografia gasosa-espectrometria de massas

    Directory of Open Access Journals (Sweden)

    Adriana Sousa

    2010-09-01

    Full Text Available Noni is a fruit that has interested the scientific community due to its medicinal and functional activities. Different products that contain noni are already in the market, but their consumption could be impaired by their distinctive unpleasant aroma and flavor. The aim of this work was to evaluate the noni pulp volatile profile by dynamic headspace and gas chromatography-mass spectrometry. Thirty seven volatile compounds were detected, mainly alcohols (63.3%, esters (26.9%, cetones (7.4%, and acids (1.2%.O noni é um fruto que tem interessado à comunidade científica por sua atividade funcional e medicinal. Já se encontram no mercado diferentes produtos que contêm noni em sua composição, mas seu consumo tem sido prejudicado por seu aroma e sabor desagradáveis. O objetivo deste trabalho foi o de avaliar o perfil de voláteis da polpa de noni pela técnica de headspace dinâmico e cromatografia gasosa-espectrometria de massas. Foram detectados 37 compostos voláteis, sendo os principais: alcoóis (63,3%, ésteres (26,9%, cetonas (7,4% e ácidos (1,2%.

  14. Does visual impairment lead to additional disability in adults with intellectual disabilities?

    Science.gov (United States)

    Evenhuis, H M; Sjoukes, L; Koot, H M; Kooijman, A C

    2009-01-01

    This study addresses the question to what extent visual impairment leads to additional disability in adults with intellectual disabilities (ID). In a multi-centre cross-sectional study of 269 adults with mild to profound ID, social and behavioural functioning was assessed with observant-based questionnaires, prior to expert assessment of visual function. With linear regression analysis the percentage of variance, explained by levels of visual function, was calculated for the total population and per ID level. A total of 107/269 participants were visually impaired or blind (WHO criteria). On top of the decrease by ID visual impairment significantly decreased daily living skills, communication & language, recognition/communication. Visual impairment did not cause more self-absorbed and withdrawn behaviour or anxiety. Peculiar looking habits correlated with visual impairment and not with ID. In the groups with moderate and severe ID this effect seems stronger than in the group with profound ID. Although ID alone impairs daily functioning, visual impairment diminishes the daily functioning even more. Timely detection and treatment or rehabilitation of visual impairment may positively influence daily functioning, language development, initiative and persistence, social skills, communication skills and insecure movement.

  15. Antimicrobial activity of aroylhydrazone-based oxido vanadium(v) complexes: in vitro and in silico studies

    Czech Academy of Sciences Publication Activity Database

    Ebrahimipour, S.Y.; Sheikhshoaie, I.; Simpson, J.; Ebrahimnejad, H.; Dušek, Michal; Kharazmi, N.; Eigner, Václav

    2016-01-01

    Roč. 40, č. 3 (2016), s. 2401-2412 ISSN 1144-0546 R&D Projects: GA ČR GA15-12653S; GA MŠk LO1603 EU Projects: European Commission(XE) CZ.2.16/3.1.00/24510 Institutional support: RVO:68378271 Keywords : Schiff bases * oxido-vanadium complexes * antimictobial activity * crystal structure Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.269, year: 2016

  16. Corporate social reponsability strategic corporate social responsability: External and internal outcomes

    OpenAIRE

    Laka, Edite

    2012-01-01

    This study investigates the importance and benefits of having a strategic Corporate Social Responsibility (CSR) program by testing the interrelationships between strategic CSR with three external (reputation, corporate image, and customer loyalty) and four internal (organizational commitment, job satisfaction, performance, and organizational deviance) variables. 269 clients and non-clients along with 190 employees and their direct supervisors completed the survey. Strategic CSR has shown to h...

  17. The Relationship Between Dynamics and Structure in the Far Infrared Absorption Spectrum of Liquid Water

    Energy Technology Data Exchange (ETDEWEB)

    Woods, K.

    2005-01-14

    Using an intense source of far-infrared radiation, the absorption spectrum of liquid water is measured at a temperature ranging from 269 to 323 K. In the infrared spectrum we observe modes that are related to the local structure of liquid water. Here we present a FIR measured spectrum that is sensitive to the low frequency (< 100cm{sup -1}) microscopic details that exist in liquid water.

  18. Parallel single-cell analysis of active caspase-3/7 in apoptotic and non-apoptotic cells

    Czech Academy of Sciences Publication Activity Database

    Ledvina, Vojtěch; Janečková, Eva; Matalová, Eva; Klepárník, Karel

    2017-01-01

    Roč. 409, č. 1 (2017), s. 269-274 ISSN 1618-2642 R&D Projects: GA ČR(CZ) GA14-28254S Institutional support: RVO:68081715 ; RVO:67985904 Keywords : single-cell analysis * bioluminescence * apoptosis * caspase-3/7 Subject RIV: CB - Analytical Chemistry , Separation; EB - Genetics ; Molecular Biology (UZFG-Y) OBOR OECD: Analytical chemistry ; Developmental biology (UZFG-Y) Impact factor: 3.431, year: 2016

  19. Environmental Assessment: Military Housing Privatization Initiative Schriever Air Force Base, Colorado

    Science.gov (United States)

    2006-08-24

    community features SAFB has requested include the following: secure perimeter wall for aesthetics and security, community center/ clubhouse , swimming pool...Proposed Action Under the proposed action, 269 family housing units would be constructed on approximately 150 acres of what is now categorized as open...incremental impact of the action when added to other past, present, and reasonably foreseeable future actions regardless of what agency (Federal or non

  20. Evolution of basin architecture in an incipient continental rift: the Cenozoic Most Basin, Eger Graben (Central Europe)

    Czech Academy of Sciences Publication Activity Database

    Rajchl, M.; Uličný, David; Grygar, R.; Mach, K.

    2009-01-01

    Roč. 21, č. 3 (2009), s. 269-294 ISSN 0950-091X R&D Projects: GA AV ČR IAA3012705; GA ČR GA205/01/0629; GA ČR(CZ) GA205/06/1823 Institutional research plan: CEZ:AV0Z30120515 Keywords : Cenozoic Most Basin * continental rift * Eger Graben Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.161, year: 2009

  1. Complex Motor–Cognitive Factors Processed in the Anterior Nucleus of the Thalamus: An Intracerebral Recording Study

    Czech Academy of Sciences Publication Activity Database

    Bočková, M.; Chládek, Jan; Jurák, Pavel; Halámek, Josef; Štillová, K.; Baláž, M.; Chrastina, J.; Rektor, I.

    2015-01-01

    Roč. 28, č. 2 (2015), s. 269-278 ISSN 0896-0267 R&D Projects: GA ČR GAP103/11/0933; GA MŠk ED0017/01/01; GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : Anterior nucleus of the thalamus * Complex cognitive functions * Deep brain stimulation * ERD/S * ERP Subject RIV: BD - Theory of Information Impact factor: 3.727, year: 2015

  2. On the Oseen-Brinkman flow around an (m-1)-dimensional solid obstacle

    Czech Academy of Sciences Publication Activity Database

    Kohr, M.; Medková, Dagmar; Wendland, W. L.

    2017-01-01

    Roč. 183, č. 2 (2017), s. 269-302 ISSN 0026-9255 R&D Projects: GA ČR GA16-03230S Institutional support: RVO:67985840 Keywords : transmission problem * Brinkman system * Oseen system Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.716, year: 2016 http://link.springer.com/article/10.1007/s00605-016-0981-2?wt_mc=Internal.Event.1. SEM .

  3. A single dose of an inhibitor of cyclooxygenase 2, meloxicam, administered shortly after irradiation increases survival of lethally irradiated mice

    Czech Academy of Sciences Publication Activity Database

    Hofer, Michal; Pospíšil, Milan; Dušek, L.; Hoferová, Zuzana; Weiterová, Lenka

    2011-01-01

    Roč. 176, č. 2 (2011), s. 269-272 ISSN 0033-7587 R&D Projects: GA ČR(CZ) GA305/08/0158 Grant - others:GA ČR(CZ) GAP303/11/0128 Program:GA Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : cyclooxygenase-2 inhibition * lethal irradiation * survival Subject RIV: BO - Biophysics Impact factor: 2.684, year: 2011

  4. Tetracoordinate Co(II) complexes containing bathocuproine and single molecule magnetism

    Czech Academy of Sciences Publication Activity Database

    Smolko, L.; Černák, J.; Dušek, Michal; Titiš, J.; Boča, R.

    2016-01-01

    Roč. 40, č. 8 (2016), s. 6593-6598 ISSN 1144-0546 R&D Projects: GA MŠk LO1603; GA ČR(CZ) GA15-12653S EU Projects: European Commission(XE) CZ.2.16/3.1.00/24510 Institutional support: RVO:68378271 Keywords : crystal structure * single molecule magnetism * Cu(II) complexes Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.269, year: 2016

  5. Biophysical characterization of recombinant human ameloblastin

    Czech Academy of Sciences Publication Activity Database

    Wald, Tomáš; Bednárová, Lucie; Osička, Radim; Pachl, Petr; Šulc, Miroslav; Lyngstadaas, S. P.; Slabý, Ivan; Vondrášek, Jiří

    2011-01-01

    Roč. 119, č. 1 (2011), s. 261-269 ISSN 0909-8836 R&D Projects: GA ČR GAP302/10/0427; GA MŠk LC512 Institutional research plan: CEZ:AV0Z50200510; CEZ:AV0Z40550506; CEZ:AV0Z50520701 Keywords : circular dichroism spectroscopy * dynamic light scattering * enamel matrix protein Subject RIV: EE - Microbiology, Virology Impact factor: 1.878, year: 2011

  6. Application of the EDYS Model to Evaluate Control Methods for Invasive Plants at Fort Carson, Colorado

    Science.gov (United States)

    2004-12-01

    increase fire frequency, reduce recreational opportunities, and can poison domestic animals. It is imperative to find economical , ecologically sound...Technology 15:257-269. Childress, W. Michael, Terry McLendon, and David L. Price. 1999a. A Multiscale Ecological Model for Allocation of Training...of some ecologically distinct plant species to nitrate and to ammonium nitrogen. Journal of Ecology 60: 93-102. Gould, Frank W. 1975. The Grasses

  7. APOE and spatial navigation in amnestic MCI: Results from a computer-based test

    Czech Academy of Sciences Publication Activity Database

    Laczó, J.; Andel, R.; Vyhnálek, M.; Vlček, Kamil; Nedělská, Z.; Maťoška, V.; Gažová, I.; Mokrišová, I.; Sheardová, K.; Hort, J.

    2014-01-01

    Roč. 28, č. 5 (2014), s. 676-684 ISSN 0894-4105 R&D Projects: GA ČR(CZ) GA309/09/1053; GA ČR(CZ) GA309/09/0286 Institutional research plan: CEZ:AV0Z50110509 Institutional support: RVO:67985823 Keywords : mild cognitive impairment * spatial navigation * Alzheimer's Disease * apolipoprotein E * hippocampus Subject RIV: FH - Neurology Impact factor: 3.269, year: 2014

  8. Parallel single-cell analysis of active caspase-3/7 in apoptotic and non-apoptotic cells

    Czech Academy of Sciences Publication Activity Database

    Ledvina, Vojtěch; Janečková, Eva; Matalová, Eva; Klepárník, Karel

    2017-01-01

    Roč. 409, č. 1 (2017), s. 269-274 ISSN 1618-2642 R&D Projects: GA ČR(CZ) GA14-28254S Institutional support: RVO:68081715 ; RVO:67985904 Keywords : single-cell analysis * bioluminescence * apoptosis * caspase-3/7 Subject RIV: CB - Analytical Chemistry, Separation; EB - Genetics ; Molecular Biology (UZFG-Y) OBOR OECD: Analytical chemistry; Developmental biology (UZFG-Y) Impact factor: 3.431, year: 2016

  9. Vitamin D Status in Small Vessel and Large Vessel Ischemic Stroke Patients: A Case–control Study

    Directory of Open Access Journals (Sweden)

    Navid Manouchehri

    2017-01-01

    Full Text Available Background: Vitamin D insufficiency is a globally widespread issue. Recent studies have reported a high prevalence of Vitamin D deficiency in Middle-East countries. Studies have shown negative effects of Vitamin D deficiency on endothelium and related diseases such as ischemic brain stroke. Here, we assessed Vitamin D status in patients with different types of ischemic brain stroke and control group. Materials and Methods: Seventy-five patients (49.3% small vessel, 50.7% large vessel and 75 controls, matched for age (68.01 ± 10.94 vs. 67.64 ± 10.24 and sex (42 male and 33 female were recruited. 25(OH D levels were measured by Chemiluminescence immunoassay. 25(OH D status was considered as severely, moderately, or mildly deficient and normal with 25(OH D levels of less than 5, 5-10, 10-16, and> 16 ng/ml, respectively. Results: Mean ± standard error concentration of 25(OH D in cases and controls were 17.7 ± 1.5 and 26.9 ± 1.6 (P = 0.0001, respectively. Mild, moderate, and severe Vitamin D deficiency were observed in 10.8%, 32.4%, 8.1% vs. 34.3%, 31.5%, 9.5% of small vessel and large vessel group, respectively. 21.7% of the controls were Vitamin D deficient. Vitamin D deficiency was significantly associated with higher risk for ischemic stroke, (P = 0.000, OR = 7.17, 95% confidence interval: 3.36–15.29. 25(OH D levels were significantly higher in control group comparing to small vessel (26.9 ± 1.6 vs. 20.59 ± 2.6 P < 0.05 and large vessel (26.9 ± 1.6 vs. 13.4 ± 1.3 P < 0.001 stroke patients. Small vessel group had significantly higher levels of Vitamin D than large vessel (P < 0.05. Conclusion: Vitamin D deficiency significantly increases the risk of ischemic stroke, favoring the types with the pathogenesis of large vessel strokes.

  10. HPLC-UV, MALDI-TOF-MS and ESI-MS/MS analysis of the mechlorethamine DNA crosslink at a cytosine-cytosine mismatch pair.

    Directory of Open Access Journals (Sweden)

    Pornchai Rojsitthisak

    Full Text Available Mechlorethamine [ClCH(2CH(2N(CH(3CH(2CH(2Cl], a nitrogen mustard alkylating agent, has been proven to form a DNA interstrand crosslink at a cytosine-cytosine (C-C mismatch pair using gel electrophoresis. However, the atomic connectivity of this unusual crosslink is unknown.HPLC-UV, MALDI-TOF-MS, and ESI-MS/MS were used to determine the atomic connectivity of the DNA C-C crosslink formed by mechlorethamine, MALDI-TOF-MS of the HPLC-purified reaction product of mechlorethamine with the DNA duplex d[CTCACACCGTGGTTC]•d[GAACCACCGTGTGAG] (underlined bases are a C-C mismatch pair indicated formation of an interstrand crosslink at m/z 9222.088 [M-2H+Na](+. Following enzymatic digestion of the crosslinked duplex by snake venom phosphodiesterase and calf intestinal phosphatase, ESI-MS/MS indicated the presence of dC-mech-dC [mech = CH(2CH(2N(CH(3CH(2CH(2] at m/z 269.2 [M](2+ (expected m/z 269.6, exact mass 539.27 and its hydrolytic product dC-mech-OH at m/z 329.6 [M](+ (expected m/z 329.2. Fragmentation of dC-mech-dC gave product ions at m/z 294.3 and 236.9 [M](+, which are both due to loss of the 4-amino group of cytosine (as ammonia, in addition to dC and dC+HN(CH(3CH = CH(2, respectively. The presence of m/z 269.2 [M](2+ and loss of ammonia exclude crosslink formation at cytosine N(4 or O(2 and indicate crosslinking through cytosine N(3 with formation of two quaternary ammonium ions.Our results provide an important addition to the literature, as the first example of the use of HPLC and MS for analysis of a DNA adduct at the N(3 position of cytosine.

  11. Compulsive buying and branding phenomena

    OpenAIRE

    Lee, Seung-hee; Workman, Jane E.

    2015-01-01

    Background: The purpose of this paper was to explore the impact of brand variables such as brand awareness, brand loyalty, brand attachment, and perceived brand quality on compulsive buying behavior. Methods: A self-administered questionnaire, containing demographic items and items related to compulsive buying, brand awareness, brand loyalty, brand attachment and perceived quality, was used to collect data. Results: Participants were 269 US university students at a large mid-western universit...

  12. Dual effect of melatonin on gonadotropin-releasing-hormone-induced Ca(2+) signaling in neonatal rat gonadotropes

    Czech Academy of Sciences Publication Activity Database

    Zemková, Hana; Vaněček, Jiří

    2001-01-01

    Roč. 74, č. 4 (2001), s. 262-269 ISSN 0028-3835 R&D Projects: GA ČR GA309/99/0213; GA ČR GA309/99/0215; GA AV ČR IAA5011103; GA AV ČR IAA5011105 Institutional research plan: CEZ:AV0Z5011922 Keywords : melatonin * gonadotropin-release hormone * calcium Subject RIV: FB - Endocrinology, Diabetology, Metabolism, Nutrition Impact factor: 2.144, year: 2001

  13. AcEST: DK950504 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9|NETR_PONPY Neurotrypsin OS=Pongo pygmaeus GN=PRSS12 PE... 25 3.5 sp|A1VRP1|T23O_POLNA Tryptophan 2,3-dioxy...in OS=Pongo pygmaeus GN=PRSS12 PE=3 SV=1 Length = 877 Score = 25.4 bits (54), Expect(2) = 3.5 Identities = 1...+LE+ +R+ Sbjct: 444 DQNLSQCKDEAHLSANNLEDAHRK 467 >sp|Q5G269|NETR_PONPY Neurotryps

  14. Oxidative stability and bacteriological assessment of meat from ...

    African Journals Online (AJOL)

    SERVER

    2007-12-03

    Dec 3, 2007 ... Bacteria load (CFU) of thigh muscle from broiler chickens fed diets containing varying levels of H. sabdariffa calyces. Diets. A. B. C. D. E. H. sabdariffa calyces level (%). Storage length at. 4oC (days). Meat condition. 0. 1.5. 3.0. 4.5. 6.0. Statistical significance. 1. Uncooked. 2.69a ± 0.12 x 108. 2.65a ± 0.23 x ...

  15. The putative sensor histidine kinase CKI1 is involved in female gametophyte development in Arabidopsis

    Czech Academy of Sciences Publication Activity Database

    Hejátko, Jan; Pernisová, M.; Eneva, T.; Palme, K.; Brzobohatý, Břetislav

    2003-01-01

    Roč. 269, č. 4 (2003), s. 443-453 ISSN 1617-4615 R&D Projects: GA MŠk VS96096; GA MŠk LN00A081 Grant - others:INCO-Copernicus(XE) ERB3512-PL966135; QLRT(XE) 2000-0020 Institutional research plan: CEZ:AV0Z5004920 Keywords : female gametophyte development * two-component signaling * sensor histidine kinase Subject RIV: BO - Biophysics Impact factor: 2.240, year: 2003

  16. World Weather Extremes. Revision,

    Science.gov (United States)

    1985-12-01

    Ext r-,ncs, Weekl Weather and Crop Bull, Vol. 43, No. 9, pp. 6-8, 27 Feb 56. 21A. ntoli, La Piu Alta Temperatura del Mondo," [The HiLhest Temperi... Temperatura in Libia", Boll Soc Geogr Ita’iana, ser. 8, Vol. 7, pp. 59-71, 1954. 23J. Gentilli, "Libyan Climate", Geograph Rev, V0 l. 45, No. 2, p. 269 S" Apr

  17. The Bible of Conrad of Vechta. Stylistic Change in Bohemian Book Illumination

    Czech Academy of Sciences Publication Activity Database

    Studničková, Milada

    2006-01-01

    Roč. 50, č. 2 (2006), s. 269-283 ISSN 0025-2603. [Conference on Manuscript Studies /32./. St. Louis, 14.10.2005-15.10.2005] R&D Projects: GA AV ČR IAA8033202 Institutional research plan: CEZ:AV0Z80330511 Keywords : Czech book illumination * Master of Antwerp Bible * Bible of Konrad of Vechta * beginning of the 15th century Subject RIV: AL - Art, Architecture, Cultural Heritage

  18. Does perfectionism in bipolar disorder pedigrees mediate associations between anxiety/stress and mood symptoms?

    OpenAIRE

    Corry, Justine; Green, Melissa; Roberts, Gloria; Fullerton, Janice M.; Schofield, Peter R.; Mitchell, Philip B.

    2017-01-01

    Background Bipolar disorder (BD) and the anxiety disorders are highly comorbid. The present study sought to examine perfectionism and goal attainment values as potential mechanisms of known associations between anxiety, stress and BD symptomatology. Measures of perfectionism and goal attainment values were administered to 269 members of BD pedigrees, alongside measures of anxiety and stress, and BD mood symptoms. Regression analyses were used to determine whether perfectionism and goal attain...

  19. Negative factors of beliefs toward advertising on Facebook and their effect on attitudes

    OpenAIRE

    Hilda Bongazana Dondolo

    2017-01-01

    Previous research has studied the effects of materialism, value corruption and falsity, which were identified by Pollay and Mittal (1993) as negatively impacting the beliefs about advertising. Few, if any, assessed negative beliefs about Facebook advertising. This paper assesses such beliefs and how these beliefs influence attitudes toward advertising on Facebook. To meet the objectives of the study, 269 undergraduate students completed the questionnaire. Regression analysis was used to exami...

  20. 78 FR 40266 - Agency Information Collection Activity Under OMB Review; Reports, Forms and Recordkeeping...

    Science.gov (United States)

    2013-07-03

    ... forwarded to the Office of Management and Budget (OMB) for review and approval. The nature of the... the U.S. Merchant Marine Academy. Form Numbers: KP2-66-DK1, KP2-67-DK2, KP3-68-DK3, KP2-69-ENG1, KP2- 70-ENG2, KP2-71-ENG3. Abstract: 46 U.S.C. 51309 authorizes the Academy to confer academic degrees. To...

  1. Myocardial extracellular volume quantified by magnetic resonance is increased in cirrhosis and related to poor outcome

    DEFF Research Database (Denmark)

    Wiese, Signe; Hove, Jens; Mo, Silje

    2018-01-01

    .04). Furthermore, ECV increased across the Child Pugh A/B/C classes (26.9±4/ 31.5±5/ 34.4±6%, P=0.02). Four-teen patients experienced the composite end-point of death/LT during follow-up and these patients had higher ECV (33.2±4 vs. 30.4±6%, P=0.04). In a univariate Cox regression analysis ECV was associated...

  2. Certification of polycyclic aromatic compounds. Pt. 6. CRM Nos. 152, 265, 266, 267, 268, 269, 270, 271, 272

    Energy Technology Data Exchange (ETDEWEB)

    Jacob, J; Belliardo, J J; Wagstaffe, P J

    1985-01-01

    The purity of samples of seven polycyclic aromatic hydrocarbons and two nitrogen-containing heterocyclics has been determined in an interlaboratory exercise, involving eleven laboratories of the EC member countries. The purity measurements were carried out using independent analytical methods (gas liquid chromatography, high performance liquid chromatography and mass spectrometry). This report describes the certification procedure and experimental details of the interlaboratory analyses of standard materials for environmental pollutants.

  3. VizieR Online Data Catalog: Quasars narrow absorption lines from SDSS (Chen+, 2015)

    Science.gov (United States)

    Chen, Z.-F.; Gu, Q.-S.; Chen, Y.-M.; Cao, Y.

    2017-11-01

    The Baryon Oscillation Spectroscopic Survey (BOSS: Eisenstein et al. 2011AJ....142...72E; Paris et al. 2012, Cat. VII/269) is the main dark-time legacy survey of the third stage of the SDSS, which used the same 2.5-m telescope (Gunn et al. 2006AJ....131.2332G; Ross et al. 2012, J/ApJS/199/3) as the first and second stages of the SDSS (hereafter SDSS-I/II). SDSS-I/II spectra have a wavelength coverage from 3800-9200Å with a spectral resolution of 1800-2200 (e.g. York et al. 2000AJ....120.1579Y). BOSS spectra span a range from 3600-10500Å at a resolution of 1300-2500 (Paris et al. 2012, Cat. VII/269). During the first two years, BOSS detected 87822 quasars over an area of 3275 deg2, including 7932 quasars that were observed by SDSS-I/II as well. Quasars observed by both SDSS-I/II and BOSS provide a remarkable chance to study the variabilities of absorption lines in a large population. Throughout this work, we take the quasar emission redshifts provided by Hewett & Wild (2010, J/MNRAS/405/2302, http://das.sdss.org/va/HewettWilddr7qso_newz/) directly. (2 data files).

  4. Overexpression, crystallization and preliminary X-ray crystallographic analysis of Pseudomonas aeruginosa MnmE, a GTPase involved in tRNA modification

    International Nuclear Information System (INIS)

    Lee, Hyung Ho; Suh, Se Won

    2010-01-01

    MnmE from P. aeruginosa was crystallized and X-ray diffraction data were collected to 2.69 Å resolution. MnmE, an evolutionarily conserved GTPase, is involved in modification of the uridine base (U34) at the wobble position of certain tRNAs. Previous crystal structures of MnmE suggest that it is a dimer with considerable conformational flexibility. To facilitate structural comparisons among MnmE proteins, structural analysis of MnmE from Pseudomonas aeruginosa encoded by the PA5567 gene was initiated. It was overexpressed in Escherichia coli and crystallized at 297 K using a reservoir solution consisting of 100 mM sodium ADA pH 6.5, 12%(w/v) polyethylene glycol 4000, 100 mM lithium sulfate, 2%(v/v) 2-propanol and 2.5 mM dithiothreitol. X-ray diffraction data were collected to 2.69 Å resolution. The crystals belonged to the orthorhombic space group C222 1 , with unit-cell parameters a = 96.74, b = 204.66, c = 120.90 Å. Two monomers were present in the asymmetric unit, resulting in a crystal volume per protein mass (V M ) of 2.99 Å 3 Da −1 and a solvent content of 58.8%

  5. Assessment of junior doctors? admission notes: do they follow what they learn?

    OpenAIRE

    Barnawi, Rashid A.; Ghurab, Abdulaziz M.; Balubaid, Hassan K.; Alfaer, Sultan S.; Hanbazazah, Kamal A.; Bukhari, Mohammed F.; Hamed, Omayma A.; Bakhsh, Talal M.

    2017-01-01

    Objectives To assess the completeness of history-taking and physical-examination notes of junior doctors at King Abdulaziz University Hospital per the approach they learned in medical school. Methods In this retrospective study, we reviewed 860 admission notes written by 269 junior doctors (interns and residents) in an academic tertiary-care medical centre in Jeddah, Saudi Arabia, over a two-month period. Notes were evaluated for completeness using a checklist developed with reference to rele...

  6. Fort Jackson, a Preventive Approach to Family Life Ministry in a Military Community.

    Science.gov (United States)

    1979-12-01

    permeability in defining the family and non-family world . 1John E. Mack and Elvin V. Temrad, "Classical Psychoanalysis , " in Comprehensive Textbook of...John E., and Temrad, Elvin V. "Classical Psychoanalysis ." In Comprehensive Textbook of Psychiatry, pp. 269-319. Edited by Alfred Freedman and Harold...this kind of communi- cation is not just going to happen. 4. Participate in some common pursuits. Share your visions, hopes, and dreams by translating

  7. The complete mitochondrial genome of the great white shark, Carcharodon carcharias (Chondrichthyes, Lamnidae).

    Science.gov (United States)

    Chang, Chia-Hao; Shao, Kwang-Tsao; Lin, Yeong-Shin; Fang, Yi-Chiao; Ho, Hsuan-Ching

    2014-10-01

    The complete mitochondrial genome of the great white shark having 16,744 bp and including 13 protein-coding genes, 2 ribosomal RNA, 22 transfer RNA genes, 1 replication origin region and 1 control region. The mitochondrial gene arrangement of the great white shark is the same as the one observed in the most vertebrates. Base composition of the genome is A (30.6%), T (28.7%), C (26.9%) and G (13.9%).

  8. HGF/c-MET Pathway in AIDS-Related Lymphoma

    Science.gov (United States)

    2016-09-01

    of Pediatrics, East Hospital, Tongji University School of Medicine, Shanghai, China 5 William Carey University College of Osteopathic Medicine...12845. 32. Gottwein E, Mukherjee N, Sachse C, Frenzel C, Majoros WH, Chi JT, Braich R, Manoharan M, Soutschek J, Ohler U and Cullen BR. A viral microRNA...relevance to the accumulation of versican. Prostate. 2005; 63:269–275. 17. Ricciardelli C, Frewin KM, Tan Ide A, Williams ED, Opeskin K, Pritchard MA

  9. SEM-EDX IDENTIFICATION OF PARTICLES FROM FOG IN AN INDUSTRIALLY POLLUTED REGION OF CZECH REPUBLIC

    Czech Academy of Sciences Publication Activity Database

    Stoyanova, V.; Shoumkova, A.; Fišák, Jaroslav; Tsacheva, Ts.

    Vol. II - BUA32, č. 1 (2010), s. 269-276 ISSN 1314-2704. [International Multidisciplinary Scientific GeoConference SGEM 2010 /10./. Albena, 20.06.2010-26.06.2010] Institutional research plan: CEZ:AV0Z30420517 Keywords : SEM-EDX * solid atmospheric pollutants * trace elements * heavy metals * Czech Republic Subject RIV: DG - Athmosphere Sciences, Meteorology http://www.ipc.bas.bg/PPages/Shoumkova/Publications/Articles/2010%20SEM-EDX%20identification%20of%20FP.pdf

  10. A note on Wang et al's attack on Zhang et al's multiparty quantum secret sharing

    International Nuclear Information System (INIS)

    Gao Gan

    2012-01-01

    Recently, Wang et al (2008 Phys. Lett. A 373 65) proposed an attack on Zhang et al's (2007 Opt. Commun. 269 418) multiparty quantum secret sharing scheme, in which the first and the last agent are reported to be able to cooperatively eavesdrop on all the secret messages without being detected. In this paper, we show that in Wang et al's attack, on average no more than half the secret messages can be eavesdropped. (paper)

  11. Embryonic Stem Cell-Derived Neurons are a Novel, Highly Sensitive Tissue Culture Platform for Botulinum Research

    Science.gov (United States)

    2011-01-01

    and acceleration of toxin degradation may be more amenable to therapeutic intervention, the neuronal response to intoxication and the molecular ...References [1] L.L. Simpson, Identification of the major steps in botulinum toxin action, Annu. Rev. Pharmacol. Toxicol. 44 (2004) 167–193. [2] J.C...BoNT) therapeutics: time to think outside the BoNT?, Botulinum J 1 (2009) 261–269. [6] L.L. Simpson, The origin, structure , and pharmacological

  12. External and internal anatomy of third molars.

    Science.gov (United States)

    Guerisoli, D M; de Souza, R A; de Sousa Neto, M D; Silva, R G; Pécora, J D

    1998-01-01

    The external and internal anatomy of 269 third molars (155 maxillary and 114 mandibular) were studied. The teeth were measured, classified according to their root number and shape and the internal anatomy was observed by the use of diaphanization. A great anatomical variability was found, with the presence of up to 5 roots in maxillary third molars and 3 roots in mandibular third molars. The number of root canals followed the same pattern.

  13. Reproductive Ecology of Vallisneria americana Michaux

    Science.gov (United States)

    2006-12-01

    River and Estuary, Maryland and Virginia, May 1978 to November 1981. U.S. Geologi- cal Survey Water Supply Paper 2234A. Carter, V. A., and N. B...Information Network, reference website: http://www.ars-grin.gov/. Haccius, B. 1952. Über die Blattstellung einiger Hydrocharitaceen-Embryonen. Planta 40: 333...Hydrocharitaceae). Aquatic Botany 13: 269- 298. Marie-Victorin, F. 1943. Les Vallisnéries américaines. Contributions de l’Institut Botanique de l’Universite de

  14. Managing the Growing Chinese Power in SE Asia: The U.S. Struggle to Maintain Power Projection in the Face of the Rising Middle Kingdom

    Science.gov (United States)

    2016-04-04

    Active Locations Spreadsheet from December 02, 2014. 32 Shannon Deebe and Mary Kaldor, The Ultimate Weapon is No Weapon (New York: Perseus Books ...available online at: https://history.state.gov/historicaldocuments/frus1945-50Intel/d269. See also Kennan’s original hand-annotated draft dated April 30...to further add to the dispersed scheme, DLA-E needs to investigate sites in other politically viable locations such as Cambodia, Brunei, and Malaysia

  15. Parkinson's disease as community health problem: study in Norwegian nursing homes. The Norwegian Study Group of Parkinson's Disease in the Elderly.

    OpenAIRE

    Larsen, J P

    1991-01-01

    OBJECTIVE--To examine the extent of under-diagnosis and overdiagnosis of Parkinson's disease and to determine quality of treatment in a defined population. DESIGN--Clinical evaluation of an elderly population. SETTING--40 Norwegian nursing homes. SUBJECTS--3322 residents of nursing homes, of whom 500 were selected by nursing staff for evaluation on the basis of a structured information programme on Parkinson's disease and 269 were examined in detail by neurologists. MAIN OUTCOME MEASURES--Pat...

  16. SoSIReČR – sociální sít informatiků v regionech ČR

    Czech Academy of Sciences Publication Activity Database

    Vojtáš, P.; Pokorný, J.; Skopal, T.; Nečaský, M.; Matoušek, K.; Kubalík, J.; Šíma, Jiří; Žák, Stanislav; Víta, Martin; Novotný, O.; Maryška, M.

    -, 2-příloha (2011), s. 259-269 ISSN 1210-9479 Grant - others:Strukturální fond EU CZ.1.07/2.4.00/12.0039 Source of funding: O - operačné programy Keywords : sociální síť * web ový portál * profil Subject RIV: IN - Informatics, Computer Science http://www.cssi.cz/cssi/ system /files/all/si-2011-02p-24-Vojtas-et-all.pdf

  17. U.S. Army Corps of Engineers Surveying Requirements Meeting, 2-5 February 1982,

    Science.gov (United States)

    1982-04-01

    performance and economical performance, has been in effect in prior legislation since the 1920’s. 2. PL 95-269 has a new provision - that the Corps...please hire and train your crew locally.* (This is also in conformance with the Legislative directive to utilize local community resources.) Seriously...Glennon Equipment Westminister Park John Lorea Contract Surveys E. Providence, RI 02914 (401) 438-1780 Riley Park Hayden Ralph L. Hayden Contract Surveys

  18. The Crimean Tatars and Their Influence on the Triangle of Conflict’ - Russia-Crimea-Ukraine

    Science.gov (United States)

    2008-03-01

    Ottoman Empire, threatening the strategic Bosporus Straits. To protect them, France , Britain and Sardinia joined the Ottomans in the war. Allied forces...educated in a local Islamic school, and then in Russia and France .259 He recognized the threat of Russification, and sought to counter it through a...269 On the other hand, Lenin claimed Crimea was a hive of bourgeoisie , and sent the Cheka (Soviet secret police) to deal with those who opposed the

  19. Surgical Results of Trabeculectomy and Ahmed Valve Implantation Following a Previous Failed Trabeculectomy in Primary Congenital Glaucoma Patients

    OpenAIRE

    Lee, Naeun; Ma, Kyoung Tak; Bae, Hyoung Won; Hong, Samin; Seong, Gong Je; Hong, Young Jae; Kim, Chan Yun

    2015-01-01

    Purpose To compare the surgical results of trabeculectomy and Ahmed glaucoma valve implantation after a previous failed trabeculectomy. Methods A retrospective comparative case series review was performed on 31 eye surgeries in 20 patients with primary congenital glaucoma who underwent trabeculectomy or Ahmed glaucoma valve implantation after a previous failed trabeculectomy with mitomycin C. Results The preoperative mean intraocular pressure was 25.5 mmHg in the trabeculectomy group and 26.9...

  20. Fault Tolerance for Fight Through (FTFT)

    Science.gov (United States)

    2013-02-01

    eventually to the lowest level. Now this information pyramid is being inverted: the lowest, most populated level is being “elevated” so that it is the... Egypt , December 2010, pp. 269-273. 8. Roger Myerson, Game Theory: Analysis of Conflict, Harvard University Press, 1997. 9. Li Wang, Zheng Li...Published by Springer, Delhi, India, May 2012, pp. 883-896. 27. “Inverting the Information Pyramid ,” Federal Computer Week, Vol. 26, No.4, March

  1. Turkish Influence in the South Caucasus and Levant: The Consequences for NATO and the EU

    Science.gov (United States)

    2013-09-01

    Baran, “Turkey and the Caucasus,” in Turkish Foreign Policy in the Post-Cold War Era, ed. Idris Bal (Boca Raton, FL: Brown Walker, 2004), 269. 56 Gareth ...Bulut, et al., Turkish Foreign Policy in Post Post-Cold War Era, ed. Idris Bal (Boca Raton: Brown Walker, 2004); Ismael, Tareq and Mustafa Aydin. ed...the Caucasus.” in Turkish Foreign Policy in the Post-Cold War Era, edited by Idris Bal. (Boca Raton: Brown Walker, 2004). Barysch, Katinka

  2. CDC25A phosphatase controls meiosis I progression in mouse oocytes

    Czech Academy of Sciences Publication Activity Database

    Šolc, Petr; Šašková, Adéla; Baran, V.; Kubelka, Michal; Schultz, R. M.; Motlík, Jan

    2008-01-01

    Roč. 317, č. 1 (2008), s. 260-269 ISSN 0012-1606 R&D Projects: GA ČR GA305/06/1413; GA ČR GD204/05/H023 Grant - others:Czech-US cooperation(CZ) ME08030; Slovenská Akademie vied(SK) VEGA 2/6176/26 Program:ME Institutional research plan: CEZ:AV0Z50450515 Keywords : resumption of meiosis * meiotic maturation * mouse oocytes Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.416, year: 2008

  3. Challenge of Humans with Wild-type Salmonella enterica Serovar Typhi Elicits Changes in the Activation and Homing Characteristics of Mucosal-Associated Invariant T Cells

    OpenAIRE

    Salerno-Goncalves, Ros?ngela; Luo, David; Fresnay, Stephanie; Magder, Laurence; Darton, Thomas C.; Jones, Claire; Waddington, Claire S.; Blohmke, Christoph J.; Angus, Brian; Levine, Myron M.; Pollard, Andrew J.; Sztein, Marcelo B.

    2017-01-01

    Gastrointestinal infections by Salmonella enterica serovar Typhi (S. Typhi) are rare in industrialized countries. However, they remain a major public health problem in the developing world with an estimated 26.9 million new cases annually and significant mortality when untreated. Recently, we provided the first direct evidence that CD8(+) MAIT cells are activated and have the potential to kill cells exposed to S. Typhi, and that these responses are dependent on bacterial load. However, MAIT c...

  4. «Dejarse caer para después poder quizá levantarse ...» o el tema mitológico del descenso a los infiernos en Rayuela de Julio Cortázar*

    Directory of Open Access Journals (Sweden)

    Agata Šega

    2015-04-01

    Full Text Available En la novela Rayuela, definida por Luis Harss (81978, 269 como «una obra terapéutica», el autor, Julio Cortázar, pone en la boca de Traveler, el amigo y el segundo yo del protagonista Horacio Oliveira, el consejo siguiente: Lo malo en vos – dijo Traveler – es que cualquier problema lo retrotraés a la infancia. Ya estoy harto de decirte que leas un poco a Jung, che (41: 3911.

  5. Speech Function and Speech Role in Carl Fredricksen's Dialogue on Up Movie

    OpenAIRE

    Rehana, Ridha; Silitonga, Sortha

    2013-01-01

    One aim of this article is to show through a concrete example how speech function and speech role used in movie. The illustrative example is taken from the dialogue of Up movie. Central to the analysis proper form of dialogue on Up movie that contain of speech function and speech role; i.e. statement, offer, question, command, giving, and demanding. 269 dialogue were interpreted by actor, and it was found that the use of speech function and speech role.

  6. The moderating effects of contact with lesbian and gay friends on the relationships among religious fundamentalism, sexism, and sexual prejudice.

    Science.gov (United States)

    Cunningham, George B; Melton, E Nicole

    2013-01-01

    The purpose of this study was to examine the degree to which contact with lesbian and gay friends moderated the effects of religious fundamentalism and sexism on sexual prejudice. The authors gathered data from 269 heterosexual adults living in Texas. Results indicate that the effects of religious fundamentalism on sexual prejudice were reduced when contact was high. However, the positive association between modern sexism and sexual prejudice was not moderated by contact. The authors discuss theoretical and practical implications.

  7. UV-absorbing bacteria in coral mucus and their response to simulated temperature elevations

    Digital Repository Service at National Institute of Oceanography (India)

    Ravindran, J.; Kannapiran, E.; Manikandan, B.; Francis, K.; Arora, S.; Karunya, E.; AmitKumar; Singh, S.K.; Jose, J.

    cervicornis. Mol Mar Biol Biotechnol 4: 345-354 Ritchie KB, Smith GW (2004) Microbial communities of coral surface mucopolysaccharide layers. In: Rosenberg E, Loya Y (eds) Coral health and disease. Springer Verlag, New York, pp 269-263 Ritchie KB, Dennis... JH, McGrath T, Smith GW (1994) Bacteria associated with bleached and nonbleached areas of Montastrea annularis. Proceedings 5th symposium: Natural history of Bahamas. San Salvador, Bahamas, Bahamas field station, pp 75-80 Rohwer F, Seguritan V...

  8. The influence of a solid and liquid bolus on food-stimulated gastroesophageal reflux

    International Nuclear Information System (INIS)

    Naeser, A.; Behrens, J.K.; Vejen-Christiansen, L.; Funch-Jensen, P.; Thommesen, P.; Aarhus Kommunehospital

    1992-01-01

    Using a radiological method to demonstrate food-stimulated gastroesophageal reflux (GER), a comparative study was carried out employing a solid, already validated bolus versus a liquid one. One hundred and four consecutive patients received both a solid and a liquid bolus in randomized order. GER was observed in 37 (35.6%) patients receiving the solid bolus versus 28 (26.9%) with the liquid one. This means that the solid bolus provokes significantly more reflux (P [de

  9. Interruption Practice Reduces Errors

    Science.gov (United States)

    2014-01-01

    miscalculations (Koppel et al., 2005). There are cases where the user (medical staff, MD, Nurse , etc.) forgets to complete the PCS which is to log off or...13. SUPPLEMENTARY NOTES Proceedings of the Human Factors and Ergonomics Society Annual Meeting, vol. 58, 1 vol. pp. 265-269, 2014. 14. ABSTRACT...2000). The effects of interruptions in work activ- ity: Field and laboratory results. Applied Ergonomics , 31(5), 537– 543. González, V. M., & Mark, G

  10. Pathological study on the process of proliferative vireoretinopahy - PVR - after retinal detachment

    OpenAIRE

    Yamashita, Hidetoshi

    1986-01-01

    学位取得大学: 東京大学; 報告番号: 乙第8071号; 学位授与年月日: 1986-11-26; 学位の種別: 論文博士; 学位の種類: 医学博士 「Japanese Journal of Opthalmology Vol.30, 1986, p.269-281, Vol.29, 1985, p.42-53, Vol.29, 1985, p.394-405」に掲載されたもの

  11. Neoarchean paleoweathering of tonalite and metabasalt: Implications for reconstructions of 2.69Ga early terrestrial ecosystems and paleoatmospheric chemistry

    Science.gov (United States)

    Driese, S.G.; Jirsa, M.A.; Ren, M.; Brantley, S.L.; Sheldon, N.D.; Parker, Dana C.; Schmitz, M.

    2011-01-01

    Field and laboratory investigations of a 2690.83Ma (207Pb/206Pb age of Saganaga Tonalite) unconformity exposed in outcrop in northeastern Minnesota, USA, reveal evidence for development of a deep paleoweathering profile with geochemical biosignatures consistent with the presence of microbial communities and weakly oxygenated conditions. Weathering profiles are characterized by a 5-50m thick regolith that consists of saprolitized Saganaga Tonalite and Paulson Lake succession basaltic metavolcanic rocks retaining rock structure, which is cross-cut by a major unconformity surface marking development of a successor basin infilled with alluvial deposits. The regolith and unconformity are overlain by thick conglomerate deposits that contain both intrabasinal (saprock) as well as extrabasinal detritus. Thin-section microscopy and electron microprobe analyses reveal extensive hydrolysis and sericitization of feldspars, exfoliation and chloritization of biotite, and weathering of Fe-Mg silicates and Cu-Fe sulfides; weathering of Fe-Ti oxides was relatively less intense than for other minerals and evidence was found for precipitation of Fe oxides. Geochemical analyses of the tonalite, assuming immobile TiO2 during weathering (??Ti,j), show depletion of SiO2, Al2O3, Na2O, CaO, MgO, and MnO, and to a lesser degree of K2O, relative to least-weathered parent materials. Significant Fe was lost from the tonalite. A paleoatmospheric pCO2 of 10-50 times PAL is estimated based on geochemical mass-balance of the tonalite profile and assuming a formation time of 50-500Kyr. Interpretations of metabasalt paleoweathering are complicated by additions of sediment to the profile and extensive diagenetic carbonate (dolomite) overprinting. Patterns of release of P and Fe and retention of Y and Cu in tonalite are consistent with recent laboratory experiments of granite weathering, and with the presence of acidic conditions in the presence of organic ligands (produced, for example, by a primitive microbial community) during weathering. Cu metal in the profile may document lower pO2 than present day at the surface. Comparison with previous studies of weathered tonalite and basalt (Denison, 2.45-2.22Ga) in Ontario, Canada, reveal general similarities in paleoweathering with our study, as well as important differences related to lower paleoatmospheric pO2 and terrestrial biosignature for the older Minnesota profile. A falling water table in the Alpine Lake locality is presumed to have promoted formation of this gossan-like deep-weathering system that extends to 50-m depth. ?? 2011 Elsevier B.V.

  12. Soldering of copper-clad niobium--titanium superconductor composite

    International Nuclear Information System (INIS)

    Moorhead, A.J.; Woodhouse, J.J.; Easton, D.S.

    1977-04-01

    When superconductivity is applied to various electrical devices, the joining of the superconducting material and the performance of the joints are generally crucial to the successful operation of the system. Although many techniques are being considered for joining composite superconductors, soldering is the most common. We determined the wetting and flow behavior of various solder and flux combinations on a copper-clad Nb-Ti composite, developed equipment and techniques for soldering and inspection of lap joints, and determined the shear strength of joints at temperatures down to -269 0 C (4 0 K). We studied 15 solders and 17 commercial and experimental fluxes in the wettability and flow tests. A resistance unit was built for soldering test specimens. A series of samples soldered with 80 Pb-20 Sn, 83 Pb-15 Sn-2 Sb, 97.5 Pb-1.5 Ag-1 Sn, 80 In-15 Pb-5 Ag, or 25 In-37.5 Pb-37.5 Sn (wt percent) was inspected by three nondestructive techniques. Through-transmission ultrasound gave the best correlation with nonbond areas revealed in peel tests. Single-lap shear specimens soldered with 97.5 Pb-1.5 Ag-1 Sn had the highest strength (10.44 ksi, 72 MPa) and total elongation (0.074 in., 1.88 mm) at -269 0 C (4 0 K) of four solders tested

  13. Tay–Sachs disease mutations in HEXA target the α chain of hexosaminidase A to endoplasmic reticulum–associated degradation

    Science.gov (United States)

    Dersh, Devin; Iwamoto, Yuichiro; Argon, Yair

    2016-01-01

    Loss of function of the enzyme β-hexosaminidase A (HexA) causes the lysosomal storage disorder Tay–Sachs disease (TSD). It has been proposed that mutations in the α chain of HexA can impair folding, enzyme assembly, and/or trafficking, yet there is surprisingly little known about the mechanisms of these potential routes of pathogenesis. We therefore investigated the biosynthesis and trafficking of TSD-associated HexA α mutants, seeking to identify relevant cellular quality control mechanisms. The α mutants E482K and G269S are defective in enzymatic activity, unprocessed by lysosomal proteases, and exhibit altered folding pathways compared with wild-type α. E482K is more severely misfolded than G269S, as observed by its aggregation and inability to associate with the HexA β chain. Importantly, both mutants are retrotranslocated from the endoplasmic reticulum (ER) to the cytosol and are degraded by the proteasome, indicating that they are cleared via ER-associated degradation (ERAD). Leveraging these discoveries, we observed that manipulating the cellular folding environment or ERAD pathways can alter the kinetics of mutant α degradation. Additionally, growth of patient fibroblasts at a permissive temperature or with chemical chaperones increases cellular Hex activity by improving mutant α folding. Therefore modulation of the ER quality control systems may be a potential therapeutic route for improving some forms of TSD. PMID:27682588

  14. Branded food references in children's magazines: 'advertisements' are the tip of the iceberg.

    Science.gov (United States)

    Jones, S C; Gregory, P; Kervin, L

    2012-06-01

    While children's magazines 'blur the lines' between editorial content and advertising, this medium has escaped the calls for government restrictions that are currently associated with food advertisements aired during children's television programming. The aim of this study was to address significant gaps in the evidence base in relation to commercial food messages in children's magazines by systematically investigating the nature and extent of food advertising and promotions over a 12-month period. All issues of Australian children's magazines published in the calendar year 2009 were examined for references to foods or beverages. Approximately 16% of the 1678 food references identified were portrayals of branded food products (or food brands). However, only 83 of these 269 were clearly identified as advertisements. Of these 269 branded food references, 86% were for non-core (broadly, less healthy) foods, including all but seven of the advertisements. It appears that recent reductions in televised promotions for non-core foods, and industry initiatives to reduce the targeting of children, have not carried through to magazine advertising. This study adds to the evidence base that the marketing of unhealthy food to children is widespread, and often covert, and supports public health calls for the strengthening of advertising regulation. © 2012 The Authors. Pediatric Obesity © 2012 International Association for the Study of Obesity.

  15. Presentations and Outcome of Thyroiditis from a Tertiary Care Hospital of Karachi.

    Science.gov (United States)

    Mahar, Saeed Ahmed; Shahid, Muhammad; Sarfaraz, Aqiba; Shaikh, Zuhaib-u-Ddin; Shaikh, Shiraz; Shahid, Nadia

    2015-10-01

    To assess the clinical presentations and short-term outcomes of patients with thyroiditis presenting to a tertiary care hospital in Karachi, Pakistan. Case series. Department of Endocrinology, Liaquat National Hospital, Karachi, from June 2014 to February 2015. Patients between 18 and 70 years of age with acute onset of thyroiditis confirmed on thyroid scan or clinical judgment presenting to the outpatient services were included in the study. Pregnant females, psychiatric patients and patients having other chronic illnesses were excluded from the study. A total of 26 patients with thyroiditis attended the endocrine clinic. Mean age of patients was 41.2 ± 11.12 years. There were 18 (69.2%) females. Clinical presentations were fever (65.4%), tender neck (23.1%), goiter (19.2%), localized tenderness in neck and palpable lymph nodes (26.9%). Major symptoms reported were: sore throat (69.2%), weight loss (38.5%), upper respiratory tract infection, thyroid pain, tremor, sweating and fever of unknown origin in 26.9% cases. All the patients had raised Erythrocyte Sedimentation Rate (ESR). Low Thyroid Stimulating Hormone (TSH) 1.8 ng/dL. Complete recovery was seen in 88.5% patients while 11.5% had early hypothyroidism. Fever and sore throat were the main presenting features of thyroiditis patients. ESR was raised in all patients. A majority of patients had complete recovery with appropriate management; however, few cases developed hypothyroidism.

  16. Dereplication of pentacyclic triterpenoids in plants by GC-EI/MS.

    Science.gov (United States)

    Gu, Jian-Qiao; Wang, Yuehong; Franzblau, Scott G; Montenegro, Gloria; Timmermann, Barbara N

    2006-01-01

    Three common plant-derived pentacyclic triterpenoids, oleanolic acid (1), betulinic acid (2) and ursolic acid (3), have been found to exhibit moderate anti-tubercular activity in a microplate alamar blue assay. In order to facilitate the discovery of novel anti-tubercular leads with diverse chemical structures, a new and rapid GC-EI/MS method was developed simultaneously and unambiguously to dereplicate 1-3 as their methyl esters with limits of detection of 25.6, 26.9 and 26.8 ng, respectively.

  17. Ar-39 Detection at the 10^-16 Isotopic Abundance Level with Atom Trap Trace Analysis

    OpenAIRE

    Jiang, W.; Williams, W. D.; Bailey, K.; Davis, A. M.; Hu, S. -M.; Lu, Z. -T.; O'Connor, T. P.; Purtschert, R.; Sturchio, N. C.; Sun, Y. R.; Mueller, P.

    2011-01-01

    Atom Trap Trace Analysis (ATTA), a laser-based atom counting method, has been applied to analyze atmospheric Ar-39 (half-life = 269 yr), a cosmogenic isotope with an isotopic abundance of 8x10^-16. In addition to the superior selectivity demonstrated in this work, counting rate and efficiency of ATTA have been improved by two orders of magnitude over prior results. Significant applications of this new analytical capability lie in radioisotope dating of ice and water samples and in the develop...

  18. Redetermination of dicerium(III) tris­(sulfate) tetra­hydrate

    OpenAIRE

    Xu, Xin

    2007-01-01

    Ce2(SO4)3(H2O)4 was obtained hydrothermally from an aqueous solution of cerium(III) oxide, trimethylamine and sulfuric acid. The precision of the structure determination has been significantly improved compared with the previous result [Dereigne (1972). Bull. Soc. Fr. Mineral. Cristallogr. 95, 269–280]. The coordination about the two Ce atoms is achieved by seven and six bridging O atoms from sulfate anions. Each S atom makes four S—O—Ce linkages through bridging O atoms. Th...

  19. A Unified Framework for Simulating Markovian Models of Highly Dependable Systems

    Science.gov (United States)

    1989-07-01

    ependability I’valuiation of Complex lault- lolerant Computing Systems. Ptreedings of the 1-.et-enth Sv~npmiun on Falult- lolerant Comnputing. Portland, Maine...New York. [12] (icis;t, R.M. and ’I’rivedi, K.S. (1983). I!Itra-Il gh Reliability Prediction for Fault-’ lolerant Computer Systems. IEE.-E Trw.%,.cions... 1998 ). Surv’ey of Software Tools for [valuating Reli- ability. A vailability, and Serviceabilitv. ACA1 Computing S urveyjs 20. 4, 227-269). [32] Meyer

  20. Enhanced Oil Recovery with Application of Enzymes

    OpenAIRE

    Khusainova, Alsu; Shapiro, Alexander; Woodley, John

    2016-01-01

    Enzymer er for nylig blevet rapporteret, som effektive stoffer for forbedret olieindvinding(EOR). Både laboratorie undersøgelser og felttest viste en markant stigning af olieproduktion. Op til ekstra 16 % af olien blev produceret i laboratorie eksperimenter og op til ekstra 269 tønder olie per dag blev fremstillet under feltforsøg. Det var foreslået, at følgende mekanismer har medvirket tiløget olieproduktionen på grund af enzymer: forbedringer af bjergartsoverfladens befugtningsevne;dannelse...