
Sample records for hassium 263

  1. 33 CFR 117.263 - Banana River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Banana River. 117.263 Section 117.263 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.263 Banana River. (a) The draw of the Mathers (SR...

  2. 12 CFR 263.400 - Scope. (United States)


    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Scope. 263.400 Section 263.400 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM RULES OF PRACTICE FOR HEARINGS Removal, Suspension, and Debarment of Accountants From Performing Audit Services...

  3. 12 CFR 263.102 - Prevailing party. (United States)


    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Prevailing party. 263.102 Section 263.102 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM RULES... Prevailing party. Only an eligible applicant that prevailed on the merits of an adversary proceeding may...

  4. The Cryo-Thermochromatographic Separator (CTS) A new rapid separation and alpha-detection system for on-line chemical studies of highly volatile osmium and hassium (Z=108) tetroxides

    CERN Document Server

    Kirbach, U W; Gregorich, K E; Lee, D M; Ninov, V; Omtvedt, J P; Patin, J B; Seward, N K; Strellis, D A; Sudowe, R; Türler, A; Wilk, P A; Zielinski, P M; Hoffman, D C; Nitsche, H


    The Cryo-Thermochromatographic Separator (CTS) was designed and constructed for rapid, continuous on-line separation and simultaneous detection of highly volatile compounds of short-lived alpha-decaying isotopes of osmium and hassium (Hs, Z=108). A flowing carrier gas containing the volatile species is passed through a channel formed by two facing rows of 32 alpha-particle detectors, cooled to form a temperature gradient extending from 247 K at the channel entrance down to 176 K at the exit. The volatile species adsorb onto the SiO sub 2 -coated detector surfaces at a characteristic deposition temperature and are identified by their observed alpha-decay energies. The CTS was tested on-line with OsO sub 4 prepared from sup 1 sup 6 sup 9 sup - sup 1 sup 7 sup 3 Os isotopes produced in sup 1 sup 1 sup 8 sup , sup 1 sup 2 sup 0 Sn( sup 5 sup 6 Fe, 3,4,5n) reactions. An adsorption enthalpy for OsO sub 4 of -40.2+-1.5 kJ/mol on SiO sub 2 was deduced by comparing the measured deposition distribution with Monte Carlo...

  5. 12 CFR 263.405 - Petition for reinstatement. (United States)


    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Petition for reinstatement. 263.405 Section 263.405 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE... Audit Services § 263.405 Petition for reinstatement. (a) Form of petition. Unless otherwise ordered by...

  6. 27 CFR 26.263 - Determination of tax on beer. (United States)


    ... beer. 26.263 Section 26.263 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Procedure at Port of Entry From the Virgin Islands § 26.263 Determination of tax on beer. If the certificate prescribed in § 26.205 covers beer, the beer tax will be collected on the basis of the number of barrels of...

  7. 12 CFR 263.7 - Good faith certification. (United States)


    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Good faith certification. 263.7 Section 263.7... RULES OF PRACTICE FOR HEARINGS Uniform Rules of Practice and Procedure § 263.7 Good faith certification... in fact and is warranted by existing law or a good faith argument for the extension, modification, or...

  8. 12 CFR 263.11 - Service of papers. (United States)


    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Service of papers. 263.11 Section 263.11 Banks... OF PRACTICE FOR HEARINGS Uniform Rules of Practice and Procedure § 263.11 Service of papers. (a) By the parties. Except as otherwise provided, a party filing papers shall serve a copy upon the counsel...

  9. 12 CFR 263.10 - Filing of papers. (United States)


    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Filing of papers. 263.10 Section 263.10 Banks... OF PRACTICE FOR HEARINGS Uniform Rules of Practice and Procedure § 263.10 Filing of papers. (a) Filing. Any papers required to be filed, excluding documents produced in response to a discovery request...

  10. 12 CFR 263.99 - Petition for reinstatement. (United States)


    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Petition for reinstatement. 263.99 Section 263... SYSTEM RULES OF PRACTICE FOR HEARINGS Practice Before the Board § 263.99 Petition for reinstatement. The Board may entertain a petition for reinstatement from any person debarred from practice before the Board...

  11. 12 CFR 263.8 - Conflicts of interest. (United States)


    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Conflicts of interest. 263.8 Section 263.8... RULES OF PRACTICE FOR HEARINGS Uniform Rules of Practice and Procedure § 263.8 Conflicts of interest. (a) Conflict of interest in representation. No person shall appear as counsel for another person in an...

  12. 26 CFR 1.263A-0 - Outline of regulations under section 263A. (United States)


    ... that change a method of accounting under section 263A. (4) Effective date. (5) Definition of change in... to services. (i) In general. (ii) Definition of services. (iii) De minimis property provided incident.... (2) Otherwise deductible. (3) Capitalize. (4) Recovery of capitalized costs. (d) Definitions. (1...

  13. Dicty_cDB: VHC263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHC263 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHC263Z 429 - - - - Show VHC263 Library VH (Link to library) Clone ID VHC263 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...ATGG ACTCCCAAC sequence update 2002. 9.10 Translated Amino Acid sequence ---QLFAGIKSICT...kyfrkkmdsq Frame B: ---QLFAGIKSICTXMAMDGCEKCSGNSPTTTCDVLPVYSSLCMAMPDMSQCANWTKMCS

  14. 12 CFR 263.9 - Ex parte communications. (United States)


    .... (a) Definition—(1) Ex parte communication means any material oral or written communication relevant... oral, a memorandum stating the substance of the communication) to be placed on the record of the... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Ex parte communications. 263.9 Section 263.9...

  15. 12 CFR 263.41 - Stays pending judicial review. (United States)


    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Stays pending judicial review. 263.41 Section... SYSTEM RULES OF PRACTICE FOR HEARINGS Uniform Rules of Practice and Procedure § 263.41 Stays pending... the effectiveness of all or any part of its order pending a final decision on a petition for review of...

  16. 12 CFR 263.65 - Civil penalty inflation adjustments. (United States)


    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Civil penalty inflation adjustments. 263.65... Money Penalties § 263.65 Civil penalty inflation adjustments. (a) Inflation adjustments. In accordance with the Federal Civil Penalties Inflation Adjustment Act of 1990 (28 U.S.C. 2461 note), the Board has...

  17. 26 CFR 1.263(a)-0 - Table of contents. (United States)


    ...) adjustment. § 1.263(a)-5Amounts paid or incurred to facilitate an acquisition of a trade or business, a... costs. (5) Stock issuance costs of open-end regulated investment companies. (6) Integration costs. (7...

  18. 12 CFR 263.4 - Authority of the Board. (United States)


    ... RULES OF PRACTICE FOR HEARINGS Uniform Rules of Practice and Procedure § 263.4 Authority of the Board... waive performance of, any act which could be done or ordered by the administrative law judge. ...

  19. 29 CFR 500.263 - Authority of the Secretary. (United States)


    ... Administrative Law Judge § 500.263 Authority of the Secretary. The Secretary may modify or vacate the Decision... inconsistent with a policy or precedent established by the Department of Labor, (b) Encompasses determinations...

  20. 12 CFR 263.402 - Removal, suspension, or debarment. (United States)


    ... accountant from performing audit services for banking organizations that are subject to section 36 of the..., immediately suspend such accountant or firm from performing audit services for banking organizations, if the... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Removal, suspension, or debarment. 263.402...

  1. 12 CFR 263.13 - Change of time limits. (United States)


    ... RULES OF PRACTICE FOR HEARINGS Uniform Rules of Practice and Procedure § 263.13 Change of time limits. Except as otherwise provided by law, the administrative law judge may, for good cause shown, extend the time limits prescribed by the Uniform Rules or by any notice or order issued in the proceedings. After...

  2. 7 CFR 2.63 - Deputy Under Secretary for Research, Education, and Economics. (United States)


    ... Economics. 2.63 Section 2.63 Agriculture Office of the Secretary of Agriculture DELEGATIONS OF AUTHORITY BY... Under Secretary for Research, Education, and Economics § 2.63 Deputy Under Secretary for Research, Education, and Economics. Pursuant to § 2.21(a), subject to reservations in § 2.21(b), and subject to policy...

  3. 27 CFR 25.263 - Production of concentrate and reconstitution of beer. (United States)


    ... and reconstitution of beer. 25.263 Section 25.263 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS BEER Beer Concentrate § 25.263 Production of concentrate and reconstitution of beer. (a) Operations at brewery. A brewer may concentrate beer...

  4. 47 CFR 25.263 - Information sharing requirements for SDARS terrestrial repeater operators. (United States)


    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Information sharing requirements for SDARS terrestrial repeater operators. 25.263 Section 25.263 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards § 25.263 Information sharing...

  5. 31 CFR 26.3 - Availability of Environmental Impact Assessment Summaries (EIA Summaries) and Environmental... (United States)


    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Availability of Environmental Impact Assessment Summaries (EIA Summaries) and Environmental Impact Assessments (EIAs). 26.3 Section 26.3 Money and... DEVELOPMENT BANDS (MDBs) § 26.3 Availability of Environmental Impact Assessment Summaries (EIA Summaries) and...

  6. 12 CFR 263.54 - Delegation to the Office of Financial Institution Adjudication. (United States)


    ... Uniform Rules § 263.54 Delegation to the Office of Financial Institution Adjudication. Unless otherwise... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Delegation to the Office of Financial Institution Adjudication. 263.54 Section 263.54 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF...

  7. NIMONIC 263 microstructure and surface characterization after laser shock peening

    Directory of Open Access Journals (Sweden)

    P. Drobnjak


    Full Text Available The Laser Shock Peening (LSP is applied to the surface of Nimonic 263 alloy. The changes in microstructure and surface topography are observed and analyzed by Scanning Electron Microscopy (SEM, profilometer and microhardness tester. Various laser regimes are chosen which provoke effects of both mechanical and thermo-mechanical treatments of the sample surface. The optimal process parameters, that result in the finest microstructure, smooth and clean surface, are determined. Some wanted and unwanted phases leading to the crack formation are observed.

  8. 12 CFR 263.404 - Notice of removal, suspension, or debarment. (United States)


    ... accountants and firms. An accountant or accounting firm that provides audit services to a banking organization... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Notice of removal, suspension, or debarment. 263.404 Section 263.404 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE...

  9. Single gene microdeletions and microduplication of 3p26.3 in three unrelated families

    DEFF Research Database (Denmark)

    Kashevarova, Anna A; Nazarenko, Lyudmila P; Schultz-Pedersen, Soren


    contain several protein-coding genes and regulatory elements, complicating the understanding of genotype-phenotype correlations. We report two siblings with ID and an unrelated patient with atypical autism who had 3p26.3 microdeletions and one intellectually disabled patient with a 3p26.3 microduplication...

  10. 29 CFR 779.263 - Excise taxes not at the retail level. (United States)


    ... ACT AS APPLIED TO RETAILERS OF GOODS OR SERVICES Employment to Which the Act May Apply; Enterprise Coverage Excise Taxes § 779.263 Excise taxes not at the retail level. There are also a wide variety of... 29 Labor 3 2010-07-01 2010-07-01 false Excise taxes not at the retail level. 779.263 Section 779...

  11. 77 FR 42003 - TA-W-81,263, Chartis Global Services, Inc., a Subsidiary of Chartis, Inc., Regional Processing... (United States)


    ... DEPARTMENT OF LABOR Employment and Training Administration TA-W-81,263, Chartis Global Services..., Houston, TX; TA-W-81,263A, Chartis Global Services, Inc., a Subsidiary of Chartis, Inc., Regional... is amending the certification (TA-W-81,263) to add ``Regional Processing Organization'' and to add...

  12. Hypolipidemic Effects and Safety of Lactobacillus Reuteri 263 in a Hamster Model of Hyperlipidemia

    Directory of Open Access Journals (Sweden)

    Wen-Ching Huang


    Full Text Available We aimed to verify the beneficial effects of probiotic strain Lactobacillus reuteri 263 (Lr263 on hypolipidemic action in hamsters with hyperlipidemia induced by a 0.2% cholesterol and 10% lard diet (i.e., high-cholesterol diet (HCD. Male Golden Syrian hamsters were randomly divided into two groups: normal (n = 8, standard diet (control, and experimental (n = 32, a HCD. After a two-week induction followed by a six-week supplementation with Lr263, the 32 hyperlipidemic hamsters were divided into four groups (n = 8 per group to receive vehicle or Lr263 by oral gavage at 2.1, 4.2, or 10.5 × 109 cells/kg/day for 6 weeks, designated the HCD, 1X, 2X and 5X groups, respectively. The efficacy and safety of Lr263 supplementation were evaluated by lipid profiles of serum, liver and feces and by clinical biochemistry and histopathology. HCD significantly increased serum levels of total cholesterol (TC, triacylglycerol (TG cholesterol, high-density lipoprotein cholesterol (HDL-C, and low-density lipoprotein cholesterol (LDL-C, LDL-C/HDL-C ratio, hepatic and fetal TC and TG levels, and degree of fatty liver as compared with controls. Lr263 supplementation dose dependently increased serum HDL-C level and decreased serum TC, TG, LDL-C levels, LDL-C/HDL-C ratio, hepatic TC and TG levels, and fecal TG level. In addition, Lr263 supplementation had few subchronic toxic effects. Lr263 could be a potential agent with a hypolipidemic pharmacological effect.

  13. A case of de novo duplication of 15q24-q26.3

    Directory of Open Access Journals (Sweden)

    Hye Ran Kim


    Full Text Available Distal duplication, or trisomy 15q, is an extremely rare chromosomal disorder characterized by prenatal and postnatal overgrowth, mental retardation, and craniofacial malformations. Additional abnormalities typically include an unusually short neck, malformations of the fingers and toes, scoliosis and skeletal malformations, genital abnormalities, particularly in affected males, and, in some cases, cardiac defects. The range and severity of symptoms and physical findings may vary from case to case, depending upon the length and location of the duplicated portion of chromosome 15q. Most reported cases of duplication of the long arm of chromosome 15 frequently have more than one segmental imbalance resulting from unbalanced translocations involving chromosome 15 and deletions in another chromosome, as well as other structural chromosomal abnormalities. We report a female newborn with a de novo duplication, 15q24- q26.3, showing intrauterine overgrowth, a narrow asymmetric face with down-slanting palpebral fissures, a large, prominent nose, and micrognathia, arachnodactyly, camptodactyly, congenital heart disease, hydronephrosis, and hydroureter. Chromosomal analysis showed a 46,XX,inv(9(p12q13,dup(15(q24q26.3. Array comparative genomic hybridization analysis revealed a gain of 42 clones on 15q24-q26.3. This case represents the only reported patient with a de novo 15q24-q26.3 duplication that did not result from an unbalanced translocation and did not have a concomitant monosomic component in Korea.

  14. 26 CFR 1.263(a)-2 - Examples of capital expenditures. (United States)


    ...) INCOME TAX (CONTINUED) INCOME TAXES Items Not Deductible § 1.263(a)-2 Examples of capital expenditures... subsidiary and increasing the value of its stockholdings in the subsidiary shall not deduct amounts paid in... be added to the cost of its stock in the subsidiary. (h) The cost of good will in connection with the...

  15. Ultra-urban baseflow and stormflow concentrations and fluxes in a watershed undergoing restoration (WS263) (United States)

    Kenneth T. Belt; William P. Stack; Richard V. Pouyat; Kimberly Burgess; Peter M. Groffman; William M. Frost; Sujay S. Kaushal; Guy. Hager


    We discuss the results of sampling baseflow and stormwater runoff in Watershed 263, an ultra-urban catchment in west Baltimore City that is undergoing restoration aimed at both improving water quality as well as the quality of life in its neighborhoods. We focus on urban hydrology and describe the high baseflow and stormwater nutrient, metal, bacterial and other...

  16. 26 CFR 1.263A-2 - Rules relating to property produced by the taxpayer. (United States)


    ... disbursements method of accounting. (2) Definition of a contract—(i) General rule. Except as provided under... financial institutions incur to originate loans. (ii) Intellectual or creative property. For purposes of...) Introduction. This paragraph (b) provides a simplified method for determining the additional section 263A costs...

  17. 12 CFR 263.62 - Relevant considerations for assessment of civil penalty. (United States)


    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Relevant considerations for assessment of civil... Collection of Civil Money Penalties § 263.62 Relevant considerations for assessment of civil penalty. In... the penalty with respect to the financial resources and good faith of the person charged, the gravity...

  18. 25 CFR 26.3 - What is the purpose of the Job Placement and Training Program? (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false What is the purpose of the Job Placement and Training... PLACEMENT AND TRAINING PROGRAM General Applicability § 26.3 What is the purpose of the Job Placement and Training Program? The purpose of the Job Placement and Training Program is to assist eligible applicants to...

  19. 26 CFR 1.263A-5 - Exception for qualified creative expenses incurred by certain free-lance authors, photographers... (United States)


    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Exception for qualified creative expenses incurred by certain free-lance authors, photographers, and artists. [Reserved] 1.263A-5 Section 1.263A-5... certain free-lance authors, photographers, and artists. [Reserved] ...

  20. 263 Abstract

    African Journals Online (AJOL)


    management staff include provision of residential accommodation, company car with free fuel allocation, pension ... Olomolaiye and Price (1989) argued that construction work .... exceed its budget, by measuring the quantity of work done in ...

  1. Constitutional 3p26.3 terminal microdeletion in an adolescent with neuroblastoma. (United States)

    Pezzolo, Annalisa; Sementa, Angela Rita; Lerone, Margherita; Morini, Martina; Ognibene, Marzia; Defferrari, Raffaella; Mazzocco, Katia; Conte, Massimo; Gigliotti, Anna Rita; Garaventa, Alberto; Pistoia, Vito; Varesio, Luigi


    Neuroblastoma (NB) is a common and often lethal cancer of early childhood that accounts for 10% of pediatric cancer mortality. Incidence peaks in infancy and then rapidly declines, with less than 5% of cases diagnosed in children and adolescents ≥ 10 y. There is increasing evidence that NB has unique biology and an chronic disease course in older children and adolescents, but ultimately dismal survival. We describe a rare constitutional 3p26.3 terminal microdeletion which occurred in an adolescent with NB, with apparently normal phenotype without neurocognitive defects. We evaluated the association of expression of genes involved in the microdeletion with NB patient outcomes using R2 platform. We screened NB patient's tumor cells for CHL1 protein expression using immunofluorescence. Constitutional and tumor DNA were tested by array-comparative genomic hybridization and single nucleotide-polymorphism-array analyses. Peripheral blood mononuclear cells from the patient showed a 2.54 Mb sub-microscopic constitutional terminal 3p deletion that extended to band p26.3. The microdeletion 3p disrupted the CNTN4 gene and the neighboring CNTN6 and CHL1 genes were hemizygously deleted, each of these genes encode neuronal cell adhesion molecules. Low expression of CNTN6 and CNTN4 genes did not stratify NB patients, whereas low CHL1 expression characterized 417 NB patients having worse overall survival. CHL1 protein expression on tumor cells from the patient was weaker than positive control. This is the first report of a constitutional 3p26.3 deletion in a NB patient. Since larger deletions of 3p, indicative of the presence of one or more tumor suppressor genes in this region, occur frequently in neuroblastoma, our results pave the way to the identification of one putative NB suppressor genes mapping in 3p26.3.

  2. ABT-263 induces G1/G0-phase arrest, apoptosis and autophagy in human esophageal cancer cells in vitro. (United States)

    Lin, Qing-Huan; Que, Fu-Chang; Gu, Chun-Ping; Zhong, De-Sheng; Zhou, Dan; Kong, Yi; Yu, Le; Liu, Shu-Wen


    Both the anti- and pro-apoptotic members of the Bcl-2 family are regulated by a conserved Bcl-2 homology (BH3) domain. ABT-263 (Navitoclax), a novel BH3 mimetic and orally bioavailable Bcl-2 family inhibitor with high affinity for Bcl-xL, Bcl-2 and Bcl-w has entered clinical trials for cancer treatment. But the anticancer mechanisms of ABT-263 have not been fully elucidated. In this study we investigated the effects of ABT-263 on human esophageal cancer cells in vitro and to explore its anticancer mechanisms. Treatment with ABT-263 dose-dependently suppressed the viability of 3 human esophageal cancer cells with IC 50 values of 10.7±1.4, 7.1±1.5 and 8.2±1.6 μmol/L, in EC109, HKESC-2 and CaES-17 cells, respectively. ABT-263 (5-20 μmol/L) dose-dependently induced G 1 /G 0 -phase arrest in the 3 cancer cell lines and induced apoptosis evidenced by increased the Annexin V-positive cell population and elevated levels of cleaved caspase 3, cleaved caspase 9 and PARP. We further demonstrated that ABT-263 treatment markedly increased the expression of p21 Waf1/Cip1 and decreased the expression of cyclin D1 and phospho-Rb (retinoblastoma tumor suppressor protein) (Ser780) proteins that contributed to the G 1 /G 0 -phase arrest. Knockdown of p21 Waf1/Cip1 attenuated ABT-263-induced G 1 /G 0 -phase arrest. Moreover, ABT-263 treatment enhanced pro-survival autophagy, shown as the increased LC3-II levels and decreased p62 levels, which counteracted its anticancer activity. Our results suggest that ABT-263 exerts cytostatic and cytotoxic effects on human esophageal cancer cells in vitro and enhances pro-survival autophagy, which counteracts its anticancer activity.

  3. Fabrication data package for HEDL-RI dosimetry in the Maine Yankee Replacement Surveillance Capsule 263 and cavity positions

    International Nuclear Information System (INIS)

    Kellogg, L.S.; Ulseth, J.A.; Lippincott, E.P.; Oliver, B.; Farrar, H.


    This document provides a complete description of dosimetry fabricated for the Maine Yankee Surveillance Capsule Number 263 and three azimuthal positions in the reactor cavity. Surveillance Capsule 263 was originally scheduled for insertion in October 1982, but will be held in reserve for future use, pending establishment of an equilibrium low leakage core burnup distribution. The cavity dosimetry is scheduled for insertion in November 1982

  4. Polarimetry diagnostic on OMEGA EP using a 10-ps, 263-nm probe beam

    International Nuclear Information System (INIS)

    Davies, A.; Haberberger, D.; Boni, R.; Ivancic, S.; Brown, R.; Froula, D. H.


    A polarimetry diagnostic was built and characterized for magnetic-field measurements in laser-plasma experiments on the OMEGA EP laser. This diagnostic was built into the existing 4ω (263-nm) probe system that employs a 10-ps laser pulse collected with an f/4 imaging system. The diagnostic measures the rotation of the probe beam's polarization. The polarimeter uses a Wollaston prism to split the probe beam into orthogonal polarization components. Spatially localized intensity variations between images indicate polarization rotation. Magnetic fields can be calculated by combining the polarimetry data with the measured plasma density profile obtained from angular filter refractometry

  5. Polarimetry diagnostic on OMEGA EP using a 10-ps, 263-nm probe beam. (United States)

    Davies, A; Haberberger, D; Boni, R; Ivancic, S; Brown, R; Froula, D H


    A polarimetry diagnostic was built and characterized for magnetic-field measurements in laser-plasma experiments on the OMEGA EP laser. This diagnostic was built into the existing 4ω (263-nm) probe system that employs a 10-ps laser pulse collected with an f/4 imaging system. The diagnostic measures the rotation of the probe beam's polarization. The polarimeter uses a Wollaston prism to split the probe beam into orthogonal polarization components. Spatially localized intensity variations between images indicate polarization rotation. Magnetic fields can be calculated by combining the polarimetry data with the measured plasma density profile obtained from angular filter refractometry.

  6. A Glio-Protective Role of mir-263a by Tuning Sensitivity to Glutamate

    DEFF Research Database (Denmark)

    Aw, Sherry Shiying; Lim, Isaac Kok Hwee; Tang, Melissa Xue Mei


    of CG5621/Grik, Nmdar1, and Nmdar2. mir-263a mutants exhibit excitotoxic death of a subset of astrocyte-like and ensheathing glia in the CNS. Glial-specific normalization of glutamate receptor levels restores cell numbers and suppresses the movement defect. Therefore, microRNA-mediated regulation...... of glutamate receptor levels protects glia from excitotoxicity, ensuring CNS health. Chronic low-level glutamate receptor overexpression due to mutations affecting microRNA (miRNA) regulation might contribute to glial dysfunction and CNS impairment....

  7. Polarimetry diagnostic on OMEGA EP using a 10-ps, 263-nm probe beam

    Energy Technology Data Exchange (ETDEWEB)

    Davies, A., E-mail:; Haberberger, D.; Boni, R.; Ivancic, S.; Brown, R.; Froula, D. H. [Laboratory for Laser Energetics, University of Rochester, Rochester, New York 14623 (United States)


    A polarimetry diagnostic was built and characterized for magnetic-field measurements in laser-plasma experiments on the OMEGA EP laser. This diagnostic was built into the existing 4ω (263-nm) probe system that employs a 10-ps laser pulse collected with an f/4 imaging system. The diagnostic measures the rotation of the probe beam's polarization. The polarimeter uses a Wollaston prism to split the probe beam into orthogonal polarization components. Spatially localized intensity variations between images indicate polarization rotation. Magnetic fields can be calculated by combining the polarimetry data with the measured plasma density profile obtained from angular filter refractometry.

  8. Rotational emission-line spectrum of Orion A between 247 and 263 GHZ

    International Nuclear Information System (INIS)

    Blake, G.A.; Sutton, E.C.; Masson, C.R.; Phillips, T.G.


    Results are presented from a molecular line survey of the core of the Orion molecular cloud between 247 and 263 GHz. The spectrum contains a total of 243 resolvable lines from 23 different chemical species. When combined with the earlier survey of Orion from 215 to 247 GHz by Sutton et al (1985), the complete data set includes over 780 emission features from 29 distinct molecules. Of the 23 molecules detected in this survey, only NO, CCH, and HCO + were identified not in the lower frequency data

  9. Architecture design of motion estimation for ITU-T H.263 (United States)

    Ku, Chung-Wei; Lin, Gong-Sheng; Chen, Liang-Gee; Lee, Yung-Ping


    Digitalized video and audio system has become the trend of the progress in multimedia, because it provides great performance in quality and feasibility of processing. However, as the huge amount of information is needed while the bandwidth is limitted, data compression plays an important role in the system. Say, for a 176 x 144 monochromic sequence with 10 frames/sec frame rate, the bandwidth is about 2Mbps. This wastes much channel resource and limits the applications. MPEG (moving picttre ezpert groip) standardizes the video codec scheme, and it performs high compression ratio while providing good quality. MPEG-i is used for the frame size about 352 x 240 and 30 frames per second, and MPEG-2 provides scalibility and can be applied on scenes with higher definition, say HDTV (high definition television). On the other hand, some applications concerns the very low bit-rate, such as videophone and video-conferencing. Because the channel bandwidth is much limitted in telephone network, a very high compression ratio must be required. ITU-T announced the H.263 video coding standards to meet the above requirements.8 According to the simulation results of TMN-5,22 it outperforms 11.263 with little overhead of complexity. Since wireless communication is the trend in the near future, low power design of the video codec is an important issue for portable visual telephone. Motion estimation is the most computation consuming parts in the whole video codec. About 60% of the computation is spent on this parts for the encoder. Several architectures were proposed for efficient processing of block matching algorithms. In this paper, in order to meet the requirements of 11.263 and the expectation of low power consumption, a modified sandwich architecture in21 is proposed. Based on the parallel processing philosophy, low power is expected and the generation of either one motion vector or four motion vectors with half-pixel accuracy is achieved concurrently. In addition, we will


    Directory of Open Access Journals (Sweden)

    Oka Widyantara


    Full Text Available Mode baseline encoder video H.263 menerapkan teknik estimasi dan kompensasi gerak dengan satu vector gerak untuk setiap macroblock. Prosedur area pencarian menggunakan pencarian penuh dengan akurasi setengah pixel pada bidang [16,15.5] membuat prediksi di tepian frame tidak dapat diprediksi dengan baik. Peningkatan unjuk kerja pengkodean prediksi interframe encoder video H.263 dengan optimalisasi teknik estimasi dan kompensasi gerak diimplementasikan dengan penambahan area pencarian [31.5,31.5] (unrestricted motion vector, Annex D dan 4 motion vector (advanced prediction mode, Annex F. Hasil penelitian menunjukkan bahwa advanced mode mampu meningkatkan nilai SNR sebesar 0.03 dB untuk sequence video claire, 0.2 dB untuk sequence video foreman, 0.041 dB untuk sequence video Glasgow, dan juga mampu menurunkan bit rate pengkodean sebesar 2.3 % untuk video Claire, 15.63 % untuk video Foreman,  dan 9.8% untuk video Glasgow dibandingkan dengan implementasi 1 motion vector pada pengkodean baseline mode.

  11. Deformed potential energy of $^{263}Db$ in a generalized liquid drop model

    CERN Document Server

    Chen Bao Qiu; Zhao Yao Lin; 10.1088/0256-307X/20/11/009


    The macroscopic deformed potential energy for super-heavy nuclei /sup 263/Db, which governs the entrance and alpha decay channels, is determined within a generalized liquid drop model (GLDM). A quasi- molecular shape is assumed in the GLDM, which includes volume-, surface-, and Coulomb-energies, proximity effects, mass asymmetry, and an accurate nuclear radius. The microscopic single particle energies derived from a shell model in an axially deformed Woods- Saxon potential with a quasi-molecular shape. The shell correction is calculated by the Strutinsky method. The total deformed potential energy of a nucleus can be calculated by the macro-microscopic method as the summation of the liquid-drop energy and the Strutinsky shell correction. The theory is applied to predict the deformed potential energy of the experiment /sup 22/Ne+/sup 241/Am to /sup 263/Db* to /sup 259/Db+4 n, which was performed on the Heavy Ion Accelerator in Lanzhou. It is found that the neck in the quasi-molecular shape is responsible for t...

  12. Nuclear data sheets for (odd-A) A = 249 through A = 263

    International Nuclear Information System (INIS)

    Schmorak, M.R.


    The available experimental data pertaining to the nuclear structure of nuclei with odd mass numbers A = 249 through 263 are compiled (the even-A mass chains were published in March 1976). The results from various decay and reaction measurements, as available through February 1976, are compared and evaluated and alpha-hindrance factors are calculated (see Table 2); syst refers to systematics values: in the case of SF a rough order of magnitude estimate of T/sub 1/2/(SF) was made in a manner similar to that of 73Ra38, T/sub 1/2/(α) syst were obtained as in 72E1Sc, and Q-values from systematics were obtained in a manner similar to that of 71WaGo

  13. SU-E-P-22: AAPM Task Group 263 Tackling Standardization of Nomenclature for Radiation Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Matuszak, M; Feng, M [University of Michigan, Ann Arbor, MI (United States); Moran, J [Univ Michigan Medical Center, Ann Arbor, MI (United States); Xiao, Y [Thomas Jefferson University, Philadelphia, PA (United States); Mayo, C; Miller, R [Mayo Clinic, Rochester, MN (United States); Bosch, W [Washington Univ, Saint Louis, MO (United States); Popple, R [Univ Alabama Birmingham, Birmingham, AL (United States); Marks, L [UNC School of Medicine, Chapel Hill, NC (United States); Wu, Q [Duke University Medical Center, Durham, NC (United States); Molineu, A; Martel, M [UT MD Anderson Cancer Center, Houston, TX (United States); Yock, T [Massachusetts General Hospital, Boston, MA (United States); McNutt, T [Johns Hopkins University, Severna Park, MD (United States); Brown, N [Baptist Medical Center, Jacksonville, FL (United States); Purdie, T [Princess Margaret Hospital, Toronto, ON (Canada); Yorke, E [Memorial Sloan-Kettering Cancer Center, New York, NY (United States); Santanam, L [Washington University School of Medicine, St.louis, MO (United States); Gabriel, P [University of Pennsylvania, Philadelphia, PA (United States); Michalski, J [Washington University, Saint Louis, MO (United States); and others


    Purpose: There is growing recognition of need for increased clarity and consistency in the nomenclatures used for body and organ structures, DVH metrics, toxicity, dose and volume units, etc. Standardization has multiple benefits; e.g. facilitating data collection for clinical trials, enabling the pooling of data between institutions, making transfers (i.e. hand-offs) between centers safer, and enabling vendors to define “default” settings. Towards this goal, the American Association of Physicists in Medicine (AAPM) formed a task group (TG263) in July of 2014, operating under the Work Group on Clinical Trials to develop consensus statements. Guiding principles derived from the investigation and example nomenclatures will be presented for public feedback. Methods: We formed a multi-institutional and multi-vendor collaborative group of 39 physicists, physicians and others involved in clinical use and electronic transfer of information. Members include individuals from IROC, NRG, IHE-RO, DICOM WG-7, ASTRO and EORTC groups with overlapping interests to maximize the quality of the consensus and increase the likelihood of adoption. Surveys of group and NRG members were used to define current nomenclatures and requirements. Technical requirements of vendor systems and the proposed DICOM standards were examined. Results: There is a marked degree of inter and intra institutional variation in current approaches, resulting from inter-vendor differences in capabilities, clinic specific conceptualizations and inconsistencies. Using a consensus approach, the group defined optimal formats for the naming of targets and normal structures. A formal objective assessment of 13 existing clinically-used software packages show that all had capabilities to accommodate these recommended nomenclatures. Conclusions: A multi-stakeholder effort is making significant steps forward in developing a standard nomenclature that will work across platforms. Our current working list includes > 550

  14. 45 CFR 263.1 - How much State money must a State expend annually to meet the basic MOE requirement? (United States)


    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false How much State money must a State expend annually... State's Maintenance of Effort? § 263.1 How much State money must a State expend annually to meet the... historic State expenditures. (2) However, if a State meets the minimum work participation rate requirements...

  15. Structural and Biochemical Characterization of Chlamydia trachomatis Hypothetical Protein CT263 Supports That Menaquinone Synthesis Occurs through the Futalosine Pathway* (United States)

    Barta, Michael L.; Thomas, Keisha; Yuan, Hongling; Lovell, Scott; Battaile, Kevin P.; Schramm, Vern L.; Hefty, P. Scott


    The obligate intracellular human pathogen Chlamydia trachomatis is the etiological agent of blinding trachoma and sexually transmitted disease. Genomic sequencing of Chlamydia indicated this medically important bacterium was not exclusively dependent on the host cell for energy. In order for the electron transport chain to function, electron shuttling between membrane-embedded complexes requires lipid-soluble quinones (e.g. menaquionone or ubiquinone). The sources or biosynthetic pathways required to obtain these electron carriers within C. trachomatis are poorly understood. The 1.58Å crystal structure of C. trachomatis hypothetical protein CT263 presented here supports a role in quinone biosynthesis. Although CT263 lacks sequence-based functional annotation, the crystal structure of CT263 displays striking structural similarity to 5′-methylthioadenosine nucleosidase (MTAN) enzymes. Although CT263 lacks the active site-associated dimer interface found in prototypical MTANs, co-crystal structures with product (adenine) or substrate (5′-methylthioadenosine) indicate that the canonical active site residues are conserved. Enzymatic characterization of CT263 indicates that the futalosine pathway intermediate 6-amino-6-deoxyfutalosine (kcat/Km = 1.8 × 103 m−1 s−1), but not the prototypical MTAN substrates (e.g. S-adenosylhomocysteine and 5′-methylthioadenosine), is hydrolyzed. Bioinformatic analyses of the chlamydial proteome also support the futalosine pathway toward the synthesis of menaquinone in Chlamydiaceae. This report provides the first experimental support for quinone synthesis in Chlamydia. Menaquinone synthesis provides another target for agents to combat C. trachomatis infection. PMID:25253688

  16. 20 CFR 1002.263 - Does the employee pay interest when he or she makes up missed contributions or elective deferrals? (United States)


    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Does the employee pay interest when he or she makes up missed contributions or elective deferrals? 1002.263 Section 1002.263 Employees' Benefits OFFICE OF THE ASSISTANT SECRETARY FOR VETERANS' EMPLOYMENT AND TRAINING SERVICE, DEPARTMENT OF LABOR REGULATIONS UNDER THE UNIFORMED SERVICES...

  17. The role of particle ripening on the creep acceleration of Nimonic 263 superalloy

    Directory of Open Access Journals (Sweden)

    Angella Giuliano


    Full Text Available Physically based constitutive equations need to incorporate the most relevant microstructural features of materials to adequately describe their mechanical behaviour. To accurately model the creep behaviour of precipitation hardened alloys, the value and the evolution of strengthening particle size are important parameters to be taken into account. In the present work, creep tests have been run on virgin and overaged (up to 3500 h at 800 ∘C Nimonic 263, a polycrystalline nickel base superalloy used for combustion chambers of gas turbines. The experimental results suggest that the reinforcing particle evolution is not the main reason for the creep acceleration that seems to be better described by a strain correlated damage, such as the accumulation of mobile dislocations or the grain boundary cavitation. The coarsened microstructure, obtained by overageing the alloy at high temperature before creep testing, mainly influences the initial stage of the creep, resulting in a higher minimum creep rate and a corresponding reduction of the creep resistance.

  18. Development of a SISAK extraction system for chemical studies of element 108, hassium

    Energy Technology Data Exchange (ETDEWEB)

    Samadani, F.; Alstad, J.; Bjoernstad, T.; Stavsetra, L.; Omtvedt, J.P. [Oslo Univ. (Germany). Dept. of Chemistry


    A liquid-liquid extraction system suitable for studies of chemical properties of Hs (element 108), in the form of HsO{sub 4}, was developed using {gamma}-emitting isotopes of its homologue Os. The system is targeted for the fast on-line extraction system SISAK, which operates in a continuous manner and is suitable for liquid-phase studies of transactinide elements. The distribution of OsO{sub 4} between various dilute NaOH solutions and toluene was studied. Both batch and SISAK on-line experiments were performed to develop an appropriate system. From analysis of the extraction curves equilibrium constants for the formation of the presumed complexes, Na[OsO{sub 4}(OH)] and Na{sub 2}[OsO{sub 4}(OH){sub 2}], were obtained: K{sub 1} = (1 {+-} 0.5) x 10{sup 4} and K{sub 2} = 12 {+-} 8, respectively. The SISAK system includes a liquid-scintillation detection system for {alpha} measurements. Due to quenching effects it is not possible to perform direct measurement of the aqueous phase {alpha}'s. Therefore, a two-stage extraction method that provides an indirect measurement of the activity in the aqueous phase was developed as part of the proposed system for Hs: Acidification of the raffinate from the first stage result in recovery of OsO{sub 4}, which is highly extractable into toluene. The yield of extraction in the second step, from 0.01 M NaOH solution after acidification with H{sub 2}SO{sub 4} solution, was (90 {+-} 3)%. (orig.)

  19. Development of a SISAK extraction system for chemical studies of element 108, hassium

    International Nuclear Information System (INIS)

    Samadani, F.; Alstad, J.; Bjoernstad, T.; Stavsetra, L.; Omtvedt, J.P.


    A liquid-liquid extraction system suitable for studies of chemical properties of Hs (element 108), in the form of HsO 4 , was developed using γ-emitting isotopes of its homologue Os. The system is targeted for the fast on-line extraction system SISAK, which operates in a continuous manner and is suitable for liquid-phase studies of transactinide elements. The distribution of OsO 4 between various dilute NaOH solutions and toluene was studied. Both batch and SISAK on-line experiments were performed to develop an appropriate system. From analysis of the extraction curves equilibrium constants for the formation of the presumed complexes, Na[OsO 4 (OH)] and Na 2 [OsO 4 (OH) 2 ], were obtained: K 1 = (1 ± 0.5) x 10 4 and K 2 = 12 ± 8, respectively. The SISAK system includes a liquid-scintillation detection system for α measurements. Due to quenching effects it is not possible to perform direct measurement of the aqueous phase α's. Therefore, a two-stage extraction method that provides an indirect measurement of the activity in the aqueous phase was developed as part of the proposed system for Hs: Acidification of the raffinate from the first stage result in recovery of OsO 4 , which is highly extractable into toluene. The yield of extraction in the second step, from 0.01 M NaOH solution after acidification with H 2 SO 4 solution, was (90 ± 3)%. (orig.)

  20. American Association of Physicists in Medicine Task Group 263: Standardizing Nomenclatures in Radiation Oncology. (United States)

    Mayo, Charles S; Moran, Jean M; Bosch, Walter; Xiao, Ying; McNutt, Todd; Popple, Richard; Michalski, Jeff; Feng, Mary; Marks, Lawrence B; Fuller, Clifton D; Yorke, Ellen; Palta, Jatinder; Gabriel, Peter E; Molineu, Andrea; Matuszak, Martha M; Covington, Elizabeth; Masi, Kathryn; Richardson, Susan L; Ritter, Timothy; Morgas, Tomasz; Flampouri, Stella; Santanam, Lakshmi; Moore, Joseph A; Purdie, Thomas G; Miller, Robert C; Hurkmans, Coen; Adams, Judy; Jackie Wu, Qing-Rong; Fox, Colleen J; Siochi, Ramon Alfredo; Brown, Norman L; Verbakel, Wilko; Archambault, Yves; Chmura, Steven J; Dekker, Andre L; Eagle, Don G; Fitzgerald, Thomas J; Hong, Theodore; Kapoor, Rishabh; Lansing, Beth; Jolly, Shruti; Napolitano, Mary E; Percy, James; Rose, Mark S; Siddiqui, Salim; Schadt, Christof; Simon, William E; Straube, William L; St James, Sara T; Ulin, Kenneth; Yom, Sue S; Yock, Torunn I


    A substantial barrier to the single- and multi-institutional aggregation of data to supporting clinical trials, practice quality improvement efforts, and development of big data analytics resource systems is the lack of standardized nomenclatures for expressing dosimetric data. To address this issue, the American Association of Physicists in Medicine (AAPM) Task Group 263 was charged with providing nomenclature guidelines and values in radiation oncology for use in clinical trials, data-pooling initiatives, population-based studies, and routine clinical care by standardizing: (1) structure names across image processing and treatment planning system platforms; (2) nomenclature for dosimetric data (eg, dose-volume histogram [DVH]-based metrics); (3) templates for clinical trial groups and users of an initial subset of software platforms to facilitate adoption of the standards; (4) formalism for nomenclature schema, which can accommodate the addition of other structures defined in the future. A multisociety, multidisciplinary, multinational group of 57 members representing stake holders ranging from large academic centers to community clinics and vendors was assembled, including physicists, physicians, dosimetrists, and vendors. The stakeholder groups represented in the membership included the AAPM, American Society for Radiation Oncology (ASTRO), NRG Oncology, European Society for Radiation Oncology (ESTRO), Radiation Therapy Oncology Group (RTOG), Children's Oncology Group (COG), Integrating Healthcare Enterprise in Radiation Oncology (IHE-RO), and Digital Imaging and Communications in Medicine working group (DICOM WG); A nomenclature system for target and organ at risk volumes and DVH nomenclature was developed and piloted to demonstrate viability across a range of clinics and within the framework of clinical trials. The final report was approved by AAPM in October 2017. The approval process included review by 8 AAPM committees, with additional review by ASTRO

  1. Optical diagnostic suite (schlieren, interferometry, and grid image refractometry) on OMEGA EP using a 10-ps, 263-nm probe beam. (United States)

    Froula, D H; Boni, R; Bedzyk, M; Craxton, R S; Ehrne, F; Ivancic, S; Jungquist, R; Shoup, M J; Theobald, W; Weiner, D; Kugland, N L; Rushford, M C


    A 10-ps, 263-nm (4ω) laser is being built to probe plasmas produced on the OMEGA EP [J. H. Kelly, L. J. Waxer, V. Bagnoud, I. A. Begishev, J. Bromage, B. E. Kruschwitz, T. E. Kessler, S. J. Loucks, D. N. Maywar, R. L. McCrory et al., J. Phys. IV France 133, 75-80 (2006)]. A suite of optical diagnostics (schlieren, interferometry, and grid image refractometry) has been designed to diagnose and characterize a wide variety of plasmas. Light scattered by the probe beam is collected by an f/4 catadioptric telescope and a transport system is designed to image with a near-diffraction-limited resolution (~1 - μm full width at half maximum) over a 5-mm field of view to a diagnostic table. The transport system provides a contrast greater than 1 : 10(4) with respect to all wavelengths outside of the 263 ± 2 nm measurement range.

  2. Optical diagnostic suite (schlieren, interferometry, and grid image refractometry) on OMEGA EP using a 10-ps, 263-nm probe beam

    International Nuclear Information System (INIS)

    Froula, D. H.; Boni, R.; Bedzyk, M.; Craxton, R. S.; Ehrne, F.; Ivancic, S.; Jungquist, R.; Shoup, M. J.; Theobald, W.; Weiner, D.; Kugland, N. L.; Rushford, M. C.


    A 10-ps, 263-nm (4ω) laser is being built to probe plasmas produced on the OMEGA EP [J. H. Kelly, L. J. Waxer, V. Bagnoud, I. A. Begishev, J. Bromage, B. E. Kruschwitz, T. E. Kessler, S. J. Loucks, D. N. Maywar, R. L. McCrory et al., J. Phys. IV France 133, 75–80 (2006)]. A suite of optical diagnostics (schlieren, interferometry, and grid image refractometry) has been designed to diagnose and characterize a wide variety of plasmas. Light scattered by the probe beam is collected by an f/4 catadioptric telescope and a transport system is designed to image with a near-diffraction-limited resolution (∼1 −μm full width at half maximum) over a 5-mm field of view to a diagnostic table. The transport system provides a contrast greater than 1 : 10 4 with respect to all wavelengths outside of the 263 ± 2 nm measurement range.

  3. Optical diagnostic suite (schlieren, interferometry, and grid image refractometry) on OMEGA EP using a 10-ps, 263-nm probe beam

    Energy Technology Data Exchange (ETDEWEB)

    Froula, D. H.; Boni, R.; Bedzyk, M.; Craxton, R. S.; Ehrne, F.; Ivancic, S.; Jungquist, R.; Shoup, M. J.; Theobald, W.; Weiner, D. [Laboratory for Laser Energetics, University of Rochester, 250 E. River Rd., Rochester, New York 14616 (United States); Kugland, N. L.; Rushford, M. C. [Lawrence Livermore National Laboratory, University of California, P. O. Box 808, Livermore, California 94551 (United States)


    A 10-ps, 263-nm (4{omega}) laser is being built to probe plasmas produced on the OMEGA EP [J. H. Kelly, L. J. Waxer, V. Bagnoud, I. A. Begishev, J. Bromage, B. E. Kruschwitz, T. E. Kessler, S. J. Loucks, D. N. Maywar, R. L. McCrory et al., J. Phys. IV France 133, 75-80 (2006)]. A suite of optical diagnostics (schlieren, interferometry, and grid image refractometry) has been designed to diagnose and characterize a wide variety of plasmas. Light scattered by the probe beam is collected by an f/4 catadioptric telescope and a transport system is designed to image with a near-diffraction-limited resolution ({approx}1 -{mu}m full width at half maximum) over a 5-mm field of view to a diagnostic table. The transport system provides a contrast greater than 1 : 10{sup 4} with respect to all wavelengths outside of the 263 {+-} 2 nm measurement range.

  4. Improvement of surface integrity of Nimonic C 263 super alloy produced by WEDM through various post-processing techniques

    Czech Academy of Sciences Publication Activity Database

    Mandal, A.; Dixit, A. R.; Chattopadhyaya, S.; Paramanik, A.; Hloch, Sergej; Królczyk, G.


    Roč. 93, 1-4 (2017), s. 433-443 ISSN 0268-3768 Institutional support: RVO:68145535 Keywords : surface integrity * wire-EDM * Nimonic C-263 * multi-cut * recast layer Subject RIV: JQ - Machines ; Tools OBOR OECD: Mechanical engineering Impact factor: 2.209, year: 2016

  5. Improvement of surface integrity of Nimonic C 263 super alloy produced by WEDM through various post-processing techniques

    Czech Academy of Sciences Publication Activity Database

    Mandal, A.; Dixit, A. R.; Chattopadhyaya, S.; Paramanik, A.; Hloch, Sergej; Królczyk, G.


    Roč. 93, 1-4 (2017), s. 433-443 ISSN 0268-3768 Institutional support: RVO:68145535 Keywords : surface integrity * wire-EDM * Nimonic C-263 * multi-cut * recast layer Subject RIV: JQ - Machines ; Tools OBOR OECD: Mechanical engineering Impact factor: 2.209, year: 2016 article /10.1007/s00170-017-9993-x

  6. Heat Killed Lactobacillus reuteri GMNL-263 Reduces Fibrosis Effects on the Liver and Heart in High Fat Diet-Hamsters via TGF-β Suppression

    Directory of Open Access Journals (Sweden)

    Wei-Jen Ting


    Full Text Available Obesity is one of the major risk factors for nonalcoholic fatty liver disease (NAFLD, and NAFLD is highly associated with an increased risk of cardiovascular disease (CVD. Scholars have suggested that certain probiotics may significantly impact cardiovascular health, particularly certain Lactobacillus species, such as Lactobacillus reuteri GMNL-263 (Lr263 probiotics, which have been shown to reduce obesity and arteriosclerosis in vivo. In the present study, we examined the potential of heat-killed bacteria to attenuate high fat diet (HFD-induced hepatic and cardiac damages and the possible underlying mechanism of the positive effects of heat-killed Lr263 oral supplements. Heat-killed Lr263 treatments (625 and 3125 mg/kg-hamster/day were provided as a daily supplement by oral gavage to HFD-fed hamsters for eight weeks. The results show that heat-killed Lr263 treatments reduce fatty liver syndrome. Moreover, heat-killed Lactobacillus reuteri GMNL-263 supplementation in HFD hamsters also reduced fibrosis in the liver and heart by reducing transforming growth factor β (TGF-β expression levels. In conclusion, heat-killed Lr263 can reduce lipid metabolic stress in HFD hamsters and decrease the risk of fatty liver and cardiovascular disease.

  7. Supplementary heat-killed Lactobacillus reuteri GMNL-263 ameliorates hyperlipidaemic and cardiac apoptosis in high-fat diet-fed hamsters to maintain cardiovascular function. (United States)

    Ting, Wei-Jen; Kuo, Wei-Wen; Kuo, Chia-Hua; Yeh, Yu-Lan; Shen, Chia-Yao; Chen, Ya-Hui; Ho, Tsung-Jung; Viswanadha, Vijaya Padma; Chen, Yi-Hsing; Huang, Chih-Yang


    Obesity and hyperlipidaemia increase the risk of CVD. Some strains of probiotics have been suggested to have potential applications in cardiovascular health by lowering serum LDL-cholesterol. In this work, high-fat diet-induced hyperlipidaemia in hamsters was treated with different doses (5×108 and 2·5×109 cells/kg per d) of heat-killed Lactobacillus reuteri GMNL-263 (Lr263) by oral gavage for 8 weeks. The serum lipid profile analysis showed that LDL-cholesterol and plasma malondialdehyde (P-MDA) were reduced in the GMNL-263 5×108 cells/kg per d treatment group. Total cholesterol and P-MDA were reduced in the GMNL-263 2·5×109 cells/kg per d treatment group. In terms of heart function, the GMNL-263 2·5×109 cells/kg per d treatments improved the ejection fraction from 85·71 to 91·81 % and fractional shortening from 46·93 to 57·92 % in the high-fat diet-fed hamster hearts. Moreover, the GMNL-263-treated, high-fat diet-fed hamster hearts exhibited reduced Fas-induced myocardial apoptosis and a reactivated IGF1R/PI3K/Akt cell survival pathway. Interestingly, the GMNL-263 treatments also enhanced the heat-shock protein 27 expression in a dose-dependent manner, but the mechanism for this increase remains unclear. In conclusion, supplementary heat-killed L. reuteri GMNL-263 can slightly reduce serum cholesterol. The anti-hyperlipidaemia effects of GMNL-263 may reactivate the IGF1R/PI3K/Akt cell survival pathway and reduce Fas-induced myocardial apoptosis in high-fat diet-fed hamster hearts.

  8. Lactobacillus paracasei GMNL-32, Lactobacillus reuteri GMNL-89 and L. reuteri GMNL-263 ameliorate hepatic injuries in lupus-prone mice. (United States)

    Hsu, Tsai-Ching; Huang, Chih-Yang; Liu, Chung-Hsien; Hsu, Kuo-Ching; Chen, Yi-Hsing; Tzang, Bor-Show


    Probiotics are known to regulate host immunity by interacting with systemic and mucosal immune cells as well as intestinal epithelial cells. Supplementation with certain probiotics has been reported to be effective against various disorders, including immune-related diseases. However, little is known about the effectiveness of Lactobacillus paracasei GMNL-32 (GMNL-32), Lactobacillus reuteri GMNL-89 (GMNL-89) and L. reuteri GMNL-263 (GMNL-263) in the management of autoimmune diseases, especially systemic lupus erythematosus (SLE). NZB/W F1 mice, which are a lupus-prone animal model, were orally gavaged with GMNL-32, GMNL-89 or GMNL-263 to investigate the effects of these Lactobacillus strains on liver injuries in NZB/W F1 mice. The results thus obtained reveal that supplementary GMNL-32, GMNL-89 or GMNL-263 in NZB/W F1 mice ameliorates hepatic apoptosis and inflammatory indicators, such as matrix metalloproteinase-9 activity and C-reactive protein and inducible nitric oxide synthase expressions. In addition, supplementation with GMNL-32, GMNL-89 or GMNL-263 in NZB/W F1 mice reduced the expressions of hepatic IL-1β, IL-6 and TNF-α proteins by suppressing the mitogen-activated protein kinase and NF-κB signalling pathways. These findings, presented here for the first time, reveal that GMNL-32, GMNL-89 and GMNL-263 mitigate hepatic inflammation and apoptosis in lupus-prone mice and may support an alternative remedy for liver disorders in cases of SLE.

  9. Generation of femtosecond laser pulses at 263 nm by K3B6O10Cl crysta*

    International Nuclear Information System (INIS)

    Zhang Ning-Hua; He Peng; Huang Hang-Dong; Zhu Jiang-Feng; Tian Wen-Long; Fang Shao-Bo; Teng Hao; Wei Zhi-Yi; Wu Hong-Ping; Pan Shi-Lie


    The third harmonic generation (THG) of a linear cavity Ti:sapphire regenerative amplifier by use of a K 3 B 6 O 10 Cl (KBOC) crystal is studied for the first time. Output power up to 5.9 mW is obtained at a central wavelength of 263 nm, corresponding to a conversion efficiency of 4.5% to the second harmonic power. Our results show a tremendous potential for nonlinear frequency conversion into the deep ultraviolet range with the new crystal and the output laser power can be further improved. (paper)

  10. Optical diagnostic suite (schlieren, interferometry, and grid image refractometry) on OMEGA EP using a 10-ps, 263-nm probe beama) (United States)

    Froula, D. H.; Boni, R.; Bedzyk, M.; Craxton, R. S.; Ehrne, F.; Ivancic, S.; Jungquist, R.; Shoup, M. J.; Theobald, W.; Weiner, D.; Kugland, N. L.; Rushford, M. C.


    A 10-ps, 263-nm (4ω) laser is being built to probe plasmas produced on the OMEGA EP [J. H. Kelly, L. J. Waxer, V. Bagnoud, I. A. Begishev, J. Bromage, B. E. Kruschwitz, T. E. Kessler, S. J. Loucks, D. N. Maywar, R. L. McCrory et al., J. Phys. IV France 133, 75-80 (2006)], 10.1051/jp4:2006133015. A suite of optical diagnostics (schlieren, interferometry, and grid image refractometry) has been designed to diagnose and characterize a wide variety of plasmas. Light scattered by the probe beam is collected by an f/4 catadioptric telescope and a transport system is designed to image with a near-diffraction-limited resolution (˜1 - μm full width at half maximum) over a 5-mm field of view to a diagnostic table. The transport system provides a contrast greater than 1 : 104 with respect to all wavelengths outside of the 263 ± 2 nm measurement range.

  11. Synthesis research of squalene synthetase inhibitor CP-263, 114. How is skeleton construction carried out?; Sukuaren gosei koso sogaizai CP-263,114 no gosei kenkyu - ikanishite kokkaku kochiku wo okonauka?

    Energy Technology Data Exchange (ETDEWEB)

    Matsushima, Y. [Tokyo Inst. of Tech., Tokyo (Japan)


    CP-263, 114 isolated as a squalene synthetase inhibitor and the decyclization of CP-225, 917 was not only expected to be a lead chemical compound of the hypercholesterolemia medicine, but also have collected the attention of the organic synthetic chemistry researchers all over the world from the ring structure of advanced oxygen functionalization. In the CP- chemical compound, the constructive method of the bicyclo ring structure is a key of the synthesis, there are three reports to use the intramolecular Diels-Alder reaction (Fukuyama) and the siloxy-Cope rearrangement (Leighton), intramolecular Heck reaction (Danishefsky) as a result of succeeding in including the foothold to the side-chain lactol ring. Recently, Nicolaou et al. succeeded for the first time in the total synthesis racemic modification shell. They carried out the skeleton construction by the intramolecular Diels-Alder reaction, and constructed the maleic anhydride structure in taking the ketone as a foothold. (NEDO)

  12. Evaluation of efficacy of prion reduction filters using blood from an endogenously infected 263K scrapie hamster model. (United States)

    McLeod, Neil P; Nugent, Philip; Dixon, Douglas; Dennis, Mike; Cornwall, Mark; Mallinson, Gary; Watkins, Nicholas; Thomas, Stephen; Sutton, J Mark


    The P-Capt prion reduction filter (MacoPharma) removes prion infectivity in model systems. This independent evaluation assesses prion removal from endogenously infected animal blood, using CE-marked P-Capt filters, and replicates the proposed use of the filter within the UK Blood Services. Two units of blood, generated from 263K scrapie-infected hamsters, were processed using leukoreduction filters (LXT-quadruple, MacoPharma). Approximately 100 mL of the removed plasma was added back to the red blood cells (RBCs) and the blood was filtered through a P-Capt filter. Samples of unfiltered whole blood, the prion filter input (RBCs plus plasma and SAGM [RBCPS]), and prion-filtered leukoreduced blood (PFB) were injected intracranially into hamsters. Clinical symptoms were monitored for 500 ± 1 day, and brains were assessed for spongiosis and prion protein deposit. In Filtration Run 1, none of the 50 challenged animals were diagnosed with scrapie after inoculation with the RBCPS fraction, while two of 190 hamsters injected with PFB were infected. In Filtration Run 2, one of 49 animals injected with RBCPS and two of 193 hamsters injected with PFB were infected. Run 1 reduced the infectious dose (ID) by 1.467 log (>1.187 log and <0.280 log for leukoreduction and prion filtration, respectively). Run 2 reduced prion infectivity by 1.424 log (1.127 and 0.297 log, respectively). Residual infectivity was estimated at 0.212 ± 0.149 IDs/mL (Run 1) and 0.208 ± 0.147 IDs/mL (Run 2). Leukoreduction removed the majority of infectivity from 263K scrapie hamster blood. The P-Capt filter removed a proportion of the remaining infectivity, but residual infectivity was observed in two independent processes. © 2015 AABB.

  13. Chromosome 15q overgrowth syndrome: Prenatal diagnosis, molecular cytogenetic characterization, and perinatal findings in a fetus with dup(15(q26.2q26.3

    Directory of Open Access Journals (Sweden)

    Chih-Ping Chen


    Conclusion: The present case provides evidence for prenatal overgrowth, craniosynostosis, and characteristic facial dysmorphism in association with a duplication of 15q26.2→q26.3 and a duplication of the IGF1R gene. Prenatal diagnosis of fetal overgrowth should include a differential diagnosis of the chromosome 15q overgrowth syndrome.

  14. 7 CFR 868.261 - Grade and grade requirements for the classes of brown rice for processing. (See also § 868.263.) (United States)


    ... Department of Agriculture (Continued) GRAIN INSPECTION, PACKERS AND STOCKYARD ADMINISTRATION (FEDERAL GRAIN INSPECTION SERVICE), DEPARTMENT OF AGRICULTURE GENERAL REGULATIONS AND STANDARDS FOR CERTAIN AGRICULTURAL..., see § 868.263(c). 3 Plates should be used for southern production rice and sieves should be used for...

  15. Cyclic plasticity and lifetime of the nickel-based Alloy C-263: Experiments, models and component simulation

    Directory of Open Access Journals (Sweden)

    Maier G.


    Full Text Available The present work deals with the thermomechanical fatigue and low-cycle fatigue behavior of C-263 in two different material conditions. Microstructural characteristics and fracture modes are investigated with light and electron microscopy. The experimental results indicate that viscoplastic deformations depend on the heat treatment or rather on the current state of the microstructure. The measured data are used to adjust the parameters of a Chaboche type model and a fracture-mechanics based model for fatigue lifetime prediction. The Chaboche model is able to describe the essential phenomena of time and temperature dependent cyclic plasticity including the complex cyclic hardening during thermo-cyclic loading of both material conditions with a unique set of material parameters. This could be achieved by including an additional internal variable into the Chaboche model which accounts for changes in the precipitation microstructure during high temperature loading. Furthermore, the proposed lifetime model is well suited for a common fatigue life prediction of both investigated heats. The deformation and lifetime models are implemented into a user defined material routine. In this work, the material routine is applied for the lifetime prediction of a critical power plant component using the finite element method.

  16. Relationships of damaged starch granules and particle size distribution with pasting and thermal profiles of milled MR263 rice flour. (United States)

    Asmeda, R; Noorlaila, A; Norziah, M H


    This research was conducted to investigate the effects of different grinding techniques (dry, semi-wet and wet) of milled rice grains on the damaged starch and particle size distribution of flour produced from a new variety, MR263, specifically related to the pasting and thermal profiles. The results indicated that grinding techniques significantly (price flour. Wet grinding process yields flour with lowest percentage of starch damage (7.37%) and finest average particle size (8.52μm). Pasting and gelatinization temperature was found in the range of 84.45-89.63°C and 59.86-75.31°C, respectively. Dry ground flour attained the lowest pasting and gelatinization temperature as shown by the thermal and pasting profiles. Correlation analysis revealed that percentage of damaged starch granules had a significant, negative relationship with pasting temperature while average particle size distribution had a significant, strong negative relationship with gelatinization temperature. Copyright © 2015 Elsevier Ltd. All rights reserved.

  17. Molecular characterization of NRXN1 deletions from 19,263 clinical microarray cases identifies exons important for neurodevelopmental disease expression (United States)

    Lowther, Chelsea; Speevak, Marsha; Armour, Christine M.; Goh, Elaine S.; Graham, Gail E.; Li, Chumei; Zeesman, Susan; Nowaczyk, Malgorzata J.M.; Schultz, Lee-Anne; Morra, Antonella; Nicolson, Rob; Bikangaga, Peter; Samdup, Dawa; Zaazou, Mostafa; Boyd, Kerry; Jung, Jack H.; Siu, Victoria; Rajguru, Manjulata; Goobie, Sharan; Tarnopolsky, Mark A.; Prasad, Chitra; Dick, Paul T.; Hussain, Asmaa S.; Walinga, Margreet; Reijenga, Renske G.; Gazzellone, Matthew; Lionel, Anath C.; Marshall, Christian R.; Scherer, Stephen W.; Stavropoulos, Dimitri J.; McCready, Elizabeth; Bassett, Anne S.


    Purpose The purpose of the current study was to assess the penetrance of NRXN1 deletions. Methods We compared the prevalence and genomic extent of NRXN1 deletions identified among 19,263 clinically referred cases to that of 15,264 controls. The burden of additional clinically relevant CNVs was used as a proxy to estimate the relative penetrance of NRXN1 deletions. Results We identified 41 (0.21%) previously unreported exonic NRXN1 deletions ascertained for developmental delay/intellectual disability, significantly greater than in controls [OR=8.14 (95% CI 2.91–22.72), p< 0.0001)]. Ten (22.7%) of these had a second clinically relevant CNV. Subjects with a deletion near the 3′ end of NRXN1 were significantly more likely to have a second rare CNV than subjects with a 5′ NRXN1 deletion [OR=7.47 (95% CI 2.36–23.61), p=0.0006]. The prevalence of intronic NRXN1 deletions was not statistically different between cases and controls (p=0.618). The majority (63.2%) of intronic NRXN1 deletion cases had a second rare CNV, a two-fold greater prevalence than for exonic NRXN1 deletion cases (p=0.0035). Conclusions The results support the importance of exons near the 5′ end of NRXN1 in the expression of neurodevelopmental disorders. Intronic NRXN1 deletions do not appear to substantially increase the risk for clinical phenotypes. PMID:27195815

  18. Total conversion coefficient of the 263 keV (21/sup 2//2->13/sup +//2) transition in sup(93m)Mo

    Energy Technology Data Exchange (ETDEWEB)

    Suryanaryana, C.; Venkateswara Rao, M.; Narayana, D.G.S.; Bhuloka Reddy, S.; Satyanarayana, G.; Sastry, D.L.; Chintalapudi, S.N.


    The total conversion coefficient of the 263 keV gamma transition in the decay scheme of sup(93m)Mo is measured by intensity balance method using a HP Ge spectrometer system. The experimental value of ..cap alpha..sub(T)(263 keV) is found to be 0.696 +- 0.05 which is in agreement with the theoretical values 0.72 and 0.7. The transition probability T(E4) is calculated using the present value of ..cap alpha..sub(T) and compared with the single-particle estimate. A good agreement is noted between the theory and the experiment for the value of T(E4).

  19. Non-LTE analysis of extremely helium-rich stars. The hot sdO stars LSE 153, 259 and 263 (United States)

    Husfeld, D.; Butler, K.; Heber, U.; Drilling, J. S.


    Results of a non-LTE fine analysis based mainly on high-resolution CASPEC spectra for three extremely helium-rich sdO stars are discussed in order to explain hydrogen deficiency in single stars. High temperature (Teff = 70,000 to 75,000 K) and a position in the log Teff - log g diagram were found close to the Eddington limit. Various abundance estimates are derived for hydrogen (upper limits only), carbon, nitrogen, and magnesium. Hydrogen is reduced to less than 10 percent by number in LSE 153 and LSE 263, and to less than 5 percent in LSE 259. The hydrogen deficiency is accompanied by nitrogen- and carbon-enrichment in LSE 153 and LSE 259 only. In LSE 263, carbon is depleted by about 1 dex. Stellar masses obtained by assuming that a core mass-luminosity relation holds for these stars, were found to be in the range 0.6-0.9 solar mass, yielding luminosities log L/L:solar = 3.7-4.5. Two of the program stars (LSE 153 and 259) appear to be possible successors of the R CrB and helium B stars, whereas the third star (LSE 263) displays a much lower carbon content in its photosphere making it an exceptional case among the known hydrogen deficient stars.

  20. Desempeño del modelo rothc-26.3 a nivel de parcela en México

    Directory of Open Access Journals (Sweden)

    Lucila González Molina


    Full Text Available De acuerdo con el Panel Intergubernamental sobre el Cambio Climático (PICC, deben reportarse los almacenes y cambios del carbono orgánico del suelo (COS en el tiempo. El modelo RothC-26.3 (RothC es uno de los más usados en el mundo para estudiar la dinámica del C en diferentes sistemas. Se evaluó el desempeño del RothC en la simulación de los cambios del COS, a nivel de parcela, en experimentos de corta duración. Se evaluaron nueve sitios y los sistemas: agrícola con residuos vegetales (A+R, agrícola sin residuos (A-R, forestales (F, praderas (PR y agostaderos (AGOS. Las parcelas experimentales se ubicaron en los estados de México, Tlaxcala, Michoacán, Guanajuato, Oaxaca, Jalisco y Nuevo León. El RothC se ejecutó (i con el COSinicial, medido en cada punto de muestreo (*CIPUN en parcelas de la Sierra Norte de Oaxaca y, (ii con el COSinicial promedio medido por parcela (*CIPAR en el resto de los sitios. Se midieron y estimaron los parámetros de entrada al modelo, como residuos vegetales y abonos orgánicos. El grado de asociación entre el COS medido y el simulado fue de 0.76 y hasta 1.0 en todos los sitios. La eficiencia del modelo (EF varió entre 0.53 y 0.93, excepto en el Batán, donde se evaluaron sistemas de labranza (EF= −0.60. La r, en ambas formas de simulación, varió entre 0.63 y 0.97, excepto en AGOS; EF en los agrícolas fue de 0.48 a 0.84 y de 0.81 en F *CIPAR. La EF fue insatisfactoria obtenida para los AGOS (*CIPAR y forestales y praderas (*CPUN. Considerando los resultados de los sitios y sistemas y, la forma de simulación *CIPAR, el modelo RothC se puede usar con buena aceptación para simular los cambios de COS a nivel de parcela en los sistemas agrícolas y forestales, mediana en praderas y baja en agostaderos.

  1. Human Pluripotent Stem Cells and Derived Neuroprogenitors Display Differential Degrees of Susceptibility to BH3 Mimetics ABT-263, WEHI-539 and ABT-199.

    Directory of Open Access Journals (Sweden)

    Carolina Paola García

    Full Text Available Human embryonic stem cells (hESCs are hypersensitive to genotoxic stress and display lower survival ability relative to their differentiated progeny. Herein, we attempted to investigate the source of this difference by comparing the DNA damage responses triggered by the topoisomerase I inhibitor camptothecin, in hESCs, human induced pluripotent stem cells (hiPSCs and hESCs-derived neuroprogenitors (NP. We observed that upon camptothecin exposure pluripotent stem cells underwent apoptosis more swiftly and at a higher rate than differentiated cells. However, the cellular response encompassing ataxia-telangiectasia mutated kinase activation and p53 phosphorylation both on serine 15 as well as on serine 46 resulted very similar among the aforementioned cell types. Importantly, we observed that hESCs and hiPSCs express lower levels of the anti-apoptotic protein Bcl-2 than NP. To assess whether Bcl-2 abundance could account for this differential response we treated cells with ABT-263, WEHI-539 and ABT-199, small molecules that preferentially target the BH3-binding pocket of Bcl-xL and/or Bcl-2 and reduce their ability to sequester pro-apoptotic factors. We found that in the absence of stress stimuli, NP exhibited a higher sensitivity to ABT- 263 and WEHI-539 than hESCs and hiPSCs. Conversely, all tested cell types appeared to be highly resistant to the Bcl-2 specific inhibitor, ABT-199. However, in all cases we determined that ABT-263 or WEHI-539 treatment exacerbated camptothecin-induced apoptosis. Importantly, similar responses were observed after siRNA-mediated down-regulation of Bcl-xL or Bcl-2. Taken together, our results suggest that Bcl-xL contrary to Bcl-2 contributes to ensure cell survival and also functions as a primary suppressor of DNA double-strand brake induced apoptosis both in pluripotent and derived NP cells. The emerging knowledge of the relative dependence of pluripotent and progenitor cells on Bcl-2 and Bcl-xL activities may help

  2. Alpha-1 antitrypsin deficiency caused by a novel mutation (p.Leu263Pro: Pi*ZQ0gaia – Q0gaia allele

    Directory of Open Access Journals (Sweden)

    M.J. Oliveira


    Full Text Available Severe alpha-1 antitrypsin deficiency (AATD is generally associated with PI*ZZ genotype and less often with combinations of PI*Z, PI*S, and other rarer deficiency or null (Q0 alleles. Severe AATD predisposes patients to various diseases, including pulmonary emphysema. Presented here is a case report of a young man with COPD and AATD. The investigation of the AATD showed a novel mutation p.Leu263Pro (c.860T>C, which was named Q0gaia (Pi*ZQ0gaia. Q0gaia is associated with very low or no detectable serum concentrations of AAT. Keywords: Alpha-1 antitrypsin deficiency, Null allele, COPD

  3. Expansion of the clinical phenotype of the distal 10q26.3 deletion syndrome to include ataxia and hyperemia of the hands and feet. (United States)

    Lacaria, Melanie; Srour, Myriam; Michaud, Jacques L; Doja, Asif; Miller, Elka; Schwartzentruber, Jeremy; Goldsmith, Claire; Majewski, Jacek; Boycott, Kym M


    Distal deletion of the long arm of chromosome 10 is associated with a dysmorphic craniofacial appearance, microcephaly, behavioral issues, developmental delay, intellectual disability, and ocular, urogenital, and limb abnormalities. Herein, we present clinical, molecular, and cytogenetic investigations of four patients, including two siblings, with nearly identical terminal deletions of 10q26.3, all of whom have an atypical presentation of this syndrome. Their prominent features include ataxia, mild-to-moderate intellectual disability, and hyperemia of the hands and feet, and they do not display many of the other features commonly associated with deletions of this region. These results point to a novel gene locus associated with ataxia and highlight the variability of the clinical presentation of patients with deletions of this region. © 2017 Wiley Periodicals, Inc.

  4. Direct on-strip analysis of size- and time-resolved aerosol impactor samples using laser induced fluorescence spectra excited at 263 and 351 nm

    International Nuclear Information System (INIS)

    Wang, Chuji; Pan, Yong-Le; James, Deryck; Wetmore, Alan E.; Redding, Brandon


    Highlights: • A dual wavelength UV-LIF spectra-rotating drum impactor (RDI) technique was developed. • The technique was demonstrated by direct on-strip analysis of size- and time-resolved LIF spectra of atmospheric aerosol particles. • More than 2000 LIF spectra of atmospheric aerosol particles collected over three weeks in Djibouti were obtained and assigned to various fluorescence clusters. • The LIF spectra showed size- and time-sensitivity behavior with a time resolution of 3.6 h. - Abstract: We report a novel atmospheric aerosol characterization technique, in which dual wavelength UV laser induced fluorescence (LIF) spectrometry marries an eight-stage rotating drum impactor (RDI), namely UV-LIF-RDI, to achieve size- and time-resolved analysis of aerosol particles on-strip. The UV-LIF-RDI technique measured LIF spectra via direct laser beam illumination onto the particles that were impacted on a RDI strip with a spatial resolution of 1.2 mm, equivalent to an averaged time resolution in the aerosol sampling of 3.6 h. Excited by a 263 nm or 351 nm laser, more than 2000 LIF spectra within a 3-week aerosol collection time period were obtained from the eight individual RDI strips that collected particles in eight different sizes ranging from 0.09 to 10 μm in Djibouti. Based on the known fluorescence database from atmospheric aerosols in the US, the LIF spectra obtained from the Djibouti aerosol samples were found to be dominated by fluorescence clusters 2, 5, and 8 (peaked at 330, 370, and 475 nm) when excited at 263 nm and by fluorescence clusters 1, 2, 5, and 6 (peaked at 390 and 460 nm) when excited at 351 nm. Size- and time-dependent variations of the fluorescence spectra revealed some size and time evolution behavior of organic and biological aerosols from the atmosphere in Djibouti. Moreover, this analytical technique could locate the possible sources and chemical compositions contributing to these fluorescence clusters. Advantages, limitations, and

  5. Direct on-strip analysis of size- and time-resolved aerosol impactor samples using laser induced fluorescence spectra excited at 263 and 351 nm

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Chuji [U.S. Army Research Laboratory, Adelphi, MD 20783 (United States); Mississippi State University, Starkville, MS, 39759 (United States); Pan, Yong-Le, E-mail: [U.S. Army Research Laboratory, Adelphi, MD 20783 (United States); James, Deryck; Wetmore, Alan E. [U.S. Army Research Laboratory, Adelphi, MD 20783 (United States); Redding, Brandon [Yale University, New Haven, CT 06510 (United States)


    Highlights: • A dual wavelength UV-LIF spectra-rotating drum impactor (RDI) technique was developed. • The technique was demonstrated by direct on-strip analysis of size- and time-resolved LIF spectra of atmospheric aerosol particles. • More than 2000 LIF spectra of atmospheric aerosol particles collected over three weeks in Djibouti were obtained and assigned to various fluorescence clusters. • The LIF spectra showed size- and time-sensitivity behavior with a time resolution of 3.6 h. - Abstract: We report a novel atmospheric aerosol characterization technique, in which dual wavelength UV laser induced fluorescence (LIF) spectrometry marries an eight-stage rotating drum impactor (RDI), namely UV-LIF-RDI, to achieve size- and time-resolved analysis of aerosol particles on-strip. The UV-LIF-RDI technique measured LIF spectra via direct laser beam illumination onto the particles that were impacted on a RDI strip with a spatial resolution of 1.2 mm, equivalent to an averaged time resolution in the aerosol sampling of 3.6 h. Excited by a 263 nm or 351 nm laser, more than 2000 LIF spectra within a 3-week aerosol collection time period were obtained from the eight individual RDI strips that collected particles in eight different sizes ranging from 0.09 to 10 μm in Djibouti. Based on the known fluorescence database from atmospheric aerosols in the US, the LIF spectra obtained from the Djibouti aerosol samples were found to be dominated by fluorescence clusters 2, 5, and 8 (peaked at 330, 370, and 475 nm) when excited at 263 nm and by fluorescence clusters 1, 2, 5, and 6 (peaked at 390 and 460 nm) when excited at 351 nm. Size- and time-dependent variations of the fluorescence spectra revealed some size and time evolution behavior of organic and biological aerosols from the atmosphere in Djibouti. Moreover, this analytical technique could locate the possible sources and chemical compositions contributing to these fluorescence clusters. Advantages, limitations, and

  6. Fabrication of High Transparency Diamond-Like Carbon Film Coating on D263T Glass at Room Temperature as an Antireflection Layer

    Directory of Open Access Journals (Sweden)

    Chii-Ruey Lin


    Full Text Available This study intends to deposit high transmittance diamond-like carbon (DLC thin films on D263T glass substrate at room temperature via a diamond powder target using the radio frequency (RF magnetron sputtering technique. Moreover, various process parameters were used to tune the properties of the thin films by using the Taguchi method. Experimental results show that the content of sp3 bonded carbon decreases in accordance with the effect of the substrate temperature. In addition, the hardness of all as-deposited single-layer DLC films ranges from 13.2 to 22.5 GPa, and the RMS surface roughness was improved significantly with the decrease in sputtering pressure. The water repellent of the deposited DLC films improved significantly with the increase of the sp3 content, and its contact angle was larger than that of the noncoated one by 1.45 times. Furthermore, the refraction index (n of all as-deposited DLC films ranges from 1.95 to 2.1 at λ = 600 nm. These results demonstrate that the thickness increased as the reflectance increased. DLC film under an RF power of 150 W possesses high transmissive ability (>81% and low average reflectance ability (<9.5% in the visible wavelengths (at λ = 400–700 nm.

  7. Effects of aging and sheet thickness on the room temperature deformation behavior and in-plane anisotropy of cold rolled and solution treated Nimonic C-263 alloy sheet

    Energy Technology Data Exchange (ETDEWEB)

    Ankamma, Kandula; Chandra Mohan Reddy, Gangireddy [Mahatma Ghandi Institute of Technology, Hyderabad (India). Mechanical Engineering Dept.; Singh, Ashok Kumar; Prasad, Konduri Satya [Defence Research and Development Organisation (DRDO), Hyderabad (India). Defence Metallurgical Research Lab.; Komaraiah, Methuku [Malla Reddy College of Engineering and Technology, Secunderabad (India); Eswara Prasad, Namburi [Regional Centre for Military Airworthiness (Materials), Hyderabad (India)


    The deformation behavior under uni-axial tensile loading is investigated and reported in the case of cold rolled Nimonic C-263 alloy sheet products of different thicknesses (0.5 mm and 1 mm) in the solution treated and aged conditions. The studies conducted include (i) Microstructure, (ii) X-ray diffraction, (iii) Texture and (iv) Tensile properties and inplane anisotropy in the yield behavior (both tensile yield strength and ultimate tensile strength as well as ductility). The results of the present study showed that despite the presence of weak crystallographic texture in this crystal symmetric material, the degrees of in-plane anisotropy in strength as well as plastic deformation properties are found to be significant in both solution treated and aged conditions, thus having significant technological relevance for both further processing and design purposes. Further, the influence of aging and sheet thickness on the tensile deformation behaviour is also found to be considerable. A brief discussion on the technological implications of these results is also included. (orig.)

  8. The Oswestry Disability Index, confirmatory factor analysis in a sample of 35,263 verifies a one-factor structure but practicality issues remain. (United States)

    Gabel, Charles Philip; Cuesta-Vargas, Antonio; Qian, Meihua; Vengust, Rok; Berlemann, Ulrich; Aghayev, Emin; Melloh, Markus


    To analyze the factor structure of the Oswestry Disability Index (ODI) in a large symptomatic low back pain (LBP) population using exploratory (EFA) and confirmatory factor analysis (CFA). Analysis of pooled baseline ODI LBP patient data from the international Spine Tango registry of EUROSPINE, the Spine Society of Europe. The sample, with n = 35,263 (55.2% female; age 15-99, median 59 years), included 76.1% of patients with a degenerative disease, and 23.9% of the patients with various other spinal conditions. The initial EFA provided a hypothetical construct for consideration. Subsequent CFA was considered in three scenarios: the full sample and separate genders. Models were compared empirically for best fit. The EFA indicated a one-factor solution accounting for 54% of the total variance. The CFA analysis based on the full sample confirmed this one-factor structure. Sub-group analyses by gender achieved good model fit for configural and partial metric invariance, but not scalar invariance. A possible two-construct model solution as outlined by previous researchers: dynamic-activities (personal care, lifting, walking, sex and social) and static-activities (pain, sleep, standing, travelling and sitting) was not preferred. The ODI demonstrated a one-factor structure in a large LBP sample. A potential two-factor model was considered, but not found appropriate for constructs of dynamic and static activity. The use of the single summary score for the ODI is psychometrically supported. However, practicality limitations were reported for use in the clinical and research settings. Researchers are encouraged to consider a shift towards newer, more sensitive and robustly developed instruments.

  9. Cardiovascular disease risk factor profiles of 263,356 older Australians according to region of birth and acculturation, with a focus on migrants born in Asia.

    Directory of Open Access Journals (Sweden)

    Shuyu Guo

    Full Text Available Risk factors for cardiovascular disease (CVD, such as obesity, diabetes, hypertension and physical inactivity, are common in Australia, but the prevalence varies according to cultural background. We examined the relationship between region of birth, measures of acculturation, and CVD risk profiles in immigrant, compared to Australian-born, older Australians. Cross-sectional data from 263,356 participants aged 45 and over joining the population-based 45 and Up Study cohort from 2006-2008 were used. Prevalence ratios for CVD risk factors in Australian- versus overseas-born participants were calculated using modified Poisson regression, adjusting for age, sex and socioeconomic factors and focusing on Asian migrants. The association between time resident in Australia and age at migration and CVD risk factors in Asian migrants was also examined. Migrants from Northeast (n = 3,213 and Southeast Asia (n = 3,942 had lower levels of overweight/obesity, physical activity and female smoking than Australian-born participants (n = 199,356, although differences in prevalence of overweight/obesity were sensitive to body-mass-index cut-offs used. Compared to Australian-born participants, migrants from Northeast Asia were 20-30% less likely, and from Southeast Asia 10-20% more likely, to report being treated for hypertension and/or hypercholesterolaemia; Southeast Asian migrants were 40-60% more likely to report diabetes. Northeast Asian-born individuals were less likely than Australian-born to have 3 or more CVD risk factors. Diabetes, treated hypertension and hypercholesterolaemia occurred at relatively low average body-mass-index in Southeast Asian migrants. The CVD risk factor profiles of migrants tended to approximate those of Australian-born with increasing acculturation, in both favourable (e.g., increased physical activity and unfavourable directions (e.g., increased female smoking. Minimizing CVD risk in migrant populations may be achieved through

  10. Influence of synthesis route and composition on electrical properties of La{sub 9.33+x}Si{sub 6}O{sub 26+3x/2} oxy-apatite compounds

    Energy Technology Data Exchange (ETDEWEB)

    Chesnaud, A.; Dezanneau, G.; Bogicevic, C.; Karolak, F.; Geneste, G. [Laboratoire Structure Proprietes et Modelisation des Solides, Ecole Centrale Paris, Grande Voie des Vignes, 92295, Chatenay-Malabry Cedex (France); Estournes, C. [CIRIMAT et Plateforme Nationale de Frittage Flash du CNRS (PNF2-MHT-UPS), Universite Paul-Sabatier, 118 Route de Narbonne, 31062, Toulouse (France); Geiger, S. [Laboratoire Structure Proprietes et Modelisation des Solides, Ecole Centrale Paris, Grande Voie des Vignes, 92295, Chatenay-Malabry Cedex (France)]|[Faculte de Pharmacie, Universite Paris-Sud, 5 Rue J-B Clement, 92296, Chatenay-Malabry (France)


    Oxy-apatite materials La{sub 9.33+x}Si{sub 6}O{sub 26+3x/2} are thought as zirconia-substitutes in Solid Oxide Fuel Cells due to their fast ionic conduction. However, the well-known difficulties related to their densification prevent them from being used as such. This paper presents strategies to obtain oxy-apatite dense materials. First, freeze-drying has been optimized to obtain ultrafine and very homogeneous La{sub 9.33+x}Si{sub 6}O{sub 26+3x/2} (0{<=}x{<=}0.67) nanopowders. From these powders, conventional and Spark Plasma Sintering (SPS) have been used leading to very dense samples obtained at temperatures rather lower than those previously reported. For instance, SPS has allowed to prepare fully dense and transparent ceramics from 1200 C under 100 MPa. The microstructure and transport properties of such samples have been then evaluated as a function of sintering conditions and lanthanum content. It will be show that for lanthanum content higher than 9.60 per unit formula, the parasitic phase La{sub 2}SiO{sub 5} appears leading to a degradation of conduction properties. We also show that grain boundaries and porosity (for conventionally-sintered materials) seem to have blocking effects on oxygen transport. The highest overall conductivity values at 700 C, i.e. {sigma}{sub 700{sub C}} = 7.33.10{sup -3} S cm{sup -1}, were measured for La{sub 9.33}Si{sub 6}O{sub 26} material conventionally-sintered at 1500 C which contains bigger grains' size by comparison with {sigma}{sub 700{sub C}} = 4.77.10{sup -3} S cm{sup -1} for SPS-sintered materials at the same temperature but for few minutes. These values are associated with activation energies close to 0.83-0.91 eV, regardless of sintering condition, which are commonly encountered for anionic conductivity into such materials. (author)

  11. 29 CFR 1910.263 - Bakery equipment. (United States)


    ... all delivery ends of conveyors, wherever manual removal of the product carried is practiced. (iii... section, and (ii) for venting products of combustion from the combustion chamber used to heat the fat. (23... Hazards of Sugar and Cocoa) and NFPA 656—1959 (Standard for Dust Hazards in Spice Grinding Plants), which...

  12. 12 CFR 263.401 - Definitions. (United States)


    ... be performed by an independent public accountant by section 36 of the FDIA and 12 CFR part 363... insured subsidiary bank of that holding company. (d) Independent public accountant (accountant) means any... PRACTICE FOR HEARINGS Removal, Suspension, and Debarment of Accountants From Performing Audit Services...

  13. 12 CFR 263.92 - Definitions. (United States)


    ... Columbia. (d) Accountant means any individual who is duly qualified to practice as a certified public accountant or a public accountant in any state, possession, territory, commonwealth, or the District of..., opinion or other paper or document by an attorney, accountant, or other licensed professional which is...

  14. Publications | Page 263 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    In Conversation: Celia Reyes on the importance of timely economic information. Asia is the largest developing region in the world both in terms of land mass and population. More than 70 % of the people in the developing world live in Asia. Over the past three decades the region has created.

  15. No. 263-Maternity Leave in Normal Pregnancy. (United States)

    Leduc, Dean


    To assist maternity care providers in recognizing and discussing health- and illness-related issues in pregnancy and their relationship to maternity benefits. Published literature was retrieved through searches of PubMed or Medline, CINAHL, and The Cochrane Library in 2009 using appropriate controlled vocabulary (e.g., maternity benefits) and key words (e.g., maternity, benefits, pregnancy). Results were restricted to systematic reviews, randomized controlled trials/controlled clinical trials, and observational studies. There were no date or language restrictions. Searches were updated on a regular basis and incorporated in the guideline to December 2009. Grey (unpublished) literature was identified through searching the web sites of health technology assessment and health technology assessment-related agencies, clinical practice guideline collections, clinical trial registries, and national and international medical specialty societies. Copyright © 2017. Published by Elsevier Inc.

  16. Publications | Page 263 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. ... Francisco Manyanga Secondary School in Maputo, Mozambique, she is responsible for the 7000 students, 210 teachers, and 64 support staff who walk through the front doors of her.

  17. 33 CFR 263.15 - Program policies. (United States)


    ... personal attention of the Chief of Engineers, the Director of Civil Works is authorized to approve or... accomplished by the Director of Civil Works, for the Chief of Engineers. ... costs of investigations, planning, design and construction, to include those incurred prior to...

  18. 10 CFR 26.3 - Scope. (United States)


    ... corporation, firm, partnership, limited liability company, association, or other organization who obtains a... a limited work authorization under § 50.10(e), if the limited work authorization authorizes the... structures, systems, and components (SSCs) under the limited work authorization; (2) Combined license holders...

  19. 26 CFR 1.263A-7 - Changing a method of accounting under section 263A. (United States)


    ... multiple changes in method of accounting occur in the year of change—(A) In general. A change in method of... decrement in an inventory pool occurs, layers accumulated in more recent years must be viewed as invaded...

  20. 12 CFR 263.403 - Automatic removal, suspension, and debarment. (United States)


    ... independent public accountant or accounting firm may not perform audit services for banking organizations if... permission to such accountant or firm to perform audit services for banking organizations. The request shall... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Automatic removal, suspension, and debarment...

  1. BKR 26(3) pp. 88-93 (Akachukwu)

    African Journals Online (AJOL)

    Femi Olorunniji


    Sep 30, 2014 ... urea concentrations were also significantly (p<0.05) increased in the test group. Histological .... synthesis of prostaglandins that regulate the contraction and .... Taussky HH (1961) Creatinine and creatinine in urine and serum.

  2. 12 CFR 263.35 - Conduct of hearings. (United States)


    ...) General rules. (1) Hearings shall be conducted so as to provide a fair and expeditious presentation of the..., respondents may agree among themselves as to their order of presentation of their cases, but if they do not...

  3. 34 CFR 263.8 - What are the payback requirements? (United States)


    ... participant performs. (Approved by the Office of Management and Budget under control number 1810-0580... for which training was actually received under the Professional Development program. (c) The cash...

  4. 40 CFR 263.20 - The manifest system. (United States)


    ... person if he knows the shipment does not conform to the EPA Acknowledgment of Consent; and unless, in... without a tracking document that includes all information required by 40 CFR 262.84. (3) Compliance Date... designated facility on either the manifest or the shipping paper; and (4) The person delivering the hazardous...

  5. 17 CFR 230.263 - Consent to Service of Process. (United States)


    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Consent to Service of Process... Consent to Service of Process. (a) If the issuer is not organized under the laws of any of the states of... [§ 239.42 of this chapter]. (b) Any change to the name or address of the agent for service of the issuer...

  6. 12 CFR 263.17 - Collateral attacks on adjudicatory proceeding. (United States)


    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Collateral attacks on adjudicatory proceeding... Collateral attacks on adjudicatory proceeding. If an interlocutory appeal or collateral attack is brought in... shall be excused based on the pendency before any court of any interlocutory appeal or collateral attack. ...

  7. BKR 26(3) pp. 76-84 (Adeyanju)

    African Journals Online (AJOL)

    Femi Olorunniji


    Sep 30, 2014 ... protein source had been established by various researchers. [(Stafford & Tacon, 1988 ... rhodanese enzyme is defined as the amount of enzyme which produces an optical ... levels of purification were determined by Biuret method. (Gornall et al., 1949) using bovine serum albumin as standard. Enzyme ...

  8. BKR 26(3) pp. 85-87 (Osadolor)

    African Journals Online (AJOL)

    Femi Olorunniji


    Sep 30, 2014 ... pancreatic beta cells in culture (Bayazit, 2004). While extensive ... toxicity to the animals. However ... be used for the treatment of chronic diabetes since it effect takes a longer time. ... Metabolism 22: 1289–1290. Gamaneil KS ...

  9. 12 CFR 263.93 - Eligibility to practice. (United States)


    ... debarment pursuant to this subpart may practice before the Board. (b) Accountants. Any accountant who is qualified to practice as a certified public accountant or public accountant and is not currently under...

  10. 263 The Decalogue and Igbo Traditional Ethics: Essential Values for ...

    African Journals Online (AJOL)

    Decalogue and Igbo traditional morality provide a sense of direction for the Jews and the ... its owners, and this explains the principle of cultural interactions. Cultures therefore .... A religious concept that is very important in Igbo morality is Ala. (The Earth ... individual self-seeking relativism in ethical considerations. As long.

  11. 38 CFR 3.263 - Corpus of estate; net worth. (United States)


    ... outlined in § 3.262(l) for the claimant and his or her dependents. (e) Agent Orange settlement payments... Agent Orange Settlement Fund or any other fund established pursuant to the settlement in the In re Agent Orange product liability litigation, M.D.L. No. 381 (E.D.N.Y.). (January 1, 1989) (Authority: Pub. L. 101...

  12. 12 CFR 263.103 - Eligibility of applicants. (United States)


    ... will be presumed to have been made for this purpose. (3) The net worth of a financial institution shall... guidelines on the financial institution's financial report to its supervisory agency for the last reporting....103 Eligibility of applicants. (a) General rule. To be eligible for an award under this subpart, an...

  13. BKR 26(3) pp. 94-98 (Yousuf)

    African Journals Online (AJOL)

    Femi Olorunniji


    Sep 30, 2014 ... Microbial Populations and Serum Parameters in Sheep ... A locally synthesized transition metal complex, cobalt-lumefantrine was assessed through laboratory .... Data were analyzed by General Linear Model of SAS using.

  14. 33 CFR 263.17 - Planning, design and construction procedures. (United States)


    ... accounting of expenditure of study funds, and the amount of funds to be returned to OCE. Release of... feasibility study, and as such, will provide reporting offices with appropriate guidance on submission of a..., requirements of local cooperation are to be stated in the agreement verbatim from the approved project document...

  15. 40 CFR 98.263 - Calculating GHG emissions. (United States)


    ... this part (General Stationary Fuel Combustion Sources). (b) Calculate and report under this subpart the... phosphate rock by origin i obtained during month n, from the carbon analysis results (percent by weight, expressed as a decimal fraction). Pn,i = Mass of phosphate rock by origin i consumed in month n by wet...

  16. All projects related to | Page 263 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Criminality and Violence in Latin America: a Comparative Perspective between Mexico, Colombia and Brazil. Project. This project will examine the dynamics of crime, violence and drug trafficking in urban centres in three Latin American countries: Brazil (Rio de Janeiro); Colombia (Medellín and Bogotá); and Mexico ...

  17. Dicty_cDB: VHK263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kd*snnlvagsfrsfpqdswssilvpsckdnd*qfrgrnals*fsnservgiilihligf *n*iahvq*kigalsgpflvsrtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevg ir*gvcnns...swssilvpsckdnd*qfrgrnals*fsnservgiilihligf *n*iahvq*kigalsgpflvsrtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevg ir*gvcnns

  18. 33 CFR Appendix B to Part 263 - Application of Multiobjective Planning Framework to Continuing Authorities Program (United States)


    ... to analyze the need for a project, to develop sketch plans, discuss views and capabilities of local interests, and identify the economy of the potential project area and possible environmental issues that... estimated cost of the study. The latter identification process can be developed as a Plan of Study for the...

  19. 26 CFR 1.263(b)-1 - Expenditures for advertising or promotion of good will. (United States)


    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Expenditures for advertising or promotion of... advertising or promotion of good will. See § 1.162-14 for the rules applicable to a corporation which has elected to capitalize expenditures for advertising or the promotion of good will under the provisions of...

  20. 26 CFR 1.263A-8 - Requirement to capitalize interest. (United States)


    ...) Timber and evergreen trees that are more than 6 years old when severed from the roots, or (ii) Property..., fences, inherently permanent advertising displays, inherently permanent outdoor lighting facilities...

  1. E331 TP HF RW O3 SHC2.63 SCID: A-bvqk (United States)

    U.S. Environmental Protection Agency — Data for differing physiological measures of dams on high fat or control diet with/without exercise and physiological effects on male and female offspring. This...

  2. People and things. CERN Courier, Apr 1986, v. 26(3)

    International Nuclear Information System (INIS)



    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. A Summer Study to be held in Snowmass, Colorado, from 23 June to 11 July will allow the US particle physics community to critically evaluate all aspects of the proposed US Superconducting Super Collider (SSC) in the light of conceptual design, progress in accelerator technology, new developments in collider physics, and innovations in instrumentation. Organized jointly by the European Committee for Future Accelerators (ECFA) and the Rheinisch-Westfälische Technische Hochschule in Aachen, a 'LEP 200' Workshop is being arranged from 29 September to 1 October to work out the physics objectives and experimental requirements for running LEP at around 100 GeV per beam. A four-day practical course on microelectronics is being hosted by CERN and the International School of Geneva

  3. People and things. CERN Courier, Apr 1986, v. 26(3)

    Energy Technology Data Exchange (ETDEWEB)



    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. A Summer Study to be held in Snowmass, Colorado, from 23 June to 11 July will allow the US particle physics community to critically evaluate all aspects of the proposed US Superconducting Super Collider (SSC) in the light of conceptual design, progress in accelerator technology, new developments in collider physics, and innovations in instrumentation. Organized jointly by the European Committee for Future Accelerators (ECFA) and the Rheinisch-Westfälische Technische Hochschule in Aachen, a 'LEP 200' Workshop is being arranged from 29 September to 1 October to work out the physics objectives and experimental requirements for running LEP at around 100 GeV per beam. A four-day practical course on microelectronics is being hosted by CERN and the International School of Geneva.

  4. 34 CFR 263.10 - What are the payback reporting requirements? (United States)


    ... for payments. (Approved by the Office of Management and Budget under control number 1810-0580... notice of intent to complete a work-related or cash payback, or to continue in a degree program as a full..., but cannot complete, a work-related payback, the payback reverts to a cash payback that is prorated...

  5. 12 CFR 263.303 - Filing of safety and soundness compliance plan. (United States)


    ... member bank will take to correct the deficiency and the time within which those steps will be taken. (c... FEDERAL RESERVE SYSTEM RULES OF PRACTICE FOR HEARINGS Submission and Review of Safety and Soundness... safety and soundness compliance plan. (a) Schedule for filing compliance plan—(1) In general. A State...

  6. 26 CFR 1.263(a)-4 - Amounts paid to acquire or create intangibles. (United States)


    ... walls, elevators, power generation and transmission facilities, and pollution control facilities. (iv... providing wireless telecommunications services to customers. To induce customer B to enter into a 3-year non-cancelable telecommunications contract, X provides B with a free wireless telephone. The fair market value of...

  7. 34 CFR 263.5 - What priority is given to certain projects and applicants? (United States)


    ... enables these individuals to meet the requirements for full State certification or licensure as a teacher... for full State certification or licensure as a teacher. (2) Pre-service administrator training. This... eligible applicants that includes a tribal college or university and that designates that tribal college or...

  8. E331 Behavior TP HF RW O3 SHC2.63 (United States)

    U.S. Environmental Protection Agency — Human and animal studies indicate that maternal obesity can negatively impact aspects of metabolism and neurodevelopment in the offspring. Not known, however, is...

  9. 49 CFR 26.3 - To whom does this part apply? (United States)


    ... Transportation Office of the Secretary of Transportation PARTICIPATION BY DISADVANTAGED BUSINESS ENTERPRISES IN... funds authorized by Titles I, III, V and VI of ISTEA, Pub. L. 102-240 or by Federal transit laws in... authorized by 49 U.S.C. 47101, et seq. (b) [Reserved] (c) If you are letting a contract, and that contract is...

  10. 34 CFR 263.6 - How does the Secretary evaluate applications for the Professional Development program? (United States)


    ... the quality of the design of the proposed project: (1) The extent to which the goals, objectives, and... following factors: (1) The relevance and demonstrated commitment of each partner in the proposed project to...) Quality of the management plan (15) points. In determining the quality of the management plan for the...

  11. 34 CFR 263.21 - What priority is given to certain projects and applicants? (United States)


    ... notice published in the Federal Register. (1) School readiness projects that provide age appropriate educational programs and language skills to three- and four-year-old Indian students to prepare them for..., including family-based preschool programs, emphasizing school readiness and parental skills. (3) College...

  12. 263: zero energy renovation of Nemavo-Airey dwellings : a ventilation concept based on occupant behaviour

    NARCIS (Netherlands)

    Oerlemans, L.J.; Ham, M.


    In the Netherlands, the large demand for new housing after the Second World War was partly solved by using alternative building methods. The Nemavo-Airey system was one of these methods. Even though regarded modern and spacious at the time, these houses are now considered small, uncomfortable and

  13. 26 CFR 1.263A-9 - The avoided cost method. (United States)


    ... calculating averages, and for determining measurement dates within the computation period. Special rules are... purposes, regardless of the extent to which the taxpayer's applicable financial accounting or other... measurement period (as defined in paragraph (f)(2)(ii) of this section) that ends on a measurement date...

  14. : tous les projets | Page 263 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    End Date: 28 avril 2015. Sujet: RELIGIOUS DISCRIMINATION, RELIGIOUS MINORITIES, ETHNIC MINORITIES, HUMAN RIGHTS, VIOLENCE, ADMINISTRATION OF JUSTICE, COMPENSATION. Région: India, Central Asia, Far East Asia, South Asia. Programme: Gouvernance et justice. Financement total : CA$ 320,000.00.

  15. 78 FR 263 - Safety Zones; TEMCO Grain Facilities; Columbia and Willamette Rivers (United States)


    ...'01'' W. In essence, these boundaries extend from the shoreline of the facility 150 yards onto the...'' N/122-40'28'' W. In essence, these boundaries extend from the shoreline of the facility 150 yards... criminal laws of the United States. (2) Navigable waters of the United States means those waters defined as...

  16. 26 CFR 1.263A-1 - Uniform capitalization of costs. (United States)


    ... costs include costs attributable to processing, assembling, repackaging and transporting goods, and... automation or changes in operation or prices, is not a change in method of accounting under section 446(e). A... standard costs that merely reflects current operating conditions, such as increases in automation or...

  17. 26 CFR 1.263A-3 - Rules relating to property acquired for resale. (United States)


    ... activities is based upon the activities performed by that person and not upon the person's title or job classification. Thus, for example, although an employee's job function may be described in such a way as to... routinely shop to select specific items of merchandise; and (iv) Which are adjacent to or in immediate...

  18. SU-E-J-263: Repeatability of SUV and Texture Parameters in Serial PET Studies

    Energy Technology Data Exchange (ETDEWEB)

    Schwartz, J; Humm, J; Nehmeh, S; Schoder, H [Memorial Sloan-Kettering Cancer Center, New York, NY (United States)


    Purpose: Standardized uptake values (SUV) are standard quantitative PET measures of FDG tumor uptake used,and are used as a tool to monitor response to therapy. Textural analysis is emerging as a new tool for assessing intratumoral heterogeneity which may allow better tissue characterization and improved prediction of response and survival rate.Understanding what variations may be expected in these parameters is key in order to make decisions based on how the change throughout the course of treatment. The aim of this study was to assess repeatability in SUV measures and texture parameters,and establish criteria that differentiate changes associated with treatment rather than statistical variability. Methods: Eighty patients,167 random lesions total,were scanned in a GE Discovery STE PET/CT Scanner. One field-of-view was chosen centered on the largest lesion observed in a clinical whole-body FDG PET.Immediately following,a gated 9 min scan was acquired in list mode,without changing the patient’s position between any scans. Data was replayed into 3 time bins,3 min each,in order to insure equivalent noise characteristics in each replicate.Data was reconstructed into 128×128×47 square matrices.One VOI was drawn over each lesion for each patient and used to segment all 3 replicates. The mean.max and peak SUV were calculated for each VOI and replicate. First-order textural features were also calculated (skewness and kurtosis). Repeatability was calculated as the average standard deviation over the mean for the 3 repeated measurements for each lesion. Results: The average percent error in the SUV max,peak and mean were 3.4%(0– 12.9%),1.9% (0–7.5%),2.8% (0–12.2%),respectively.For skewness and kurtosis they were 10.9% and 17.8%. Conclusion: We have shown that there is a large variation in %error in SUV measures across patients. SUVpeak is the least variable and kurtosis and skewness parameters are less reliable thatn SUVs.Higher order textures are be.

  19. 45 CFR 263.0 - What definitions apply to this part? (United States)


    ... projects; (v) Fraud and abuse units; (vi) Procurement activities; (vii) Public relations; (viii) Services related to accounting, litigation, audits, management of property, payroll, and personnel; (ix) Costs for...

  20. SU-E-J-263: Repeatability of SUV and Texture Parameters in Serial PET Studies

    International Nuclear Information System (INIS)

    Schwartz, J; Humm, J; Nehmeh, S; Schoder, H


    Purpose: Standardized uptake values (SUV) are standard quantitative PET measures of FDG tumor uptake used,and are used as a tool to monitor response to therapy. Textural analysis is emerging as a new tool for assessing intratumoral heterogeneity which may allow better tissue characterization and improved prediction of response and survival rate.Understanding what variations may be expected in these parameters is key in order to make decisions based on how the change throughout the course of treatment. The aim of this study was to assess repeatability in SUV measures and texture parameters,and establish criteria that differentiate changes associated with treatment rather than statistical variability. Methods: Eighty patients,167 random lesions total,were scanned in a GE Discovery STE PET/CT Scanner. One field-of-view was chosen centered on the largest lesion observed in a clinical whole-body FDG PET.Immediately following,a gated 9 min scan was acquired in list mode,without changing the patient’s position between any scans. Data was replayed into 3 time bins,3 min each,in order to insure equivalent noise characteristics in each replicate.Data was reconstructed into 128×128×47 square matrices.One VOI was drawn over each lesion for each patient and used to segment all 3 replicates. The mean.max and peak SUV were calculated for each VOI and replicate. First-order textural features were also calculated (skewness and kurtosis). Repeatability was calculated as the average standard deviation over the mean for the 3 repeated measurements for each lesion. Results: The average percent error in the SUV max,peak and mean were 3.4%(0– 12.9%),1.9% (0–7.5%),2.8% (0–12.2%),respectively.For skewness and kurtosis they were 10.9% and 17.8%. Conclusion: We have shown that there is a large variation in %error in SUV measures across patients. SUVpeak is the least variable and kurtosis and skewness parameters are less reliable thatn SUVs.Higher order textures are be

  1. Nuclear Technology. Course 26: Nondestructive Examination (NDE) Techniques I. Module 26-3, Hydrostatic Tests. (United States)

    Pelton, Rick; Espy, John

    This third in a series of seven modules for a course titled Nondestructive Examination (NDE) Techniques I describes the principles and practices associated with hydrostatic testing. The module follows a typical format that includes the following sections: (1) introduction, (2) module prerequisites, (3) objectives, (4) notes to instructor/student,…

  2. 26 CFR 1.263A-4 - Rules for property produced in a farming business. (United States)


    ... the end of 7 months, Farmer B takes possession of the plants and plants them in the permanent orchard...): Example 1. Farmer A grows trees that have a preproductive period in excess of 2 years, and that produce an annual crop. Farmer A is not required by section 447 to use an accrual method or prohibited by section...

  3. 40 CFR 52.263 - Priority treatment for buses and carpools-Los Angeles Region. (United States)


    ... converted from existing lanes. (3) “Preferential treatment” for any class of vehicles, means either the.../carpool lanes: (1) Contraflow lane on the Golden State Freeway (I-5) from junction of Ventura Freeway...” means a vehicle containing three or more persons. (2) “Bus/carpool lane” means a lane on a street or...

  4. 45 CFR 263.20 - What definitions apply to Individual Development Accounts (IDAs)? (United States)


    ... Carl D. Perkins Vocational and Applied Technology Education Act (20 U.S.C. 2471(4)) that is in any... in any Federal means-tested programs. Post-secondary educational expenses means a student's tuition and fees required for the enrollment or attendance at an eligible educational institution, and...

  5. 34 CFR 263.3 - What definitions apply to the Professional Development program? (United States)


    ... load; and (3) Is not employed for more than 20 hours a week. Good standing means a cumulative grade point average of at least 2.0 on a 4.0 grade point scale in which failing grades are computed as part of the average, or another appropriate standard established by the institution. Graduate degree means a...

  6. 77 FR 263 - Certain Cut-To-Length Carbon-Quality Steel Plate From Italy and Japan: Revocation of Antidumping... (United States)


    ... physical description, and in which the chemistry quantities do not equal or exceed any one of the levels...- alloying levels of elements such as chromium, copper, niobium, titanium, vanadium, and molybdenum. Steel....3000, 7210.90.9000, 7211.13.0000, 7211.14.0030, 7211.14.0045, 7211.90.0000, 7212.40.1000, 7212.40.5000...

  7. SU-F-T-263: Dosimetric Characteristics of the Cine Acquisition Mode of An A-Si EPID

    Energy Technology Data Exchange (ETDEWEB)

    Bawazeer, O; Deb, P [RMIT University, Melbourne, VIC (Australia); Sarasanandarajah, S [Peter MacCallum Cancer Institute, Melbourne, Victoria (Australia); Herath, S; Kron, T [Peter MacCallum Cancer Institute, Melbourne, VIC (Australia)


    Purpose: To investigate the dosimetric characteristics of Varian a-Si-500 electronic portal imaging device (EPID) operated in cine mode particularly considering linearity with delivered dose, dose rate, field size, phantom thickness, MLC speed and common IMRT fields. Methods: The EPID that attached to a Varian Clinac 21iX linear accelerator, was irradiated with 6 and 18 MV using 600 MU/min. Image acquisition is controlled by the IAS3 software, Trigger delay was 6 ms, BeamOnDelay and FrameStartDelay were zero. Different frame rates were utilized. Cine mode response was calculated using MATLAB as summation of mean pixel values in a region of interest of the acquired images. The performance of cine mode was compared to integrated mode and dose measurements in water using CC13 ionization chamber. Results: Figure1 illustrates that cine mode has nonlinear response for small MU, when delivering 10 MU was about 0.5 and 0.64 for 6 and 18 MV respectively. This is because the missing acquired images that were calculated around four images missing in each delivery. With the increase MU the response became linear and comparable with integrated mode and ionization chamber within 2%. Figure 2 shows that cine mode has comparable response with integrated mode and ionization chamber within 2% with changing dose rate for 10 MU delivered. This indicates that the dose rate change has no effect on nonlinearity of cine mode response. Except nonlinearity, cine mode is well matched to integrated mode response within 2% for field size, phantom thickness, MLC speed dependences. Conclusion: Cine mode has similar dosimetric characteristics to integrated mode with open and IMRT fields, and the main limitation with cine mode is missing images. Therefore, the calibration of EPID images with this mode should be run with large MU, and when IMRT verification field has low MU, the correction for missing images are required.

  8. SU-F-T-263: Dosimetric Characteristics of the Cine Acquisition Mode of An A-Si EPID

    International Nuclear Information System (INIS)

    Bawazeer, O; Deb, P; Sarasanandarajah, S; Herath, S; Kron, T


    Purpose: To investigate the dosimetric characteristics of Varian a-Si-500 electronic portal imaging device (EPID) operated in cine mode particularly considering linearity with delivered dose, dose rate, field size, phantom thickness, MLC speed and common IMRT fields. Methods: The EPID that attached to a Varian Clinac 21iX linear accelerator, was irradiated with 6 and 18 MV using 600 MU/min. Image acquisition is controlled by the IAS3 software, Trigger delay was 6 ms, BeamOnDelay and FrameStartDelay were zero. Different frame rates were utilized. Cine mode response was calculated using MATLAB as summation of mean pixel values in a region of interest of the acquired images. The performance of cine mode was compared to integrated mode and dose measurements in water using CC13 ionization chamber. Results: Figure1 illustrates that cine mode has nonlinear response for small MU, when delivering 10 MU was about 0.5 and 0.64 for 6 and 18 MV respectively. This is because the missing acquired images that were calculated around four images missing in each delivery. With the increase MU the response became linear and comparable with integrated mode and ionization chamber within 2%. Figure 2 shows that cine mode has comparable response with integrated mode and ionization chamber within 2% with changing dose rate for 10 MU delivered. This indicates that the dose rate change has no effect on nonlinearity of cine mode response. Except nonlinearity, cine mode is well matched to integrated mode response within 2% for field size, phantom thickness, MLC speed dependences. Conclusion: Cine mode has similar dosimetric characteristics to integrated mode with open and IMRT fields, and the main limitation with cine mode is missing images. Therefore, the calibration of EPID images with this mode should be run with large MU, and when IMRT verification field has low MU, the correction for missing images are required.

  9. 33 CFR 263.25 - Authority for emergency streambank and shoreline protection of public works and nonprofit public... (United States)


    ..., important access routes to other communities and adjacent settlements, and roads designated as primary farm... interests supplement the Federal funds, so that combined Federal and local efforts will produce a complete... Environmental Quality objectives. (c) Legislative interpretations. (1) “Public Works” are considered to be those...

  10. AFSC/RACE/EcoFOCI: 2011 Gulf of Alaska IERP Cruise TN263/1TT11 (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A total of 105 stations were occupied. There were two sample grids (southeast Alaska and Yakutat Bay) and two transects in the vicinity of Kayak Island. At each...

  11. Interchromosomal insertional translocation at Xq26.3 alters SOX3 expression in an individual with XX male sex reversal. (United States)

    Haines, Bryan; Hughes, James; Corbett, Mark; Shaw, Marie; Innes, Josie; Patel, Leena; Gecz, Jozef; Clayton-Smith, Jill; Thomas, Paul


    46,XX male sex reversal occurs in approximately 1: 20 000 live births and is most commonly caused by interchromosomal translocations of the Y-linked sex-determining gene, SRY. Rearrangements of the closely related SOX3 gene on the X chromosome are also associated with 46,XX male sex reversal. It has been hypothesized that sex reversal in the latter is caused by ectopic expression of SOX3 in the developing urogenital ridge where it triggers male development by acting as an analog of SRY. However, altered regulation of SOX3 in individuals with XX male sex reversal has not been demonstrated. Here we report a boy with SRY-negative XX male sex reversal who was diagnosed at birth with a small phallus, mixed gonads, and borderline-normal T. Molecular characterization of the affected individual was performed using array comparative genomic hybridization, fluorescent in situ hybridization of metaphase chromosomes, whole-genome sequencing, and RT-PCR expression analysis of lymphoblast cell lines. The affected male carries ∼774-kb insertion translocation from chromosome 1 into a human-specific palindromic sequence 82 kb distal to SOX3. Importantly, robust SOX3 expression was identified in cells derived from the affected individual but not from control XX or XY cells, indicating that the translocation has a direct effect on SOX3 regulation. This is the first demonstration of altered SOX3 expression in an individual with XX male sex reversal and suggests that SOX3 can substitute for SRY to initiate male development in humans.

  12. Comparison of environmental risk factors for esophageal atresia, anorectal malformations, and the combined phenotype in 263 German families. (United States)

    Zwink, N; Choinitzki, V; Baudisch, F; Hölscher, A; Boemers, T M; Turial, S; Kurz, R; Heydweiller, A; Keppler, K; Müller, A; Bagci, S; Pauly, M; Brokmeier, U; Leutner, A; Degenhardt, P; Schmiedeke, E; Märzheuser, S; Grasshoff-Derr, S; Holland-Cunz, S; Palta, M; Schäfer, M; Ure, B M; Lacher, M; Nöthen, M M; Schumacher, J; Jenetzky, E; Reutter, H


    Esophageal atresia with or without tracheoesophageal fistula (EA/TEF) and anorectal malformations (ARM) represent the severe ends of the fore- and hindgut malformation spectra. Previous research suggests that environmental factors are implicated in their etiology. These risk factors might indicate the influence of specific etiological mechanisms on distinct developmental processes (e.g. fore- vs. hindgut malformation). The present study compared environmental factors in patients with isolated EA/TEF, isolated ARM, and the combined phenotype during the periconceptional period and the first trimester of pregnancy in order to investigate the hypothesis that fore- and hindgut malformations involve differing environmental factors. Patients with isolated EA/TEF (n = 98), isolated ARM (n = 123), and the combined phenotype (n = 42) were included. Families were recruited within the context of two German multicenter studies of the genetic and environmental causes of EA/TEF (great consortium) and ARM (CURE-Net). Exposures of interest were ascertained using an epidemiological questionnaire. Chi-square, Fisher's exact, and Mann-Whitney U-tests were used to assess differences between the three phenotypes. Newborns with isolated EA/TEF and the combined phenotype had significantly lower birth weights than newborns with isolated ARM (P = 0.001 and P studies. © 2015 International Society for Diseases of the Esophagus.

  13. 40 CFR 421.263 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the... (United States)


    ... for any 1 day Maximum for monthly average mg/troy ounce of precious metals, including silver.../troy ounce of precious metals in the granulated raw material Copper 0.819 0.390 Cyanide (total) 0.128 0... Maximum for monthly average mg/troy ounce of gold produced by cyanide stripping Copper 4.736 2.257 Cyanide...

  14. 76 FR 4250 - Operating Certain Railroad Tank Cars in Excess of 263,000 Pounds Gross Rail Load; Approval (United States)


    ..., thicknesses, materials of construction, and working pressures were as follows: Working Tank car specification..., wheels, draft systems, springs and trucks. S-259, however, does not allow for the free interchange among...-jacketed tank cars constructed with ASTM 516-70 steel and having only the minimum plate thickness required...

  15. 45 CFR 263.2 - What kinds of State expenditures count toward meeting a State's basic MOE expenditure requirement? (United States)


    ...) Cash assistance, including the State's share of the assigned child support collection that is... technology and computerization needed for tracking or monitoring required by or under part IV-A of the Act do... used for tracking and monitoring. (B) It also covers the costs of contracts for the development...

  16. The 26.3-h orbit and multiwavelength properties of the `redback' millisecond pulsar PSR J1306-40 (United States)

    Linares, Manuel


    We present the discovery of the variable optical and X-ray counterparts to the radio millisecond pulsar (MSP) PSR J1306-40, recently discovered by Keane et al. We find that both the optical and X-ray fluxes are modulated with the same period, which allows us to measure for the first time the orbital period Porb = 1.097 16[6] d. The optical properties are consistent with a main-sequence companion with spectral type G to mid K and, together with the X-ray luminosity (8.8 × 1031 erg s-1 in the 0.5-10 keV band, for a distance of 1.2 kpc), confirm the redback classification of this pulsar. Our results establish the binary nature of PSR J1306-40, which has the longest Porb among all known compact binary MSPs in the Galactic disc. We briefly discuss these findings in the context of irradiation and intrabinary shock emission in compact binary MSPs.

  17. Physical modeling of triple near-Earth Asteroid (153591) 2001 SN263 from radar and optical light curve observations

    Czech Academy of Sciences Publication Activity Database

    Becker, T.M.; Howell, E. S.; Nolan, M. C.; Magri, C.; Pravec, Petr; Taylor, P.A.; Oey, J.; Higgins, D.; Világi, J.; Kornoš, L.; Galád, A.; Gajdoš, Š.; Gaftonyuk, N. M.; Krugly, Yu. N.; Molotov, I.E.; Hicks, M. D.; Carbognani, A.; Warner, B. D.; Vachier, F.; Marchis, F.; Pollock, J.


    Roč. 248, March (2015), s. 499-515 ISSN 0019-1035 R&D Projects: GA ČR GAP209/12/0229 Grant - others:SAV(SK) Vega1/0670/13 Institutional support: RVO:67985815 Keywords : asteroids * near- Earth objects * satellites of asteroids Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.383, year: 2015

  18. Evidence for the formation of sodium hassate(VIII)

    International Nuclear Information System (INIS)

    Zweidorf, A. von; Angert, R.; Bruechle, W.; Buerger, S.; Eberhardt, K.; Eichler, R.; Hummrich, H.; Jaeger, E.; Kling, H.O.; Kratz, J.V.; Kuczewski, B.; Langrock, G.; Mendel, M.; Rieth, U.; Schaedel, M.; Schausten, B.; Schimpf, E.; Thoerle, P.; Trautmann, N.; Tsukada, K.; Wiehl, N.; Wirth, G.


    Hassium, element 108, was produced in the fusion reaction between 26 Mg and 248 Cm. The hassium recoils were oxidized in-situ to a highly volatile oxide, presumably HsO 4 , and were transported in a mixture of He and O 2 to a deposition and detection system. The latter consisted of 16 silicon PIN-photodiodes facing a layer of NaOH, which served, in the presence of a certain partial pressure of water in the transport gas, as reactive surface for the deposition of the volatile tetroxides. Six correlated α-decay chains of Hs were detected in the first 5 detectors centred around detection position 3. In analogy to OsO 4 , which forms Na 2 [OsO 4 (OH) 2 ], an osmate(VIII), with aqueous NaOH, HsO 4 presumably was deposited as Na 2 [HsO 4 (OH) 2 ], a hassate(VIII). (orig.)

  19. 26 CFR 1.263(a)-5 - Amounts paid or incurred to facilitate an acquisition of a trade or business, a change in the... (United States)


    ... activities occur. (7) Registrar and transfer agent fees for the maintenance of capital stock records. An... capitalized generally reduces the total premium received by the option writer. However, other provisions of... not the registration is productive of equity capital). Example 2. Costs to facilitate. Q corporation...

  20. Investigations on ideal mode of cell disruption in extremely halophilic Actinopolyspora halophila (MTCC 263 for efficient release of glycine betaine and trehalose

    Directory of Open Access Journals (Sweden)

    Jayaranjan R. Kar


    Full Text Available Actinopolyspora halophila produces glycine betaine and trehalose intracellularly in considerable quantities. These biomolecules are commercially important as they have applications in food, pharmaceuticals, and agricultural sector. Development of an efficient cell disruption technique is an important step for the release of these biomolecules. In this study, various cell disruption methods such as chemical, enzymatic, physico-mechanical and physical methods were evaluated. Cell disruption by osmotic shock was found to be the best suited method for A. halophila which also has a potential to be industrially scaled up. Cell bursting pressure that is generated during osmotic shock in A. halophila was computed using Morse equation and was found to be π = 238.37 ± 29.54 atm or 2.35 ± 0.29 kPa. In addition, it was found that osmotic shock followed a first order release rate kinetics in A. halophila. The findings can be used for commercially important biomolecules from other halophilic and/or halotolerant microbes.

  1. 263. Resultado de la cirugía cardíaca en los pacientes con cirrosis hepática y endocarditis infecciosa activa

    Directory of Open Access Journals (Sweden)

    E. Quintana


    Conclusiones: Los pacientes con endocarditis y cirrosis son los de más riesgo. EuroSCORE no fue útil para la estratificación del riesgo. En pacientes con cirrosis avanzada la cirugía debe ofrecerse sólo en casos seleccionados.

  2. 49 CFR 40.263 - What happens when an employee is unable to provide a sufficient amount of saliva for an alcohol... (United States)


    ... sufficient amount of saliva for an alcohol screening test? (a) As the STT, you must take the following steps if an employee is unable to provide sufficient saliva to complete a test on a saliva screening device (e.g., the employee does not provide sufficient saliva to activate the device). (1) You must conduct...

  3. Days-lost to training and competition in relation to workload in 263 elite show-jumping horses in four European countries

    NARCIS (Netherlands)

    Egenvall, A; Tranquille, C A; Lönnell, A C; Bitschnau, C; Oomen, A|info:eu-repo/dai/nl/314417311; Hernlund, E; Montavon, S; Franko, M A; Murray, R C; Weishaupt, M A; Weeren, van R; Roepstorff, L; van Weeren, René|info:eu-repo/dai/nl/074628550


    Orthopaedic, or other, injuries in sports medicine can be quantified using the 'days-lost to training' concept. Both the training regimen and the surface used in training and racing can affect the health of racehorses. Our aim was to associate 'days-lost to training' in elite-level show-jumpers to

  4. Multibeam collection for TN263: Multibeam data collected aboard Thomas G. Thompson from 2011-04-30 to 2011-05-21, Seattle, WA to Seattle, WA (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  5. Estimação do fator de condição de peixes da espécie Tracydoras paraguayensis: uma perspectiva bayesiana - DOI: 10.4025/actascianimsci.v29i1.263 Estimate of the condition factor of fish of the Tracydoras paraguayensis species: a Bayesian perspective - DOI: 10.4025/actascianimsci.v29i1.263

    Directory of Open Access Journals (Sweden)

    Vanderly Janeiro


    Full Text Available O fator de condição de peixes, expressa a relação peso-comprimento e é aceitacomo um indicador da avaliação do “bem-estar” do animal; quanto maior o peso, melhor deveser sua condição de sobrevivência. Este trabalho objetivou ajustar um modelo Gama, da família exponencial com função de ligação potência, a dados de medidas de comprimento e peso depeixes da espécie Trachydoras paraguayensis, observados na bacia do Rio Paraná, Paraná-Brasil. Asestimativas dos parâmetros do modelo foram obtidos por dois processos distintos: pelométodo clássico da máxima verossimilhança e pelo método Bayesiano (MCMC. Observou-seque todas as estimativas Bayesianas (médias à posteriori para os parâmetros de locação foramsimilares as estimativas clássicas, contudo o parâmetro de dispersão é inferior ao obtido pela aestimativa clássica, além de fornecer um erro padrão 30% menor.The factor of fish condition expresses the weight-lengthrelationship and it is accepted as an indicator for the evaluation of the animal "well-being";as larger the weight, best should be your survival condition. This work aims to fit a Gammamodel, from the exponential family with power link function, to data of lengthmeasurements and weight of fish from the Trachydoras paraguayensis species, observed in thebasin of the Paraná River, Paraná-Brazil. The estimates of the parameters of the model wereobtained by two different processes: by a classic method (maximum likelihood and byBayesian method (MCMC. It was observed that the Bayesians estimates (posterior meanof the parameters of interest were similar to the classic estimates, the dispersion parameter,it underestimated the classic estimate, however the dispersion parameter is inferior to theobtained by the classic estimate, besides supplying a standard mistake 30% smaller.

  6. SU-E-T-263: Point Dose Variation Using a Single Ir-192 HDR Brachytherapy Plan for Two Treatments with a Single Tandem-Ovoid Insertion for Cervical Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Liang, X; Morrill, S; Hardee, M; Han, E; Penagaricano, J; Zhang, X; Vaneerat, R [University of Arkansas Medical Science, Little Rock, AR (United States)


    Purpose: To evaluate the point dose variations between Ir-192 HDR treatments on two consecutive days using a single tandem-ovoid insertion without replanning in cervical cancer patients. Methods: This study includes eleven cervical cancer patients undergoing HDR brachytherapy with a prescribed dose of 28 Gy in 4 fractions. Each patient had two tandemovoid insertions one week apart. Each insertion was treated on consecutive days with rescanning and replanning prior to each treatment. To study the effect of no replanning for day 2 treatments, the day 1 plan dwell position and dwell time with decay were applied to the day 2 CT dataset. The point dose variations on the prescription point H (defined according to American Brachytherapy Society), and normal tissue doses at point B, bladder, rectum and vaginal mucosa (based on ICRU Report 38) were obtained. Results: Without replanning, the mean point H dose variation was 4.6 ± 10.7% on the left; 2.3 ± 2.9% on the right. The mean B point variation was 3.8 ± 4.9% on the left; 3.6 ± 4.7% on the right. The variation in the left vaginal mucosal point was 12.2 ± 10.7%; 9.5 ± 12.5% on the right; the bladder point 5.5 ± 7.4%; and the rectal point 7.9 ± 9.1%. Conclusion: Without replanning, there are variations both in the prescription point and the normal tissue point doses. The latter can vary as much as 10% or more. This is likely due to the steep dose gradient from brachytherapy compounded by shifts in the positions of the applicator in relationship to the patients anatomy. Imaging prior to each treatment and replanning ensure effective and safe brachytherapy are recommended.

  7. Decree of the Czech Labor Safety Office No. 263/1991 amending the Decree No. 76/1989 on ensuring safety of technical facilities in the nuclear power sector

    International Nuclear Information System (INIS)


    Some provisions of the Decree of the Czech Labor Safety Office No. 76/1989 on ensuring safety of technical facilities in the nuclear power sector are amended, particularly in the field of construction activities, assembling, reconstruction and repair of nuclear power facilities. The Decree entered into force on 28 June 1991. (J.B.)

  8. JUAN JESÚS LÓPEZ-GUADALUPE MUÑOZ. Imágenes elocuentes. Estudios sobre patrimonio escultórico. Granada: Atrio, 2008. 509 pp. y 263 ils.

    Directory of Open Access Journals (Sweden)

    José Policarpo Cruz Cabrera


    Full Text Available Con este sugestivo título el profesor López-Guadalupe nos ofrece un hermoso ramillete de estudios dedicado a la escultura devocional y procesional granadina. Por fortuna, hace ya bastantes años que este campo integrado en el tronco común de la plástica renacentista y barroca hispana es contemplado en su reconocido mérito y con solidez investigadora en el ámbito de nuestras universidades, superadas con creces visiones meramente populistas o folclóricas para consumo cofradiero...

  9. From bohrium to copernicium and beyond SHE research at SHIP

    Energy Technology Data Exchange (ETDEWEB)

    Münzenberg, G., E-mail: [GSI Helmholtzzentrum für Schwerionenforschung, Planckstrasse 1, 64291 Darmstadt (Germany); Manipal Centre for Natural Sciences, Manipal University, Manipal 576104, Karnataka (India)


    Heavy-element research with SHIP at GSI is reviewed including the discovery of the chemical elements bohrium to copernicium, experimental developments, cold fusion of heavy ions, and the discovery of a shell region around hassium. Elements bohrium and heavier are located beyond the limit of liquid-drop stability. They exist by shell stabilization. A universal, sensitive, and fast method: in-flight separation and identification of single atomic nuclei has been developed with the velocity filter SHIP and the detector system to measure decay sequences of individual atoms. Research with single atomic nuclei including detection methods, identification, and physics results will be discussed. Experiments with actinide targets as well as prospects with NUSTAR at FAIR will be addressed.

  10. ORF Alignment: NC_003318 [GENIUS II[Archive

    Lifescience Database Archive (English)


  11. Scent of a break-up: phylogeography and reproductive trait divergences in the red-tailed bumblebee (Bombus lapidarius)

    Czech Academy of Sciences Publication Activity Database

    Lecocq, T.; Dellicour, S.; Michez, D.; Lhomme, P.; Vanderplanck, M.; Valterová, Irena; Rasplus, J. Y.; Rasmont, P.


    Roč. 13, č. 263 (2013), 263/1-263/17 ISSN 1471-2148 Grant - others:Seventh Framework Programme(XE) FP7-244090 Institutional support: RVO:61388963 Keywords : phylogeography * reproductive traits * genetic differentiation * bumblebees Subject RIV: CC - Organic Chemistry Impact factor: 3.407, year: 2013

  12. Statistical Measures Alone Cannot Determine Which Database (BNI, CINAHL, MEDLINE, or EMBASE Is the Most Useful for Searching Undergraduate Nursing Topics. A Review of: Stokes, P., Foster, A., & Urquhart, C. (2009. Beyond relevance and recall: Testing new user-centred measures of database performance. Health Information and Libraries Journal, 26(3, 220-231.

    Directory of Open Access Journals (Sweden)

    Giovanna Badia


    Full Text Available Objective – The research project sought to determine which of four databases was the most useful for searching undergraduate nursing topics. Design – Comparative database evaluation. Setting – Nursing and midwifery students at Homerton School of Health Studies (now part of Anglia Ruskin University, Cambridge, United Kingdom, in 2005-2006. Subjects – The subjects were four databases: British Nursing Index (BNI, CINAHL, MEDLINE, and EMBASE.Methods – This was a comparative study using title searches to compare BNI (BritishNursing Index, CINAHL, MEDLINE and EMBASE.According to the authors, this is the first study to compare BNI with other databases. BNI is a database produced by British libraries that indexes the nursing and midwifery literature. It covers over 240 British journals, and includes references to articles from health sciences journals that are relevant to nurses and midwives (British Nursing Index, n.d..The researchers performed keyword searches in the title field of the four databases for the dissertation topics of nine nursing and midwifery students enrolled in undergraduate dissertation modules. The list of titles of journals articles on their topics were given to the students and they were asked to judge the relevancy of the citations. The title searches were evaluated in each of the databases using the following criteria: • precision (the number of relevant results obtained in the database for a search topic, divided by the total number of results obtained in the database search;• recall (the number of relevant results obtained in the database for a search topic, divided by the total number of relevant results obtained on that topic from all four database searches;• novelty (the number of relevant results that were unique in the database search, which was calculated as a percentage of the total number of relevant results found in the database;• originality (the number of unique relevant results obtained in the database for a search topic, which was calculated as a percentage of the total number of unique results found in all four database searches;• availability (the number of relevant full text articles obtained from the database search results, which was calculated as a percentage of the total number of relevant results found in the database;• retrievability (the number of relevant full text articles obtained from the database search results, which was calculated as a percentage of the total number of relevant full text articles found from all four database searches;• effectiveness (the probable odds that a database will obtain relevant search results;• efficiency (the probable odds that a database will obtain both unique and relevant search results; and• accessibility (the probable odds that the full text of the relevant references obtained from the database search are available electronically or in print via the user’s library.Students decided whether the search results were relevant to their topic by using a “yes/no” scale. Only record titles were used to make relevancy judgments.Main Results – Friedman’s Test and odds ratios were used to compare the performance of BNI, CINAHL, MEDLINE, and EMBASE when searching for information about nursing topics.These two statistical measures demonstrated the following:• BNI had the best average score for the precision, availability, effectiveness, and accessibility of search results;• CINAHL scored the highest for the novelty, retrievability, and efficiency of results, and ranked second place for all the other criteria;• MEDLINE excelled in the areas of recall and originality, and ranked second place for novelty and retrievability; and• EMBASE did not obtain the highest, or second highest score, for any of the criteria.Conclusion – According to the authors, these results suggest that none of the databases studied can be considered the most useful for searching undergraduate nursing topics. CINAHL and MEDLINE emerge as consistently good performers, but both databases are needed to find relevant material on a topic.Friedman’s Test clearly differentiated between the databases for the accessibility of search results. Odds ratio testing may assist librarians to make decisions about database purchases. BNI scored the highest for availability of results and CINAHL ranked the highest for retrievability. Statistical measures need to be supplemented with qualitative data about user preferences in order to determine which database is the most useful to our users.

  13. Study of Search Engine Transaction Logs Shows Little Change in How Users use Search Engines. A review of: Jansen, Bernard J., and Amanda Spink. “How Are We Searching the World Wide Web? A Comparison of Nine Search Engine Transaction Logs.” Information Processing & Management 42.1 (2006: 248‐263.

    Directory of Open Access Journals (Sweden)

    David Hook


    Full Text Available Objective – To examine the interactions between users and search engines, and how they have changed over time. Design – Comparative analysis of search engine transaction logs. Setting – Nine major analyses of search engine transaction logs. Subjects – Nine web search engine studies (4 European, 5 American over a seven‐year period, covering the search engines Excite, Fireball, AltaVista, BWIE and AllTheWeb. Methods – The results from individual studies are compared by year of study for percentages of single query sessions, one term queries, operator (and, or, not, etc. usage and single result page viewing. As well, the authors group the search queries into eleven different topical categories and compare how the breakdown has changed over time. Main Results – Based on the percentage of single query sessions, it does not appear that the complexity of interactions has changed significantly for either the U.S.‐based or the European‐based search engines. As well, there was little change observed in the percentage of one‐term queries over the years of study for either the U.S.‐based or the European‐based search engines. Few users (generally less than 20% use Boolean or other operators in their queries, and these percentages have remained relatively stable. One area of noticeable change is in the percentage of users viewing only one results page, which has increased over the years of study. Based on the studies of the U.S.‐based search engines, the topical categories of ‘People, Place or Things’ and ‘Commerce, Travel, Employment or Economy’ are becoming more popular, while the categories of ‘Sex and Pornography’ and ‘Entertainment or Recreation’ are declining. Conclusions – The percentage of users viewing only one results page increased during the years of the study, while the percentages of single query sessions, oneterm sessions and operator usage remained stable. The increase in single result page viewing implies that users are tending to view fewer results per web query. There was also a significant difference in the percentage of queries using Boolean operators between the US‐based and the European‐based search engines. One of the study’s findings was that results from a study of a particular search engine cannot necessarily be applied to all search engines. Finally, web search topics show a trend towards information or commerce searching rather than entertainment.

  14. Gclust Server: 85848 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 85848 CEL_C08H9.5_17535345 Cluster Sequences Related Sequences(263) 502 old-1: Overexpression...ences Related Sequences(263) Sequence length 502 Representative annotation old-1: Overexpression

  15. Gclust Server: 120676 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 120676 ATH_AT3G61450_18412010 Cluster Sequences Related Sequences(21) 263 SYP73 (SYNTAXIN OF PLANTS...equence length 263 Representative annotation SYP73 (SYNTAXIN OF PLANTS 73) Number

  16. Decay properties of nuclei close to Z = 108 and N = 162

    International Nuclear Information System (INIS)

    Dvorak, Jan


    The goal of the research conducted in the frame of this thesis was to investigate the decay properties of the nuclides 269-271 Hs and their daughters using an improved chemical separation and detection system. Shell stabilization was predicted in the region around Z=108 and N=162 in calculations, taking into account possible higher orders of deformations of the nuclei. The nucleus 270 Hs with a closed proton and a closed neutron deformed shell, was predicted to be ''deformed doubly magic''. Nuclei around 270 Hs can be produced only via fusion reactions at picobarn levels, resulting in a production rates of few atoms per day. Investigating short-lived nuclei using rapid chemical separation and subsequent on-line detection methods provides an independent and alternative means to electromagnetic on-line separators. Chemical separation of Hs in the form of HsO 4 provides an excellent tool to study the formation reactions and nuclear structure in this region of the chart of nuclides due to a high overall efficiency and a very high purification factor. The goal was accomplished, as element 108, hassium, was produced in the reaction 248 Cm( 26 Mg,xn) 274-x Hs and chemically isolated. After gas phase separation of HsO 4 , 26 genetically linked decay chains have been observed. These were attributed to decays of three different Hs isotopes produced in the 3-5n evaporation channels. The known decay chain of 269 Hs, the 5n evaporation product, serves as an anchor point, thus allowing the unambiguous assignment of the observed decay chains to the 5n, 4n, and 3n channels, respectively. Decay properties of five nuclei have been unambiguously established for the first time, including the one for the the doubly-magic nuclide 270 Hs. This hassium isotope is the next doubly magic nucleus after the well known 208 Pb and the first experimentally observed even-even nucleus on the predicted N=162 neutron shell. The observed decay properties provide strong indications for enhanced nuclear

  17. Superheavy element chemistry. Achievements and perspectives

    International Nuclear Information System (INIS)

    Schaedel, M.


    Superheavy elements have been synthesized and chemically characterized one-atom-at-a-time up to element 108. Presently, the quest for element 112 is one of the hottest topics in this field. The transactinide elements 104 to 108 are members of group 4 to 8 of the Periodic Table and element 112 belongs into group 12. Chemical properties of some of these elements, like elements 104 and 105, show stunning deviations from simple extrapolations within their respective group while others exhibit great similarities with their lighter homologues elements. First experiments to investigate seaborgium (Sg, element 106) in aqueous solution were performed. Again, in large international collaborations at the GSI, several gas-phase chemistry experiments were performed with hassium (Hs, element 108). Recently, the highly efficient and very clean separation of Hs was applied for nuclear studies of various Hs nuclides investigating their cross section and their nuclear decay properties in the region of the doubly-magic 270 Hs (Z=108, N=162). To overcome certain limitations of the presently used on-line chemical separations the new TransActinide Separation and Chemistry Apparatus (TASCA) - with a gas-filled recoil separator as a front-end tool - was designed and built at the GSI in a collaborative effort. Presently in its commissioning phase, TASCA shall be a key instrument for a big leap into quantitatively and qualitatively new experiments in the region of superheavy elements. (author)

  18. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    Energy Technology Data Exchange (ETDEWEB)

    Even, Julia


    Topic of this thesis is the development of experiments behind the gas-filled separator TASCA (TransActinide Separator and Chemistry Apparatus) to study the chemical properties of the transactinide elements. In the first part of the thesis, the electrodepositions of short-lived isotopes of ruthenium and osmium on gold electrodes were studied as model experiments for hassium. From literature it is known that the deposition potential of single atoms differs significantly from the potential predicted by the Nernst equation. This shift of the potential depends on the adsorption enthalpy of therndeposited element on the electrode material. If the adsorption on the electrode-material is favoured over the adsorption on a surface made of the same element as the deposited atom, the electrode potential is shifted to higher potentials. This phenomenon is called underpotential deposition. Possibilities to automatize an electro chemistry experiment behind the gas-filled separator were explored for later studies with transactinide elements. The second part of this thesis is about the in-situ synthesis of transition-metal-carbonyl complexes with nuclear reaction products. Fission products of uranium-235 and californium-249 were produced at the TRIGA Mainz reactor and thermalized in a carbon-monoxide containing atmosphere. The formed volatile metal-carbonyl complexes could be transported in a gas-stream. Furthermore, short-lived isotopes of tungsten, rhenium, osmium, and iridium were synthesised at the linear accelerator UNILAC at GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt. The recoiling fusion products were separated from the primary beam and the transfer products in the gas-filled separator TASCA. The fusion products were stopped in the focal plane of TASCA in a recoil transfer chamber. This chamber contained a carbon-monoxide - helium gas mixture. The formed metal-carbonyl complexes could be transported in a gas stream to various experimental setups. All

  19. The synthesis of the deformed superheavy elements 107 to 111

    International Nuclear Information System (INIS)

    Armbuster, P.


    By inflight separation, implantation into Si-detector arrays, and correlation analysis of subsequent α-decay chains many isotopes were discovered at GSI since 1980, among others the elements Nielsbohriurn, Hassium and Meitnerium. The sensitivity of the method allows to identify an element by one decay chain, as we demonstrated for the case of 266 Mt. After a break of our work during the time when the new accelerator system SIS-FRS-ESR was installed (1989-1993) at GSI, and many improvements of our system EZR-UNILAC-SHIP accomplished, we restarted element synthesis in 1994. The synthesis of the isotopes 269 110, 271 110, and 272 111 of the new elements Z--110 and Z=l11 was a first success at the end of 1994. This discovery is in the center of this presentation. The reaction mechanism, a one-step, cold and compact rearrangement process at a level of some 10 -36 cm 2 is discussed. Cross sections and excitation functions systematically studied allow to extrapolate to the next element Z=112, which seems not to be out of reach

  20. Design and properties of silicon charged-particle detectors developed at the Institute of Electron Technology (ITE) (United States)

    Wegrzecki, Maciej; Bar, Jan; Budzyński, Tadeusz; CieŻ, Michal; Grabiec, Piotr; Kozłowski, Roman; Kulawik, Jan; Panas, Andrzej; Sarnecki, Jerzy; Słysz, Wojciech; Szmigiel, Dariusz; Wegrzecka, Iwona; Wielunski, Marek; Witek, Krzysztof; Yakushev, Alexander; Zaborowski, Michał


    The paper discusses the design of charged-particle detectors commissioned and developed at the Institute of Electron Technology (ITE) in collaboration with foreign partners, used in international research on transactinide elements and to build personal radiation protection devices in Germany. Properties of these detectors and the results obtained using the devices are also presented. The design of the following epiplanar detector structures is discussed: ♢ 64-element chromatographic arrays for the COMPACT (Cryo On-line Multidetector for Physics And Chemistry of Transactinides) detection system used at the GSI Helmholtzzentrum für Schwerionenforschung in Darmstadt (GSI) for research on Hassium, Copernicium and Flerovium, as well as elements 119 and 120, ♢ 2-element flow detectors for the COLD (Cryo On-Line Detector) system used for research on Copernicium and Flerovium at the Joint Institute for Nuclear Research, Dubna, ♢ detectors for a radon exposimeter and sensors for a neutron dosimeter developed at the Institut für Strahlenschutz, Helmholtz Zentrum München. The design of planar detectors - single-sided and double-sided strip detectors for the Focal Plane Detector Box used at GSI for research on Flerovium and elements 119 and 120 is also discussed.

  1. IVO, a device for In situ Volatilization and On-line detection of products from heavy ion reactions

    CERN Document Server

    Duellmann, C E; Eichler, R; Gäggeler, H W; Jost, D T; Piguet, D; Türler, A


    A new gaschromatographic separation system to rapidly isolate heavy ion reaction products in the form of highly volatile species is described. Reaction products recoiling from the target are stopped in a gas volume and converted in situ to volatile species, which are swept by the carrier gas to a chromatography column. Species that are volatile under the given conditions pass through the column. In a cluster chamber, which is directly attached to the exit of the column, the isolated volatile species are chemically adsorbed to the surface of aerosol particles and transported to an on-line detection system. The whole set-up was tested using short-lived osmium (Os) and mercury (Hg) nuclides produced in heavy ion reactions to model future chemical studies with hassium (Hs, Z=108) and element 112. By varying the temperature of the isothermal section of the chromatography column between room temperature and -80 deg. C, yield measurements of given species can be conducted, yielding information about the volatility o...

  2. Chemical experiments with superheavy elements. (United States)

    Türler, Andreas


    Unnoticed by many chemists, the Periodic Table of the Elements has been extended significantly in the last couple of years and the 7th period has very recently been completed with eka-Rn (element 118) currently being the heaviest element whose synthesis has been reported. These 'superheavy' elements (also called transactinides with atomic number > or = 104 (Rf)) have been artificially synthesized in fusion reactions at accelerators in minute quantities of a few single atoms. In addition, all isotopes of the transactinide elements are radioactive and decay with rather short half-lives. Nevertheless, it has been possible in some cases to investigate experimentally chemical properties of transactinide elements and even synthesize simple compounds. The experimental investigation of superheavy elements is especially intriguing, since theoretical calculations predict significant deviations from periodic trends due to the influence of strong relativistic effects. In this contribution first experiments with hassium (Hs, atomic number 108), copernicium (Cn, atomic number 112) and element 114 (eka-Pb) are reviewed.

  3. Chemistry of superheavy elements

    International Nuclear Information System (INIS)

    Schaedel, M.


    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  4. Chemistry of the superheavy elements. (United States)

    Schädel, Matthias


    The quest for superheavy elements (SHEs) is driven by the desire to find and explore one of the extreme limits of existence of matter. These elements exist solely due to their nuclear shell stabilization. All 15 presently 'known' SHEs (11 are officially 'discovered' and named) up to element 118 are short-lived and are man-made atom-at-a-time in heavy ion induced nuclear reactions. They are identical to the transactinide elements located in the seventh period of the periodic table beginning with rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) in groups 4, 5 and 6, respectively. Their chemical properties are often surprising and unexpected from simple extrapolations. After hassium (element 108), chemistry has now reached copernicium (element 112) and flerovium (element 114). For the later ones, the focus is on questions of their metallic or possibly noble gas-like character originating from interplay of most pronounced relativistic effects and electron-shell effects. SHEs provide unique opportunities to get insights into the influence of strong relativistic effects on the atomic electrons and to probe 'relativistically' influenced chemical properties and the architecture of the periodic table at its farthest reach. In addition, they establish a test bench to challenge the validity and predictive power of modern fully relativistic quantum chemical models. © 2015 The Author(s) Published by the Royal Society. All rights reserved.

  5. 75 FR 16204 - Reporting and Recordkeeping Requirements Under OMB Review (United States)


    ..., Office of Management and Budget, New Executive Office Building, Washington, DC 20503. FOR FURTHER... Burden: 263. Title: Federal Cash Transaction Report, Financial Status Report, Program Income Report...

  6. ORF Alignment: NC_005126 [GENIUS II[Archive

    Lifescience Database Archive (English)


  7. Decay properties of nuclei close to Z = 108 and N = 162

    Energy Technology Data Exchange (ETDEWEB)

    Dvorak, Jan


    The goal of the research conducted in the frame of this thesis was to investigate the decay properties of the nuclides {sup 269-271}Hs and their daughters using an improved chemical separation and detection system. Shell stabilization was predicted in the region around Z=108 and N=162 in calculations, taking into account possible higher orders of deformations of the nuclei. The nucleus {sup 270}Hs with a closed proton and a closed neutron deformed shell, was predicted to be ''deformed doubly magic''. Nuclei around {sup 270}Hs can be produced only via fusion reactions at picobarn levels, resulting in a production rates of few atoms per day. Investigating short-lived nuclei using rapid chemical separation and subsequent on-line detection methods provides an independent and alternative means to electromagnetic on-line separators. Chemical separation of Hs in the form of HsO{sub 4} provides an excellent tool to study the formation reactions and nuclear structure in this region of the chart of nuclides due to a high overall efficiency and a very high purification factor. The goal was accomplished, as element 108, hassium, was produced in the reaction {sup 248}Cm({sup 26}Mg,xn){sup 274-x}Hs and chemically isolated. After gas phase separation of HsO{sub 4}, 26 genetically linked decay chains have been observed. These were attributed to decays of three different Hs isotopes produced in the 3-5n evaporation channels. The known decay chain of {sup 269}Hs, the 5n evaporation product, serves as an anchor point, thus allowing the unambiguous assignment of the observed decay chains to the 5n, 4n, and 3n channels, respectively. Decay properties of five nuclei have been unambiguously established for the first time, including the one for the the doubly-magic nuclide {sup 270}Hs. This hassium isotope is the next doubly magic nucleus after the well known {sup 208}Pb and the first experimentally observed even-even nucleus on the predicted N=162 neutron shell. The

  8. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    International Nuclear Information System (INIS)

    Even, Julia


    Topic of this thesis is the development of experiments behind the gas-filled separator TASCA (TransActinide Separator and Chemistry Apparatus) to study the chemical properties of the transactinide elements. In the first part of the thesis, the electrodepositions of short-lived isotopes of ruthenium and osmium on gold electrodes were studied as model experiments for hassium. From literature it is known that the deposition potential of single atoms differs significantly from the potential predicted by the Nernst equation. This shift of the potential depends on the adsorption enthalpy of therndeposited element on the electrode material. If the adsorption on the electrode-material is favoured over the adsorption on a surface made of the same element as the deposited atom, the electrode potential is shifted to higher potentials. This phenomenon is called underpotential deposition. Possibilities to automatize an electro chemistry experiment behind the gas-filled separator were explored for later studies with transactinide elements. The second part of this thesis is about the in-situ synthesis of transition-metal-carbonyl complexes with nuclear reaction products. Fission products of uranium-235 and californium-249 were produced at the TRIGA Mainz reactor and thermalized in a carbon-monoxide containing atmosphere. The formed volatile metal-carbonyl complexes could be transported in a gas-stream. Furthermore, short-lived isotopes of tungsten, rhenium, osmium, and iridium were synthesised at the linear accelerator UNILAC at GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt. The recoiling fusion products were separated from the primary beam and the transfer products in the gas-filled separator TASCA. The fusion products were stopped in the focal plane of TASCA in a recoil transfer chamber. This chamber contained a carbon-monoxide - helium gas mixture. The formed metal-carbonyl complexes could be transported in a gas stream to various experimental setups. All

  9. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Department of Molecular Biology and Genetic Engineering, G. B. Pant University of Agriculture and Technology, Pantnagar 263 145, India; Department of Molecular Biology and Genetic Engineering, College of Basic Science and Humanities, G. B. Pant University of Agriculture and Technology, Pantnagar 263 145, India ...

  10. Local predators attack exotic aphid Brachycaudus divaricatae in Lithuania

    Czech Academy of Sciences Publication Activity Database

    Danilov, J.; Rakauskas, R.; Havelka, Jan; Starý, Petr


    Roč. 69, č. 2 (2016), s. 263-269 ISSN 1721-8861 Institutional support: RVO:60077344 Keywords : Prunus * Aphids * Brachycaudus divaricatae Subject RIV: EH - Ecology, Behaviour Impact factor: 1.051, year: 2016

  11. Fulltext PDF

    Indian Academy of Sciences (India)

    Cheon Taksu. 311. Datta Animesh. 425. Dattagupta Sushanta. 203. Deepak P N. 175. Edamatsu Keiichi. 165. Ganesh Pradeep. 263. Ghose Partha. 417,425. Ghosh Rupamanjari. 189. Gillies G T. 369. Gisin Nicolas. 181. Goswami Debabrata. 235. Hara Koh'ichiro. 405. Hari Dass N D. 263,303. Home Dipankar. 229,289,321.

  12. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 263 of 263 ... Vol 16, No 2 (2015), Training accountants in developing countries: The relevance of information and communication technology, Abstract PDF. Godson Okwuchukwu Okafor, Okenwa CY Ogbodo. Vol 17, No 3 (2017), Transition and the Problems of Modern Nigerian Poetry: An Overview of Selected ...

  13. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)


    Jan 27, 2016 ... Home; Journals; Journal of Astrophysics and Astronomy; Volume 22; Issue 4. Volume 22, Issue 4. December 2001, pages 263-349. pp 263-282. Variability of Extragalactic Objects in Relation to Redshift, Color, Radio Spectral Index and Absorption Lines · D. Basu · More Details Abstract Fulltext PDF.

  14. Nuclear structure studies towards superheavy elements and perspectives with AGATA

    International Nuclear Information System (INIS)

    Korichi, A.


    A variety of theoretical approaches have been used to calculate the shell closure of spherical Super Heavy Elements (SHE) but the predictions of the location of the 'island of stability' vary from Z=114 to 120 and 126, with neutron numbers around N=172 or N=184 depending on the model employed. A deformed minimum around Z=108 and N=162 is predicted and an increase of the half-life of Hassium (Z=108) is experimentally observed when approaching the neutron number N=162. Super heavy nuclei are produced with very low cross-section (a few picobarns) and this makes their spectroscopic study impossible with today's beam intensities and detectors. However, important information can be obtained from the structure of mid-shell deformed nuclei (Z∼104) where selected single particle orbitals, which lie close to the spherical shell gap in SHE, are close to the Fermi level. The information will come from decay and in-beam spectroscopy. A promising area of progress, using the state-of-the art instruments, is represented by the observation of rotational gamma-ray transitions in No and Fm isotopes showing the deformed character of these nuclei. One of the objectives and focus of the nuclear structure community is related to the investigation of Single particle excitations beyond the N=152 neutron gap and collective properties of heavier systems towards Z∼104. The IN2P3-JINR collaboration has launched a project of electron and gamma-ray spectroscopy studies of heavy nuclei at the FLNR. This project benefits from the radioactive actinide targets uniquely available at Dubna and from the very intense stable beams provided by the U400 cyclotron. This offers a unique opportunity for the study of nuclei above Z=100 along an isotopic chain approaching N=162. In this contribution, the emphasis will be on the GABRIELA project and its issues. I will finally point out the perspectives with the new generation of gamma detectors such as AGATA

  15. Development of an Atmospheric Dispersion Model for Heavier-Than-Air Gas Mixtures. Volume 1. (United States)


    aspirated concentration sensor used a balanced Wheatstone bridge to measure the heat loss from a sensing element placed in the sample stream. Shaded...a semipermeable membrane and electrochemical cell. A fast response sensor (10 Hz) basically aspirated a sample past the cell membrane. Reported...ramp function around the freezing point of water by X11., X= vap for T 273.15 K vap fus 263.15 for 263.15 <T < 273.15 Xvap +x fus for T < 263.15 (A-4

  16. Integration of the information problem-solving skill in an educational programme: The effects of learning with authentic tasks.

    NARCIS (Netherlands)

    Brand-Gruwel, Saskia; Wopereis, Iwan


    Brand-Gruwel, S., & Wopereis, I. (2006). Integration of the information problem-solving skill in an educational programme: The effects of learning with authentic tasks. Technology, Instruction, Cognition, and Learning, 4, 243-263.

  17. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 263 ... ... Social Stability: A Case of Umuada Burial Performance, Abstract PDF ... Learning, Cultural Education and Social Advocacy: An Appraisal, Abstract PDF ... Vol 18, No 2 (2017): Special Edition, Gender Inequality and its ...

  18. Nucleotide diversity and phylogenetic relationships among ...

    Indian Academy of Sciences (India)


    Mar 3, 2017 ... 2Department of Botany, D. S. B. Campus, Kumaun University, Nainital 263 001, India ... Rana T. S. 2017 Nucleotide diversity and phylogenetic relationships ... Anderson and Park 1989). ..... Edgewood Press, Edgewood, USA.

  19. Effect of radiation-induced substrate defects on microstrip gas chamber gain behaviour

    International Nuclear Information System (INIS)

    Pallares, A.; Brom, J.M.; Bergdolt, A.M.; Coffin, J.; Eberle, H.; Sigward, M.H.; Fontaine, J.C.; Barthe, S.; Schunck, J.P.


    The aim of this work was to quantify the influence of radiation-induced substrate defects on microstrip gas chamber (MSGC) gain behaviour. The first part of this paper focuses on radiation effects on a typical MSGC substrate: Desag D263 glass. Defect generation was studied for Desag D263 with pure silica (Suprasil 1) as a reference. We studied the evolution of defect concentration with respect to accumulated doses up to 480 kGy. Annealing studies of defects in Desag D263 were also performed. In the second part, the radiation sensitivity of Desag D263 glass has been linked to the behaviour of the detector under irradiation. Comparative gain measurements were taken before and after substrate irradiation at 10 and 80 kGy the minimal dose received during LHC operation and the dose for which defect density is maximum (respectively). (orig.)

  20. Effect of radiation-induced substrate defects on microstrip gas chamber gain behaviour

    Energy Technology Data Exchange (ETDEWEB)

    Pallares, A.; Brom, J.M.; Bergdolt, A.M.; Coffin, J.; Eberle, H.; Sigward, M.H. [Institute de Recherches Subatomiques, 67 - Strasbourg (France); Fontaine, J.C. [Universite de Haute Alsace, GRPHE, 61 rue Albert Camus, 68093 Mulhouse Cedex (France); Barthe, S.; Schunck, J.P. [Laboratoire PHASE (UPR 292 du CNRS), 23 rue du Loess, BP 28, 67037 Strasbourg Cedex 2 (France)


    The aim of this work was to quantify the influence of radiation-induced substrate defects on microstrip gas chamber (MSGC) gain behaviour. The first part of this paper focuses on radiation effects on a typical MSGC substrate: Desag D263 glass. Defect generation was studied for Desag D263 with pure silica (Suprasil 1) as a reference. We studied the evolution of defect concentration with respect to accumulated doses up to 480 kGy. Annealing studies of defects in Desag D263 were also performed. In the second part, the radiation sensitivity of Desag D263 glass has been linked to the behaviour of the detector under irradiation. Comparative gain measurements were taken before and after substrate irradiation at 10 and 80 kGy the minimal dose received during LHC operation and the dose for which defect density is maximum (respectively). (orig.) 26 refs.

  1. The Johannesburg cardiac rehabilitation programme

    African Journals Online (AJOL)


    Feb 16, 1991 ... sion 72,9% of patients were smokers, 26,3% had hypertension and 34,3% had ... Cardiac rehabilitation, including supervised exercise therapy, has become a .... sions on risk factor modification, diet, aspects of heart disease,.

  2. a comparative study of student academic performance in on-campus

    African Journals Online (AJOL)


    demic performance (Cumulative Weighted Average Scores) between distance and on-campus students. ... one of the several programmes that is offered ... and women in the two courses in health care ..... cation for Business 77 (5):257-263.

  3. What to Expect During a Colonoscopy

    Medline Plus

    Full Text Available ... ACG welcomes inquiries about digestive health from the media and can make experts available for interviews upon request. Please call the Communications Team at 301-263-9000 or e-mail ...

  4. Migrace v české etnologii: náměty k obohacení migrační teorie

    Czech Academy of Sciences Publication Activity Database

    Uherek, Zdeněk


    Roč. 26, č. 4 (2016), s. 263-270 ISSN 0862-8351 Institutional support: RVO:68378076 Keywords : ethnology * social and cultural anthropology * migration * Czech Republic Subject RIV: AC - Archeology, Anthropology, Ethnology

  5. Pholiota highlandensis var. citrinosquamulosa (Fungi, Agaricales) is conspecific with Pholiota gallica

    Czech Academy of Sciences Publication Activity Database

    Holec, J.; Kolařík, Miroslav; Borgarino, D.; Bidaud, A.; Moreau, P.A.


    Roč. 103, 1-2 (2016), s. 251-263 ISSN 0029-5035 Institutional support: RVO:61388971 Keywords : Basidiomycota * Strophariaceae * phylogeny Subject RIV: EE - Microbiology, Virology Impact factor: 0.941, year: 2016

  6. Research Facilities for Solar Astronomy at ARIES P. Pant

    Indian Academy of Sciences (India)

    Aryabhatta Research Institute of Observational Sciences (ARIES), Manora Peak,. Nainital 263 129 .... station-20 computer, a GPS clock for accurate timing, etc. The various CCD ... circulation unit is used for cooling the camera head up to −25.

  7. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 263 ... Vol 6, No 1 (2007), A review of Chest Pain in Nigerian Hypertensive ... Acute Toxicity, Analgesic Potential and Preliminary Antimocrobial ... Antihypertensive Drug combinations in Lagos University Teaching Hospital, Abstract.

  8. EJOTMAS 20

    African Journals Online (AJOL)


    EJOTMAS: EKPOMA JOURNAL OF THEATRE AND MEDIA ARTS. 263. INDIGENOUS .... science and all their social institutions, including their system of belief .... Nigerian Tourism Development Corporation has been working with the states to ...

  9. Massenspektrometrie in der organischen Chemie

    Czech Academy of Sciences Publication Activity Database

    Schröder, Detlef


    Roč. 57, - (2009), s. 262-263 ISSN 1439-9598 Institutional research plan: CEZ:AV0Z40550506 Keywords : organic chemistry * mass spectrometry Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.133, year: 2009

  10. Dibutyryl c-AMP as an inducer of sporidia formation: Biochemical ...

    Indian Academy of Sciences (India)


    and Technology, Pantnagar 263 145, India. *Corresponding author ... on growth and morphological differentiation of Tilletia indica. Exponential growth was .... developmentally related markers on fungal population. Number of these markers is ...

  11. Basic student nurse perceptions about clinical instructor caring

    African Journals Online (AJOL)

    Gerda-Marie Meyer

    instructor caring. A structured self administered questionnaire using the Nursing Student .... 263). The high enthusiasm and belief in the ability to care may result in .... treatment and protection from discomfort and harm (Grove,. Burns, & Gray ...

  12. Drug: D02679 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available psychiatric agent ... DG01905 ... Phenothiazine antipsychotics ... Phenothiazine derivative ... CAS: 3819-00-9 PubChem: 17396848 ChEMBL: CHEMBL1584 LigandBox: D02679 NIKKAJI: J8.263E ...

  13. Nález zásobnic ze střední doby hradištní u závrtu ZMF (Tetín, okr. Beroun)

    Czech Academy of Sciences Publication Activity Database

    Vencl, Slavomil


    Roč. 19, č. 1 (2015), s. 263-269 ISSN 1214-3553 Institutional support: RVO:67985912 Keywords : Middle Hillfort Period * storage jars * Bohemian Karst Subject RIV: AC - Archeology, Anthropology, Ethnology

  14. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Author Affiliations. Abraham F Jalbout1 Md Abul Haider Shipar2. Instituto de Quimica, Universidad Nacional Autonoma de Mexico, Mexico City, Mexico; Faculty of Engineering, Chiba University, Inage-ku, Chiba 263-8522, Japan ...

  15. Sur, a former late-glacial and Holocene lake at the westernmost margin of the Carpathians

    Czech Academy of Sciences Publication Activity Database

    Petr, L.; Žáčková, P.; Matys Grygar, Tomáš; Píšková, Anna; Křížek, M.; Treml, V.


    Roč. 85, č. 3 (2013), s. 239-263 ISSN 0032-7786 Institutional support: RVO:61388980 Keywords : Geochemistry * Geomorphology * Multi-proxy reconstruction * Palaeobotany * Palaeolimnology * Pannonia Subject RIV: DD - Geochemistry Impact factor: 2.778, year: 2013

  16. Association Between the Solar Wind Speed, Interplanetary Magnetic ...

    Indian Academy of Sciences (India)

    Meena Pokharia


    Nov 27, 2017 ... Department of Physics, M. B. Government P. G. College, Haldwani, Nainital 263 139, India. ∗. Corresponding author. E-mail: ...... service and also thankful to ARIES, Nainital for pro-.

  17. Elementõ polititsheskoi mifologii Tjuttsheva (kommentari k state 1844 g.) / Aleksandr Ospovat

    Index Scriptorium Estoniae

    Ospovat, Aleksandr


    Bibl. lk. 259-263. Kokkuvõte inglise k. lk. 321. Kiri ajalehe "Allgemeine Zeitung" (Augsburg) toimetajale Gustav Kolbile (1844, prantsuse k.). Artikli venek. versioon (pealk. "Venemaa ja Saksamaa") publitseeriti ajakirjas Russki arhiv (1873, nr. 10)

  18. 12 CFR 225.6 - Penalties for violations. (United States)


    ... Act or any regulation or order issued under it, or for making a false entry in any book, report, or... be made in accordance with subpart C of the Board's Rules of Practice for Hearings (12 CFR part 263...

  19. First record of Philometra katsuwoni (Nematoda, Philometridae), a parasite of skipjack tuna Katsuwonus pelamis (Perciformes, Scombridae), off South American Atlantic coast

    Czech Academy of Sciences Publication Activity Database

    Cárdenas, M. Q.; Moravec, František; Kohn, A.


    Roč. 9, č. 2 (2009), s. 263-266 ISSN 1676-0611 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * Katsuwonus * Brazil Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine

  20. Development of an Assay for the Detection of PrPres in Blood and Urine Based on PMCA Assay an ELISA Methods

    National Research Council Canada - National Science Library

    Rohwer, Robert G; Gregori, Luisa L


    .... The assay is been developed with test material from two animal models: the hamster infected with the 263K strain of scrapie and the sheep either naturally or experimentally infected with scrapie...

  1. 77 FR 42476 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; Reef Fish Fishery of the Gulf of... (United States)


    ... submitting comments. Mail: Rich Malinowski, Southeast Regional Office, NMFS, 263 13th Avenue South, St...: Rich Malinowski, Southeast Regional Office, telephone 727-824-5305, email

  2. 76 FR 13122 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; Reef Fish Fishery of the Gulf of... (United States)


    ... Malinowski, Southeast Regional Office, NMFS, 263 13th Avenue, South, St. Petersburg, FL 33701. Instructions... INFORMATION CONTACT: Rich Malinowski, 727-824-5305; fax: 727-824-5308. SUPPLEMENTARY INFORMATION: The reef...

  3. 78 FR 76807 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; Revisions to Dealer Permitting... (United States)


    ... submitting comments. Mail: Rich Malinowski, Southeast Regional Office, NMFS, 263 13th Avenue South, St... CONTACT: Rich Malinowski, Southeast Regional Office, NMFS, telephone 727-824-5305; email: rich.malinowski...

  4. Indications and Complications of Tube Thoracostomy with ...

    African Journals Online (AJOL)

    ... surgeon and patients were followed up with serial chest X‑rays until certified cured. ... Others were trauma, 44 (26.3%), Parapneumonic effusion, 20 (12%), ... more frequent complications been empyema (5.6%) and pneumothorax (3.6%).

  5. ORF Alignment: NC_005786 [GENIUS II[Archive

    Lifescience Database Archive (English)


  6. 75 FR 78617 - Final Flood Elevation Determinations (United States)


    .... Rockport Creek Approximately 2,300 feet +260 Unincorporated Areas of downstream of Martin Hot Spring County. Luther King Boulevard. Approximately 1,300 feet +263 downstream of Martin Luther King Boulevard. Town...

  7. 75 FR 5925 - Proposed Flood Elevation Determinations (United States)


    ... Spring County. Martin Luther King Boulevard. Approximately 1,300 None +263 feet downstream of Martin Luther King Boulevard. Town Creek Approximately 2,300 None +253 Unincorporated Areas of feet downstream...

  8. 21. Effects of Gender Based Violence on Neurocognitive functioning ...

    African Journals Online (AJOL)


    correlation on both psychological and sexual abuse on working memory r (263) ... to capture violence that occurs as a result of the normative role expectations .... The Working Memory and Attention Domain comprising the Paced Auditory ...

  9. Supercapacitive performance of hydrous ruthenium oxide (RuO2 ...

    Indian Academy of Sciences (India)

    gel method have been employed to prepare ruthenium oxide thin films. Recently ... the potentiostat (263A EG&G, Princeton Applied Research. Potentiostat). .... is a mixed conductor that conducts protons and electrons in acidic solution (as ...

  10. Research Article Special Issue

    African Journals Online (AJOL)



    Feb 24, 2018 ... college students of Surigao del Sur State University in Cantilan, the northernmost municipality in ... their children. It is therefore critical that young individuals begin to learn about ..... I watch movies or entertainment shows. 2.63.

  11. The effect of full agonist/antagonist of D1 receptor on cognitive function in dizocilpine-treated rats

    Czech Academy of Sciences Publication Activity Database

    Bubeníková-Valešová, V.; Svoboda, Jan; Stuchlík, Aleš; Valeš, Karel


    Roč. 11, Suppl.1 (2008), s. 263-263 ISSN 1461-1457. [CINP Congress /26./. 13.07.2008-17.07.2008, Munich] R&D Projects: GA MŠk(CZ) 1M0517; GA MZd(CZ) NR9178; GA ČR(CZ) GA309/07/0341 Institutional research plan: CEZ:AV0Z50110509 Keywords : cpo1 * D1 receptor * schizophrenia * cognitive function Subject RIV: FH - Neurology

  12. Fibrin nanostructures for biomedical applications

    Czech Academy of Sciences Publication Activity Database

    Riedelová-Reicheltová, Zuzana; Brynda, Eduard; Riedel, Tomáš


    Roč. 65, Suppl. 2 (2016), S263-S272 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LQ1604 Institutional support: RVO:61389013 Keywords : fibrinogen * fibrin-bound thrombin * nanostructures Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.461, year: 2016

  13. The Moral Challenge of Dangerous Climate Change: Values, Poverty, and Policy

    DEFF Research Database (Denmark)

    Crabtree, Andrew


    Book review of: The Moral Challenge of Dangerous Climate Change: Values, Poverty, and Policy by Darrel Moellendorf. New York: Cambridge University Press, 2014, pp. 263 (paperback), ISBN 978-1-107-67850-7......Book review of: The Moral Challenge of Dangerous Climate Change: Values, Poverty, and Policy by Darrel Moellendorf. New York: Cambridge University Press, 2014, pp. 263 (paperback), ISBN 978-1-107-67850-7...

  14. Variation in NAT2 acetylation phenotypes is associated with differences in food-producing subsistence modes and ecoregions in Africa

    Czech Academy of Sciences Publication Activity Database

    Podgorná, Eliška; Diallo, I.; Vangenot, Ch.; Sanchez-Mazas, A.; Sabbagh, A.; Černý, Viktor; Poloni, E. S.


    Roč. 15, č. 263 (2015) ISSN 1471-2148 R&D Projects: GA ČR GA13-37998S Institutional support: RVO:67985912 Keywords : NAT2 * acetylation polymorphism * African Sahel * pastoral nomads * subsistence mode * ecoregion * natural selection Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 3.406, year: 2015

  15. RLE (Research Laboratory of Electronics) Progress Report Number 126. (United States)


    Loudness 184 26.3 Binaural Hearing 186 S.26.4 Hearing Aid Research 188 26.5 Discrimination of Spectral Shape 191 26.6 Tactile Perception of Speech... beating in the pulse. It is these high intensities which are responsible for large A.C. Stark shifts and ionization RLE P.R. No. 126 12 * . . . Atomic...Department of Aeronautics and Astronautics, Massachusetts Institute of Technology, 1984. 26.3 Binaural Hearing National Institutes of Health (Grant

  16. PI3K and Bcl-2 inhibition primes glioblastoma cells to apoptosis through downregulation of Mcl-1 and Phospho-BAD. (United States)

    Pareja, Fresia; Macleod, David; Shu, Chang; Crary, John F; Canoll, Peter D; Ross, Alonzo H; Siegelin, Markus D


    Glioblastoma multiforme (GBM) is a highly malignant human brain neoplasm with limited therapeutic options. GBMs display a deregulated apoptotic pathway with high levels of the antiapoptotic Bcl-2 family of proteins and overt activity of the phosphatidylinositol 3-kinase (PI3K) signaling pathway. Therefore, combined interference of the PI3K pathway and the Bcl-2 family of proteins is a reasonable therapeutic strategy. ABT-263 (Navitoclax), an orally available small-molecule Bcl-2 inhibitor, and GDC-0941, a PI3K inhibitor, were used to treat established glioblastoma and glioblastoma neurosphere cells, alone or in combination. Although GDC-0941 alone had a modest effect on cell viability, treatment with ABT-263 displayed a marked reduction of cell viability and induction of apoptotic cell death. Moreover, combinatorial therapy using ABT-263 and GDC-0941 showed an enhanced effect, with a further decrease in cellular viability. Furthermore, combination treatment abrogated the ability of stem cell-like glioma cells to form neurospheres. ABT-263 and GDC-0941, in combination, resulted in a consistent and significant increase of Annexin V positive cells and loss of mitochondrial membrane potential compared with either monotherapy. The combination treatment led to enhanced cleavage of both initiator and effector caspases. Mechanistically, GDC-0941 depleted pAKT (Serine 473) levels and suppressed Mcl-1 protein levels, lowering the threshold for the cytotoxic actions of ABT-263. GDC-0941 decreased Mcl-1 in a posttranslational manner and significantly decreased the half-life of Mcl-1 protein. Ectopic expression of human Mcl-1 mitigated apoptotic cell death induced by the drug combination. Furthermore, GDC-0941 modulated the phosphorylation status of BAD, thereby further enhancing ABT-263-mediated cell death. Combination therapy with ABT-263 and GDC-0941 has novel therapeutic potential by specifically targeting aberrantly active, deregulated pathways in GBM, overcoming

  17. Conjunctival Lymphoma

    DEFF Research Database (Denmark)

    Kirkegaard, Marina M; Rasmussen, Peter K; Coupland, Sarah E


    IMPORTANCE: To date, the clinical features of the various subtypes of conjunctival lymphoma (CL) have not been previously evaluated in a large cohort. OBJECTIVE: To characterize subtype-specific clinical features of CL and their effect on patient outcome. DESIGN, SETTING, AND PARTICIPANTS...... age was 61.3 years, and 55.1% (145 of 263) were female. All lymphomas were of B-cell type. The most frequent subtype was extranodal marginal zone lymphoma (EMZL) (68.4% [180 of 263]), followed by follicular lymphoma (FL) (16.3% [43 of 263]), mantle cell lymphoma (MCL) (6.8% [18 of 263]), and diffuse...... large B-cell lymphoma (DLBCL) (4.6% [12 of 263). Conjunctival lymphoma commonly manifested in elderly individuals (age range, 60-70 years old), with EMZL having a female predilection (57.8% [104 of 180]) and MCL having a marked male predominance (77.8% [14 of 18]). Unlike EMZL and FL, DLBCL and MCL were...

  18. Effects of oral Lactobacillus administration on antioxidant activities and CD4+CD25+forkhead box P3 (FoxP3)+ T cells in NZB/W F1 mice. (United States)

    Tzang, Bor-Show; Liu, Chung-Hsien; Hsu, Kuo-Ching; Chen, Yi-Hsing; Huang, Chih-Yang; Hsu, Tsai-Ching


    Systemic lupus erythematosus (SLE) is an autoimmune disease that is characterised by a dysregulation of the immune system, which causes inflammation responses, excessive oxidative stress and a reduction in the number of cluster of differentiation (CD)4+CD25+forkhead box P3 (FoxP3)+ T cells. Supplementation with certain Lactobacillus strains has been suggested to be beneficial in the comprehensive treatment of SLE. However, little is known about the effect and mechanism of certain Lactobacillus strains on SLE. To investigate the effects of Lactobacillus on SLE, NZB/W F1 mice were orally gavaged with Lactobacillus paracasei GMNL-32 (GMNL-32), Lactobacillus reuteri GMNL-89 (GMNL-89) and L. reuteri GMNL-263 (GMNL-263). Supplementation with GMNL-32, GMNL-89 and GMNL-263 significantly increased antioxidant activity, reduced IL-6 and TNF-α levels and significantly decreased the toll-like receptors/myeloid differentiation primary response gene 88 signalling in NZB/W F1 mice. Notably, supplementation with GMNL-263, but not GMNL-32 and GMNL-89, in NZB/W F1 mice significantly increased the differentiation of CD4+CD25+FoxP3+ T cells. These findings reveal beneficial effects of GMNL-32, GMNL-89 and GMNL-263 on NZB/W F1 mice and suggest that these specific Lactobacillus strains can be used as part of a comprehensive treatment of SLE patients.

  19. Ortholog Alleles at Xa3/Xa26 Locus Confer Conserved Race-Specific Resistance against Xanthomonas oryzae in Rice

    Institute of Scientific and Technical Information of China (English)

    Hong-Jing Li; Xiang-Hua Li; Jing-Hua Xiao; Rod A. Wing; Shi-Ping Wang


    The rice disease resistance (R) gene Xa3/Xa26 (having also been named Xa3 and Xa26) against Xanthomonas oryzae pv.oryzae (Xoo),which causes bacterial blight disease,belongs to a multiple gene family clustered in chromosome 11 and is from an AA genome rice cultivar (Oryza sativa L.).This family encodes leucine-rich repeat (LRR) receptor kinasetype proteins.Here,we show that the orthologs (alleles) of Xa3/Xa26,Xa3/Xa26-2,and Xa3/Xa26-3,from wild Oryza species O.officinalis (CC genome) and O.minuta (BBCC genome),respectively,were also R genes against Xoo.Xa3/Xa26-2 and Xa3/Xa26-3 conferred resistance to 16 of the 18 Xoo strains examined.Comparative sequence analysis of the Xa3/Xa26 families in the two wild Oryza species showed that Xa3/Xa26-3 appeared to have originated from the CC genome of O.minuta.The predicted proteins encoded by Xa3/Xa26,Xa3/Xa26-2,and Xa3/Xa26-3 share 91-99% sequence identity and 94-99% sequence similarity.Transgenic plants carrying a single copy of Xa3/Xa26,Xa3/Xa26-2,or Xa3/Xa26-3,in the same genetic background,showed a similar resistance spectrum to a set of Xoo strains,although plants carrying Xa3/Xa26-2 or Xa3/Xa26-3 showed lower resistance levels than the plants carrying Xa3/Xa26.These results suggest that the Xa3/Xa26 locus predates the speciation of A and C genome,which is approximately 7.5 million years ago.Thus,the resistance specificity of this locus has been conserved for a long time.

  20. Archeological Excavations at Two Prehistoric Campsites Near Keystone Dam, El Paso, Texas. (United States)


    Flotacion Microdebitate Analysis 246 Groundstone Artifacts 253 Slab Metates 253 Manos 253 PesLIes 253 Groundstone Fragments 263 Anvils 263 Polishing...important new information to our understanding of local prehistory. The bulk ot O’LaugnliLn’s (1980) work in the area was directed toward the excavation...contains or summarizes the bulk of L111 ptiiaisiitd( iaci on iitnic artiract frequenCies irom El Paso ’Ir’Ia Sites. fhese data, along with those from the

  1. Proton capture by magnetic monopoles

    International Nuclear Information System (INIS)

    Olaussen, K.; Olsen, H.A.; Oeverboe, I.; Osland, P.


    In the Kazama-Yang approximation, the lowest monopole-proton bound states have binding energies of 938 MeV, 263 keV, 105 eV, and 0.04 eV. The cross section for radiative capture to these states is for velocities β = 10 -5 - 10 -3 found to be of the order of 10 -28 - 10 -26 cm 2 . For the state that has a binding energy of 263 keV, the capture length in water is 171 x (β/10 -4 )sup(0.48) m. Observation of photons from the capture process would indicate the presence of monopoles. (orig.)

  2. X-linked Acrogigantism (X-LAG) Syndrome: Clinical Profile and Therapeutic Responses


    Beckers, Albert; Lodish, Maya Beth; Trivellin, Giampaolo; Rostomyan, Liliya; Lee, Misu; Faucz, Fabio R; Yuan, Bo; Choong, Catherine S; Caberg, Jean-Hubert; Verrua, Elisa; Naves, Luciana Ansaneli; Cheetham, Tim D; Young, Jacques; Lysy, Philippe A; Petrossians, Patrick


    X-linked acro-gigantism (X-LAG) is a new syndrome of pituitary gigantism, caused by microduplications on chromosome Xq26.3, encompassing the gene GPR101, which is highly upregulated in pituitary tumors. We conducted this study to explore the clinical, radiological and hormonal phenotype and responses to therapy in patients with X-LAG syndrome. The study included 18 patients (13 sporadic) with X-LAG and a microduplication in chromosome Xq26.3. All sporadic cases had unique duplications and the...

  3. Aggressive tumor growth and clinical evolution in a patient with X-linked acro-gigantism syndrome.


    Naves, Luciana A.; Daly, Adrian Francis; Dias, Luiz Augusto; Yuan, Bo; Zakir, Juliano Coelho Oliveira; Barra, Gustavo Barcellos; Palmeira, Leonor; Villa, Chiara; Trivellin, Giampaolo; Junior, Armindo Jreige; Neto, Florencio Figueiredo Cavalcante; Liu, Pengfei; Pellegata, Natalia S.; Stratakis, Constantine A.; Lupski, James R.


    X-linked acro-gigantism (X-LAG) syndrome is a newly described disease caused by microduplications on chromosome Xq26.3 leading to copy number gain of GPR101. We describe the clinical progress of a sporadic male X-LAG syndrome patient with an Xq26.3 microduplication, highlighting the aggressive natural history of pituitary tumor growth in the absence of treatment. The patient first presented elsewhere aged 5 years 8 months with a history of excessive growth for >2 years. His height was 163 cm,...

  4. Clinico-hysteroscopic analysis of severe intrauterine adhesions ...

    African Journals Online (AJOL)

    Secondary dysmenorrhea and cyclical abdominal pain were found in 10.8% and 31.6% of the women respectively. The main aetiological events were complicated caesarean section (42.1%) and abdominal myomectomy (26.3%). The adhesions were mainly dense (52.6%) and multiple (94.7%) with complete involvement of ...

  5. Kruhatka Matthiolova (Cortusa matthioli) v Sudetech aneb anti-Hendrych

    Czech Academy of Sciences Publication Activity Database

    Danihelka, Jiří


    Roč. 46, č. 2 (2012), s. 251-263 ISSN 1211-5258 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60050516 Keywords : Central Europe * C. Schwenckfelt * history of botany Subject RIV: EF - Botanics

  6. Assessing food security status among farming households in Ibadan ...

    African Journals Online (AJOL)

    ... relative to urban farming practices was found to influence the food security status of the respondents. This is justified from the χ2 value of 9.263 and 6.443 returned for this factor and which is significant at 0.05 level of significance. Keywords: Food security; Odds; Urban farming. Moor Journal of Agricultural Research Vol.

  7. Identification and characterization of a nationwide Danish adult common variable immunodeficiency cohort

    DEFF Research Database (Denmark)

    Westh, Lena; Mogensen, Trine Hyrup; Dalgaard, Lars Skov


    infections were seen in 92.7% of the patients. The prevalence of non-infectious complications was similar to that of previously reported cohorts: bronchiectasis (35.8%), splenomegaly (22.4%), lymphadenopathy (26.3%), granulomatous inflammation (3.9%) and idiopathic thrombocytopenic purpura (14.5%). Non...

  8. Localization of MHC class II/human cartilage glycoprotein-39 complexes in synovia of rheumatoid arthritis patients using complex-specific monoclonal antibodies

    NARCIS (Netherlands)

    Steenbakkers, Peter G. A.; Baeten, Dominique; Rovers, Eric; Veys, Eric M.; Rijnders, Antonius W. M.; Meijerink, Jan; de Keyser, Filip; Boots, Annemieke M. H.


    Recently human cartilage gp-39 (HC gp-39) was identified as a candidate autoantigen in rheumatoid arthritis (RA). To further investigate the relevance of this Ag in RA, we have generated a set of five mAbs to a combination epitope of complexes of HC gp-39(263-275) and the RA-associated DR alpha beta

  9. Morphology evolution during cooling of quiescent immiscible polymer blends: matrix crystallization effect on the dispersed phase coalescence

    Czech Academy of Sciences Publication Activity Database

    Dimzoski, Bojan; Fortelný, Ivan; Šlouf, Miroslav; Sikora, Antonín; Michálková, Danuše


    Roč. 70, č. 1 (2013), s. 263-275 ISSN 0170-0839 R&D Projects: GA AV ČR IAA200500903 Institutional research plan: CEZ:AV0Z40500505 Keywords : polymer blends * coalescence * morphology evolution Subject RIV: BJ - Thermodynamics Impact factor: 1.491, year: 2013

  10. 21 CFR 522.460 - Cloprostenol sodium. (United States)


    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Cloprostenol sodium. 522.460 Section 522.460 Food... Cloprostenol sodium. (a)(1) Specifications. Each milliliter of the aqueous solution contains 263 micrograms of cloprostenol sodium (equivalent to 250 micrograms of cloprostenol) in a sodium citrate, anhydrous citric acid...

  11. Prevalence of camel tuberculosis and associated risk factors in ...

    African Journals Online (AJOL)

    Kremer, K. and Van-Soolingen, D., 2002. The last outbreak of bovine tuberculosis in cattle in the Czech Republic in 1995 was caused by Mycobacterium bovis subspe- cies caprae. Vet. Med., 47, 251–263. Pavlik, I., Trcka, I., Parmova, I., Svobodova, J., Melicharek, I., Nagy, G., Cvetnic, Z.,. Ocepek, M., Pate, M. and Lipiec, M., ...

  12. Žena ve vědě: Alena Lengerová

    Czech Academy of Sciences Publication Activity Database

    Bahenská, Marie


    Roč. 3, č. 2 (2011), s. 248-263 ISSN 1803-9448 Institutional research plan: CEZ:AV0Z80770509 Keywords : Lengerová, Alena * history of science * Czechoslovak Academy of Science s Subject RIV: AB - History

  13. Blurring alien introduction pathways risks losing focus on invasive species policy

    Czech Academy of Sciences Publication Activity Database

    Hulme, P. E.; Bacher, S.; Kenis, M.; Kühn, I.; Pergl, Jan; Pyšek, Petr; Roques, A.; Vila, M.


    Roč. 10, č. 2 (2017), s. 265-266 ISSN 1755-263X Grant - others:AV ČR(CZ) AP1002 Program:Akademická prémie - Praemium Academiae Institutional support: RVO:67985939 Keywords : biological invasions * introductions pathways * management Subject RIV: EH - Ecology, Behaviour OBOR OECD: Biodiversity conservation Impact factor: 7.020, year: 2016

  14. Spatial distribution of bird communities in small forest fragments in central Europe in relation to distance to the forest edge, fragment size and type of forest

    Czech Academy of Sciences Publication Activity Database

    Hofmeister, Jeňýk; Hošek, J.; Brabec, Marek; Kočvara, R.


    Roč. 401, OCT (2017), s. 255-263 ISSN 0378-1127 Institutional support: RVO:67179843 ; RVO:67985807 Keywords : Clearing * Dryocopus martius * Forest bird * Forest management * Generalized additive model * Habitat fragmentation Subject RIV: GK - Forestry; BB - Applied Statistics, Operational Research (UIVT-O) OBOR OECD: Forestry; Statistics and probability (UIVT-O) Impact factor: 3.064, year: 2016

  15. Design and Optimization of Reverse-Transcription Quantitative PCR Experiments

    Czech Academy of Sciences Publication Activity Database

    Tichopád, A.; Kitchen, R.; Riedmaier, I.; Becker, Ch.; Ståhlberg, A.; Kubista, Mikael


    Roč. 55, č. 10 (2009), s. 1816-1823 ISSN 0009-9147 Institutional research plan: CEZ:AV0Z50520701 Keywords : Design * optimization * RT qPCR Subject RIV: EG - Zoology Impact factor: 6.263, year: 2009

  16. Profile of children with cerebral palsy attending outpatient ...

    African Journals Online (AJOL)

    Jaundice (39.9%), asphyxia (26.8%) and infection (17.4%) were the leading causes of CP and spastic CP was the most common type (81.7%). Quadriplegic CP presentation was predominant (67.1%), and leading co-morbidities were mental retardation (31%) and speech impairment (26.3%). About 50% of the children ...

  17. Optical replication techniques for image slicers

    Czech Academy of Sciences Publication Activity Database

    Schmoll, J.; Robertson, D.J.; Dubbeldam, C.M.; Bortoletto, F.; Pína, L.; Hudec, René; Prieto, E.; Norrie, C.; Ramsay- Howat, S.


    Roč. 50, 4-5 (2006), s. 263-266 ISSN 1387-6473 Institutional research plan: CEZ:AV0Z10030501 Keywords : smart focal planes * image slicers * replication Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.914, year: 2006

  18. The cestode community in northern fur seals (Callorhinus ursinus) on St. Paul Island, Alaska

    Czech Academy of Sciences Publication Activity Database

    Kuzmina, T.A.; Hernández-Orts, Jesús S.; Lyons, E.T.; Spraker, T.R.; Kornyushyn, V.V.; Kuchta, Roman


    Roč. 4, č. 2 (2015), s. 256-263 ISSN 2213-2244 R&D Projects: GA ČR GAP506/12/1632 Institutional support: RVO:60077344 Keywords : Adenocephalus pacificus (Diphyllobothrium pacificum) * Anophryocephalus cf. ochotensis * Cestoda * Diphyllobothridea * Diplogonoporus tetrapterus * Otariidae, North Pacific * Tapeworms * Tetrabothriidea Subject RIV: EG - Zoology

  19. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)


    Jan 27, 2016 ... Author Affiliations. B. Rani1 Alok C. Gupta1 Paul J. Wiita2. Aryabhatta Research Institute of Observational Sciences (ARIES), Nainital 263 129, India. Department of Physics, The College of New Jersey, P.O. Box 7718, Ewing, NJ 08628, USA.

  20. Critical Review of the Heats of Formation of HNO and Some Related Species

    National Research Council Canada - National Science Library

    Anderson, William


    .... It was found that predissociation experiments, which have gone largely unnoticed for over 15 yr, lead to a significant revision in the recommended value. The new value, 25.6 + 0.6 kcal/mol and 25.6 - 0.1 kcal/mol (298 K; 26.3 kcal/mol at 0 K...

  1. Reproductive ecology and egg production of the radiated tortoise ...

    African Journals Online (AJOL)

    We captured and marked 1438 radiated tortoises of which 26% were adults. Mating and nesting coincided with the rainy season, and mating events peaked in December, shortly before females started nesting in January. The incubation period was approximately 263–342 days, and hatchlings emerged after the onset of the ...

  2. Edward U Lorenz

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Edward U Lorenz. Articles written in Resonance – Journal of Science Education. Volume 20 Issue 3 March 2015 pp 260-263 Classics. Predictability: Does the Flap of a Butterfly's Wings in Brazil Set off a Tornado in Texas? Edward U Lorenz · More Details Fulltext ...

  3. Hobojista Arnošt König a jeho působení v pražském hudebním životě

    Czech Academy of Sciences Publication Activity Database

    Kolátorová, Petra


    Roč. 49, č. 3 (2012), s. 263-284 ISSN 0018-7003 R&D Projects: GA ČR GA408/08/1020 Institutional support: RVO:68378076 Keywords : Arnošt König * oboist * Prague´s musical life * Antonín Dvořák Subject RIV: AL - Art, Architecture, Cultural Heritage

  4. Low-level determination of silicon in biological materials using radiochemical neutron activation analysis

    Czech Academy of Sciences Publication Activity Database

    Kučera, Jan; Zeisler, R.


    Roč. 263, č. 3 (2005), s. 811-816 ISSN 0236-5731 R&D Projects: GA ČR GA202/03/0891 Institutional research plan: CEZ:AV0Z10480505 Keywords : gel breast implants * alzhemers-disease * renal-failure Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.460, year: 2005

  5. Human Problem Solving in 2012 (United States)

    Funke, Joachim


    This paper presents a bibliography of 263 references related to human problem solving, arranged by subject matter. The references were taken from PsycInfo and Academic Premier data-base. Journal papers, book chapters, and dissertations are included. The topics include human development, education, neuroscience, and research in applied settings. It…

  6. A Century of Change: The Evolution of School Library Resources, 1915-2015 (United States)

    Lamb, Annette


    School libraries have been in existence since at least the eighth century. However, it wasn't until the twentieth century that the school library was seen primarily as "a source of enrichment for the curriculum, and a means of developing reading and study habits in the pupils" (Clyde 1981, 263). While the formats available and tools for…

  7. Toxic Hazards Research Unit Annual Technical Report: 1985 (United States)


    varnish makers’ and painters’ naphtha, Toxicol. Appl. Pharmacol., 32:263-281. Carpenter, C. P.. E. R. Kinkead, D. L. Geary, L. J. Sullivan, Jr., and J...and Pharmacology of Inorganic and Fluorine Contairnin Compounds, AMRL-TR-67-224, Aerospace Medical Research Laboiatory, Wright-Patterson Air Force Base

  8. Tropical Journal of Pharmaceutical Research - Vol 16, No 2 (2017)

    African Journals Online (AJOL)

    Biosynthesis of lovastatin using agro-industrial wastes as carrier substrates · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Sadia Javed, Munazzah Meraj, Saqib Mahmood, Arruje Hameed, Farah Naz, Sameera Hassan, Rao Irfan, 263-269.

  9. Particle Flux in the Western Black Sea in the Present and over the Last 5,000 Years: Temporal Variability, Sources, Transport Mechanisms. (United States)


    unit i in the deep basil o,’res is 263 rm. Thus, based on this calculation the annua! deposition at the suGre sites is on average 4.7 times higher than...AAS) y espectrografia de emision (OES): Anales de Quimica, v. 81, p. 48-55. % %. -131- Baumgartner, T., V. Ferreira-Bartrina, H. Schrader, and A

  10. Greater Focus Needed on Alien Plant Impacts in Protected Areas

    Czech Academy of Sciences Publication Activity Database

    Hulme, P. E.; Pyšek, Petr; Pergl, Jan; Jarošík, Vojtěch; Schaffner, U.; Vila, M.


    Roč. 7, č. 5 (2014), s. 459-466 ISSN 1755-263X R&D Projects: GA ČR(CZ) GAP504/11/1028 Institutional support: RVO:67985939 Keywords : plant invasions * impact * protected areas Subject RIV: EF - Botanics Impact factor: 7.241, year: 2014

  11. Arithmetic on the European Logarithmic Microprocessor

    Czech Academy of Sciences Publication Activity Database

    Coleman, J. N.; Chester, E. I.; Softley, C. I.; Kadlec, Jiří


    Roč. 49, č. 7 (2000), s. 702-715 ISSN 0018-9340 Grant - others:MŠMT(CZ) OK 314; MŠMT(CZ) LN00B096; Commission EC(XE) ESPRIT 33544 HSLA Program:OK; LN Institutional research plan: AV0Z1075907 Subject RIV: JC - Computer Hardware ; Software Impact factor: 1.263, year: 2000

  12. Assessment of Maternal Satisfaction with Facility-based Childbirth ...

    African Journals Online (AJOL)

    AJRH Managing Editor

    In Senegal, only 60% of mothers in rural areas deliver in health facilities. ... experience is one of the factors in their choosing to deliver in such facilities in ... maternal satisfaction with childbirth care and 23 standard care survey items was assessed. .... cost*. 0.64. Cheap. 30 (11.6). Affordable. 140 (54.1). Expensive. 68 (26.3).

  13. The Relationship between Spirituality and the Use of Self-Regulation Strategies by Hospitalized Adult Oncology Patients (United States)


    Titlebaum, 1988. Stoyva, 1977; Vines, 1988; Wood & Pesut, 1981; Zahourek , 1988). However, any behavior an individual uses to consciously modify a...Journal of Nursing Research, 3, 263-271. Zahourek , K. (1987). Clinical hypnosis in holistic healing. Holistic Nursing Practice, 2(1), 15-24. 76 APPENDIX A

  14. Structural study of a novel antimicrobial peptide isolated from the venom of bee Anthophora plumipes

    Czech Academy of Sciences Publication Activity Database

    Čujová, Sabína; Veverka, Václav; Buděšínský, Miloš; Bednárová, Lucie; Čeřovský, Václav


    Roč. 20, Suppl S1 (2014), S263-S264 ISSN 1075-2617. [European Peptide Symposium /33./. 31.08.2014-05.09.2014, Sofia] Institutional support: RVO:61388963 Keywords : antimicrobial peptides * membranes * CD-spectroscopy * NMR spectroscopy Subject RIV: CC - Organic Chemistry

  15. A review of the distribution of Yellowhammer (Emberiza citrinella) dialects in Europe reveals the lack of a clear macrogeographic pattern

    Czech Academy of Sciences Publication Activity Database

    Petrusková, T.; Diblíková, L.; Pipek, P.; Frauendorf, E.; Procházka, Petr; Petrusek, A.


    Roč. 156, č. 1 (2015), s. 263-273 ISSN 0021-8375 Institutional support: RVO:68081766 Keywords : Emberiza citrinella * Song variation * Dialect nomenclature * Online sources * Macrogeographic patterns Subject RIV: EG - Zoology Impact factor: 1.419, year: 2015

  16. Aplikace nízkých teplot pro zvýšení katodoluminiscenčního signálu v rastrovacím elektronovém mikroskopu

    Czech Academy of Sciences Publication Activity Database

    Vaškovicová, Naděžda; Skoupý, Radim; Krzyžánek, Vladislav


    Roč. 62, č. 10 (2017), s. 260-263 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : scanning electron microscopy * cathodoluminescence * diamonds * CL spectrums * cryo-SEM * contamination Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering OBOR OECD: Electrical and electronic engineering

  17. 75 FR 78940 - Sales-Based Royalties and Vendor Allowances (United States)


    ... acquired for resale. These costs include licensing and franchise costs incurred in securing the contractual... capitalizable licensing and franchise costs within the meaning of Sec. 1.263A-1(e)(3)(ii)(U). The proposed... produced or property acquired for resale: * * * * * (U) Licensing and franchise costs. (1) * * * These...

  18. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. K Ankamma. Articles written in Sadhana. Volume 36 Issue 2 April 2011 pp 223-249. In-plane anisotropy in tensile deformation and its influence on the drawability of Nimonic C–263 alloy sheets · K Ankamma D V V Satyanarayana G Chandramohan Reddy M Komaraiah N Eswara Prasad.

  19. G Chandramohan Reddy

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. G Chandramohan Reddy. Articles written in Sadhana. Volume 36 Issue 2 April 2011 pp 223-249. In-plane anisotropy in tensile deformation and its influence on the drawability of Nimonic C–263 alloy sheets · K Ankamma D V V Satyanarayana G Chandramohan Reddy M Komaraiah N Eswara ...

  20. Perceived Social Support and Locus of Control as the Predictors of Vocational Outcome Expectations (United States)

    Isik, Erkan


    The purpose of this study was to examine the relationships of vocational outcome expectation to social support which is an environmental factor and locus of control which is a personal factor. With this purpose, using Social Cognitive Career Theory as the theoretical framework, 263 undergraduate students completed Vocational Outcome Expectations…

  1. Knowledge and attitude of primary health care staff screening and ...

    African Journals Online (AJOL)

    Husniyah D. Qasem


    Aug 23, 2012 ... Attitude and knowledge of the primary health care ... ference was the psychological sub-domain (78.4 ± 20.3 compared with 69.4 ± 26.3%, P = 0.004). ... depression, posttraumatic stress disorder, and substance abuse.

  2. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Author Affiliations. A. Pirya1 S. Nandi1 D. J. Saikia2 C. Konar3 M. Singh1. Aryabhatta Research Institute of Observational Sciences, Manora Peak, Nainital 263 129, India. National Centre for Radio Astrophysics, Pune University Campus, Post Bag 3, Pune 411 007, India. ASIAA, Taipei 10617, Taiwan, Republic of China.

  3. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)


    Jan 27, 2016 ... Institute of Astronomy and Astrophysics, AS, Taipei 10617, Taiwan. Astronomical Observatory, Jagiellonian University, ul. Orla 171, 30244 Kraków, Poland. University of Hertfordshire, College Lane, Hatfield, UK. University of Southampton, Southampton SO17 1BJ, UK. ARIES, Manora Peak, Nainital 263 ...

  4. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 250 of 263 ... Vol 6, No 2 (2007), Prevalence of Plasmodial Parasiteamia among ... Vol 5, No 2 (2006), Profile of menarche among school children in ... Non-paretic Lower Limbs of Patients with Post-stroke Hemiplegia, Abstract ... Vol 6, No 2 (2007), Root Surface Caries Occurence in Relation to Social and Dental ...

  5. Yet another call for a greater role for good faith in the South African ...

    African Journals Online (AJOL)


    (Pty) Ltd and a KwaZulu-Natal franchisee, Dula Investments (Pty) Ltd, .... Company v The Paul Armstrong Company 263 NY 79; 188 NE 163; 1933 NY 167 (as recently ..... where his best advantage lies has a state of mind that falls short of the ...... ravages of apartheid, disadvantage and inequality are just immeasurable.

  6. 78 FR 26004 - Notice of Availability; Draft Environmental Impact Statement for the FutureGen 2.0 Project (United States)


    ... floodplain and wetland review requirements (10 CFR part 1022). DATES: DOE invites the public to comment on... commercial operations after this date. The oxy-combustion plant would be built on a 263-acre existing power... would be used for the injection facilities, associated infrastructure and buildings, and access roads...

  7. Factorial Validity and Psychometric Examination of the Exercise Dependence Scale-Revised (United States)

    Downs, Danielle Symons; Hausenblas, Heather A.; Nigg, Claudio R.


    The research purposes were to examine the factorial and convergent validity, internal consistency, and test-retest reliability of the Exercise Dependence Scale (EDS). Two separate studies, containing a total of 1,263 college students, were undertaken to accomplish these purposes. Participants completed the EDS and measures of exercise behavior and…

  8. Cyclotron targets and production technologies used for radiopharmaceuticals in NPI

    Czech Academy of Sciences Publication Activity Database

    Fišer, Miroslav; Kopička, Karel; Hradilek, Pavel; Hanč, Petr; Lebeda, Ondřej; Panek, T.; Vognar, M.


    Roč. 53, č. 2 (2003), s. A737-A743 ISSN 0011-4626 R&D Projects: GA AV ČR KSK4055109 Keywords : cyclotron * radiopharmaceuticals Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.263, year: 2003

  9. The Forgotten Service: Determining the US Army’s Role in Shaping American Strategy in the Asia-Pacific Region (United States)


    bombers 2,263 716 Tactical bombers 1,251 723 Fighters 3,456 1,897 Transporters 849 545 Naval aviation Land-based aircraft 204...ASEAN) is comprised of ten member states: Brunei Darussalam, Cambodia, Indonesia, Lao PDR, Malaysia, Myanmar , Philippines, Singapore, Thailand, and

  10. 29 CFR 1910.6 - Incorporation by reference. (United States)


    ... Test for Distillation of Petroleum Products, IBR approved for §§ 1910.106(a)(5) and 1910.119(b... of Pulverized Sugar and Cocoa, IBR approved for § 1910.263(k)(2)(i). (15) NFPA 68-1954 Guide for...

  11. Gifted Education in Preschool: Perceived Barriers and Benefits of Program Development (United States)

    Kettler, Todd; Oveross, Mattie E.; Bishop, James C.


    Substantial evidence supports the benefits of quality preschool education for children of all levels and backgrounds. However, early childhood gifted education services rarely exist in preschool centers. This study included 263 preschool centers representing geographic diversity in a southern state in the United States. Narrative data were…

  12. The "putative" role of transcription factors from HlWRKY family in the regulation of the final steps of prenylflavonid and bitter acids biosynthesis in hop (Humulus lupulus L.)

    Czech Academy of Sciences Publication Activity Database

    Matoušek, Jaroslav; Kocábek, Tomáš; Patzak, J.; Bříza, Jindřich; Siglová, Kristýna; Mishra, Ajay Kumar; Duraisamy, Ganesh Selvaraj; Týcová, Anna; Ono, E.; Krofta, K.


    Roč. 92, č. 3 (2016), s. 263-277 ISSN 0167-4412 R&D Projects: GA ČR GA13-03037S Institutional support: RVO:60077344 Keywords : Lupulin biosynthesis * Transcription factors * 5' RNA degradome * Plant promoter activation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.356, year: 2016

  13. 40 CFR 721.10193 - 1-Butanaminium, N-(3-aminopropyl)-N-butyl-N-(2-carboxyethyl)-, N-coco acyl derivs., inner salts. (United States)


    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false 1-Butanaminium, N-(3-aminopropyl)-N...-aminopropyl)-N-butyl-N-(2-carboxyethyl)-, N-coco acyl derivs., inner salts. (a) Chemical substance and...-aminopropyl)-N-butyl-N-(2-carboxyethyl)-, N-coco acyl derivs., inner salts (PMN P-06-263, Chemical B; CAS No...

  14. insights from a linkage map of the damselfly Ischnura elegans

    Indian Academy of Sciences (India)

    tion of achiasmiatic meiosis. Biochem. Genet. 19, 1237–. 1245. Cooper G., Miller P. L. and Holland P. W. H. 1994 Molecular genetic analysis of sperm competition in the damselfly Ischnura elegans (Vander Linden). Proc. R. Soc. London, Ser. B 263,. 1343–1349. Huxley J. S. 1928 Sexual differences in linkage in Gammar-.

  15. Letter to the Editor: About "Studies of Viscosity and Excess Molar Volume of Binary Mixtures of Propane-1,2 diol with Water at Various Temperatures"

    Czech Academy of Sciences Publication Activity Database

    Linek, Jan


    Roč. 208, 1-2 (2003), s. 261-263 ISSN 0378-3812 R&D Projects: GA ČR GA203/02/1098 Institutional research plan: CEZ:AV0Z4072921 Keywords : water * propane-1,2-diol * physical properties Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.165, year: 2003

  16. Review of Physical and Chemical Methods for Characterization of Fuels (United States)


    Reversed-phase chromatography REF Refractometry CAL Calorimetry POT Potentiometry CC Coordination chromatography MSB Mossbauer spectroscopy FS Flame...petroleum distillates ......... .... ........................ . .... A-2-63 Determination of the nitrogen content of shale oil furnace oil by refractometry ... refractometry ............................................ A-2-70 SAPONIFICATION NUMBER Saponification number of petroleum products.......................A-2

  17. Transformation of indole and quinoline by Desulfobacterium indolicum (DSM 3383)

    DEFF Research Database (Denmark)

    Licht, D.; Johansen, S.S.; Arvin, E.


    kinetics. The kinetic parameters for indole were an apparent maximum specific transformation rate (V-Amax) of 263 mu mol mg total protein(-1) day(-1) and an apparent half-saturation constant (K-Am) of 139 mu M. The V-Amax for quinoline was 170 mu mol mg total protein(-1) day(-1) and K-Am was 92 mu M...

  18. The Prevalence of Kidney Dysfunction and Associated Risk Factors ...

    African Journals Online (AJOL)

    Journal Home > Vol 44, No 3 (2017) > ... use of a kidney disease screening algorithm to guide choice of a cART regimen in the absence of serum creatinine. Despite ... Hypertension OR=2.63, (95% CI 1.11, 6.12) was the only factor found to be ...

  19. Magnetism in UPtAl under high pressure

    Czech Academy of Sciences Publication Activity Database

    Honda, F.; Eto, T.; Oomi, G.; Sechovský, V.; Andreev, Alexander V.; Takeshita, N.; Môri, N.


    Roč. 52, č. 2 (2002), s. 263-266 ISSN 0011-4626. [Czech and Slovak Conference on Magnetism /11./. Košice, 20.08.2001-23.08.2001] Institutional research plan: CEZ:AV0Z1010914 Keywords : UPtAl * high pressure * electrical resistivity Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.311, year: 2002

  20. Salivary gland carcinoma in Denmark 1990-2005: a national study of incidence, site and histology. Results of the Danish Head and Neck Cancer Group (DAHANCA)

    DEFF Research Database (Denmark)

    Bjørndal, Kristine; Krogdahl, Annelise; Therkildsen, Marianne Hamilton


    years. The parotid gland was the most common site (52.5%) followed by the minor salivary glands of the oral cavity (26.3%). The most frequent histological subtypes were adenoid cystic carcinoma (25.2%), mucoepidermoid carcinoma (16.9%), adenocarcinoma NOS (12.2%) and acinic cell carcinoma (10...

  1. 41 CFR 101-26.301 - Applicability. (United States)


    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Applicability. 101-26.301 Section 101-26.301 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 26-PROCUREMENT SOURCES AND PROGRAM 26.3...

  2. 41 CFR 101-26.301-2 - Issue of used, repaired, and rehabilitated items in serviceable condition. (United States)


    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Issue of used, repaired... and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 26-PROCUREMENT SOURCES AND PROGRAM 26.3-Procurement of GSA Stock Items...

  3. Impact of the changing ecology on intertidal polychaetes in an anthropogenically stressed tropical creek, India

    Digital Repository Service at National Institute of Oceanography (India)

    Quadros, G.; Sukumaran, S.; Athalye, R.P.

    of Bombay, India. Part I: quantification of heavy metal pollution of aquatic sediments and recogni- tion of environmental discriminants. Chem Geol 90:263– 283. doi:10.1016/0009-2541(91)90104-Y Sanders HL, Grassle JF, Hampson GR, Morse LS, Garner Price S...

  4. South African Neurosurgical Patient Management Survey

    African Journals Online (AJOL)


    cluding subarachnoid haemorrhage (SAH), traumatic brain injuries (TBI) ... Number. Percentage. <1960. 1. 2.6%. 1960-69. 3. 7.9%. 1970-79. 10. 26.3%. 1980-89. 7. 18.4% ... to Aneurysm surgery with particular reference to the use of early and ...

  5. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    LCAE, Département de Chimie, Faculté des Sciences, Université Mohammed Premier, Oujda 60000, Morocco; Institut de Physique de Rennes, UMR 625, Université de Rennes 1, Campus de Beaulieu Bat. 11 A, 263 av. Général Leclerc, 35042 Rennes Cedex, France; Department of Chemistry, University of Science ...

  6. Occurrence of Philometra lateolabracis (Nematoda: Philometridae) in the gonads of marine perciform fishes in the Mediterranean region

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Glamuzina, B.; Marino, G.; Merella, P.; Di Cave, D.


    Roč. 53, č. 3 (2003), s. 267-269 ISSN 0177-5103 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z6022909 Keywords : parasitic nematode * Philometra lateolabracis * marine fish Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.263, year: 2003

  7. A scent shield to survive: identification of the repellent compounds secreted by the male offspring of the cuckoo bumblebee Bombus vestalis

    Czech Academy of Sciences Publication Activity Database

    Lhomme, P.; Ayasse, M.; Valterová, Irena; Lecocq, T.; Rasmont, P.


    Roč. 157, č. 3 (2015), s. 263-270 ISSN 0013-8703 Institutional support: RVO:61388963 Keywords : Hymenoptera * Apidae * Psithyrus * social parasitism * repellent * GC-EAD * chemical camouflage Subject RIV: EG - Zoology Impact factor: 1.442, year: 2015

  8. 76 FR 11426 - Gulf Spill Restoration Planning; Public Scoping Meetings for the Programmatic Environmental... (United States)


    ... Center, 3401 Cultural Center Drive, Port Arthur, TX. 10. Thursday, March 31, 2011: Texas A & M at... restoration types should be sent to: NOAA Restoration Center, Attn: DWH PEIS Comments, 263 13th Avenue South... County Government Center, County Commissioner Chambers, 840 W. 11th Street, Panama City, FL. 3. Monday...

  9. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. M Komaraiah. Articles written in Sadhana. Volume 36 Issue 2 April 2011 pp 223-249. In-plane anisotropy in tensile deformation and its influence on the drawability of Nimonic C–263 alloy sheets · K Ankamma D V V Satyanarayana G Chandramohan Reddy M Komaraiah N Eswara Prasad.

  10. 20 CFR 628.804 - Authorized services. (United States)


    ...) Schoolwide projects for low-income schools shall meet the conditions in sections 263(g)(1) and (2) of the Act... programs that coordinate educational programs with work in the private sector. Subsidized wages are not... this chapter and shall: (i) Be for positions that pay the participant a wage that equals or exceeds on...

  11. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 121; Issue 2. Impact of continental meteorology and atmospheric circulation in the modulation of Aerosol Optical Depth over the Arabian Sea. Sandhya K Nair S Sijikumar S S Prijith. Volume 121 Issue 2 April 2012 pp 263-272 ...

  12. VizieR Online Data Catalog: Inner/outer HII regions: galaxy sample (Rodriguez-Baras+, 2018) (United States)

    Rodriguez-Baras, M.; Diaz, A. I.; Rosales-Ortega, F. F.; Sanchez, S. F.


    Physical properties for 263 isolated spiral galaxies, observed by the CALIFA survey, are presented. These galaxies compose this work galaxy sample. For each galaxy redshift, morphological type, inclination, distance, effective radius, g and r SDSS magnitudes, absolute B magnitude and total number of HII regions extracted in the galaxy are given. (1 data file).

  13. North Atlantic weather oscillation and human infectious diseases in the Czech Republic, 1951-2003

    Czech Academy of Sciences Publication Activity Database

    Hubálek, Zdeněk


    Roč. 20, č. 3 (2005), s. 263-270 ISSN 0393-2990 R&D Projects: GA ČR(CZ) GA206/03/0726 Institutional research plan: CEZ:AV0Z60930519 Keywords : climate change * cluster analysis * human infectious diseases Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 1.361, year: 2005

  14. Effects of the content and language integrated learning approach to EFL teaching: A comparative study

    NARCIS (Netherlands)

    Goris, J.A.; Denessen, E.J.P.G.; Verhoeven, L.T.W.


    This study investigates the effects of English-medium CLIL on EFL proficiency in three European countries. Seven mainstream grammar schools spread across The Netherlands, Germany, and Italy participated with a total of 263 pupils aged 12 to 16. Several language skills were measured by means of

  15. disaster preparedness in secondary schools in ruiru division ...

    African Journals Online (AJOL)


    Nov 11, 2014 ... EAsT AFRICAN MEDICAL JOURNAL. November 2014 ... Results: The respondents did not know how to use the first aid kit elements ( = 835.263, p = 0.000, df =1). ... A good disaster and emergency response is merely an ...

  16. Coronal Mass Ejections of Solar Cycle 23 Nat Gopalswamy

    Indian Academy of Sciences (India)

    Hanssen 1995)), slow-drifting radio bursts (Payne-Scott et al. 1947), and moving type. IV radio bursts (Boischot 1957). There were also other indications ..... ASA, 2, 57. Hirshberg, J., Bame, S. J., Robbins, D. E. 1972, Solar Phys., 23, 467. Howard, R. A., Michels, D. J., Sheeley, N. R. Jr., Koomen, M. J. 1982, ApJ, 263, L101.

  17. Primary productivity and nitrogen fixation by Trichodesmium spp. in the Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Parab, S.G.; Matondkar, S.G.P.

    was around 28 degrees C and nitrate content was as low as 0.34 mu M. After the northeast monsoon, Trichodesmium erythraeum developed in the offshore area and then spread to coastal waters. Both species of Trichodesmium together produced a total of 0.263 Tg...

  18. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. MOSAMI GALVANKAR. Articles written in Journal of Biosciences. Volume 42 Issue 2 June 2017 pp 251-263 Article. Estrogen is essential but not sufficient to induce endometriosis · MOSAMI GALVANKAR NEHA SINGH MODI DEEPAK · More Details Abstract Fulltext PDF.

  19. Does Self-Efficacy Mediate the Effect of Primary School Teachers' Emotional Support on Learning Behavior and Academic Skills? (United States)

    Kikas, Eve; Mägi, Katrin


    This study examined the effects of first-grade teachers' emotional support on task persistence and academic skills in the sixth grade and the mediational role of children's academic self-concept in these effects. Participants were 524 children (263 boys, X-bar age in the first grade = 7.47 years), their first-grade homeroom teachers (n = 53), and…

  20. Chiral crystal of a C2v-symmetric 1,3-diazaaulene derivative showing efficient optical second harmonic generation

    KAUST Repository

    Ma, Xiaohua; Fu, Limin; Zhao, Yunfeng; Ai, Xicheng; Zhang, Jianping; Han, Yu; Guo, Zhixin


    the moderate static first hyperpolarizabilities (β0) for both APNA [(136 ± 5) à - 10-30 esu] and DPAPNA [(263 ± 20) à - 10-30 esu], only APNA crystal shows a powder efficiency of second harmonic generation (SHG) of 23 times that of urea. It is shown

  1. Learning for Semantic Parsing and Natural Language Generation Using Statistical Machine Translation Techniques (United States)


    individual players to take: Productions Meaning of predicates DIRECTIVE → (do PLAYER ACTION) PLAYER should take ACTION. DIRECTIVE → ( dont PLAYER...Computational Lin- guistics (COLING-ACL-2006), Poster Sessions, pp. 263–270. Sydney, Australia. 170 Daniel Gildea and Daniel Jurafsky (2002

  2. Single nucleotide polymorphism near CREB1, rs7591784, is associated with pretreatment methamphetamine use frequency and outcome of outpatient treatment for methamphetamine use disorder


    Heinzerling, Keith G.; Demirdjian, Levon; Wu, Yingnian; Shoptaw, Steven


    Although stimulant dependence is highly heritable, few studies have examined genetic influences on methamphetamine dependence. We performed a candidate gene study of 52 SNPs and pretreatment methamphetamine use frequency among 263 methamphetamine dependent Hispanic and Non-Hispanic White participants of several methamphetamine outpatient clinical trials in Los Angeles. One SNP, rs7591784 was significantly associated with pretreatment methamphetamine use frequency following Bonferroni correcti...

  3. 76 FR 50425 - Service Rules and Policies for the Broadcasting Satellite Service (BSS) (United States)


    ... video-on-demand, to consumers in the United States and promote increased competition among satellite and... innovative services, including video, audio, data, and video-on-demand, to consumers in the United States and... variation is 26.3 km. Thus, the measurement range of 30[deg] from the X axis in the X-Z plane proposed by...

  4. 77 FR 54482 - Allocation of Costs Under the Simplified Methods (United States)


    ... cost of goods sold cash or trade discounts that taxpayers do not capitalize for book purposes (and... to adjust additional section 263A costs for cash or trade discounts described in Sec. 1.471-3(b... Allocation of Costs Under the Simplified Methods AGENCY: Internal Revenue Service (IRS), Treasury. ACTION...

  5. An insight into the sequential, structural and phylogenetic properties ...

    Indian Academy of Sciences (India)


    composition bias between sequences. Plant name. Musa acuminate. Diospyros kaki. 0.463. Malus domestica. 0.333. Momordica charantia. 0.383. Medicago truncatula. 0.263. Glycine max. 0.223. Populas canadensis. 0.450. Pyrus communis. 0.223. Cucumis melo. 0.497. Lycopersicon esculentum. 0.327. Persea americana.

  6. Pharmacogenetic Analysis of Captopril Effects on Blood Pressure: Possible Role of the Ednrb (Endothelin Receptor Type B) Candidate Gene

    Czech Academy of Sciences Publication Activity Database

    Zicha, Josef; Dobešová, Zdenka; Zídek, Václav; Šilhavý, Jan; Šimáková, Miroslava; Mlejnek, Petr; Vaněčková, Ivana; Kuneš, Jaroslav; Pravenec, Michal


    Roč. 63, č. 2 (2014), s. 263-265 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LH11049 Institutional support: RVO:67985823 Keywords : captopril * blood pressure * QTL * Ednrb gene * spontaneously hypertensive rat Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.293, year: 2014

  7. Structural, Morphological, and Functional Correlates of Corneal Endothelial Toxicity Following Corneal Exposure to Sulfur Mustard Vapor (United States)


    States Depart- ment of Agriculture certificate No. 51-F-0006). All procedures were in compliance with the ARVO Statement for the Use of Animals in...exposure: pathological mechanism and poten- tial therapy. Toxicology. 2009;263:59–69. 9. Gordon MK, Desantis A, Deshmukh M, et al. Doxycycline hydrogels

  8. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 263 ... Vol 5, No 2 (2006), Blood glucose level and lipid profile in rats fed on Treculia Africana (Breadfruit) diet: A sub-chronic study, Abstract. OO Okwari, OE Ofem, ... Vol 9, No 2 (2010), Comparative Effect of Fresh, Thermoxidized and Irradiated Oil on Gastric Acid Secretion and Cytoprotection in Rats, Abstract.

  9. Polypseudorotaxanes between .alpha.-cyclodextrin and poly(propylene glycol)-b-poly(ethylene glycol)-b-poly(propylene glycol) copolymers studied by MALDI-TOF mass spectrometry

    Czech Academy of Sciences Publication Activity Database

    Horský, Jiří; Walterová, Zuzana


    Roč. 74, January (2016), s. 256-263 ISSN 0014-3057 Grant - others:OPPK(XE) CZ.2.16/3.1.00/24504 Institutional support: RVO:61389013 Keywords : polypseudorotaxanes * reverse pluronics * cyclodextrin Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.531, year: 2016

  10. Download this PDF file

    African Journals Online (AJOL)

    Babalola OE, Rachel Eye Center, PO Box 4108, Garki, Abuja. M ESUGA (MBBS). PKATO YOHANA (RN, Diploma in ... This can often best be achieved through eye camps. Outreach programmes also help to define the extent of .... prescribed eye drops for glaucoma. Ophthalmic Surg 1995;. 26(3): 233-6. Thomas R and ...

  11. Tracking progress toward EU Biodiversity Strategy targets: EU policy effects in preserving its common farmland birds

    Czech Academy of Sciences Publication Activity Database

    Gamero, A.; Brotons, L.; Brunner, A.; Foppen, R.; Fornasari, L.; Gregory, R. D.; Herrando, S.; Hořák, D.; Jiguet, F.; Kmecl, P.; Lehikoinen, A.; Lindström, Å.; Paquet, J. Y.; Reif, J.; Sirkiä, P. M.; Škorpilová, J.; van Strien, A.; Szép, T.; Telenský, Tomáš; Teufelbauer, N.; Trautmann, S.; Van Turnhout, C. A. M.; Vermouzek, Z.; Vikstrøm, T.; Voříšek, P.


    Roč. 10, č. 4 (2017), s. 395-402 ISSN 1755-263X Institutional support: RVO:68081766 Keywords : Agricultural intensification * Agrienvironmental schemes * Bird monitoring * Birds directive * Common agriculture policy * Natura 2000 * SPA Subject RIV: EG - Zoology OBOR OECD: Biodiversity conservation Impact factor: 7.020, year: 2016

  12. George Washington and the Establishment of Civil-Military Relations in Relation to the Declaration of Independence (United States)


    sending their men to fight the British or to die trying. Like the rage militaire that spurred men to surround the city of Boston, public support for...those around him “with vast ease and dignity , and dispens[ed] happiness around him.”263 Washington also consulted with and advised the Continental

  13. The Development of Attentional Networks: Cross-Sectional Findings from a Life Span Sample (United States)

    Waszak, Florian; Li, Shu-Chen; Hommel, Bernhard


    Using a population-based sample of 263 individuals ranging from 6 to 89 years of age, we investigated the gains and losses in the abilities to (a) use exogenous cues to shift attention covertly and (b) ignore conflicting information across the life span. The participants' ability to shift visual attention was tested by a typical Posner-type…

  14. Developmental Dynamics of Emotion and Cognition Processes in Preschoolers (United States)

    Blankson, A. Nayena; O'Brien, Marion; Leerkes, Esther M.; Marcovitch, Stuart; Calkins, Susan D.; Weaver, Jennifer Miner


    Dynamic relations during the preschool years across processes of control and understanding in the domains of emotion and cognition were examined. Participants were 263 children (42% non-White) and their mothers who were seen first when the children were 3 years old and again when they were 4. Results indicated dynamic dependence among the…

  15. Malakostratigrafie pěnitcového převisu V Balnom v Národním parku Nízké Tatry

    Czech Academy of Sciences Publication Activity Database

    Ložek, Vojen


    Roč. 2012, Prosinec (2013), s. 263-265 ISSN 0514-8057 Institutional support: RVO:67985831 Keywords : Holocene * rock shelter * foam sinter * molluscan succession * Low Tatra Mts. Subject RIV: DB - Geology ; Mineralogy

  16. Fathers' Involvement with Their Preschool-Age Children: How Fathers Spend Time with Their Children in Different Family Structures (United States)

    Halme, Nina; Astedt-Kurki, Paivi; Tarkka, Marja-Terttu


    The purpose of this study was to describe how fathers (n = 263) spent time with their preschool-age children and to compare it in different family structures. Data were gathered by structured questionnaires. The instrument included five categories of variables for the time spent: the quantity of time, physical activities, fathers' attitude towards…

  17. Endoscopy services in KwaZulu-Natal Province, South Africa, are ...

    African Journals Online (AJOL)

    There were 0.06 registered gastroenterologists (GEs) per 100 000 population. Each endoscopist performed an average of 263 endoscopies per annum. There were 1.18 endoscopy rooms available per unit, and two units had on-site fluoroscopy available. The average waiting period for an upper endoscopy was 27 (range 7 ...

  18. Update of monotherapy trials with the new anti-androgen, Casodex (ICI 176,334). International Casodex Investigators

    DEFF Research Database (Denmark)

    Iversen, P


    Casodex (ICI 176,334) is a non-steroidal anti-androgen, which has a half-life compatible with once-daily oral dosing. In an open, phase II study on 267 patients given Casodex, 50 mg/day, an overall objective response (i.e. partial regression) was seen in 55.5% of patients (146 of 263) with a furt...

  19. The National Benchmark Test of quantitative literacy: Does it ...

    African Journals Online (AJOL)

    Windows User

    A total of 263,464 of these learners wrote this examination at the end of that year. On the .... it requires the activation of a range of enabling knowledge .... English. 197. 5.74. 708. 56.46. 821. 54.73 42 95.45 131 100 1,899. Xhosa. 1,271 37.01.

  20. A Spreadsheet Model That Estimates the Impact of Reduced Distribution Time on Inventory Investment Savings: What is a Day Taken Out of the Pipeline Worth in Inventory? (United States)


    fall-2006/lecture-notes/lect11.pdf Chang, C.-T. (2005). A Linearization Approach for Inventory Models with Variable Lead Time. International Journal of Production Economics , 263...Demand and Lead Time are Stochastic. International Journal of Production Economics , 595-605. Hayya, J. C., Harrison, T. P., & He, X. (2011). The Impact

  1. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 263 ... Issue, Title. Vol 1, No 2 (2002), Effect of Light and Darkness on Packed Cell Volume in the Rat, Abstract. A. A. OSINUBI, F. I. DURU, C. C. NORONHA, A. O. OKANLAWON. Vol 4, No 1 (2005), Effect of Marijuana Smoking on Blood Chemistry and Serum Biogenic Amines Concentrations in Humans ...

  2. 77 FR 43232 - National School Lunch, Special Milk, and School Breakfast Programs, National Average Payments... (United States)


    ...) establishes National Average Payments for free, reduced price and paid afterschool snacks as part of the...--free lunch-- 303 cents, reduced price lunch--263 cents. Afterschool Snacks in Afterschool Care Programs--The payments are: Contiguous States--free snack--78 cents, reduced price snack--39 cents, paid snack...

  3. Blood parasites in northern goshawk (Accipiter gentilis) with an emphasis to Leucocytozoon toddi

    Czech Academy of Sciences Publication Activity Database

    Hanel, J.; Doležalová, J.; Stehlíková, Š.; Modrý, David; Chudoba, J.; Synek, P.; Votýpka, Jan


    Roč. 115, č. 1 (2016), s. 263-270 ISSN 0932-0113 Institutional support: RVO:60077344 Keywords : avian blood parasites * Haemosporida * Trypanosoma * PCR detection * birds of prey * raptors * mixed infection Subject RIV: EG - Zoology Impact factor: 2.329, year: 2016

  4. 21 CFR 73.450 - Riboflavin. (United States)


    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Riboflavin. 73.450 Section 73.450 Food and Drugs... ADDITIVES EXEMPT FROM CERTIFICATION Foods § 73.450 Riboflavin. (a) Identity. (1) The color additive riboflavin is the riboflavin defined in the Food Chemicals Codex, 3d Ed. (1981), pp. 262-263, which is...

  5. Markets and medicine: the politics of health care reform in Britain, Germany, and the United States

    National Research Council Canada - National Science Library

    Giaimo, Susan


    ...: The Limits of Markets in Health Care 193 Appendix: Information on Interviews and Methodology 225 Notes 233 Bibliography 263 Index 293 List of TablesTables I. Physicians' Earnings Relative to Other Occupations in the United Kingdom, Germany, and the United States, 1965-92 13 2. Physicians' Mean Gross Income in the United Kingdom, Germany, and...

  6. Genetic polymorphisms in DNA repair and oxidative stress pathways may modify the association between body size and postmenopausal breast cancer

    Czech Academy of Sciences Publication Activity Database

    McCullough, L. E.; Eng, S. M.; Bradshaw, P. T.; Cleveland, R. J.; Steck, S. E.; Terry, M. B.; Shen, J.; Crew, K.D.; Rössner ml., Pavel; Ahn, J.; Ambrosone, Ch.B.; Teitelbaum, S. L.; Neugut, A. I.; Santella, R. M.; Gammon, M. D.


    Roč. 25, č. 4 (2015), s. 263-269 ISSN 1047-2797 Institutional support: RVO:68378041 Keywords : breast cancer * body mass index * oxidative stress * DNA repair * Epidemiology Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.335, year: 2015

  7. The structure of cortical cytoplasm in cold-treated tobacco cells: the role of the cytoskeleton and the endomembrane system

    Czech Academy of Sciences Publication Activity Database

    Schwarzerová, K.; Pokorná, J.; Petrášek, Jan; Zelenková, S.; Čapková, Věra; Janotová, I.; Opatrný, Z.


    Roč. 27, - (2003), 263ů265 ISSN 1065-6995 R&D Projects: GA AV ČR IAA5038207 Institutional research plan: CEZ:AV0Z5038910 Keywords : cytoskeletal polymers * tobacco * endomembrane system Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.092, year: 2003

  8. The structure of cortical cytoplasm in cold-treated tobacco cells: the role of the cytoskeleton and the endomembrane system

    Czech Academy of Sciences Publication Activity Database

    Schwarzerová, K.; Pokorná, J.; Petrášek, Jan; Zelenková, S.; Čapková, Věra; Janotová, I.; Opatrný, Z.


    Roč. 27, - (2003), s. 263ů265 ISSN 1065-6995 R&D Projects: GA AV ČR IAA5038207 Institutional research plan: CEZ:AV0Z5038910; CEZ:MSM 113100003 Keywords : cytoskeletal polymers * tobacco * endomembrane system Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.092, year: 2003

  9. pi-dimerization of pleiadiene radical cations at low temperatures revealed by UV-vis spectroelectrochemistry and quantum theory

    NARCIS (Netherlands)

    van het Goor, Layo; van Duijnen, Piet Th.; Koper, Carola; Jenneskens, Leonardus W.; Havenith, Remco W. A.; Hartl, Frantisek


    One-electron oxidation of the non-alternant polycyclic aromatic hydrocarbon pleiadiene and related cyclohepta[c,d]pyrene and cyclohepta[c,d]fluoranthene in THF produces corresponding radical cations detectable in the temperature range of 293-263 K only on the subsecond time scale of cyclic

  10. Selected Works: 1990-1994 (United States)


    soldiers: 43 tanks: 37 Isaacs, Betty: 336 Isherwood, Mike: 336 Ishikawa , Kaoru : 263 Isolationism: 137 Israel: 29, 229, 335 383 Israeli Air Force: 335...Deming, Juran, Ishikawa , and others—have long been practiced by the Air Force. We’ve used these principles from our beginnings as an institution—long

  11. Fish diversity in the Niokolo Koba National Park, middle Gambia River basin, Senegal

    Czech Academy of Sciences Publication Activity Database

    Blažek, Radim; Ondračková, Markéta; Vošlajerová Bímová, Barbora; Vetešník, Lukáš; Petrášová, Ivona; Reichard, Martin


    Roč. 23, č. 3 (2012), s. 263-272 ISSN 0936-9902 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:68081766 Keywords : West Africa * estuary * assemblages Subject RIV: EH - Ecology, Behaviour Impact factor: 1.648, year: 2012

  12. Relativistic hypernuclei: old problems and new prospects

    Czech Academy of Sciences Publication Activity Database

    Majling, Lubomír; Lukstins, J.; Parfenov, AN.; Chren, D.; Solar, M.; Sopko, B.


    Roč. 53, č. 8 (2003), s. 667-677 ISSN 0011-4626 R&D Projects: GA ČR GA202/02/0930; GA AV ČR KSK1048102 Keywords : quantum wave -guides * Schrödinger-operators * Dirichlet Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 0.263, year: 2003

  13. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 263 ... Vol 6, No 1 (2007), Mortality rate in Sickle Cell Disease Patients in Crisis at a Haematology Day Care Unit (HDCU) in Nigeria, Abstract. J O Olabode, W A Shokunbi. Vol 5, No 1 ... S A Afijabi, P E Idaewor. Vol 6, No 1 (2007), Periodontal Status of Adolescents in Surulere, Lagos State, Nigeria. Abstract.

  14. Educators vs. Entrepreneurs: Traits and Bias in the Teaching of SWOT (United States)

    Clark, Andre


    A study of the marks allocated by 10 tutors to 263 students' SWOT (Strengths, Weaknesses, Opportunities, Threats) analyses on a range of business education courses reveals a largely hidden assumption regarding the balance of the four factors. To investigate the significance of this in light of the suggestion in the trait literature that…

  15. AcEST: DK944889 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 27-F10, full insert seque... 264 2e-69 tr|Q40093|Q40093_IPONI PNIL34 OS=Ipomoea nil GN=PNIL 34 PE=2 SV=1 263...LVY 487 VKNL+R+P Y M P++SGSVD AEFEPQLVY Sbjct: 367 VKNLKRIPHVAALVSEIIAAYLMPPIESGSVDFAEFEPQLVY 408 >tr|Q40093|Q40093_IPONI PNIL34

  16. Jiecai Han

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. Jiecai Han. Articles written in Bulletin of Materials Science. Volume 25 Issue 4 August 2002 pp 263-266 Synthesis. Self-propagating high temperature synthesis and magnetic properties of Ni0.35Zn0.65Fe2O4 powders · Yao Li Jiupeng Zhao Jiecai Han · More Details Abstract ...

  17. 75 FR 80746 - Interpretation of Rest Requirements (United States)


    ... Whitlow Letter in its interpretations of section 121.471(g). See Air Transport Ass'n of America, Inc. v. F... 121.471(g) and 135.263(d) is interpreted in two different ways. See Air Transport Ass'n, 291 F.3d at...

  18. Nová zjištění z prostoru zaniklé tvrze v Bernarticích na Písecku

    Czech Academy of Sciences Publication Activity Database

    Dohnal, Martin; Fröhlich, J.; Kovář, D.


    Roč. 28, [1] (2015), s. 263-280 ISSN 0231-8237 R&D Projects: GA ČR(CZ) GAP410/11/1287 Keywords : Bernartice * fortified house * archeological finds * mezza majolica * Jesuits Subject RIV: AC - Archeology, Anthropology, Ethnology

  19. Identifikační znaky samic čolků rodu Triturus podrodu Paleotriton, druhové skupiny vulgaris na území České republiky

    Czech Academy of Sciences Publication Activity Database

    Zavadil, V.; Piálek, Jaroslav


    Roč. 49, č. 3 (2000), s. 263-273 ISSN 0323-0627 R&D Projects: GA MŽP MR/610/1/96; GA MŠk VS97102 Institutional research plan: CEZ:AV0Z6093917 Keywords : genus Triturus * morphological traits Subject RIV: EG - Zoology

  20. The MIQE Guidelines: Minimum Information for Publication of Quantitative Real-Time PCR Experiments

    Czech Academy of Sciences Publication Activity Database

    Bustin, S.A.; Benes, V.; Garson, J.A.; Hellemans, J.; Huggett, J.; Kubista, Mikael; Mueller, R.; Nolan, T.; Pfaffl, M.V.; Shipley, G.L.; Vandesompele, J.; Wittver, C.T.


    Roč. 55, č. 4 (2009), s. 611-622 ISSN 0009-9147 R&D Projects: GA AV ČR IAA500520809 Institutional research plan: CEZ:AV0Z50520701 Keywords : qPCR * MIQE * publication of experiments data Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 6.263, year: 2009

  1. Measurements of fast-neutron-induced signals in silicon pad detectors

    Czech Academy of Sciences Publication Activity Database

    Linhart, V.; Bedajanek, I.; Bém, Pavel; Götz, Miloslav; Honusek, Milan; Pospíšil, S.; Šimečková, Eva


    Roč. 563, č. 1 (2006), s. 263-267 ISSN 0168-9002 R&D Projects: GA MPO(CZ) 1H-PK/07 Institutional research plan: CEZ:AV0Z10480505 Keywords : background signals * neutron reactions * solid-state detectors Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.185, year: 2006

  2. Contribution to the knowledge of ptyctimous mites (Acari: Oribatida) from Madagascar

    Czech Academy of Sciences Publication Activity Database

    Niedbala, W.; Starý, Josef


    Roč. 59, č. 4 (2013), s. 337-345 ISSN 1217-8837 Institutional research plan: CEZ:AV0Z60660521 Institutional support: RVO:60077344 Keywords : oribatid mites * new species * Mahunka * Phthiracaroidea * Euphthiracaroidea Subject RIV: EG - Zoology Impact factor: 0.263, year: 2013

  3. Developmental windows and environment as important factors in the expression of genetic information: a cardiovascular physiologist's view

    Czech Academy of Sciences Publication Activity Database

    Kuneš, Jaroslav; Zicha, Josef


    Roč. 111, č. 5 (2006), s. 295-305 ISSN 0143-5221 R&D Projects: GA MZd(CZ) NR7786 Institutional research plan: CEZ:AV0Z50110509 Keywords : developmental window * genetic determinants * environmental stimuli Subject RIV: ED - Physiology Impact factor: 3.263, year: 2006

  4. Microscopic investigation of surface layers on rails

    Czech Academy of Sciences Publication Activity Database

    Jirásková, Yvonna; Svoboda, Jiří; Schneeweiss, Oldřich; Daves, W.; Fischer, F. D.


    Roč. 239, č. 2 (2005), s. 132-141 ISSN 0169-4332 R&D Projects: GA AV ČR(CZ) IBS2041105 Institutional research plan: CEZ:AV0Z20410507 Keywords : Mössbauer phase analysis * TEM * rail Subject RIV: JO - Structural Engineering Impact factor: 1.263, year: 2005

  5. Effect of prolonged exposure to sublethal concentrations of DDT and DDE on protein expression in human pancreatic beta cells

    Czech Academy of Sciences Publication Activity Database

    Pavlíková, N.; Smetana, P.; Halada, Petr; Kovář, J.


    Roč. 142, OCT 2015 (2015), s. 257-263 ISSN 0013-9351 Grant - others:OPPK(CZ) CZ.2.16/3.1.00/24023 Source of funding: O - operačné programy Keywords : Diabetes * DDT/E * Alpha-enolase Subject RIV: CE - Biochemistry Impact factor: 3.088, year: 2015

  6. The Relationship of the Murphy-Meisgeier Type Indicator for Children to Sex, Race, and Fluid-Crystallized Intelligence on the KAIT at Ages 11 to 15. (United States)

    Kaufman, Alan S.; McLean, James E.


    Four typologies assessed by the Murphy-Meisgeier Type Indicator for Children (C. Meisgeier and M. Murphy, 1987) (Extraversion-Introversion, Sensing-Intuition, Thinking-Feeling, Judging-Perceiving) were related to sex, race/ethnic group, intelligence level, and fluid/crystallized IQ discrepancy for 263 adolescents. The Thinking/Feeling index…

  7. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. D K Avasthi. Articles written in Bulletin of Materials Science. Volume 27 Issue 3 June 2004 pp 263-267 Polymers. Electrical properties of ion irradiated polypropylene films · N L Singh Anita Sharma V Shrinet A K Rakshit D K Avasthi · More Details Abstract Fulltext PDF. The effect ...

  8. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. V Shrinet. Articles written in Bulletin of Materials Science. Volume 27 Issue 3 June 2004 pp 263-267 Polymers. Electrical properties of ion irradiated polypropylene films · N L Singh Anita Sharma V Shrinet A K Rakshit D K Avasthi · More Details Abstract Fulltext PDF. The effect of ...

  9. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. A K Rakshit. Articles written in Bulletin of Materials Science. Volume 27 Issue 3 June 2004 pp 263-267 Polymers. Electrical properties of ion irradiated polypropylene films · N L Singh Anita Sharma V Shrinet A K Rakshit D K Avasthi · More Details Abstract Fulltext PDF. The effect ...

  10. A New Point of View on the Relationship Between Global Solar Irradiation and Sunshine Quantifiers

    Czech Academy of Sciences Publication Activity Database

    Brabec, Marek; Badescu, V.; Dumitrescu, A.; Paulescu, M.


    Roč. 126, March (2016), s. 252-263 ISSN 0038-092X Institutional support: RVO:67985807 Keywords : global solar irradiation * sunshine quantifiers * sunshine number * Angstrom equation * statistical modeling * regression analysis Subject RIV: BB - Applied Statistics, Operation al Research Impact factor: 4.018, year: 2016

  11. Landscape level analysis of disturbance regimes in protected areas ...

    Indian Academy of Sciences (India)

    G B Pant Institute of Himalayan Environment and Development, Almora 263 643, Uttarakhand, India. ... level assessment of fragmentation and disturbance index in protected areas of Rajasthan using remote ..... anthropogenic/natural forces on the landscape was ..... Environmental Research, Engineering and Management.

  12. Redescription of Heliconema africanum (Linstow, 1899) n. comb. (Nematoda: Physalopteridae), a nematode parasite of freshwater eels (Anguilla spp.) in South Africa

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Taraschewski, H.; Weyl, O.L.F.


    Roč. 85, č. 3 (2013), s. 263-269 ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Parasitic nematode * Heliconema * South Africa Subject RIV: EA - Cell Biology Impact factor: 1.035, year: 2013

  13. Cross-Cultural Comparison of Anxiety Symptoms in Colombian and Australian Children (United States)

    Amaya, Andrea Crane; Campbell, Marilyn


    Introduction: This cross-cultural study compared both the symptoms of anxiety and their severity in a community sample of children from Colombia and Australia. Method: The sample comprised 516 children (253 Australian children and 263 Colombian children), aged 8 to 12-years-old. The Spence Children's Anxiety Scale (SCAS) was used to measure both…

  14. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy. K. M. Hiremath. Articles written in Journal of Astrophysics and Astronomy. Volume 21 Issue 3-4 September-December 2000 pp 263-264 Session V – Vector Magnetic Fields, Prominences, CMEs & Flares. Emergence of Twisted Magnetic Flux Related Sigmoidal ...

  15. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences. INDRANIL BISWAS. Articles written in Proceedings – Mathematical Sciences. Volume 111 Issue 3 August 2001 pp 263-269. Stability of Picard Bundle Over Moduli Space of Stable Vector Bundles of Rank Two Over a Curve · Indranil Biswas Tomás L Gómez.

  16. 26 CFR 1.199-3 - Domestic production gross receipts. (United States)


    ... receipts for the taxable year that are recognized under the taxpayer's methods of accounting used for... consumer electronics stores. S requires that its customers purchase a minimum of 100 television sets per... accounting for its production activities under section 263A, and wishes to change its method of accounting to...

  17. 1056-IJBCS-Article-Oga Oms+

    African Journals Online (AJOL)


    L'activité 14C du Maestrichtien est de 26,4 ± 0,6 pCM pour une teneur en 13C de -16,2 ..... carboniques mettant en jeu la phase gazeuse et ..... 14C method. ... fields of. Hydrolosphere, Sugarawa Festival,. Tokyo; 263-283. Jahns S, Hüls M, ...

  18. Relationships between the normalised difference vegetation index and temperature fluctuations in post-mining sites

    Czech Academy of Sciences Publication Activity Database

    Bujalský, L.; Jirka, V.; Zemek, František; Frouz, J.


    Roč. 32, č. 4 (2018), s. 254-263 ISSN 1748-0930 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:67179843 Keywords : temperature * normalised difference * vegetation index (NDVI) * vegetation cover * remote sensing Subject RIV: DF - Soil Science Impact factor: 1.078, year: 2016

  19. 26 CFR 1.162-12 - Expenses of farmers. (United States)


    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Expenses of farmers. 1.162-12 Section 1.162-12... farmers. (a) Farms engaged in for profit. A farmer who operates a farm for profit is entitled to deduct... 263A and the regulations thereunder. For taxable years beginning after July 12, 1972, where a farmer is...

  20. Combustion Stability Innovations for Liquid Rocket (United States)


    properties. You can do this by doubte-clctung the left mouse button. If you wish to edit al the species, then click on the Do Al button. Note that the...34Experiments on the Instabilities of a Swirling Jet," Physics of Fluids, Vol. 6, No. 1, Jan. 1994, pp 263-276. Cerecedo, L. M., Aisa , L., Garcia, J. A., and

  1. Effect of enzyme/substrate ratio on the antioxidant properties of ...

    African Journals Online (AJOL)

    Dr (Mrs) O.Fasasi


    Jun 21, 2012 ... Department of Food Science and Technology, P. M. B. 704, Federal University of Technology, ... of East Africa and it is cultivated for both its seeds and ..... inhibit lipid oxidation in cooked pork patties, Meat Sci., 64: 259-263.

  2. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 263 ... Vol 17, No 3 (2017), Allomorphs in the Igbo Language: An Optimality Theory Approach, Abstract PDF. Thecla Udemmadu. Vol 17, No 2 (2016), An analysis of the auxiliary structure of basic Nigerian pidgin sentences, Abstract. Christopher Ufuoma Akaruese. Vol 18, No 2 (2017): Special Edition ...

  3. Solvability conditions of the Cauchy problem for two-dimensional systems of linear functional differential equations with monotone operators

    Czech Academy of Sciences Publication Activity Database

    Šremr, Jiří


    Roč. 132, č. 3 (2007), s. 263-295 ISSN 0862-7959 R&D Projects: GA ČR GP201/04/P183 Institutional research plan: CEZ:AV0Z10190503 Keywords : system of functional differential equations with monotone operators * initial value problem * unique solvability Subject RIV: BA - General Mathematics

  4. Differential immunodominance hierarchy of CD8+ T-cell responses in HLA-B*27

    DEFF Research Database (Denmark)

    Adland, Emily; Hill, Matilda; Lavandier, Nora


    The well-characterized association between HLA-B*27:05 and protection against HIV disease progression has been linked to immunodominant HLA-B*27:05- restricted CD8+ T-cell responses toward the conserved Gag KK10 (residues 263 to 272) and polymerase (Pol) KY9 (residues 901 to 909) epitopes. We stu...

  5. Clinical features of diabetes retinopathy in elderly patients with type ...

    African Journals Online (AJOL)

    Objective: The objective was to estimate the prevalence and clinical characteristics of diabetes retinopathy (DR) in elderly individuals with type 2 diabetes mellitus in Northern Chinese. Materials and Methods: 595 eligible subjects (263 men, 332 women) assisted by the community health service center in Beijing, China ...

  6. Dissemination and implementation of "Aging Well and Healthily": A health-education and exercise program for older adults

    NARCIS (Netherlands)

    Westhoff, M.H.; Hopman-Rock, M.


    The article describes the dissemination and implementation of the Aging Well and Healthily (AWH) program in the Netherlands. In the period 1997-1999 this process was monitored by means of telephone interviews with 263 participants, 28 peer educators, and 13 organizers. The program participants were

  7. 78 FR 23631 - Notice of Final Federal Agency Actions on Proposed Highway in California (United States)


    ... Lake County with NEPA oversight being conducted by the State of California. The project takes place in Lake County, immediately adjacent to the town of Lakeport on South Main Street and Soda Bay Rd. Those... County: Lars Ewing, Assistant Public Works Director, telephone (707) 263-2341, email Lars.Ewing...

  8. Prevention of bone bridge formation using transplantation of the autogenous mesenchymal stem cells to physeal defects: An experimental study in rabbits

    Czech Academy of Sciences Publication Activity Database

    Plánka, L.; Nečas, A.; Gál, P.; Kecová, H.; Filová, Eva; Křen, L.; Kroupa, P.


    Roč. 76, - (2007), s. 253-263 ISSN 0001-7213 R&D Projects: GA MŠk 2B06130 Institutional research plan: CEZ:AV0Z50390512 Keywords : Growth plate injury * Physis * Growth arrest Subject RIV: FI - Traumatology, Orthopedics Impact factor: 0.687, year: 2007

  9. Resorting to Rare Sources of Antiquity: Nikephoros Basilakes and the Popularity of Plutarch’s Parallel Lives in Twelfth-Century Byzantium

    Directory of Open Access Journals (Sweden)

    Sophia Xenophontos


    Full Text Available This article examines the Byzantine adaptation of the anecdote of the Lydian king Pythes within Nikephoros Basilakes’ Progymnasma 11 in relation to its earliest surviving source, Plutarch’s Mulierum virtutes 262D–263A. By looking at the ascription accompanying Basilakes’ progymnasma, it additionally argues for the popularity of Plutarch’s Parallel Lives in Komnenian Byzantium.


    National Aeronautics and Space Administration — Transmission spectra of amorphous and crystalline H2O-ice at temperatures from 20-150 K for a wavelength range from 1.11 to 2.63 microns. These spectra have not been...


    National Aeronautics and Space Administration — Transmission spectra of amorphous and crystalline H2O-ice at temperatures from 20-150 K for a wavelength range from 1.11 to 2.63 microns. These spectra have not been...

  12. Logically Incorrect Arguments

    Czech Academy of Sciences Publication Activity Database

    Svoboda, Vladimír; Peregrin, Jaroslav


    Roč. 30, č. 3 (2016), s. 263-287 ISSN 0920-427X R&D Projects: GA ČR(CZ) GA13-21076S Institutional support: RVO:67985955 Keywords : argumentation * logical form * incorrect argument * correct arguments Subject RIV: AA - Philosophy ; Religion Impact factor: 0.689, year: 2016

  13. The Implications of ISO 9000 and the European Community on the U.S. Construction Industry. (United States)


    G.D. Aurbach. 1983. Binding of radioiodinated bovine parathyroid hormone-(1-84) to canine renal cortical membranes. Endocrinology, =1:1303-1312... osteosarcoma cells. J. Biol. Chem., 263:3864-3868. Shurtz-Swirski, R., D. Lewinson, P. Shenzer, H. Mayer, M. Silbermann. 1990. Effects of parathyroid

  14. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 263 ... Vol 11, No 1 (2010), Population Growth and the Dilemma of Rural Life and Economy ... Special Edition 2011, Spanish-English False Friends: Possible Problems for the Nigerian Learner of Spanish as a Foreign Language, Abstract PDF ... Vol 12, No 2 (2011), Speaking for the Voiceless: Yvonne Vera's ...

  15. Molecular characterization of rainbow trout, Oncorhynchus mykiss ...

    Indian Academy of Sciences (India)

    Molecular Genetics Laboratory, Directorate of Coldwater Fisheries Research, Bhimtal 263 ... Mir J. I., Ali S., Patiyal R. S. and Singh A. K. 2015 Molecular characterization of rainbow trout, ..... 5 × 106 MCMC repeats for final sampling of data. .... enhancing aquaculture productivity in the coldwater regions. ... simulation study.

  16. Simple Calculation Programs for Biology Immunological Methods

    Indian Academy of Sciences (India)

    First page Back Continue Last page Overview Graphics. Simple Calculation Programs for Biology Immunological Methods. Computation of Ab/Ag Concentration from EISA data. Graphical Method; Raghava et al., 1992, J. Immuno. Methods 153: 263. Determination of affinity of Monoclonal Antibody. Using non-competitive ...

  17. Discovery of SM Higgs Boson in ATLAS Experiment

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 3. Discovery of SM Higgs Boson in ATLAS Experiment. Prafulla Kumar Behera. General Article Volume 18 Issue 3 March 2013 pp 248-263. Fulltext. Click here to view fulltext PDF. Permanent link:

  18. The novel brassinosteroid analog BR4848 inhibits angiogenesis in human endothelial cells and induces apoptosis in human cancer cells in vitro

    Czech Academy of Sciences Publication Activity Database

    Rárová, L.; Sedlák, David; Oklešťková, Jana; Steigerová, J.; Liebl, J.; Zahler, S.; Bartůněk, Petr; Kolář, Z.; Kohout, Ladislav; Kvasnica, Miroslav; Strnad, Miroslav


    Roč. 178 (2018), s. 263-271 ISSN 0960-0760 R&D Projects: GA MŠk(CZ) LO1204; GA MŠk LO1220; GA MŠk LM2015063 Institutional support: RVO:68378050 ; RVO:61389030 Keywords : Brassinosteroid analog * Cancer cell lines * Apoptosis * HUVEC * Angiogenesis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.561, year: 2016

  19. 77 FR 26304 - Federal Housing Administration (FHA) Healthcare Facility Documents: Proposed Revisions and... (United States)


    ... provide Uniform Commercial Code (UCC) collateral through security agreements; borrowers provide their...--Contrac tors. HUD-90019-OHP Auditor Certification 3 1 3 0.58 2 67 117 223d. HUD-90021-OHP Certification.... HUD-92434-OHP Lender Certification... 35 10 350 0.75 263 75 19,688 HUD-91130-OHP Building Code 26 2 52...

  20. Customer Overview of Pulsed Laser Heating for Evaluation of Gun Bore Materials (United States)


    properties of the gun bore materials. Ideally, well validated interior ballistics modeling has been carried out (typically with NOVA) to provide time...03002, February 2003. 5. J. Warrender, C. Mulligan, and J. Underwood , “Analysis of thermo-mechanical cracking in refractory coatings using variable pulse duration laser pulse heating,” Wear 263 1540 (2007).

  1. probing the cob(ii)alamin conductor hypothesis with glutamate ...

    African Journals Online (AJOL)


    Glutamate mutase activity was also demonstrated upon incubation of GlmS and E with 3',5'- ... overproduced in E.coli (Huhta et al. 2001,. Huhta et ..... Biochemistry. 37: 9704-9715. Buckel W 2001 Unusual enzymes involved in five pathways of glutamate fermentation. Appl. Microbiol. Biotechnol. 57: 263-273. Buckel W and ...

  2. The smt-0 mutation which abolishes mating-type switching in fission yeast is a deletion

    DEFF Research Database (Denmark)

    Styrkársdóttir, U; Egel, R; Nielsen, O


    Mating-type switching in the fission yeast, S. pombe, is initiated by a DNA double-strand break (DSB) between the mat1 cassette and the H1 homology box. The mat1-cis-acting mutant, smt-0, abolishes mating-type switching and is shown here to be a 263-bp deletion. This deletion starts in the middle...

  3. 50 Detecting adenosine triphosphatase 6 point mutations that may ...

    African Journals Online (AJOL)

    mutations at codons for the key residues Lys 260, Leu263, Gln266, Ser769 .... agarose gel and visualized under UV transillumination after treatment with ..... Li, W., Mo, W., Shen, D., Sun, L., Wang, J., Lu, S., Gitschier, J.M. & Zhou, B. (2005) Yeast ... Nagamune, K., Beatty, W.L., & Sibley, D. (2007) Artemisinin induces Calcium ...

  4. Biophysical Characteristics of Chemical Protective Ensemble With and Without Body Armor (United States)


    agility and mobility to complete mission-essential tasks. Nevertheless, the bulk, weight, and encapsulation associated with these protective ensembles...compromises mobility , agility, situational awareness, and thermoregulation. Thermal strain management during military training and operations...Corner BD, & Paquette S. Investigation of Air Gaps Entrapped in Protective Clothing System. Fire and Materials, 26(3), 121-126, 2002. 15. Song G

  5. 21 CFR 640.71 - Manufacturing responsibility. (United States)


    ... the Public Health Service Act, or by a clinical laboratory that meets the standards of the Clinical Laboratories Improvement Amendments of 1988 (CLIA) (42 U.S.C. 263a): Provided, The establishment or clinical... collection, plasmapheresis, laboratory testing, labeling, storage, and issuing shall be performed by...

  6. The Best and the Rest: Revisiting the Norm of Normality of Individual Performance (United States)

    O'Boyle, Ernest, Jr.; Aguinis, Herman


    We revisit a long-held assumption in human resource management, organizational behavior, and industrial and organizational psychology that individual performance follows a Gaussian (normal) distribution. We conducted 5 studies involving 198 samples including 633,263 researchers, entertainers, politicians, and amateur and professional athletes.…

  7. Preschool-Aged Children's Understanding of Gratitude: Relations with Emotion and Mental State Knowledge (United States)

    Nelson, Jackie A.; de Lucca Freitas, Lia Beatriz; O'Brien, Marion; Calkins, Susan D.; Leerkes, Esther M.; Marcovitch, Stuart


    Developmental precursors to children's early understanding of gratitude were examined. A diverse group of 263 children was tested for emotion and mental state knowledge at ages 3 and 4, and their understanding of gratitude was measured at age 5. Children varied widely in their understanding of gratitude, but most understood some aspects of…

  8. Parental Support and Knowledge and Adolescents' Sexual Health: Testing Two Mediational Models in a National Dutch Sample (United States)

    de Graaf, Hanneke; Vanwesenbeeck, Ine; Woertman, Liesbeth; Keijsers, Loes; Meijer, Suzanne; Meeus, Wim


    This study investigated age- and gender-specific associations between parental support and parental knowledge of the child's whereabouts, on the one hand, and sexual experience and sexual health (the ability to have safe and pleasurable sexual experiences) on the other hand. A representative Dutch sample of 1,263 males and 1,353 females (aged…

  9. Geofyzikální výzkum tvaru vulkanických těles v oblasti mezi Jičínem a Turnovem (Český ráj)

    Czech Academy of Sciences Publication Activity Database

    Rapprich, V.; Skácelová, Z.; Valenta, Jan


    Roč. 44, - (2011), s. 263-266 ISSN 0514-8057 Institutional research plan: CEZ:AV0Z30460519 Keywords : magnetic survey * gravity survey * basanite Subject RIV: DC - Siesmology, Volcanology, Earth Structure

  10. Alien Pathogens on the Horizon: Opportunities for Predicting their Threat to Wildlife

    Czech Academy of Sciences Publication Activity Database

    Roy, H. E.; Hesketh, H.; Purse, B. V.; Eilenberg, J.; Santini, A.; Sclarea, R.; Stentiford, G. D.; Adriaens, T.; Bacela-Spychalska, K.; Bass, D.; Beckmann, K. M.; Bessell, P.; Bojko, J.; Booy, O.; Cardoso, A.-C.; Essl, F.; Groom, Q.; Harrower, C.; Kleespies, R. G.; Martinou, A. F.; van Oers, M. M.; Peeler, E. J.; Pergl, Jan; Rabitsch, W.; Roques, A.; Schaffner, F.; Schindler, S.; Schmidt, B. R.; Schönrogge, K.; Smith, J.; Solarz, W.; Stewart, A.; Stroo, A.; Tricarico, E.; Turvey, K. M. A.; Vannini, A.; Vila, M.; Woodward, S.; Wynns, A. A.; Dunn, A. M.


    Roč. 10, č. 4 (2017), s. 477-484 ISSN 1755-263X Grant - others:COST(XE) TD1209 Program:FA Institutional support: RVO:67985939 Keywords : horizon scanning * invasions * legislation * wildlife diseases Subject RIV: EH - Ecology, Behaviour OBOR OECD: Biodiversity conservation Impact factor: 7.020, year: 2016

  11. Fen Bilimlerinde ve Beşeri bilimlerde öykülerin rolü

    Czech Academy of Sciences Publication Activity Database

    Sládek, Ondřej; Dervişcemaloğlu, B.


    Roč. 2011, č. 20 (2011), s. 263-272 ISSN 1300-5715 R&D Projects: GA ČR GAP406/10/1911 Institutional research plan: CEZ:AV0Z90560517 Keywords : narrative * science * humanities Subject RIV: AJ - Letters, Mass-media, Audiovision

  12. Postup izotachoforetického stanovení kyseliny thioglykolové v moči za odsolení a úpravy pH analyzovaného vzorku

    Czech Academy of Sciences Publication Activity Database

    Chýlková, J.; Fadrná, Renata


    Roč. 98, č. 5 (2004), s. 260-263 ISSN 0009-2770 R&D Projects: GA AV ČR KSK4040110 Keywords : thiodiglykolic acid * TDGA * isotachophores Subject RIV: CG - Electrochemistry Impact factor: 0.348, year: 2004

  13. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    These results suggest that sexual preference may be influenced in a significant proportion of homosexual men by a biological/genetic factor that also controls direction of hair-whorl rotation. pp 257-263 Research Article. Cloning of a novel gene, Cymg1, related to family 2 cystatins and expressed at specific stages of mouse ...

  14. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. L Sriramkumar. Articles written in Pramana – Journal of Physics. Volume 72 Issue 1 January 2009 pp 263-267. WHEPP-X: Report of the working group on cosmology · M Kaplinghat L Sriramkumar A Berera P Chingangbam R K Jain M Joy J Martin S Mohanty A Nautiyal R ...

  15. Fulltext PDF

    Indian Academy of Sciences (India)

    Potentials of Potatoes: A Surprise in Newtonian Gravity*. T Padmanabhan. * This is based on an article originally published by the au- thor in Physics Education, Vol. 22, No. 4, p.263, 2006. T Padmanabhan works at. IUCAA, Pune and is interested in all areas of theoretical physics, especially those which have something to ...

  16. 78 FR 46491 - Adjustment of Appendices to the Dairy Tariff-Rate Import Quota Licensing Regulation for the 2013... (United States)


    ...;Prices of new books are listed in the first FEDERAL REGISTER issue of each #0;week. #0; #0; #0; #0;#0...,935 Any Country 4,392,977 2,263,334 6,656,311 DRIED SKIM MILK (NOTE 7) 5,261,000 5,261,000 5,261,000 5...

  17. Isotope exchange study of the dissociation of metal - humic substance complexes

    Czech Academy of Sciences Publication Activity Database

    Mizera, J.; Jansová, A.; Hvoždová, I.; Beneš, P.; Novák, František


    Roč. 53, A (2003), s. A97-A101 ISSN 0011-4626 Institutional research plan: CEZ:AV0Z6066911; CEZ:MSM 210000019 Keywords : isotope exchange * dissociation of metal * humic substance complexes Subject RIV: EH - Ecology, Behaviour Impact factor: 0.263, year: 2003

  18. Collagen-lactoferrin fibrillar coatings enhance osteoblast proliferation and differentiation

    Czech Academy of Sciences Publication Activity Database

    Vandrovcová, Marta; Douglas, T.E.L.; Heinemann, S.; Scharnweber, D.; Dubruel, P.; Bačáková, Lucie


    Roč. 103, č. 2 (2015), s. 525-533 ISSN 1549-3296 R&D Projects: GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:67985823 Keywords : lactoferin * collagen * bone cells Subject RIV: EI - Biotechnology ; Bionics Impact factor: 3.263, year: 2015

  19. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 250 of 263 ... Vol 11, No 1 (2010), The Phonological Problems Encountered by Igbo Students in Chinese Language Learning. Abstract PDF. IS Odinye. Vol 15, No 2 (2014), The Quest for a Sure Foundation of Cognitive Beliefs: Karl Popper's Fallibilist Critique of Rationalism and Empirisism, Abstract PDF. I Ndianefo.

  20. Network Correlates of Sexual Health Advice Seeking and Substance Use among Members of the Los Angeles House and Ball Communities (United States)

    Holloway, Ian W.; Schrager, Sheree M.; Wong, Carolyn F.; Dunlap, Shannon L.; Kipke, Michele D.


    House and Ball communities (HBCs), represent a prime context for human immunodeficiency virus prevention with African American young men who have sex with men and transgender persons. This study sought to understand the composition and function of social support and sexual networks of HBC members in Los Angeles, California (N = 263). Participants…

  1. Quantum nonlocality of photon pairs in interference in a Mach-Zehnder interferometer

    Czech Academy of Sciences Publication Activity Database

    Trojek, P.; Peřina ml., Jan


    Roč. 53, č. 4 (2003), s. 335-349 ISSN 0011-4626 R&D Projects: GA MŠk LN00A015 Institutional research plan: CEZ:AV0Z1010921 Keywords : entangled photon pairs * nonlocal interference * Mach-Zehender interferometer Subject RIV: BH - Optics, Masers, Lasers Impact factor: 0.263, year: 2003

  2. short communication infrared and ultraviolet spectrophotometric

    African Journals Online (AJOL)


    petroleum distillate into acid, base, neutral, saturate and aromatic fractions while Hirsh et al. [9] ... 100% n-hexane 5% Benzene + 15% benzene + benzene, ether and .... Model compounds: toluene 254 nm, o-xylene 263 nm, aniline 230 nm, ...

  3. Biochemical properties and microbial analysis of honey from North ...

    African Journals Online (AJOL)

    In the present study, physicochemical properties (pH, ash, commercial glucose, starch, reducing sugars and moisture) and microbial (yeast and enterobacterial) contaminations of 263 honey samples from North-western regions of Iran were evaluated in a 2 year period in different seasons of 2010 and 2011. Levels of ...

  4. Separation of Azeotropic Mixture Acetone + Hexane by Using Polydimethylsiloxane Membrane.

    Czech Academy of Sciences Publication Activity Database

    Randová, A.; Bartovská, L.; Kačírková, Marie; Ledesma, Oscar Iván Hernández; Červenková Šťastná, Lucie; Izák, Pavel; Žitková, Andrea; Friess, K.


    Roč. 170, OCT 1 (2016), s. 256-263 ISSN 1383-5866 R&D Projects: GA MŠk(CZ) LD14094 Institutional support: RVO:67985858 Keywords : azeotropic mixture * PDMS membrane * pervaporation Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 3.359, year: 2016

  5. alpha-Tocopheryl succinate inhibits angiogenesis by disrupting paracrine FGF2 signalling

    Czech Academy of Sciences Publication Activity Database

    Neužil, Jiří; Swettenham, E.; Wang, X.F.; Dong, L.F.; Stapelberg, M.


    Roč. 581, č. 24 (2007), s. 4611-4615 ISSN 0014-5793 Institutional research plan: CEZ:AV0Z50520514; CEZ:AV0Z50520701 Keywords : mitocans * proliferating endothelial cells * apoptosis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.263, year: 2007

  6. Oenothera coronifera, a new alien species for the Czech flora, and Oenothera stricta, recorded again after nearly two centuries

    Czech Academy of Sciences Publication Activity Database

    Mihulka, Stanislav; Pyšek, Petr; Pyšek, A.


    Roč. 75, - (2003), s. 263-270 ISSN 0032-7786 R&D Projects: GA AV ČR KSK6005114; GA ČR GA206/99/1239 Institutional research plan: CEZ:AV0Z6005908 Keywords : alien plants * casual occurrence * Oenothera Subject RIV: EF - Botanics

  7. The Relationship between Preservative Tax Assessments and Netherlands Tax Treaties: Not Always Pacta Sunt Servanda?

    NARCIS (Netherlands)

    Potgens, F.P.G.


    This article analyses the decisions of the Dutch Supreme Court of 20 February 2009, BNB 2009/260 through 262 and 19 June, 2009, BNB 2009/263 through 266 on the relationship between the domestic concept of preservative tax assessments and previously concluded tax treaties. The author argies that some

  8. Intertextualita a její podíl na vyjednávání pozic účastníků talk show

    Czech Academy of Sciences Publication Activity Database

    Čmejrková, Světla; Hoffmannová, Jana


    Roč. 73, č. 4 (2012), s. 263-284 ISSN 0037-7031 R&D Projects: GA ČR GAP406/12/1829 Institutional support: RVO:68378092 Keywords : political discourse * intertextuality * talk shaw * polyphony * irony * parody Subject RIV: AI - Linguistics Impact factor: 0.233, year: 2012

  9. Nuclear Structures Surrounding Internal Lamin Invaginations

    Czech Academy of Sciences Publication Activity Database

    Legartová, Soňa; Stixová, Lenka; Laur, O.; Kozubek, Stanislav; Sehnalová, Petra; Bártová, Eva


    Roč. 115, č. 3 (2014), s. 476-487 ISSN 0730-2312 R&D Projects: GA MŠk(CZ) LD11020 Institutional support: RVO:68081707 Keywords : LAMINS * NUCLEAR PORES * CHROMATIN Subject RIV: BO - Biophysics Impact factor: 3.263, year: 2014

  10. Prevalence of Demodex spp among alcohol-dependent patients

    Directory of Open Access Journals (Sweden)

    Mehmet Hanifi Kokacya


    Conclusion: Demodex spp. are more common in alcohol-dependent patients due conditions of reduced self-care and immunosuppression. Demodex parasites should be considered in alcohol-dependent patients with skin lesions, especially on the face, and should to be treated if needed. [Cukurova Med J 2016; 41(2.000: 259-263

  11. 50 CFR 622.9 - Vessel monitoring systems (VMSs). (United States)


    ..., St. Petersburg, FL 33701; phone: 800-758-4833. An operating VMS includes an operating mobile... board when on a trip in the South Atlantic. An operating VMS includes an operating mobile transmitting... Region, 263 13th Avenue South, St. Petersburg, FL 33701; phone: 800-758-4833; and (2) Submit to NMFS...

  12. AcEST: DK957284 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tr|Q092J0|Q092J0_STIAU Putative uncharacterized protein OS=Stigm... 40 0.094 tr|Q69340|Q69340_9ALPH Pseudorabies...PP--------VPLPRPVPGCGE 263 >tr|Q69340|Q69340_9ALPH Pseudorabies virus ORF1, ORF2, and ORF3 OS=Suid herpesvir

  13. A suitable material for the substrate of micro-strip gas chamber

    International Nuclear Information System (INIS)

    Zhang Minglong; Xia Yiben; Wang Linjun; Zhang Weili


    Micro-strip Gas Chamber (MSGC) used as a position sensitive detector has perfect performances in the detection of nuclear irradiations. However, it encounters a severe problem, that is, positive charge accumulation which can be avoided by reducing the surface resistivity of insulating substrate. So, diamond-like carbon (DLC) film is coated on D263 glass to modify its electrical properties as substrate for MSGC. Raman spectroscopy demonstrates that DLC film is of sp 3 (σ bounding) and sp 2 bonding (π bonding), and therefore it is a type of electronically conducting material. It also reveals that the film deposited on D263 glass possesses very large of sp 3 content and consequently is a high quality DLC film. I-V plots indicate that samples with DLC film enjoy very steady and suitable resistivities in the range of 10 9 -10 12 Ω·cm. C-F characteristics also show that samples coated by DLC film have low and stable capacitance with frequency. These excellent performances of the new material, DLC film/D263 glass, meet the optimum requirements of MSGC. DLC film/D263 glass used as the substrate of MSGC should effectively avoid the charge pile-up effect and substrate instability and then improve its performances

  14. Self-Harm Behaviour in Adolescents: Body Image and Self-Esteem (United States)

    Oktan, Vesile


    This research aimed to reveal the relationship between self-harm behaviour, body image, and self-esteem, and examined whether there was a difference between the body image and self-esteem of the adolescents who exhibited self-harm behaviour and those who did not. The study was conducted with the participation of 263 high school students--143…

  15. Extremely Energetic 4B/X17.2 Flare and Associated Phenomena ...

    Indian Academy of Sciences (India)

    Aryabhatta Research Institute of Observational Sciences (ARIES), Manora Peak,. Nainital 263 129 ... In this paper, we present the preliminary analysis of X17.2 flare, observed on. 28 October 2003. ... The Hα movie shows large scale .... we calculate the thermal energy (Eth) content of the flare applying the following formula:.

  16. Correlation of Ultrastructural Changes of Endothelial Cells and Astrocytes Occurring during Blood Brain Barrier Damage after Traumatic Brain Injury with Biochemical Markers of Blood Brain Barrier Leakage and Inflammatory Response

    Czech Academy of Sciences Publication Activity Database

    Vajtr, D.; Benada, Oldřich; Kukačka, J.; Průša, R.; Houšťava, L.; Toupalík, P.; Kizek, R.


    Roč. 58, č. 2 (2009), s. 263-268 ISSN 0862-8408 Institutional research plan: CEZ:AV0Z50200510 Keywords : Blood brain barrier * Expansive contusion * Metalloproteinases Subject RIV: EE - Microbiology, Virology Impact factor: 1.430, year: 2009

  17. Book ReviewslBoekbesprekings

    African Journals Online (AJOL)

    Bertram and K. L. Moore. Pp. xii + 263. Illustrated. Baltimore: Williams & Wilkins. 1982. Several good atlases of the human central nervous system are available, but the present authors have concentrated on developing a three-dimensional image of the complex neuro-anatomical relationships of structures in the brain and ...

  18. Philometra johnii sp nov (Nematoda, Philometridae), a new gonad-infecting philometrid from the sin croaker Johnius dussumieri (Cuvier) (Perciformes, Sciaenidae) from marine waters of Iraq

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Ali, A. H.


    Roč. 58, č. 3 (2013), s. 263-268 ISSN 1230-2821 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Parasitic nematode * Philometra * new species * marine fish * Johnius * Iraq * Arabian Gulf Subject RIV: EA - Cell Biology Impact factor: 0.965, year: 2013

  19. Effects of stocking on the genetic structure of brown trout, Salmo trutta, in Central Europe inferred from mitochondrial and nuclear DNA markers

    Czech Academy of Sciences Publication Activity Database

    Kohout, Jan; Jašková, I.; Papoušek, Ivo; Šedivá, Alena; Šlechta, Vlastimil


    Roč. 19, č. 3 (2012), 252-263 ISSN 0969-997X R&D Projects: GA AV ČR 1QS500450513; GA MŠk LC06073; GA ČR GA206/09/1154 Institutional support: RVO:67985904 ; RVO:68081766 Keywords : control region * Danube * introgression Subject RIV: GL - Fishing Impact factor: 1.028, year: 2012

  20. Modeling of the Aerosol Infiltration Characteristics in a Cultural Heritage Building: Τhe Baroque Library Hall in Prague

    Czech Academy of Sciences Publication Activity Database

    Chatoutsidou, S.E.; Mašková, Ludmila; Ondráčková, Lucie; Ondráček, Jakub; Lazaridis, M.; Smolík, Jiří


    Roč. 89, JUL (2015), s. 253-263 ISSN 0360-1323 EU Projects: European Commission(XE) 315760 Grant - others:EEA(NO) A/CZ0046/2/001 Institutional support: RVO:67985858 Keywords : infiltration factor * penetration * deposition Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.394, year: 2015

  1. Quo vadis plant hormone analysis?

    Czech Academy of Sciences Publication Activity Database

    Tarkowská, Danuše; Novák, Ondřej; Floková, Kristýna; Tarkowski, P.; Turečková, Veronika; Grúz, Jiří; Rolčík, Jakub; Strnad, Miroslav


    Roč. 240, č. 1 (2014), s. 55-76 ISSN 0032-0935 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Plant hormones * Extraction * Mass spectrometr Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.263, year: 2014

  2. Meningococcal adhesion suppresses proapoptotic gene expression and promotes expression of genes supporting early embryonic and cytoprotective signaling of human endothelial cells

    Czech Academy of Sciences Publication Activity Database

    Linhartová, Irena; Basler, Marek; Ichikawa, J.; Pelicic, V.; Osička, Radim; Lory, S.; Nassif, X.; Šebo, Peter


    Roč. 263, - (2006), s. 109-118 ISSN 0378-1097 R&D Projects: GA ČR GA310/06/0720 Institutional research plan: CEZ:AV0Z50200510 Keywords : neisseria meningitidis * adherence * signaling Subject RIV: EE - Microbiology, Virology Impact factor: 2.068, year: 2006

  3. Head-on collision between two solitary waves in a one-dimensional bead chain (United States)

    Wang, Fu-Gang; Yang, Yang-Yang; Han, Juan-Fang; Duan, Wen-Shan


    Not Available Project supported by the National Magnetic Confinement Fusion Science Program of China (Grant No. 2014GB104002), the National Natural Science Foundation of China (Grant No. 11647313), the Youth Science and Technology Foundation of Gansu Province, China (Grant No. 1606RJYA263), and the Institutes of Higher Education Institutions of Gansu Province, China (Grant No. 2015B-022).

  4. Review of adult head injury admissions into the intensive care unit of ...

    African Journals Online (AJOL)

    The most common mode of injury was road traffic accident. All the patients admitted to ICU had either moderate or severe head injury, with 73.7% having severe head injury. About 26.3% of the patients had associated cervical spine injuries and 50% had various musculoskeletal and soft tissue injuries. Cranial computed ...

  5. Industrial-scale process control by means of electrostatics probes

    Czech Academy of Sciences Publication Activity Database

    Špatenka, P.; Brunnhofer, Václav; Krumeich, J.; Blažek, J.; Šerý, M.; Endres, H. J.; Cook, R.


    Roč. 5, - (2001), s. 255-263 ISSN 1084-0184 R&D Projects: GA ČR GA202/00/1592; GA MŠk OC 527.60 Institutional research plan: CEZ:AV0Z5007907 Subject RIV: CI - Industrial Chemistry, Chemical Engineering

  6. U.S.-India Relations: Partners in Democracy (United States)


    2011. (JQ 629 .A58 N53 2011) Oldenburg , Philip. India, Pakistan, and Democracy: Solving the Puzzle of Divergent Paths. New York: Routledge, 2010. (JQ...Power, Ambition, and the Ultimate Weapon. Washington: Georgetown UP, 2012. (U 263 .S773 2012) Journals Acheson, Ray . "Modernization of

  7. Collagen/hydroxyapatite scaffold enriched with polycaprolactone nanofibers, thrombocyte-rich solution and mesenchymal stem cells promotes regeneration in large bone defect in vivo

    Czech Academy of Sciences Publication Activity Database

    Prosecká, Eva; Rampichová, Michala; Litvinec, Andrej; Tonar, Z.; Králíčková, M.; Vojtová, L.; Kochová, P.; Plencner, Martin; Buzgo, Matej; Míčková, Andrea; Jančář, J.; Amler, Evžen


    Roč. 103, č. 2 (2015), s. 671-682 ISSN 1549-3296 Institutional support: RVO:68378041 Keywords : bone regeneration * mesenchymal stem cells * collagen/hydroxyapatite scaffold Subject RIV: EI - Biotechnology ; Bionics Impact factor: 3.263, year: 2015

  8. Environmental Assessment for Selected Regions in the Mediterranean Sea (United States)


    7-23. Finetti, I. and C. Morelli (1972). Wide scale digital seismic exploration of the Mediterranean Sea. Bollettino Di Geofisica Teorica Applicata 14...291-342. Finetti, I. and C. Morelli (1973). Geophysical exploration of the Mediterranean. Bollettino Di Geofisica Teorica Applicata 15: 263-341

  9. ORF Alignment: NC_003318 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003318 gi|17988654 >1v7zA 9 254 21 263 2e-44 ... ref|NP_541287.1| creatininase [Br...ucella melitensis 16M] gb|AAL53551.1| creatininase ... [Brucella melitensis 16M] pir||AD3548 creatini

  10. Perceived Self-Efficacy to Avoid Cigarette Smoking and Addiction: Differences between Hispanics and Non-Hispanic Whites. (United States)

    Sabogal, Fabio; And Others


    Finds that, among 263 Hispanic and 150 non-Hispanic White smokers, Hispanics smoked fewer cigarettes, had lower levels of perceived addiction to nicotine, and had higher perceived self-efficacy to avoid smoking, but these differences shrank with greater acculturation. Discusses implications for smoking cessation programs. Contains 27 references.…

  11. A novel inhibitor of cytokinin degradation (INCYDE) influences the biochemical parameters and photosynthetic apparatus in NaCl-stressed tomato plants

    Czech Academy of Sciences Publication Activity Database

    Aremu, A.O.; Masondo, N.A.; Sunmonu, T.O.; Kulkarni, M. G.; Zatloukal, Marek; Spíchal, Lukáš; Doležal, Karel; van Staden, J.


    Roč. 240, č. 4 (2014), s. 877-889 ISSN 0032-0935 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Antioxidant * Cytokinins * Chlorophyll Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.263, year: 2014

  12. Elaboración de referencias regionales sobre el crecimiento ponderal correspondiente a cada edad para los países donde la malaria es endémica a fin de optimizar la dosificación basada en la edad de los medicamentos contra la malaria

    NARCIS (Netherlands)

    Hayes, Daniel J.; van Buuren, Stef; ter Kuile, Feiko O.; Stasinopoulos, D. Mikis; Rigby, Robert A.; Terlouw, Dianne J.


    Methods: A weight-for-age database was constructed from pre-existing population-based anthropometric data obtained from household surveys and research groups. It contained data collected between 1995 and 2012 on 1 263 119 individuals (909 368 female, 353 751 male) older than 14 days and younger than

  13. Developing regional weight-for-age growth references for malaria-endemic countries to optimize age-based dosing of antimalarials = Développer des références régionales de croissance pour le rapport poids/âge dans les pays où le paludisme est endémique, afin d’optimiser la posologie des médicaments antipaludiques en fonction de l’âge = Elaboración de referencias regionales sobre el crecimiento ponderal correspondiente a cada edad para los países donde la malaria es endémica a fin de optimizar la dosificación basada en la edad de los medicamentos contra la malaria

    NARCIS (Netherlands)

    Hayes, D.J.; Buuren, S. van; Kuile, F.O. ter; Stasinopoulos, D.M.; Rigby, R.A.; Terlouw, D.J.


    Methods: A weight-for-age database was constructed from pre-existing population-based anthropometric data obtained from household surveys and research groups. It contained data collected between 1995 and 2012 on 1 263 119 individuals (909 368 female, 353 751 male) older than 14 days and younger than

  14. What to Expect During a Colonoscopy

    Medline Plus

    Full Text Available ... available for interviews upon request. Please call the Communications Team at 301-263-9000 or e-mail ... Media Patients Patient Resource Center GI Health and Disease Recursos en Español What is a Gastroenterologist? Video ...

  15. 76 FR 34053 - Marine Mammals; File No. 16314 (United States)


    ..., Silver Spring, MD 20910; phone (301) 713-2289; fax (301) 713-0376; and Southeast Region, NMFS, 263 13th..., at the address listed above. Comments may also be submitted by facsimile to (301) 713- 0376, or by e... samples from the Lower Florida Keys. In compliance with the National Environmental Policy Act of 1969 (42...

  16. 75 FR 29316 - Marine Mammals; File No. 13599 (United States)


    ...; fax (301) 713-0376; and Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg, Florida 33701... the Chief, Permits, Conservation and Education Division, at the address listed above. Comments may... black abalone (Haliotis cracherodii). In compliance with the National Environmental Policy Act of 1969...

  17. 75 FR 16076 - Marine Mammals; File No. 15206 (United States)


    ..., NMFS, 263 13th Avenue South, Saint Petersburg, FL 33701; phone (727) 824-5312; fax (727) 824-5309... Division, at the address listed above. Comments may also be submitted by facsimile to (301) 713- 0376, or... Environmental Policy Act of 1969 (42 U.S.C. 4321 et seq.), an initial determination has been made that the...

  18. 77 FR 29981 - Marine Mammals; File No. 17086 (United States)


    ...-9394; and Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg, FL 33701; phone (727) 824... authorized. The permit is valid until May 11, 2017. In compliance with the National Environmental Policy Act of 1969 (42 U.S.C. 4321 et seq.), a final determination has been made that the activity proposed is...

  19. 77 FR 12244 - Marine Mammals; File No. 16325 (United States)


    ..., Gloucester, MA 01930; phone (978) 281-9328; fax (978) 281-9394; and Southeast Region, NMFS, 263 13th Avenue.... Comments may also be submitted by facsimile to (301) 713-0376, or by email to [email protected] Environmental Policy Act of 1969 (42 U.S.C. 4321 et seq.), to examine whether significant environmental impacts...

  20. 75 FR 42689 - Marine Mammals; File Nos. 15498 and 15500 (United States)


    ...-9394; and File No. 15500: Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg, FL 33701... Beard, (301) 713-2289. SUPPLEMENTARY INFORMATION: On May 3, 2010, notice was published in the Federal... Policy Act of 1969 (42 U.S.C. 4321 et seq.), a final determination has been made that the activity...

  1. 75 FR 50748 - Marine Mammals; File No. 14514 (United States)


    ..., Silver Spring, MD 20910; phone (301) 713-2289; fax (301) 713-0376; and Southeast Region, NMFS, 263 13th... INFORMATION CONTACT: Amy Sloan or Laura Morse, (301) 713- 2289. SUPPLEMENTARY INFORMATION: On May 3, 2010... Policy Act of 1969 (42 U.S.C. 4321 et seq.), a final determination has been made that the activity...

  2. 76 FR 63286 - Marine Mammals; File No. 15537 (United States)


    ..., Silver Spring, MD 20910; phone (301) 427-8401; fax (301) 713-0376; and Southeast Region, NMFS, 263 13th... INFORMATION CONTACT: Jennifer Skidmore or Amy Sloan, (301) 427-8401. SUPPLEMENTARY INFORMATION: On May 20... activities on the human environment in compliance with the National Environmental Policy Act of 1969 (42 U.S...

  3. 77 FR 13562 - Marine Mammals; File No. 14241 (United States)


    ... the permit, July 31, 2014. In compliance with the National Environmental Policy Act of 1969 (42 U.S.C.... Documents may be reviewed in the following locations: Permits and Conservation Division, Office of Protected... Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg, FL 33701; phone (727) 824-5312; fax (727...

  4. 75 FR 64247 - Marine Mammals; File No. 15543 (United States)


    ... (301) 713-2289; fax (301) 713- 0376; and Southeast Region, NMFS, 263 13th Avenue South, Saint... above. Comments may also be submitted by facsimile to (301) 713- 0376, or by e-mail to NMFS.Pr1Comments... with the National Environmental Policy Act of 1969 (42 U.S.C. 4321 et seq.), an initial determination...

  5. 75 FR 23242 - Marine Mammals; File Nos. 15498 and 15500 (United States)


    ... (978) 281-9394; and File No. 15500: Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg, FL... the address listed above. Comments may also be submitted by facsimile to (301) 713-0376, or by email... activities stated in the applications. In compliance with the National Environmental Policy Act of 1969 (42 U...

  6. 76 FR 28421 - Marine Mammals; File No. 15646 (United States)


    ...- 4018; and Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg, Florida 33701; phone (727..., Permits, Conservation and Education Division, at the address listed above. Comments may also be submitted... duration of the import permit is 5 years. In compliance with the National Environmental Policy Act of 1969...

  7. 76 FR 37063 - Marine Mammals; File No. 16510 (United States)


    ..., MD 20910; phone (301) 427-8401; fax (301) 713-0376; and Southeast Region, NMFS, 263 13th Avenue South... listed above. Comments may also be submitted by facsimile to (301) 713- 0376, or by e-mail to NMFS... with the National Environmental Policy Act of 1969 (42 U.S.C. 4321 et seq.), an initial determination...

  8. 77 FR 33199 - Marine Mammals; File No. 16124 (United States)


    ...; phone (808) 944-2200; fax (808) 973-2941; and Southeast Region, NMFS, 263 13th Avenue South, Saint... of issuance. In compliance with the National Environmental Policy Act of 1969 (42 U.S.C. 4321 et seq... purposes and policies set forth in section 2 of the ESA. Dated: May 24, 2012. Tammy C. Adams, Acting Chief...

  9. 76 FR 70418 - Marine Mammals; File No. 16124 (United States)


    ..., Honolulu, HI 96814-4700; phone (808) 944-2200; fax (808) 973-2941; and Southeast Region, NMFS, 263 13th..., at the address listed above. Comments may also be submitted by facsimile to (301) 713- 0376, or by...-year period. In compliance with the National Environmental Policy Act of 1969 (42 U.S.C. 4321 et seq...

  10. 77 FR 58357 - Marine Mammals; File No. 17355 (United States)


    ..., Gloucester, MA 01930; phone (978) 281-9328; fax (978) 281-9394; and Southeast Region, NMFS, 263 13th Avenue.... Comments may also be submitted by facsimile to (301) 713-0376, or by email to [email protected] compliance with the National Environmental Policy Act of 1969 (42 U.S.C. 4321 et seq.), an initial...

  11. 77 FR 26513 - Marine Mammals; File No. 15777 (United States)


    ...; fax (978) 281-9394; and Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg, FL 33701... the Chief, Permits and Conservation Division, at the address listed above. Comments may also be... compliance with the National Environmental Policy Act of 1969 (42 U.S.C. 4321 et seq.), an initial...

  12. 76 FR 75524 - Marine Mammals (United States)


    ..., 263 13th Avenue South, Saint Petersburg, Florida 33701; phone (727) 824-5312; fax (727) 824-5309. FOR... (Globicephala melas), although other small cetacean species may also be studied. The locations for the field... of 1969 (42 U.S.C. 4321 et seq.), an initial determination has been made that the activity proposed...

  13. 78 FR 56218 - Marine Mammals; File No. 18171 (United States)


    ...; and Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg, FL 33701; phone (727) 824-5312... Conservation Division, at the address listed above. Comments may also be submitted by facsimile to (301) 713... mammal program. In compliance with the National Environmental Policy Act of 1969 (42 U.S.C. 4321 et seq...

  14. 75 FR 16077 - Marine Mammals; File No. 15430 (United States)


    ...) 713-0376; and Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg, FL 33701; phone (727..., Permits, Conservation and Education Division, at the address listed above. Comments may also be submitted... with the National Environmental Policy Act of 1969 (42 U.S.C. 4321 et seq.), an initial determination...

  15. 76 FR 80890 - Endangered Species; File Nos. 13599 and 1614 (United States)


    ..., 263 13th Avenue South, Saint Petersburg, Florida 33701; phone (727) 824-5312; fax (727) 824-5309..., at the address listed above. Comments may also be submitted by facsimile to (301) 713-0376, or by... be valid until each permit expires. In compliance with the National Environmental Policy Act of 1969...

  16. 77 FR 45592 - Marine Mammals; File No. 17157 (United States)


    ..., Silver Spring, MD 20910; phone (301) 427-8401; fax (301) 713-0376; and Southeast Region, NMFS, 263 13th... INFORMATION CONTACT: Laura Morse or Jennifer Skidmore, (301) 427-8401. SUPPLEMENTARY INFORMATION: On May 21... 1969 (42 U.S.C. 4321 et seq.), a final determination has been made that the activity proposed is...

  17. 75 FR 47779 - Marine Mammals; File No. 14241 (United States)


    ... Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg, FL 33701; phone (727)824-5312; fax (727)824... INFORMATION: On May 28, 2010, notice was published in the Federal Register (75 FR 29991) that a request for an... compliance with the National Environmental Policy Act of 1969 (42 U.S.C. 4321 et seq.), a final determination...

  18. 78 FR 7755 - Marine Mammals; File No. 17754 (United States)


    ...)713-0376; and Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg, FL 33701; phone (727..., Permits and Conservation Division, at the address listed above. Comments may also be submitted by... of 1969 (42 U.S.C. 4321 et seq.), an initial determination has been made that the activity proposed...

  19. 77 FR 33444 - Marine Mammals; File No. 17217 (United States)


    ... (301) 427-8401; fax (301) 713-0376; and Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg... National Environmental Policy Act of 1969 (42 U.S.C. 4321 et seq.), a final determination has been made... assessment or environmental impact statement. Dated: May 30, 2012. Tammy C. Adams, Acting Chief, Permits and...

  20. 75 FR 29991 - Marine Mammals; receipt of application for permit amendment (United States)


    ...; phone (978)281-9300; fax (978)281-9333; and Southeast Region, NMFS, 263 13th Avenue South, Saint... delphinids such as long-finned pilot whales (Globicephala melas), although other small cetacean species may... expiration date of the permit. In compliance with the National Environmental Policy Act of 1969 (42 U.S.C...

  1. 78 FR 69049 - Marine Mammals; File No. 18171 (United States)


    ... (301) 427-8401; fax (301) 713-0376; and Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg... and 60 killer whales, could be approached and filmed annually. Filming may occur year-round. The... 1969 (42 U.S.C. 4321 et seq.), a final determination has been made that the activity proposed is...

  2. 77 FR 50086 - Marine Mammals; File No. 16109 (United States)


    ..., 263 13th Avenue South, Saint Petersburg, FL 33701; phone (727) 824-5312; fax (727) 824-5309. FOR... original permit, May 15, 2017. An environmental assessment (EA) analyzing the effects of the permitted... 1969 (42 U.S.C. 4321 et seq.). Based on the analyses in the EA, NMFS determined that issuance of the...

  3. 76 FR 45232 - Marine Mammals; File No. 16443 (United States)


    ..., MD 20910; phone (301) 427-8401; fax (301) 713-0376; and Southeast Region, NMFS, 263 13th Avenue South... listed above. Comments may also be submitted by facsimile to (301) 713- 0376, or by e-mail to NMFS... requested for a five-year period. In compliance with the National Environmental Policy Act of 1969 (42 U.S.C...

  4. 76 FR 51001 - Marine Mammals; File Nos. 16109 and 15575 (United States)


    ... Southeast Region, NMFS, 263 13th Avenue South, Saint Petersburg, FL 33701; phone (727) 824-5312; fax (727..., Conservation and Education Division, at the address listed above. Comments may also be submitted by facsimile... in compliance with the National Environmental Policy Act of 1969 (42 U.S.C. 4321 et seq.), to examine...

  5. 75 FR 75458 - Marine Mammals; File No. 15488 (United States)


    ..., NMFS, 263 13th Avenue South, Saint Petersburg, FL 33701; phone (727) 824-5312; fax (727) 824-5309... Division, at the address listed above. Comments may also be submitted by facsimile to (301) 713- 0376, or... with the National Environmental Policy Act of 1969 (42 U.S.C. 4321 et seq.), a draft environmental...

  6. 77 FR 29966 - Marine Mammals; File No. 17157 (United States)


    ..., MD 20910; phone (301) 427-8401; fax (301) 713-0376; and Southeast Region, NMFS, 263 13th Avenue South.... Comments may also be submitted by facsimile to (301) 713-0376, or by email to [email protected] 1969 (42 U.S.C. 4321 et seq.), an initial determination has been made that the activities proposed are...

  7. Dynamic coupling between heart rate and ventricular repolarisation

    Czech Academy of Sciences Publication Activity Database

    Halámek, Josef; Jurák, Pavel; Villa, M.; Souček, M.; Fráňa, P.; Nykodym, J.; Eisenberger, M.; Leinveber, P.; Vondra, Vlastimil; Somers, V. K.; Kára, T.


    Roč. 52, č. 3 (2007), s. 255-263 ISSN 0013-5585 R&D Projects: GA ČR(CZ) GA102/05/0402 Institutional research plan: CEZ:AV0Z20650511 Keywords : QT/RR coupling * transfer function Subject RIV: FS - Medical Facilities ; Equipment Impact factor: 0.593, year: 2007

  8. 78 FR 62016 - Agency Information Collection Activities: Announcement of Board Approval Under Delegated... (United States)


    .... Telecommunications Device for the Deaf (TDD) users may contact (202) 263-4869, Board of Governors of the Federal...- generated survey. First, under the guidance of Board economists, the Federal Reserve Banks survey business... use online survey tools to collect responses to the survey. The frequency and content of the questions...

  9. 75 FR 12748 - Ocean Transportation Intermediary License Applicants (United States)


    ... Shipping & Logistics, LLC, 10651 SW. 108 Avenue, 3A, Miami, FL 33176, Officers: Lorenzo A. Macias... Castleton Street, 263, City of Industry, CA 91748, Officers: Hua Yang, Vice President, (Qualifying Individual), Zhenfen Wu, Chairman. Qingfeng Wang dba Global Intertrans Logistics, 200 East Norwood Place, San...

  10. Perceived Learning and Timely Graduation for Business Undergraduates Taking an Online or Hybrid Course (United States)

    Blau, Gary; Drennan, Rob B.; Hochner, Arthur; Kapanjie, Darin


    An online survey tested the impact of background, technological, and course-related variables on perceived learning and timely graduation for a complete data sample of 263 business undergraduates taking at least one online or hybrid course in the fall of 2015. Hierarchical regression results showed that course-related variables (instructor…

  11. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. A Nautiyal. Articles written in Pramana – Journal of Physics. Volume 72 Issue 1 January 2009 pp 263-267. WHEPP-X: Report of the working group on cosmology · M Kaplinghat L Sriramkumar A Berera P Chingangbam R K Jain M Joy J Martin S Mohanty A Nautiyal R ...

  12. Evaluation of age and peripheral vascular disease as risk factors for ...

    African Journals Online (AJOL)

    Results: Among the 120 diabetic participants, peripheral vascular disease (PVD) was detected only in those aged 50 years and above and all the three diagnostic methods detected PVD increasingly with advancing age. Clinical criteria detected PVD in 4.7% of those aged 50-59 years and 26.3% of those aged .70years.

  13. Do Hours Spent Viewing Television at Ages 3 and 4 Predict Vocabulary and Executive Functioning at Age 5? (United States)

    Blankson, A. Nayena; O'Brien, Marion; Leerkes, Esther M.; Calkins, Susan D.; Marcovitch, Stuart D.


    We examined the impact of television viewing at ages 3 and 4 on vocabulary and at age 5 on executive functioning in the context of home learning environment and parental scaffolding. Children (N = 263) were seen in the lab when they were 3 years old and then again at ages 4 and 5. Parents completed measures assessing child television viewing and…

  14. Expressivity of apomixis in 2n + n hybrids from an apomictic and a sexual parent: insights into variation detected in Pilosella (Asteraceae: Lactuceae)

    Czech Academy of Sciences Publication Activity Database

    Krahulcová, Anna; Krahulec, František; Rosenbaumová, R.


    Roč. 24, č. 1 (2011), s. 263-274 ISSN 0934-0882 R&D Projects: GA ČR GA206/08/0890 Institutional research plan: CEZ:AV0Z60050516 Keywords : inheritance of apomixis * residual sexuality * unreduced hybrids Subject RIV: EF - Botanics Impact factor: 1.869, year: 2011

  15. The Relationship between EFL Learners' Language Learning Strategy Use and Achievement (United States)

    Balci, Özgül; Ügüten, Selma Durak


    The primary purpose of this study was to examine the relationship between language learning strategy use and foreign language achievement, focusing on differences in gender. A total of 263 English as a foreign language students enrolled in English preparatory class program at Necmettin Erbakan University, School of Foreign Languages participated…

  16. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. N L Singh. Articles written in Bulletin of Materials Science. Volume 27 Issue 3 June 2004 pp 263-267 Polymers. Electrical properties of ion irradiated polypropylene films · N L Singh Anita Sharma V Shrinet A K Rakshit D K Avasthi · More Details Abstract Fulltext PDF. The effect ...

  17. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences. Vijay Kodiyalam. Articles written in Proceedings – Mathematical Sciences. Volume 110 Issue 3 August 2000 pp 263-292. The Algebra of -relations · Vijay Kodiyalam R Srinivasan V S Sunder · More Details Abstract Fulltext PDF. In this paper, we study a tower { A n G ...

  18. Optimal selection for BRCA1 and BRCA2 mutation testing using a combination of ' easy to apply ' probability models

    NARCIS (Netherlands)

    Bodmer, D.; Ligtenberg, M. J. L.; van der Hout, A. H.; Gloudemans, S.; Ansink, K.; Oosterwijk, J. C.; Hoogerbrugge, N.


    To establish an efficient, reliable and easy to apply risk assessment tool to select families with breast and/or ovarian cancer patients for BRCA mutation testing, using available probability models. In a retrospective study of 263 families with breast and/or ovarian cancer patients, the utility of

  19. Advancing the Science of Team Science (United States)

    Falk‐Krzesinski, Holly J.; Börner, Katy; Contractor, Noshir; Fiore, Stephen M.; Hall, Kara L.; Keyton, Joann; Spring, Bonnie; Stokols, Daniel; Trochim, William; Uzzi, Brian


    Abstract The First Annual International Science of Team Science (SciTS) Conference was held in Chicago, IL April 22–24, 2010. This article presents a summary of the Conference proceedings. Clin Trans Sci 2010; Volume 3: 263–266. PMID:20973925

  20. 78 FR 14225 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; Gulf of Mexico Reef Fish Fishery... (United States)


    ... documentation may be obtained from Rich Malinowski, NMFS, Southeast Regional Office, 263 13th Avenue South, St. Petersburg, FL 33701; telephone: 727-824-5305. FOR FURTHER INFORMATION CONTACT: Rich Malinowski, telephone: 727-824- 5305, or email: . SUPPLEMENTARY INFORMATION: The reef fish fishery...