The mtDNA haplogroup P of modern Asian cattle: A genetic legacy of Asian aurochs?

Science.gov (United States)

Noda, Aoi; Yonesaka, Riku; Sasazaki, Shinji; Mannen, Hideyuki

2018-01-01

Aurochs (Bos primigenius) were distributed throughout large parts of Eurasia and Northern Africa during the late Pleistocene and the early Holocene, and all modern cattle are derived from the aurochs. Although the mtDNA haplogroups of most modern cattle belong to haplogroups T and I, several additional haplogroups (P, Q, R, C and E) have been identified in modern cattle and aurochs. Haplogroup P was the most common haplogroup in European aurochs, but so far, it has been identified in only three of >3,000 submitted haplotypes of modern Asian cattle. We sequenced the complete mtDNA D-loop region of 181 Japanese Shorthorn cattle and analyzed these together with representative bovine mtDNA sequences. The haplotype P of Japanese Shorthorn cattle was analyzed along with that of 36 previously published European aurochs and three modern Asian cattle sequences using the hypervariable 410 bp of the D-loop region. We detected the mtDNA haplogroup P in Japanese Shorthorn cattle with an extremely high frequency (83/181). Phylogenetic networks revealed two main clusters, designated as Pa for haplogroup P in European aurochs and Pc in modern Asian cattle. We also report the genetic diversity of haplogroup P compared with the sequences of extinct aurochs. No shared haplotypes are observed between the European aurochs and the modern Asian cattle. This finding suggests the possibility of local and secondary introgression events of haplogroup P in northeast Asian cattle, and will contribute to a better understanding of its origin and genetic diversity.

New population and phylogenetic features of the internal variation within mitochondrial DNA macro-haplogroup R0.

Directory of Open Access Journals (Sweden)

Vanesa Alvarez-Iglesias

Full Text Available BACKGROUND: R0 embraces the most common mitochondrial DNA (mtDNA lineage in West Eurasia, namely, haplogroup H (approximately 40%. R0 sub-lineages are badly defined in the control region and therefore, the analysis of diagnostic coding region polymorphisms is needed in order to gain resolution in population and medical studies. METHODOLOGY/PRINCIPAL FINDINGS: We sequenced the first hypervariable segment (HVS-I of 518 individuals from different North Iberian regions. The mtDNAs belonging to R0 (approximately 57% were further genotyped for a set of 71 coding region SNPs characterizing major and minor branches of R0. We found that the North Iberian Peninsula shows moderate levels of population stratification; for instance, haplogroup V reaches the highest frequency in Cantabria (north-central Iberia, but lower in Galicia (northwest Iberia and Catalonia (northeast Iberia. When compared to other European and Middle East populations, haplogroups H1, H3 and H5a show frequency peaks in the Franco-Cantabrian region, declining from West towards the East and South Europe. In addition, we have characterized, by way of complete genome sequencing, a new autochthonous clade of haplogroup H in the Basque country, named H2a5. Its coalescence age, 15.6+/-8 thousand years ago (kya, dates to the period immediately after the Last Glacial Maximum (LGM. CONCLUSIONS/SIGNIFICANCE: In contrast to other H lineages that experienced re-expansion outside the Franco-Cantabrian refuge after the LGM (e.g. H1 and H3, H2a5 most likely remained confined to this area till present days.

Associations of mitochondrial haplogroups and mitochondrial DNA copy numbers with end-stage renal disease in a Han population.

Science.gov (United States)

Zhang, Yuheng; Zhao, Ying; Wen, Shuzhen; Yan, Rengna; Yang, Qinglan; Chen, Huimei

2017-09-01

Mitochondrial DNA (mtDNA) is closely related to mitochondrion function, and variations have been suggested to be involved in pathogenesis of complex diseases. The present study sought to elucidate mitochondrial haplogroups and mtDNA copy number in end-stage renal disease (ESRD) in a Han population. First, the mitochondrial haplogroups of 37 ESRD patients were clustered into several haplogroups, and haplogroup A & D were taken as the candidate risk haplogroups for ESRD. Second, the frequencies of A and D were assessed in 344 ESRD patients and 438 healthy controls, respectively. Haplogroup D was found to be risk maker for ESRD in young subjects (numbers were evaluated with quantitative-PCR. The ESRD patients exhibited greater cell-free mtDNA contents than the healthy controls but less intracellular mtDNA. Haplogroup D exhibited a further increase in cell-free mtDNA content and a decrease in intracellular mtDNA content among the ESRDs patients. Our findings suggest that mtNDA haplogroup D may contributes to pathogenesis of early-onset ESRD through alterations of mtDNA copy numbers.

Determining Y-STR mutation rates in deep-routing genealogies: Identification of haplogroup differences.

Science.gov (United States)

Claerhout, Sofie; Vandenbosch, Michiel; Nivelle, Kelly; Gruyters, Leen; Peeters, Anke; Larmuseau, Maarten H D; Decorte, Ronny

2018-05-01

Knowledge of Y-chromosomal short tandem repeat (Y-STR) mutation rates is essential to determine the most recent common ancestor (MRCA) in familial searching or genealogy research. Up to now, locus-specific mutation rates have been extensively examined especially for commercially available forensic Y-STRs, while haplogroup specific mutation rates have not yet been investigated in detail. Through 450 patrilineally related namesakes distributed over 212 deep-rooting genealogies, the individual mutation rates of 42 Y-STR loci were determined, including 27 forensic Y-STR loci from the Yfiler ® Plus kit and 15 additional Y-STR loci (DYS388, DYS426, DYS442, DYS447, DYS454, DYS455, DYS459a/b, DYS549, DYS607, DYS643, DYS724a/b and YCAIIa/b). At least 726 mutations were observed over 148,596 meiosis and individual Y-STR mutation rates varied from 2.83 × 10 -4 to 1.86 × 10 -2 . The mutation rate was significantly correlated with the average allele size, the complexity of the repeat motif sequence and the age of the father. Significant differences in average Y-STR mutations rates were observed when haplogroup 'I & J' (4.03 × 10 -3 mutations/generation) was compared to 'R1b' (5.35 × 10 -3 mutations/generation) and to the overall mutation rate (5.03 × 10 -3 mutations/generation). A difference in allele size distribution was identified as the only cause for these haplogroup specific mutation rates. The haplogroup specific mutation rates were also present within the commercially available Y-STR kits (Yfiler ® , PowerPlex ® Y23 System and Yfiler ® Plus). This observation has consequences for applications where an average Y-STR mutation rate is used, e.g. tMRCA estimations in familial searching and genealogy research. Copyright © 2018 Elsevier B.V. All rights reserved.

Mitochondrial haplogroups in patients with rheumatoid arthritis

DEFF Research Database (Denmark)

Duhn, Pernille Hurup; Sode, Jacob; Hagen, Christian Munch

2017-01-01

Objective To describe the distribution of specific mitochondrial DNA (mtDNA) haplogroups (hgs) in a cohort of patients with rheumatoid arthritis (RA). Methods Two-hundred nineteen consecutive patients with RA had mtDNA isolated from their blood, sequenced and haplotyped. Patients were diagnosed...

Human mitochondrial haplogroup H: the highest VO2max consumer--is it a paradox?

Science.gov (United States)

Martínez-Redondo, Diana; Marcuello, Ana; Casajús, José A; Ara, Ignacio; Dahmani, Yahya; Montoya, Julio; Ruiz-Pesini, Eduardo; López-Pérez, Manuel J; Díez-Sánchez, Carmen

2010-03-01

Mitochondrial background has been demonstrated to influence maximal oxygen uptake (VO(2max), in mLkg(-1)min(-1)), but this genetic influence can be compensated for by regular exercise. A positive correlation among electron transport chain (ETC) coupling, ATP and reactive oxygen species (ROS) production has been established, and mitochondrial variants have been reported to show differences in their ETC performance. In this study, we examined in detail the VO(2max) differences found among mitochondrial haplogroups. We recruited 81 healthy male Spanish Caucasian individuals and determined their mitochondrial haplogroup. Their VO(2max) was determined using incremental cycling exercise (ICE). VO(2max) was lower in J than in non-J haplogroup individuals (P=0.04). The H haplogroup was responsible for this difference (VO(2max); J vs. H; P=0.008) and this group also had significantly higher mitochondrial oxidative damage (mtOD) than the J haplogroup (P=0.04). In agreement with these results, VO(2max) and mtOD were positively correlated (P=0.01). Given that ROS production is the major contributor to mtOD and consumes four times more oxygen per electron than the ETC, our results strongly suggest that ROS production is responsible for the higher VO(2max) found in the H variant. These findings not only contribute to a better understanding of the mechanisms underneath VO(2max), but also help to explain some reported associations between mitochondrial haplogroups and mtOD with longevity, sperm motility, premature aging and susceptibility to different pathologies.

The phylogeny of the four pan-American MtDNA haplogroups: implications for evolutionary and disease studies.

Directory of Open Access Journals (Sweden)

Alessandro Achilli

Full Text Available Only a limited number of complete mitochondrial genome sequences belonging to Native American haplogroups were available until recently, which left America as the continent with the least amount of information about sequence variation of entire mitochondrial DNAs. In this study, a comprehensive overview of all available complete mitochondrial DNA (mtDNA genomes of the four pan-American haplogroups A2, B2, C1, and D1 is provided by revising the information scattered throughout GenBank and the literature, and adding 14 novel mtDNA sequences. The phylogenies of haplogroups A2, B2, C1, and D1 reveal a large number of sub-haplogroups but suggest that the ancestral Beringian population(s contributed only six (successful founder haplotypes to these haplogroups. The derived clades are overall starlike with coalescence times ranging from 18,000 to 21,000 years (with one exception using the conventional calibration. The average of about 19,000 years somewhat contrasts with the corresponding lower age of about 13,500 years that was recently proposed by employing a different calibration and estimation approach. Our estimate indicates a human entry and spread of the pan-American haplogroups into the Americas right after the peak of the Last Glacial Maximum and comfortably agrees with the undisputed ages of the earliest Paleoindians in South America. In addition, the phylogenetic approach also indicates that the pathogenic status proposed for various mtDNA mutations, which actually define branches of Native American haplogroups, was based on insufficient grounds.

Mitochondrial haplogroups modify the risk of developing hypertrophic cardiomyopathy in a Danish population

DEFF Research Database (Denmark)

Hagen, Christian M; Aidt, Frederik H; Hedley, Paula L

2013-01-01

Hypertrophic cardiomyopathy (HCM) is a genetic disorder caused by mutations in genes coding for proteins involved in sarcomere function. The disease is associated with mitochondrial dysfunction. Evolutionarily developed variation in mitochondrial DNA (mtDNA), defining mtDNA haplogroups and haplog......Hypertrophic cardiomyopathy (HCM) is a genetic disorder caused by mutations in genes coding for proteins involved in sarcomere function. The disease is associated with mitochondrial dysfunction. Evolutionarily developed variation in mitochondrial DNA (mtDNA), defining mtDNA haplogroups...... factors in the development of HCM. Thus, constitutive differences in mitochondrial function may influence the occurrence and clinical presentation of HCM. This could explain some of the phenotypic variability in HCM. The fact that haplogroup H and J are also modifying factors in ischemic cardiomyopathy...

Association of low race performance with mtDNA haplogroup L3b of Australian thoroughbred horses.

Science.gov (United States)

Lin, Xiang; Zheng, Hong-Xiang; Davie, Allan; Zhou, Shi; Wen, Li; Meng, Jun; Zhang, Yong; Aladaer, Qimude; Liu, Bin; Liu, Wu-Jun; Yao, Xin-Kui

2018-03-01

Mitochondrial DNA (mtDNA) encodes the genes for respiratory chain sub-units that determine the efficiency of oxidative phosphorylation in mitochondria. The aim of this study was to determine if there were any haplogroups and variants in mtDNA that could be associated with athletic performance of Thoroughbred horses. The whole mitochondrial genomes of 53 maternally unrelated Australian Thoroughbred horses were sequenced and an association study was performed with the competition histories of 1123 horses within their maternal lineages. A horse mtDNA phylogenetic tree was constructed based on a total of 195 sequences (including 142 from previous reports). The association analysis showed that the sample groups with poor racing performance history were enriched in haplogroup L3b (p = .0003) and its sub-haplogroup L3b1a (p = .0007), while those that had elite performance appeared to be not significantly associated with haplogroups G2 and L3a1a1a (p > .05). Haplogroup L3b and L3b1a bear two and five specific variants of which variant T1458C (site 345 in 16s rRNA) is the only potential functional variant. Furthermore, secondary reconstruction of 16s RNA showed considerable differences between two types of 16s RNA molecules (with and without T1458C), indicating a potential functional effect. The results suggested that haplogroup L3b, could have a negative association with elite performance. The T1458C mutation harboured in haplogroup L3b could have a functional effect that is related to poor athletic performance.

Control region variability of haplogroup C1d and the tempo of the peopling of the Americas.

Directory of Open Access Journals (Sweden)

Gonzalo Figueiro

Full Text Available BACKGROUND: Among the founding mitochondrial haplogroups involved in the peopling of the Americas, haplogroup C1d has been viewed as problematic because of its phylogeny and because of the estimates of its antiquity, apparently being much younger than other founding haplogroups. Several recent analyses, based on data from the entire mitochondrial genome, have contributed to an advance in the resolution of these problems. The aim of our analysis is to compare the conclusions drawn from the available HVR-I and HVR-II data for haplogroup C1d with the ones based on whole mitochondrial genomes. METHODOLOGY/PRINCIPAL FINDINGS: HVR-I and HVR-II sequences defined as belonging to haplogroup C1d by standard criteria were gathered from the literature as well as from population studies carried out in Uruguay. Sequence phylogeny was reconstructed using median-joining networks, geographic distribution of lineages was analyzed and the age of the most recent common ancestor estimated using the ρ-statistic and two different mutation rates. The putative ancestral forms of the haplogroup were found to be more widespread than the derived lineages, and the lineages defined by np 194 were found to be widely distributed and of equivalent age. CONCLUSIONS/SIGNIFICANCE: The analysis of control region sequences is found to still harbor great potential in tracing microevolutionary phenomena, especially those found to have occurred in more recent times. Based on the geographic distributions of the alleles of np 7697 and np 194, both discussed as possible basal mutations of the C1d phylogeny, we suggest that both alleles were part of the variability of the haplogroup at the time of its entrance. Moreover, based on the mutation rates of the different sites stated to be diagnostic, it is possible that the anomalies found when analyzing the haplogroup are due to paraphyly.

mtDNA mutation C1494T, haplogroup A, and hearing loss in Chinese

International Nuclear Information System (INIS)

Wang Chengye; Kong Qingpeng; Yao Yonggang; Zhang Yaping

2006-01-01

Mutation C1494T in mitochondrial 12S rRNA gene was recently reported in two large Chinese families with aminoglycoside-induced and nonsyndromic hearing loss (AINHL) and was claimed to be pathogenic. This mutation, however, was first reported in a sample from central China in our previous study that was aimed to reconstruct East Asian mtDNA phylogeny. All these three mtDNAs formed a subclade defined by mutation C1494T in mtDNA haplogroup A. It thus seems that mutation C1494T is a haplogroup A-associated mutation and this matrilineal background may contribute a high risk for the penetrance of mutation C1494T in Chinese with AINHL. To test this hypothesis, we first genotyped mutation C1494T in 553 unrelated individuals from three regional Chinese populations and performed an extensive search for published complete or near-complete mtDNA data sets (>3000 mtDNAs), we then screened the C1494T mutation in 111 mtDNAs with haplogroup A status that were identified from 1823 subjects across China. The search for published mtDNA data sets revealed no other mtDNA besides the above-mentioned three carrying mutation C1494T. None of the 553 randomly selected individuals and the 111 haplogroup A mtDNAs was found to bear this mutation. Therefore, our results suggest that C1494T is a very rare event. The mtDNA haplogroup A background in general is unlikely to play an active role in the penetrance of mutation C1494T in AINHL

Phylogeography of mtDNA haplogroup R7 in the Indian peninsula

Directory of Open Access Journals (Sweden)

Shukla Parul

2008-08-01

Full Text Available Abstract Background Human genetic diversity observed in Indian subcontinent is second only to that of Africa. This implies an early settlement and demographic growth soon after the first 'Out-of-Africa' dispersal of anatomically modern humans in Late Pleistocene. In contrast to this perspective, linguistic diversity in India has been thought to derive from more recent population movements and episodes of contact. With the exception of Dravidian, which origin and relatedness to other language phyla is obscure, all the language families in India can be linked to language families spoken in different regions of Eurasia. Mitochondrial DNA and Y chromosome evidence has supported largely local evolution of the genetic lineages of the majority of Dravidian and Indo-European speaking populations, but there is no consensus yet on the question of whether the Munda (Austro-Asiatic speaking populations originated in India or derive from a relatively recent migration from further East. Results Here, we report the analysis of 35 novel complete mtDNA sequences from India which refine the structure of Indian-specific varieties of haplogroup R. Detailed analysis of haplogroup R7, coupled with a survey of ~12,000 mtDNAs from caste and tribal groups over the entire Indian subcontinent, reveals that one of its more recently derived branches (R7a1, is particularly frequent among Munda-speaking tribal groups. This branch is nested within diverse R7 lineages found among Dravidian and Indo-European speakers of India. We have inferred from this that a subset of Munda-speaking groups have acquired R7 relatively recently. Furthermore, we find that the distribution of R7a1 within the Munda-speakers is largely restricted to one of the sub-branches (Kherwari of northern Munda languages. This evidence does not support the hypothesis that the Austro-Asiatic speakers are the primary source of the R7 variation. Statistical analyses suggest a significant correlation between

Mitochondrial haplogroup H1 in north Africa: an early holocene arrival from Iberia.

Directory of Open Access Journals (Sweden)

Claudio Ottoni

Full Text Available The Tuareg of the Fezzan region (Libya are characterized by an extremely high frequency (61% of haplogroup H1, a mitochondrial DNA (mtDNA haplogroup that is common in all Western European populations. To define how and when H1 spread from Europe to North Africa up to the Central Sahara, in Fezzan, we investigated the complete mitochondrial genomes of eleven Libyan Tuareg belonging to H1. Coalescence time estimates suggest an arrival of the European H1 mtDNAs at about 8,000-9,000 years ago, while phylogenetic analyses reveal three novel H1 branches, termed H1v, H1w and H1x, which appear to be specific for North African populations, but whose frequencies can be extremely different even in relatively close Tuareg villages. Overall, these findings support the scenario of an arrival of haplogroup H1 in North Africa from Iberia at the beginning of the Holocene, as a consequence of the improvement in climate conditions after the Younger Dryas cold snap, followed by in situ formation of local H1 sub-haplogroups. This process of autochthonous differentiation continues in the Libyan Tuareg who, probably due to isolation and recent founder events, are characterized by village-specific maternal mtDNA lineages.

Mutation rate switch inside Eurasian mitochondrial haplogroups: impact of selection and consequences for dating settlement in Europe.

Directory of Open Access Journals (Sweden)

Denis Pierron

Full Text Available R-lineage mitochondrial DNA represents over 90% of the European population and is significantly present all around the planet (North Africa, Asia, Oceania, and America. This lineage played a major role in migration "out of Africa" and colonization in Europe. In order to determine an accurate dating of the R lineage and its sublineages, we analyzed 1173 individuals and complete mtDNA sequences from Mitomap. This analysis revealed a new coalescence age for R at 54.500 years, as well as several limitations of standard dating methods, likely to lead to false interpretations. These findings highlight the association of a striking under-accumulation of synonymous mutations, an over-accumulation of non-synonymous mutations, and the phenotypic effect on haplogroup J. Consequently, haplogroup J is apparently not a Neolithic group but an older haplogroup (Paleolithic that was subjected to an underestimated selective force. These findings also indicated an under-accumulation of synonymous and non-synonymous mutations localized on coding and non-coding (HVS1 sequences for haplogroup R0, which contains the major haplogroups H and V. These new dates are likely to impact the present colonization model for Europe and confirm the late glacial resettlement scenario.

Mitochondrial DNA Haplogroup A Decreases the Risk of Drug Addiction but Conversely Increases the Risk of HIV-1 Infection in Chinese Addicts.

Science.gov (United States)

Zhang, A-Mei; Hu, Qiu-Xiang; Liu, Feng-Liang; Bi, Rui; Yang, Bi-Qing; Zhang, Wen; Guo, Hao; Logan, Ian; Zheng, Yong-Tang; Yao, Yong-Gang

2016-08-01

Drug addiction is one of the most serious social problems in the world today and addicts are always at a high risk of acquiring HIV infection. Mitochondrial impairment has been reported in both drug addicts and in HIV patients undergoing treatment. In this study, we aimed to investigate whether mitochondrial DNA (mtDNA) haplogroup could affect the risk of drug addiction and HIV-1 infection in Chinese. We analyzed mtDNA sequence variations of 577 Chinese intravenous drug addicts (289 with HIV-1 infection and 288 without) and compared with 2 control populations (n = 362 and n = 850). We quantified the viral load in HIV-1-infected patients with and without haplogroup A status and investigated the potential effect of haplogroup A defining variants m.4824A > G and m.8794C > T on the cellular reactive oxygen species (ROS) levels by using an allotopic expression assay. mtDNA haplogroup A had a protective effect against drug addiction but appeared to confer an increased risk of HIV infection in addicts. HIV-1-infected addicts with haplogroup A had a trend for a higher viral load, although the mean viral load was similar between carriers of haplogroup A and those with other haplogroup. Hela cells overexpressing allele m.8794 T showed significantly decreased ROS levels as compared to cells with the allele m.8794C (P = 0.03). Our results suggested that mtDNA haplogroup A might protect against drug addiction but increase the risk of HIV-1 infection. The contradictory role of haplogroup A might be caused by an alteration in mitochondrial function due to a particular mtDNA ancestral variant.

Mitochondrial Haplogroups Modify the Effect of Diabetes Duration and HbA1c on Proliferative Diabetic Retinopathy Risk in Patients With Type 2 Diabetes.

Science.gov (United States)

Mitchell, Sabrina L; Neininger, Abigail C; Bruce, Carleigh N; Chocron, Isaac M; Bregman, Jana A; Estopinal, Christopher B; Muhammad, Ayesha; Umfress, Allison C; Jarrell, Kelli L; Warden, Cassandra; Harlow, Paula A; Wellons, Melissa; Samuels, David C; Brantley, Milam A

2017-12-01

We previously demonstrated an association between European mitochondrial haplogroups and proliferative diabetic retinopathy (PDR). The purpose of this study was to determine how the relationship between these haplogroups and both diabetes duration and hyperglycemia, two major risk factors for diabetic retinopathy (DR), affect PDR prevalence. Our population consisted of patients with type 2 diabetes with (n = 377) and without (n = 480) DR. A Kruskal-Wallis test was used to compare diabetes duration and hemoglobin A1c (HbA1c) among mitochondrial haplogroups. Logistic regressions were performed to investigate diabetes duration and HbA1c as risk factors for PDR in the context of European mitochondrial haplogroups. Neither diabetes duration nor HbA1c differed among mitochondrial haplogroups. Among DR patients from haplogroup H, longer diabetes duration and increasing HbA1c were significant risk factors for PDR (P = 0.0001 and P = 0.011, respectively). Neither diabetes duration nor HbA1c was a significant risk factor for PDR in DR patients from haplogroup UK. European mitochondrial haplogroups modify the effects of diabetes duration and HbA1c on PDR risk in patients with type 2 diabetes. In our patient population, longer diabetes duration and higher HbA1c increased PDR risk in patients from haplogroup H, but did not affect PDR risk in patients from haplogroup UK. This relationship has not been previously demonstrated and may explain, in part, why some patients with nonproliferative DR develop PDR and others do not, despite similar diabetes duration and glycemic control.

Parental diabetes status reveals association of mitochondrial DNA haplogroup J1 with type 2 diabetes

Directory of Open Access Journals (Sweden)

Wainstein Julio

2009-06-01

Full Text Available Abstract Background Although mitochondrial dysfunction is consistently manifested in patients with Type 2 Diabetes mellitus (T2DM, the association of mitochondrial DNA (mtDNA sequence variants with T2DM varies among populations. These differences might stem from differing environmental influences among populations. However, other potentially important considerations emanate from the very nature of mitochondrial genetics, namely the notable high degree of partitioning in the distribution of human mtDNA variants among populations, as well as the interaction of mtDNA and nuclear DNA-encoded factors working in concert to govern mitochondrial function. We hypothesized that association of mtDNA genetic variants with T2DM could be revealed while controlling for the effect of additional inherited factors, reflected in family history information. Methods To test this hypothesis we set out to investigate whether mtDNA genetic variants will be differentially associated with T2DM depending on the diabetes status of the parents. To this end, association of mtDNA genetic backgrounds (haplogroups with T2DM was assessed in 1055 Jewish patients with and without T2DM parents ('DP' and 'HP', respectively. Results Haplogroup J1 was found to be 2.4 fold under-represented in the 'HP' patients (p = 0.0035. These results are consistent with a previous observation made in Finnish T2DM patients. Moreover, assessing the haplogroup distribution in 'DP' versus 'HP' patients having diabetic siblings revealed that haplogroup J1 was virtually absent in the 'HP' group. Conclusion These results imply the involvement of inherited factors, which modulate the susceptibility of haplogroup J1 to T2DM.

New evidence of a mitochondrial genetic background paradox: Impact of the J haplogroup on the A3243G mutation

Directory of Open Access Journals (Sweden)

Pennarun Erwann

2008-05-01

Full Text Available Abstract Background The A3243G mutation in the tRNALeu gene (UUR, is one of the most common pathogenic mitochondrial DNA (mtDNA mutations in France, and is associated with highly variable and heterogeneous disease phenotypes. To define the relationships between the A3243G mutation and mtDNA backgrounds, we determined the haplogroup affiliation of 142 unrelated French patients – diagnosed as carriers of the A3243G mutation – by control-region sequencing and RFLP survey of their mtDNAs. Results The analysis revealed 111 different haplotypes encompassing all European haplogroups, indicating that the 3243 site might be a mutational hot spot. However, contrary to previous findings, we observed a statistically significant underepresentation of the A3243G mutation on haplogroup J in patients (p = 0.01, OR = 0.26, C.I. 95%: 0.08–0.83, suggesting that might be due to a strong negative selection at the embryo or germ line stages. Conclusion Thus, our study supports the existence of mutational hotspot on mtDNA and a "haplogroup J paradox," a haplogroup that may increase the expression of mtDNA pathogenic mutations, but also be beneficial in certain environmental contexts.

Mitochondrial DNA analysis of medieval sheep (Ovis aries) in central Italy reveals the predominance of haplogroup B already in the Middle Ages.

Science.gov (United States)

Gabbianelli, F; Gargani, M; Pariset, L; Mariotti, M; Alhaique, F; De Minicis, E; Barelli, L; Ciammetti, E; Redi, F; Valentini, A

2015-06-01

We retrieved 34 medieval ovicaprine remains, from three archaeological sites of central Italy dating to about 1000 years old, and analyzed them using mitochondrial DNA. We compared the reconstructed haplogroups with modern sheep samples from Europe and the Middle East and sequences from the literature. In modern sheep, haplogroup HA is present in countries with access to the Mediterranean and close to the domestication center, whereas it is very rare or absent in the rest of Europe. The haplogroup HB was predominant in ancient samples (90%), whereas haplogroup HA was found at 10%. Ancient haplogroups match the present distribution in modern sheep in Italy, indicating that the current proportion of HA/HB was already established in the Middle Ages and is not the result of subsequent events such as selective breeding practices. © 2015 Stichting International Foundation for Animal Genetics.

Inland post-glacial dispersal in East Asia revealed by mitochondrial haplogroup M9a'b

Directory of Open Access Journals (Sweden)

Wang Wen-Zhi

2011-01-01

Full Text Available Abstract Background Archaeological studies have revealed a series of cultural changes around the Last Glacial Maximum in East Asia; whether these changes left any signatures in the gene pool of East Asians remains poorly indicated. To achieve deeper insights into the demographic history of modern humans in East Asia around the Last Glacial Maximum, we extensively analyzed mitochondrial DNA haplogroup M9a'b, a specific haplogroup that was suggested to have some potential for tracing the migration around the Last Glacial Maximum in East Eurasia. Results A total of 837 M9a'b mitochondrial DNAs (583 from the literature, while the remaining 254 were newly collected in this study pinpointed from over 28,000 subjects residing across East Eurasia were studied here. Fifty-nine representative samples were further selected for total mitochondrial DNA sequencing so we could better understand the phylogeny within M9a'b. Based on the updated phylogeny, an extensive phylogeographic analysis was carried out to reveal the differentiation of haplogroup M9a'b and to reconstruct the dispersal histories. Conclusions Our results indicated that southern China and/or Southeast Asia likely served as the source of some post-Last Glacial Maximum dispersal(s. The detailed dissection of haplogroup M9a'b revealed the existence of an inland dispersal in mainland East Asia during the post-glacial period. It was this dispersal that expanded not only to western China but also to northeast India and the south Himalaya region. A similar phylogeographic distribution pattern was also observed for haplogroup F1c, thus substantiating our proposition. This inland post-glacial dispersal was in agreement with the spread of the Mesolithic culture originating in South China and northern Vietnam.

Yleaf: Software for Human Y-Chromosomal Haplogroup Inference from Next-Generation Sequencing Data.

Science.gov (United States)

Ralf, Arwin; Montiel González, Diego; Zhong, Kaiyin; Kayser, Manfred

2018-05-01

Next-generation sequencing (NGS) technologies offer immense possibilities given the large genomic data they simultaneously deliver. The human Y-chromosome serves as good example how NGS benefits various applications in evolution, anthropology, genealogy, and forensics. Prior to NGS, the Y-chromosome phylogenetic tree consisted of a few hundred branches, based on NGS data, it now contains many thousands. The complexity of both, Y tree and NGS data provide challenges for haplogroup assignment. For effective analysis and interpretation of Y-chromosome NGS data, we present Yleaf, a publically available, automated, user-friendly software for high-resolution Y-chromosome haplogroup inference independently of library and sequencing methods.

The genetic impact of the lake chad basin population in North Africa as documented by mitochondrial diversity and internal variation of the L3e5 haplogroup.

Science.gov (United States)

Podgorná, Eliška; Soares, Pedro; Pereira, Luísa; Cerný, Viktor

2013-11-01

The presence of sub-Saharan L-type mtDNA sequences in North Africa has traditionally been explained by the recent slave trade. However, gene flow between sub-Saharan and northern African populations would also have been made possible earlier through the greening of the Sahara resulting from Early Holocene climatic improvement. In this article, we examine human dispersals across the Sahara through the analysis of the sub-Saharan mtDNA haplogroup L3e5, which is not only commonly found in the Lake Chad Basin (∼17%), but which also attains nonnegligible frequencies (∼10%) in some Northwestern African populations. Age estimates point to its origin ∼10 ka, probably directly in the Lake Chad Basin, where the clade occurs across linguistic boundaries. The virtual absence of this specific haplogroup in Daza from Northern Chad and all West African populations suggests that its migration took place elsewhere, perhaps through Northern Niger. Interestingly, independent confirmation of Early Holocene contacts between North Africa and the Lake Chad Basin have been provided by craniofacial data from Central Niger, supporting our suggestion that the Early Holocene offered a suitable climatic window for genetic exchanges between North and sub-Saharan Africa. In view of its younger founder age in North Africa, the discontinuous distribution of L3e5 was probably caused by the Middle Holocene re-expansion of the Sahara desert, disrupting the clade's original continuous spread. © 2013 John Wiley & Sons Ltd/University College London.

The genetic landscape of Equatorial Guinea and the origin and migration routes of the Y chromosome haplogroup R-V88.

Science.gov (United States)

González, Miguel; Gomes, Verónica; López-Parra, Ana Maria; Amorim, António; Carracedo, Angel; Sánchez-Diz, Paula; Arroyo-Pardo, Eduardo; Gusmão, Leonor

2013-03-01

Human Y chromosomes belonging to the haplogroup R1b1-P25, although very common in Europe, are usually rare in Africa. However, recently published studies have reported high frequencies of this haplogroup in the central-western region of the African continent and proposed that this represents a 'back-to-Africa' migration during prehistoric times. To obtain a deeper insight into the history of these lineages, we characterised the paternal genetic background of a population in Equatorial Guinea, a Central-West African country located near the region in which the highest frequencies of the R1b1 haplogroup in Africa have been found to date. In our sample, the large majority (78.6%) of the sequences belong to subclades in haplogroup E, which are the most frequent in Bantu groups. However, the frequency of the R1b1 haplogroup in our sample (17.0%) was higher than that previously observed for the majority of the African continent. Of these R1b1 samples, nine are defined by the V88 marker, which was recently discovered in Africa. As high microsatellite variance was found inside this haplogroup in Central-West Africa and a decrease in this variance was observed towards Northeast Africa, our findings do not support the previously hypothesised movement of Chadic-speaking people from the North across the Sahara as the explanation for these R1b1 lineages in Central-West Africa. The present findings are also compatible with an origin of the V88-derived allele in the Central-West Africa, and its presence in North Africa may be better explained as the result of a migration from the south during the mid-Holocene.

Genetic evidence of an East Asian origin and paleolithic northward migration of Y-chromosome haplogroup N.

Science.gov (United States)

Shi, Hong; Qi, Xuebin; Zhong, Hua; Peng, Yi; Zhang, Xiaoming; Ma, Runlin Z; Su, Bing

2013-01-01

The Y-chromosome haplogroup N-M231 (Hg N) is distributed widely in eastern and central Asia, Siberia, as well as in eastern and northern Europe. Previous studies suggested a counterclockwise prehistoric migration of Hg N from eastern Asia to eastern and northern Europe. However, the root of this Y chromosome lineage and its detailed dispersal pattern across eastern Asia are still unclear. We analyzed haplogroup profiles and phylogeographic patterns of 1,570 Hg N individuals from 20,826 males in 359 populations across Eurasia. We first genotyped 6,371 males from 169 populations in China and Cambodia, and generated data of 360 Hg N individuals, and then combined published data on 1,210 Hg N individuals from Japanese, Southeast Asian, Siberian, European and Central Asian populations. The results showed that the sub-haplogroups of Hg N have a distinct geographical distribution. The highest Y-STR diversity of the ancestral Hg N sub-haplogroups was observed in the southern part of mainland East Asia, and further phylogeographic analyses supports an origin of Hg N in southern China. Combined with previous data, we propose that the early northward dispersal of Hg N started from southern China about 21 thousand years ago (kya), expanding into northern China 12-18 kya, and reaching further north to Siberia about 12-14 kya before a population expansion and westward migration into Central Asia and eastern/northern Europe around 8.0-10.0 kya. This northward migration of Hg N likewise coincides with retreating ice sheets after the Last Glacial Maximum (22-18 kya) in mainland East Asia.

Data from complete mtDNA sequencing of Tunisian centenarians: testing haplogroup association and the "golden mean" to longevity.

Science.gov (United States)

Costa, Marta D; Cherni, Lotfi; Fernandes, Verónica; Freitas, Fernando; Ammar El Gaaied, Amel Ben; Pereira, Luísa

2009-04-01

Since the mitochondrial theory of ageing was proposed, mitochondrial DNA (mtDNA) diversity has been largely studied in old people, however complete genomes are still rare, being limited to Japanese and UK/US samples. In this work, we evaluated possible longevity associated polymorphisms/haplogroups in an African population, from Tunisia, by performing complete mtDNA sequencing. This population has a mixed Eurasian/sub-Saharan mtDNA gene pool, which could potentially facilitate the evaluation of association for sub-Saharan lineages. Sub-Saharan haplogroups were shown to be significantly less represented in centenarians (9.5%) than in controls (54.5%), but it is not possible to rule out an influence of population structure, which is high in these populations. No recurrent polymorphism were more frequent in centenarians than in controls, and although the Tunisian centenarians presented less synonymous and replacement polymorphisms than controls, this difference was not statistically significant. So far, it does not seem that centenarians have significantly less mildly deleterious substitutions, not only in Tunisia but also in Japanese and UK/US samples, as tested here, not favouring a "golden mean" to longevity.

Genetic diversity among ancient Nordic populations

DEFF Research Database (Denmark)

Melchior, Linea Cecilie; Lynnerup, Niels; Siegismund, Hans Redlef

2010-01-01

, the success rate varied substantially between sites; the highest rates were obtained with untouched, freshly excavated material, whereas heavy handling, archeological preservation and storage for many years influenced the ability to obtain authentic endogenic DNA. While the nucleotide diversity at two...... the ancient Danes (average 13%) than among extant Danes and Scandinavians ( approximately 2.5%) as well as among other ancient population samples reported. Haplogroup I could therefore have been an ancient Southern Scandinavian type "diluted" by later immigration events. Interestingly, the two Neolithic...... samples (4,200 YBP, Bell Beaker culture) that were typed were haplogroup U4 and U5a, respectively, and the single Bronze Age sample (3,300-3,500 YBP) was haplogroup U4. These two haplogroups have been associated with the Mesolithic populations of Central and Northern Europe. Therefore, at least...

Human Retinal Transmitochondrial Cybrids with J or H mtDNA Haplogroups Respond Differently to Ultraviolet Radiation: Implications for Retinal Diseases

Science.gov (United States)

Malik, Deepika; Hsu, Tiffany; Falatoonzadeh, Payam; Cáceres-del-Carpio, Javier; Tarek, Mohamed; Chwa, Marilyn; Atilano, Shari R.; Ramirez, Claudio; Nesburn, Anthony B.; Boyer, David S.; Kuppermann, Baruch D.; Jazwinski, S. Michal; Miceli, Michael V.; Wallace, Douglas C.; Udar, Nitin; Kenney, M. Cristina

2014-01-01

Background It has been recognized that cells do not respond equally to ultraviolet (UV) radiation but it is not clear whether this is due to genetic, biochemical or structural differences of the cells. We have a novel cybrid (cytoplasmic hybrids) model that allows us to analyze the contribution of mitochondrial DNA (mtDNA) to cellular response after exposure to sub-lethal dose of UV. mtDNA can be classified into haplogroups as defined by accumulations of specific single nucleotide polymorphisms (SNPs). Recent studies have shown that J haplogroup is high risk for age-related macular degeneration while the H haplogroup is protective. This study investigates gene expression responses in J cybrids versus H cybrids after exposure to sub-lethal doses of UV-radiation. Methodology/Principal Findings Cybrids were created by fusing platelets isolated from subjects with either H (n = 3) or J (n = 3) haplogroups with mitochondria-free (Rho0) ARPE-19 cells. The H and J cybrids were cultured for 24 hours, treated with 10 mJ of UV-radiation and cultured for an additional 120 hours. Untreated and treated cybrids were analyzed for growth rates and gene expression profiles. The UV-treated and untreated J cybrids had higher growth rates compared to H cybrids. Before treatment, J cybrids showed lower expression levels for CFH, CD55, IL-33, TGF-A, EFEMP-1, RARA, BCL2L13 and BBC3. At 120 hours after UV-treatment, the J cybrids had decreased CFH, RARA and BBC3 levels but increased CD55, IL-33 and EFEMP-1 compared to UV-treated H cybrids. Conclusion/Significance In cells with identical nuclei, the cellular response to sub-lethal UV-radiation is mediated in part by the mtDNA haplogroup. This supports the hypothesis that differences in growth rates and expression levels of complement, inflammation and apoptosis genes may result from population-specific, hereditary SNP variations in mtDNA. Therefore, when analyzing UV-induced damage in tissues, the mtDNA haplogroup background may be

Genetic evidence of an East Asian origin and paleolithic northward migration of Y-chromosome haplogroup N.

Directory of Open Access Journals (Sweden)

Hong Shi

Full Text Available The Y-chromosome haplogroup N-M231 (Hg N is distributed widely in eastern and central Asia, Siberia, as well as in eastern and northern Europe. Previous studies suggested a counterclockwise prehistoric migration of Hg N from eastern Asia to eastern and northern Europe. However, the root of this Y chromosome lineage and its detailed dispersal pattern across eastern Asia are still unclear. We analyzed haplogroup profiles and phylogeographic patterns of 1,570 Hg N individuals from 20,826 males in 359 populations across Eurasia. We first genotyped 6,371 males from 169 populations in China and Cambodia, and generated data of 360 Hg N individuals, and then combined published data on 1,210 Hg N individuals from Japanese, Southeast Asian, Siberian, European and Central Asian populations. The results showed that the sub-haplogroups of Hg N have a distinct geographical distribution. The highest Y-STR diversity of the ancestral Hg N sub-haplogroups was observed in the southern part of mainland East Asia, and further phylogeographic analyses supports an origin of Hg N in southern China. Combined with previous data, we propose that the early northward dispersal of Hg N started from southern China about 21 thousand years ago (kya, expanding into northern China 12-18 kya, and reaching further north to Siberia about 12-14 kya before a population expansion and westward migration into Central Asia and eastern/northern Europe around 8.0-10.0 kya. This northward migration of Hg N likewise coincides with retreating ice sheets after the Last Glacial Maximum (22-18 kya in mainland East Asia.

The Indian origin of paternal haplogroup R1a1* substantiates the autochthonous origin of Brahmins and the caste system.

Science.gov (United States)

Sharma, Swarkar; Rai, Ekta; Sharma, Prithviraj; Jena, Mamata; Singh, Shweta; Darvishi, Katayoon; Bhat, Audesh K; Bhanwer, A J S; Tiwari, Pramod Kumar; Bamezai, Rameshwar N K

2009-01-01

Many major rival models of the origin of the Hindu caste system co-exist despite extensive studies, each with associated genetic evidences. One of the major factors that has still kept the origin of the Indian caste system obscure is the unresolved question of the origin of Y-haplogroup R1a1*, at times associated with a male-mediated major genetic influx from Central Asia or Eurasia, which has contributed to the higher castes in India. Y-haplogroup R1a1* has a widespread distribution and high frequency across Eurasia, Central Asia and the Indian subcontinent, with scanty reports of its ancestral (R*, R1* and R1a*) and derived lineages (R1a1a, R1a1b and R1a1c). To resolve these issues, we screened 621 Y-chromosomes (of Brahmins occupying the upper-most caste position and schedule castes/tribals occupying the lower-most positions) with 55 Y-chromosomal binary markers and seven Y-microsatellite markers and compiled an extensive dataset of 2809 Y-chromosomes (681 Brahmins, and 2128 tribals and schedule castes) for conclusions. A peculiar observation of the highest frequency (up to 72.22%) of Y-haplogroup R1a1* in Brahmins hinted at its presence as a founder lineage for this caste group. Further, observation of R1a1* in different tribal population groups, existence of Y-haplogroup R1a* in ancestors and extended phylogenetic analyses of the pooled dataset of 530 Indians, 224 Pakistanis and 276 Central Asians and Eurasians bearing the R1a1* haplogroup supported the autochthonous origin of R1a1 lineage in India and a tribal link to Indian Brahmins. However, it is important to discover novel Y-chromosomal binary marker(s) for a higher resolution of R1a1* and confirm the present conclusions.

The genetic landscape of Equatorial Guinea and the origin and migration routes of the Y chromosome haplogroup R-V88

OpenAIRE

González, Miguel; Gomes, Verónica; López-Parra, Ana Maria; Amorim, António; Carracedo, Ángel; Sánchez-Diz, Paula; Arroyo-Pardo, Eduardo; Gusmão, Leonor

2012-01-01

Human Y chromosomes belonging to the haplogroup R1b1-P25, although very common in Europe, are usually rare in Africa. However, recently published studies have reported high frequencies of this haplogroup in the central-western region of the African continent and proposed that this represents a ‘back-to-Africa' migration during prehistoric times. To obtain a deeper insight into the history of these lineages, we characterised the paternal genetic background of a population in Equatorial Guinea,...

Mitochondrial DNA haplogroup phylogeny of the dog: Proposal for a cladistic nomenclature.

Science.gov (United States)

Fregel, Rosa; Suárez, Nicolás M; Betancor, Eva; González, Ana M; Cabrera, Vicente M; Pestano, José

2015-05-01

Canis lupus familiaris mitochondrial DNA analysis has increased in recent years, not only for the purpose of deciphering dog domestication but also for forensic genetic studies or breed characterization. The resultant accumulation of data has increased the need for a normalized and phylogenetic-based nomenclature like those provided for human maternal lineages. Although a standardized classification has been proposed, haplotype names within clades have been assigned gradually without considering the evolutionary history of dog mtDNA. Moreover, this classification is based only on the D-loop region, proven to be insufficient for phylogenetic purposes due to its high number of recurrent mutations and the lack of relevant information present in the coding region. In this study, we design 1) a refined mtDNA cladistic nomenclature from a phylogenetic tree based on complete sequences, classifying dog maternal lineages into haplogroups defined by specific diagnostic mutations, and 2) a coding region SNP analysis that allows a more accurate classification into haplogroups when combined with D-loop sequencing, thus improving the phylogenetic information obtained in dog mitochondrial DNA studies. Copyright © 2015 Elsevier B.V. All rights reserved.

The Expansion of mtDNA Haplogroup L3 within and out of Africa

Czech Academy of Sciences Publication Activity Database

Soares, P.; Alshamali, F.; Pereira, J. B.; Fernandes, V.; Silva, N. M.; Afonso, C.; Costa, M. D.; Musilová, E.; Macaulay, V.; Richards, M. B.; Černý, Viktor; Pereira, L.

2012-01-01

Roč. 29, č. 3 (2012), s. 915-927 ISSN 0737-4038 R&D Projects: GA MŠk ME 917 Institutional research plan: CEZ:AV0Z80020508 Keywords : mtDNA * complete genomes * haplogroup L3 * out of Africa * modern human expansions Sub ject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 10.353, year: 2012

An original phylogenetic approach identified mitochondrial haplogroup T1a1 as inversely associated with breast cancer risk in BRCA2 mutation carriers.

Science.gov (United States)

Blein, Sophie; Bardel, Claire; Danjean, Vincent; McGuffog, Lesley; Healey, Sue; Barrowdale, Daniel; Lee, Andrew; Dennis, Joe; Kuchenbaecker, Karoline B; Soucy, Penny; Terry, Mary Beth; Chung, Wendy K; Goldgar, David E; Buys, Saundra S; Janavicius, Ramunas; Tihomirova, Laima; Tung, Nadine; Dorfling, Cecilia M; van Rensburg, Elizabeth J; Neuhausen, Susan L; Ding, Yuan Chun; Gerdes, Anne-Marie; Ejlertsen, Bent; Nielsen, Finn C; Hansen, Thomas Vo; Osorio, Ana; Benitez, Javier; Conejero, Raquel Andrés; Segota, Ena; Weitzel, Jeffrey N; Thelander, Margo; Peterlongo, Paolo; Radice, Paolo; Pensotti, Valeria; Dolcetti, Riccardo; Bonanni, Bernardo; Peissel, Bernard; Zaffaroni, Daniela; Scuvera, Giulietta; Manoukian, Siranoush; Varesco, Liliana; Capone, Gabriele L; Papi, Laura; Ottini, Laura; Yannoukakos, Drakoulis; Konstantopoulou, Irene; Garber, Judy; Hamann, Ute; Donaldson, Alan; Brady, Angela; Brewer, Carole; Foo, Claire; Evans, D Gareth; Frost, Debra; Eccles, Diana; Douglas, Fiona; Cook, Jackie; Adlard, Julian; Barwell, Julian; Walker, Lisa; Izatt, Louise; Side, Lucy E; Kennedy, M John; Tischkowitz, Marc; Rogers, Mark T; Porteous, Mary E; Morrison, Patrick J; Platte, Radka; Eeles, Ros; Davidson, Rosemarie; Hodgson, Shirley; Cole, Trevor; Godwin, Andrew K; Isaacs, Claudine; Claes, Kathleen; De Leeneer, Kim; Meindl, Alfons; Gehrig, Andrea; Wappenschmidt, Barbara; Sutter, Christian; Engel, Christoph; Niederacher, Dieter; Steinemann, Doris; Plendl, Hansjoerg; Kast, Karin; Rhiem, Kerstin; Ditsch, Nina; Arnold, Norbert; Varon-Mateeva, Raymonda; Schmutzler, Rita K; Preisler-Adams, Sabine; Markov, Nadja Bogdanova; Wang-Gohrke, Shan; de Pauw, Antoine; Lefol, Cédrick; Lasset, Christine; Leroux, Dominique; Rouleau, Etienne; Damiola, Francesca; Dreyfus, Hélène; Barjhoux, Laure; Golmard, Lisa; Uhrhammer, Nancy; Bonadona, Valérie; Sornin, Valérie; Bignon, Yves-Jean; Carter, Jonathan; Van Le, Linda; Piedmonte, Marion; DiSilvestro, Paul A; de la Hoya, Miguel; Caldes, Trinidad; Nevanlinna, Heli; Aittomäki, Kristiina; Jager, Agnes; van den Ouweland, Ans Mw; Kets, Carolien M; Aalfs, Cora M; van Leeuwen, Flora E; Hogervorst, Frans Bl; Meijers-Heijboer, Hanne Ej; Oosterwijk, Jan C; van Roozendaal, Kees Ep; Rookus, Matti A; Devilee, Peter; van der Luijt, Rob B; Olah, Edith; Diez, Orland; Teulé, Alex; Lazaro, Conxi; Blanco, Ignacio; Del Valle, Jesús; Jakubowska, Anna; Sukiennicki, Grzegorz; Gronwald, Jacek; Lubinski, Jan; Durda, Katarzyna; Jaworska-Bieniek, Katarzyna; Agnarsson, Bjarni A; Maugard, Christine; Amadori, Alberto; Montagna, Marco; Teixeira, Manuel R; Spurdle, Amanda B; Foulkes, William; Olswold, Curtis; Lindor, Noralane M; Pankratz, Vernon S; Szabo, Csilla I; Lincoln, Anne; Jacobs, Lauren; Corines, Marina; Robson, Mark; Vijai, Joseph; Berger, Andreas; Fink-Retter, Anneliese; Singer, Christian F; Rappaport, Christine; Kaulich, Daphne Geschwantler; Pfeiler, Georg; Tea, Muy-Kheng; Greene, Mark H; Mai, Phuong L; Rennert, Gad; Imyanitov, Evgeny N; Mulligan, Anna Marie; Glendon, Gord; Andrulis, Irene L; Tchatchou, Sandrine; Toland, Amanda Ewart; Pedersen, Inge Sokilde; Thomassen, Mads; Kruse, Torben A; Jensen, Uffe Birk; Caligo, Maria A; Friedman, Eitan; Zidan, Jamal; Laitman, Yael; Lindblom, Annika; Melin, Beatrice; Arver, Brita; Loman, Niklas; Rosenquist, Richard; Olopade, Olufunmilayo I; Nussbaum, Robert L; Ramus, Susan J; Nathanson, Katherine L; Domchek, Susan M; Rebbeck, Timothy R; Arun, Banu K; Mitchell, Gillian; Karlan, Beth Y; Lester, Jenny; Orsulic, Sandra; Stoppa-Lyonnet, Dominique; Thomas, Gilles; Simard, Jacques; Couch, Fergus J; Offit, Kenneth; Easton, Douglas F; Chenevix-Trench, Georgia; Antoniou, Antonis C; Mazoyer, Sylvie; Phelan, Catherine M; Sinilnikova, Olga M; Cox, David G

2015-04-25

Individuals carrying pathogenic mutations in the BRCA1 and BRCA2 genes have a high lifetime risk of breast cancer. BRCA1 and BRCA2 are involved in DNA double-strand break repair, DNA alterations that can be caused by exposure to reactive oxygen species, a main source of which are mitochondria. Mitochondrial genome variations affect electron transport chain efficiency and reactive oxygen species production. Individuals with different mitochondrial haplogroups differ in their metabolism and sensitivity to oxidative stress. Variability in mitochondrial genetic background can alter reactive oxygen species production, leading to cancer risk. In the present study, we tested the hypothesis that mitochondrial haplogroups modify breast cancer risk in BRCA1/2 mutation carriers. We genotyped 22,214 (11,421 affected, 10,793 unaffected) mutation carriers belonging to the Consortium of Investigators of Modifiers of BRCA1/2 for 129 mitochondrial polymorphisms using the iCOGS array. Haplogroup inference and association detection were performed using a phylogenetic approach. ALTree was applied to explore the reference mitochondrial evolutionary tree and detect subclades enriched in affected or unaffected individuals. We discovered that subclade T1a1 was depleted in affected BRCA2 mutation carriers compared with the rest of clade T (hazard ratio (HR) = 0.55; 95% confidence interval (CI), 0.34 to 0.88; P = 0.01). Compared with the most frequent haplogroup in the general population (that is, H and T clades), the T1a1 haplogroup has a HR of 0.62 (95% CI, 0.40 to 0.95; P = 0.03). We also identified three potential susceptibility loci, including G13708A/rs28359178, which has demonstrated an inverse association with familial breast cancer risk. This study illustrates how original approaches such as the phylogeny-based method we used can empower classical molecular epidemiological studies aimed at identifying association or risk modification effects.

Evidence of ancient DNA reveals the first European lineage in Iron Age Central China.

Science.gov (United States)

Xie, C Z; Li, C X; Cui, Y Q; Zhang, Q C; Fu, Y Q; Zhu, H; Zhou, H

2007-07-07

Various studies on ancient DNA have attempted to reconstruct population movement in Asia, with much interest focused on determining the arrival of European lineages in ancient East Asia. Here, we discuss our analysis of the mitochondrial DNA of human remains excavated from the Yu Hong tomb in Taiyuan, China, dated 1400 years ago. The burial style of this tomb is characteristic of Central Asia at that time. Our analysis shows that Yu Hong belonged to the haplogroup U5, one of the oldest western Eurasian-specific haplogroups, while his wife can be classified as haplogroup G, the type prevalent in East Asia. Our findings show that this man with European lineage arrived in Taiyuan approximately 1400 years ago, and most probably married a local woman. Haplogroup U5 was the first west Eurasian-specific lineage to be found in the central part of ancient China, and Taiyuan may be the easternmost location of the discovered remains of European lineage in ancient China.

Vector coherent state representations of SO5 contains SU2 + SU2 contains U1 + U1 and SO5 contains U1 + U1

International Nuclear Information System (INIS)

Pan Feng

1991-01-01

VCS representations of SO 5 contains SU 2 + SU 2 contains U 1 + U 1 and SO 5 contains U 1 + U 1 are discussed. Reduced matrix elements for SO 5 contains SU 2 + SU 2 are derived. The multiplicity of a weight for SO 5 is determined by using the K-matrix technique

Introduction of an single nucleodite polymorphism-based "Major Y-chromosome haplogroup typing kit" suitable for predicting the geographical origin of male lineages

DEFF Research Database (Denmark)

Brión, María; Sanchez, Juan J; Balogh, Kinga

2005-01-01

. From more than 200 SNPs compiled in the phylogenetic tree published by the Y-Chromosome Consortium, and looking at the population studies previously published, a package of 29 SNPs has been selected for the identification of major population haplogroups. A "Major Y-chromosome haplogroup typing kit" has......The European Consortium "High-throughput analysis of single nucleotide polymorphisms for the forensic identification of persons--SNPforID", has performed a selection of candidate Y-chromosome single nucleotide polymorphisms (SNPs) for making inferences on the geographic origin of an unknown sample...

U.S. Army Mobile Application Development: A Coder’s Perspective

Science.gov (United States)

2011-02-01

FEB 2011 2. REPORT TYPE 3. DATES COVERED 00-00-2011 to 00-00-2011 4. TITLE AND SUBTITLE U.S. Army Mobile Application Development: A Coder’s...activities on a smartphone. We called this app Sigacts. U.S. Army Mobile Application Development: A Coder’s Perspective As shown on the iPhone, The

An analysis of trends and perspectives of U.S.'s nuclear policies

International Nuclear Information System (INIS)

Lee, B. W.; Lee, K. S.; Oh, K. B.

2001-01-01

This paper analyzes the trends and perspectives of U.S.'s nuclear polices. With the changing of the administration of U.S., certain changes in nuclear policies are foreseen under Bush's new administration. Considering the traditional basis of republicans, somewhat positive impacts on nuclear R and D and nuclear power program are expected

The recruitment of the U5 snRNP to nascent transcripts requires internal loop 1 of U5 snRNA.

Science.gov (United States)

Kim, Rebecca; Paschedag, Joshua; Novikova, Natalya; Bellini, Michel

2012-12-01

In this study, we take advantage of the high spatial resolution offered by the nucleus and lampbrush chromosomes of the amphibian oocyte to investigate the mechanisms that regulate the intranuclear trafficking of the U5 snRNP and its recruitment to nascent transcripts. We monitor the fate of newly assembled fluorescent U5 snRNP in Xenopus oocytes depleted of U4 and/or U6 snRNAs and demonstrate that the U4/U6.U5 tri-snRNP is not required for the association of U5 snRNP with Cajal bodies, splicing speckles, and nascent transcripts. In addition, using a mutational analysis, we show that a non-functional U5 snRNP can associate with nascent transcripts, and we further characterize internal loop structure 1 of U5 snRNA as a critical element for licensing U5 snRNP to target both nascent transcripts and splicing speckles. Collectively, our data support the model where the recruitment of snRNPs onto pre-mRNAs is independent of spliceosome assembly and suggest that U5 snRNP may promote the association of the U4/U6.U5 tri-snRNP with nascent transcripts.

Mitogenomes from two uncommon haplogroups mark late glacial/postglacial expansions from the near east and neolithic dispersals within Europe.

Directory of Open Access Journals (Sweden)

Anna Olivieri

Full Text Available The current human mitochondrial (mtDNA phylogeny does not equally represent all human populations but is biased in favour of representatives originally from north and central Europe. This especially affects the phylogeny of some uncommon West Eurasian haplogroups, including I and W, whose southern European and Near Eastern components are very poorly represented, suggesting that extensive hidden phylogenetic substructure remains to be uncovered. This study expanded and re-analysed the available datasets of I and W complete mtDNA genomes, reaching a comprehensive 419 mitogenomes, and searched for precise correlations between the ages and geographical distributions of their numerous newly identified subclades with events of human dispersal which contributed to the genetic formation of modern Europeans. Our results showed that haplogroups I (within N1a1b and W originated in the Near East during the Last Glacial Maximum or pre-warming period (the period of gradual warming between the end of the LGM, ∼19 ky ago, and the beginning of the first main warming phase, ∼15 ky ago and, like the much more common haplogroups J and T, may have been involved in Late Glacial expansions starting from the Near East. Thus our data contribute to a better definition of the Late and postglacial re-peopling of Europe, providing further evidence for the scenario that major population expansions started after the Last Glacial Maximum but before Neolithic times, but also evidencing traces of diffusion events in several I and W subclades dating to the European Neolithic and restricted to Europe.

Increased Y-chromosome resolution of haplogroup O suggests genetic ties between the Ami aborigines of Taiwan and the Polynesian Islands of Samoa and Tonga.

Science.gov (United States)

Mirabal, Sheyla; Herrera, Kristian J; Gayden, Tenzin; Regueiro, Maria; Underhill, Peter A; Garcia-Bertrand, Ralph L; Herrera, Rene J

2012-01-25

The Austronesian expansion has left its fingerprint throughout two thirds of the circumference of the globe reaching the island of Madagascar in East Africa to the west and Easter Island, off the coast of Chile, to the east. To date, several theories exist to explain the current genetic distribution of Austronesian populations, with the "slow boat" model being the most widely accepted, though other conjectures (i.e., the "express train" and "entangled bank" hypotheses) have also been widely discussed. In the current study, 158 Y chromosomes from the Polynesian archipelagos of Samoa and Tonga were typed using high resolution binary markers and compared to populations across Mainland East Asia, Taiwan, Island Southeast Asia, Melanesia and Polynesia in order to establish their patrilineal genetic relationships. Y-STR haplotypes on the C2 (M38), C2a (M208), O1a (M119), O3 (M122) and O3a2 (P201) backgrounds were utilized in an attempt to identify the differing sources of the current Y-chromosomal haplogroups present throughout Polynesia (of Melanesian and/or Asian descent). We find that, while haplogroups C2a, S and K3-P79 suggest a Melanesian component in 23%-42% of the Samoan and Tongan Y chromosomes, the majority of the paternal Polynesian gene pool exhibits ties to East Asia. In particular, the prominence of sub-haplogroup O3a2c* (P164), which has previously been observed at only minimal levels in Mainland East Asians (2.0-4.5%), in both Polynesians (ranging from 19% in Manua to 54% in Tonga) and Ami aborigines from Taiwan (37%) provides, for the first time, evidence for a genetic connection between the Polynesian populations and the Ami. Copyright © 2011 Elsevier B.V. All rights reserved.

Near-Term Nuclear Power Revival? A U.S. and International Perspective

International Nuclear Information System (INIS)

Braun, C.

2004-01-01

In this paper I review the causes for the renewed interest in the near-term revival of nuclear power in the U.S. and internationally. I comment on the progress already made in the U.S. in restarting a second era of commercial nuclear power plant construction, and on what is required going forwards, from a utilities perspective, to commit to and implement new plant orders. I review the specific nuclear projects discussed and committed to in the U.S. and abroad in terms of utilities, sites, vendor and suppliers teams, and project arrangements. I will then offer some tentative conclusions regarding the prospects for a near-term U.S. and global nuclear power revival

The mitochondrial DNA makeup of Romanians: A forensic mtDNA control region database and phylogenetic characterization.

Science.gov (United States)

Turchi, Chiara; Stanciu, Florin; Paselli, Giorgia; Buscemi, Loredana; Parson, Walther; Tagliabracci, Adriano

2016-09-01

To evaluate the pattern of Romanian population from a mitochondrial perspective and to establish an appropriate mtDNA forensic database, we generated a high-quality mtDNA control region dataset from 407 Romanian subjects belonging to four major historical regions: Moldavia, Transylvania, Wallachia and Dobruja. The entire control region (CR) was analyzed by Sanger-type sequencing assays and the resulting 306 different haplotypes were classified into haplogroups according to the most updated mtDNA phylogeny. The Romanian gene pool is mainly composed of West Eurasian lineages H (31.7%), U (12.8%), J (10.8%), R (10.1%), T (9.1%), N (8.1%), HV (5.4%),K (3.7%), HV0 (4.2%), with exceptions of East Asian haplogroup M (3.4%) and African haplogroup L (0.7%). The pattern of mtDNA variation observed in this study indicates that the mitochondrial DNA pool is geographically homogeneous across Romania and that the haplogroup composition reveals signals of admixture of populations of different origin. The PCA scatterplot supported this scenario, with Romania located in southeastern Europe area, close to Bulgaria and Hungary, and as a borderland with respect to east Mediterranean and other eastern European countries. High haplotype diversity (0.993) and nucleotide diversity indices (0.00838±0.00426), together with low random match probability (0.0087) suggest the usefulness of this control region dataset as a forensic database in routine forensic mtDNA analysis and in the investigation of maternal genetic lineages in the Romanian population. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

Perspectives of U.S. energy problems

International Nuclear Information System (INIS)

Kimel, W.R.

In 1973 U.S. energy problems were brought dramatically into focus by the Arab oil embargo. A variety of bills passed by the Congress since that time and others that are under consideration do not adequately address our energy situation. To correct this situation the author believes free enterprise should be allowed to operate with as little regulation as possible to increase energy production using coal and nuclear as well as other 'soft' technologies. Conservation will also play an important role if economic factors are allowed to control logical implementation and application of energy saving techniques. Specifically, nuclear power must play a significant role because it has been proven economical, safe, dependable and the best energy source we know from an environmental perspective. (L.L.)

An original phylogenetic approach identified mitochondrial haplogroup T1a1 as inversely associated with breast cancer risk in BRCA2 mutation carriers

DEFF Research Database (Denmark)

Blein, Sophie; Bardel, Claire; Danjean, Vincent

2015-01-01

of Investigators of Modifiers of BRCA1/2 for 129 mitochondrial polymorphisms using the iCOGS array. Haplogroup inference and association detection were performed using a phylogenetic approach. ALTree was applied to explore the reference mitochondrial evolutionary tree and detect subclades enriched in affected......, H and T clades), the T1a1 haplogroup has a HR of 0.62 (95% CI, 0.40 to 0.95; P = 0.03). We also identified three potential susceptibility loci, including G13708A/rs28359178, which has demonstrated an inverse association with familial breast cancer risk. CONCLUSIONS: This study illustrates how...... original approaches such as the phylogeny-based method we used can empower classical molecular epidemiological studies aimed at identifying association or risk modification effects....

Phylogeography of Y-chromosome haplogroup O3a2b2-N6 reveals patrilineal traces of Austronesian populations on the eastern coastal regions of Asia

Science.gov (United States)

Teo, Yik-Ying; Huang, Yun-Zhi; Wang, Ling-Xiang; Yu, Ge; Saw, Woei-Yuh; Ong, Rick Twee-Hee; Lu, Yan; Zhang, Chao; Xu, Shu-Hua; Jin, Li; Li, Hui

2017-01-01

Austronesian diffusion is considered one of the greatest dispersals in human history; it led to the peopling of an extremely vast region, ranging from Madagascar in the Indian Ocean to Easter Island in Remote Oceania. The Y-chromosome haplogroup O3a2b*-P164(xM134), a predominant paternal lineage of Austronesian populations, is found at high frequencies in Polynesian populations. However, the internal phylogeny of this haplogroup remains poorly investigated. In this study, we analyzed -seventeen Y-chromosome sequences of haplogroup O3a2b*-P164(xM134) and generated a revised phylogenetic tree of this lineage based on 310 non-private Y-chromosome polymorphisms. We discovered that all available O3a2b*-P164(xM134) samples belong to the newly defined haplogroup O3a2b2-N6 and samples from Austronesian populations belong to the sublineage O3a2b2a2-F706. Additionally, we genotyped a series of Y-chromosome polymorphisms in a large collection of samples from China. We confirmed that the sublineage O3a2b2a2b-B451 is unique to Austronesian populations. We found that O3a2b2-N6 samples are widely distributed on the eastern coastal regions of Asia, from Korea to Vietnam. Furthermore, we propose- that the O3a2b2a2b-B451 lineage represents a genetic connection between ancestors of Austronesian populations and ancient populations in North China, where foxtail millet was domesticated about 11,000 years ago. The large number of newly defined Y-chromosome polymorphisms and the revised phylogenetic tree of O3a2b2-N6 will be helpful to explore the origin of proto-Austronesians and the early diffusion process of Austronesian populations. PMID:28380021

The Eastern side of the Westernmost Europeans: Insights from subclades within Y-chromosome haplogroup J-M304.

Science.gov (United States)

Manco, Licínio; Albuquerque, Joana; Sousa, Maria Francisca; Martiniano, Rui; de Oliveira, Ricardo Costa; Marques, Sofia; Gomes, Verónica; Amorim, António; Alvarez, Luís; Prata, Maria João

2018-03-01

We examined internal lineages and haplotype diversity in Portuguese samples belonging to J-M304 to improve the spatial and temporal understanding of the introduction of this haplogroup in Iberia, using the available knowledge about the phylogeography of its main branches, J1-M267 and J2-M172. A total of 110 males of Portuguese descent were analyzed for 17 Y-chromosome bi-allelic markers and seven Y-chromosome short tandem repeats (Y-STR) loci. Among J1-M267 individuals (n = 36), five different sub-haplogroups were identified, with the most common being J1a2b2-L147.1 (∼72%), which encompassed the majority of representatives of the J1a2b-P58 subclade. One sample belonged to the rare J1a1-M365.1 lineage and presented a core Y-STR haplotype consistent with the Iberian settlement during the fifth century by the Alans, a people of Iranian heritage. The analysis of J2-M172 Portuguese males (n = 74) enabled the detection of the two main subclades at very dissimilar frequencies, J2a-M410 (∼80%) and J2b-M12 (∼20%), among which the most common branches were J2a1(xJ2a1b,h)-L26 (22.9%), J2a1b(xJ2a1b1)-M67 (20.3%), J2a1h-L24 (27%), and J2b2-M241 (20.3%). While previous inferences based on modern haplogroup J Y-chromosomes implicated a main Neolithic dissemination, here we propose a later arrival of J lineages into Iberia using a combination of novel Portuguese Y-chromosomal data and recent evidence from ancient DNA. Our analysis suggests that a substantial tranche of J1-M267 lineages was likely carried into the Iberian Peninsula as a consequence of the trans-Mediterranean contacts during the first millennium BC, while most of the J2-M172 lineages may be associated with post-Neolithic population movements within Europe. © 2017 Wiley Periodicals, Inc.

Mitochondrial DNA haplogroup D4a is a marker for extreme longevity in Japan.

Directory of Open Access Journals (Sweden)

Erhan Bilal

Full Text Available We report results from the analysis of complete mitochondrial DNA (mtDNA sequences from 112 Japanese semi-supercentenarians (aged above 105 years combined with previously published data from 96 patients in each of three non-disease phenotypes: centenarians (99-105 years of age, healthy non-obese males, obese young males and four disease phenotypes, diabetics with and without angiopathy, and Alzheimer's and Parkinson's disease patients. We analyze the correlation between mitochondrial polymorphisms and the longevity phenotype using two different methods. We first use an exhaustive algorithm to identify all maximal patterns of polymorphisms shared by at least five individuals and define a significance score for enrichment of the patterns in each phenotype relative to healthy normals. Our study confirms the correlations observed in a previous study showing enrichment of a hierarchy of haplogroups in the D clade for longevity. For the extreme longevity phenotype we see a single statistically significant signal: a progressive enrichment of certain "beneficial" patterns in centenarians and semi-supercentenarians in the D4a haplogroup. We then use Principal Component Spectral Analysis of the SNP-SNP Covariance Matrix to compare the measured eigenvalues to a Null distribution of eigenvalues on Gaussian datasets to determine whether the correlations in the data (due to longevity arises from some property of the mutations themselves or whether they are due to population structure. The conclusion is that the correlations are entirely due to population structure (phylogenetic tree. We find no signal for a functional mtDNA SNP correlated with longevity. The fact that the correlations are from the population structure suggests that hitch-hiking on autosomal events is a possible explanation for the observed correlations.

Energy use in the U.S. steel industry: An historical perspective and future opportunities

Energy Technology Data Exchange (ETDEWEB)

Stubbles, John [Steel Industry Consultant, Mason, OH (United States)

2000-09-01

Renowned industry expert Dr. John Stubbles has projected the energy savings that the U.S. steel industry could reasonably expect to achieve in the report, Energy Use in the U.S. Steel Industry: Historical Perspective and Future Opportunities (PDF 432 KB). The report examines the potential impacts of state-of-the-art technologies and operating practices, as well as structural changes in the industry itself.

An alternative model for the early peopling of southern South America revealed by analyses of three mitochondrial DNA haplogroups.

Science.gov (United States)

de Saint Pierre, Michelle; Bravi, Claudio M; Motti, Josefina M B; Fuku, Noriyuki; Tanaka, Masashi; Llop, Elena; Bonatto, Sandro L; Moraga, Mauricio

2012-01-01

After several years of research, there is now a consensus that America was populated from Asia through Beringia, probably at the end of the Pleistocene. But many details such as the timing, route(s), and origin of the first settlers remain uncertain. In the last decade genetic evidence has taken on a major role in elucidating the peopling of the Americas. To study the early peopling of South America, we sequenced the control region of mitochondrial DNA from 300 individuals belonging to indigenous populations of Chile and Argentina, and also obtained seven complete mitochondrial DNA sequences. We identified two novel mtDNA monophyletic clades, preliminarily designated B2l and C1b13, which together with the recently described D1g sub-haplogroup have locally high frequencies and are basically restricted to populations from the extreme south of South America. The estimated ages of D1g and B2l, about ~15,000 years BP, together with their similar population dynamics and the high haplotype diversity shown by the networks, suggests that they probably appeared soon after the arrival of the first settlers and agrees with the dating of the earliest archaeological sites in South America (Monte Verde, Chile, 14,500 BP). One further sub-haplogroup, D4h3a5, appears to be restricted to Fuegian-Patagonian populations and reinforces our hypothesis of the continuity of the current Patagonian populations with the initial founders. Our results indicate that the extant native populations inhabiting South Chile and Argentina are a group which had a common origin, and suggest a population break between the extreme south of South America and the more northern part of the continent. Thus the early colonization process was not just an expansion from north to south, but also included movements across the Andes.

Microarray Analysis of Copy Number Variants on the Human Y Chromosome Reveals Novel and Frequent Duplications Overrepresented in Specific Haplogroups.

Directory of Open Access Journals (Sweden)

Martin M Johansson

Full Text Available The human Y chromosome is almost always excluded from genome-wide investigations of copy number variants (CNVs due to its highly repetitive structure. This chromosome should not be forgotten, not only for its well-known relevance in male fertility, but also for its involvement in clinical phenotypes such as cancers, heart failure and sex specific effects on brain and behaviour.We analysed Y chromosome data from Affymetrix 6.0 SNP arrays and found that the signal intensities for most of 8179 SNP/CN probes in the male specific region (MSY discriminated between a male, background signals in a female and an isodicentric male containing a large deletion of the q-arm and a duplication of the p-arm of the Y chromosome. Therefore, this SNP/CN platform is suitable for identification of gain and loss of Y chromosome sequences. In a set of 1718 males, we found 25 different CNV patterns, many of which are novel. We confirmed some of these variants by PCR or qPCR. The total frequency of individuals with CNVs was 14.7%, including 9.5% with duplications, 4.5% with deletions and 0.7% exhibiting both. Hence, a novel observation is that the frequency of duplications was more than twice the frequency of deletions. Another striking result was that 10 of the 25 detected variants were significantly overrepresented in one or more haplogroups, demonstrating the importance to control for haplogroups in genome-wide investigations to avoid stratification. NO-M214(xM175 individuals presented the highest percentage (95% of CNVs. If they were not counted, 12.4% of the rest included CNVs, and the difference between duplications (8.9% and deletions (2.8% was even larger.Our results demonstrate that currently available genome-wide SNP platforms can be used to identify duplications and deletions in the human Y chromosome. Future association studies of the full spectrum of Y chromosome variants will demonstrate the potential involvement of gain or loss of Y chromosome sequence in

Teachers' Perspectives of Students with ADHD in Korea and the U.S.

Science.gov (United States)

Moon, SeokYoung

2016-01-01

The purpose of this study was to explore teachers' perspectives of working with students with Attention Deficit Hyperactivity Disorder (ADHD) with two hundred twenty-eight K-12th grade teachers in Korea and the U.S. by using a concept mapping methodology. The four research questions were: (1) How do teachers in two different cultures (Korea and…

Human maternal heritage in Andalusia (Spain): its composition reveals high internal complexity and distinctive influences of mtDNA haplogroups U6 and L in the western and eastern side of region.

Science.gov (United States)

Hernández, Candela L; Reales, Guillermo; Dugoujon, Jean-Michel; Novelletto, Andrea; Rodríguez, Juan Nicolás; Cuesta, Pedro; Calderón, Rosario

2014-01-24

The archeology and history of the ancient Mediterranean have shown that this sea has been a permeable obstacle to human migration. Multiple cultural exchanges around the Mediterranean have taken place with presumably population admixtures. A gravitational territory of those migrations has been the Iberian Peninsula. Here we present a comprehensive analysis of the maternal gene pool, by means of control region sequencing and PCR-RFLP typing, of autochthonous Andalusians originating from the coastal provinces of Huelva and Granada, located respectively in the west and the east of the region. The mtDNA haplogroup composition of these two southern Spanish populations has revealed a wide spectrum of haplogroups from different geographical origins. The registered frequencies of Eurasian markers, together with the high incidence and diversification of African maternal lineages (15% of the total mitochondrial variability) among Huelva Andalusians when compared to its eastwards relatives of Granada and other Iberian populations, constitute relevant findings unknown up-to-date on the characteristics of mtDNA within Andalusia that testifies a female population substructure. Therefore, Andalusia must not be considered a single, unique population. The maternal legacy among Andalusians reflects distinctive local histories, pointing out the role of the westernmost territory of Peninsular Spain as a noticeable recipient of multiple and diverse human migrations. The obtained results underline the necessity of further research on genetic relationships in both sides of the western Mediterranean, using carefully collected samples from autochthonous individuals. Many studies have focused on recent North African gene flow towards Iberia, yet scientific attention should be now directed to thoroughly study the introduction of European genes in northwest Africa across the sea, in order to determine its magnitude, timescale and methods, and to compare them to those terrestrial movements

Theorizing Strategic Communication in Parsimony from the U.S. Government Perspective

Directory of Open Access Journals (Sweden)

Young Joon Lim

2015-06-01

Full Text Available Although the term Strategic Communication seems to be a rising topic in communication studies, it is obvious that the term has been hardly visualized and explained from the U.S. government perspective in academic work. This paper theoretically visualizes strategic communication processes. The Department of State and the Department of Defense streamlined the use of strategic communication in different terms but they both focus on using soft power over hard power to gain support from foreign audiences through communication. Both departments especially after the 9/11attacks have developed programs to win hearts and minds of the target audience. This paper shows the salient process of strategic communication programs and conceptualizes principles of strategic communication from their perspectives. This paper after all illustrates the processes for theorizing strategic communication.

Sub-populations within the major European and African derived haplogroups R1b3 and E3a are differentiated by previously phylogenetically undefined Y-SNPs.

Science.gov (United States)

Sims, Lynn M; Garvey, Dennis; Ballantyne, Jack

2007-01-01

Single nucleotide polymorphisms on the Y chromosome (Y-SNPs) have been widely used in the study of human migration patterns and evolution. Potential forensic applications of Y-SNPs include their use in predicting the ethnogeographic origin of the donor of a crime scene sample, or exclusion of suspects of sexual assaults (the evidence of which often comprises male/female mixtures and may involve multiple perpetrators), paternity testing, and identification of non- and half-siblings. In this study, we used a population of 118 African- and 125 European-Americans to evaluate 12 previously phylogenetically undefined Y-SNPs for their ability to further differentiate individuals who belong to the major African (E3a)- and European (R1b3, I)-derived haplogroups. Ten of these markers define seven new sub-clades (equivalent to E3a7a, E3a8, E3a8a, E3a8a1, R1b3h, R1b3i, and R1b3i1 using the Y Chromosome Consortium nomenclature) within haplogroups E and R. Interestingly, during the course of this study we evaluated M222, a sub-R1b3 marker rarely used, and found that this sub-haplogroup in effect defines the Y-STR Irish Modal Haplotype (IMH). The new bi-allelic markers described here are expected to find application in human evolutionary studies and forensic genetics. (c) 2006 Wiley-Liss, Inc.

XPS study of U, UNi5, UCu5 and UNisub(0.5)Cusub(4.5)

International Nuclear Information System (INIS)

Grohs, H.; Hoechst, H.; Steiner, P.; Huefner, S.; Buschow, K.H.J.

1980-01-01

Core and valence band spectra of U metal and the intermetallic compounds UNi 5 , UCu 5 and UNisub(0.5)Cusub(4.5) have been measured by X-ray excited photoelectron spectroscopy (XPS). The data indicate that in UNi 5 the configuration is 5f 3 , and in UCu 5 and UNisub(0.5)Cusub(4.5) a mixed valence configuration with fewer 5f electrons than in UNi 5 is present. (author)

Mitochondrial DNA copy number, but not haplogroup, confers a genetic susceptibility to leprosy in Han Chinese from Southwest China.

Directory of Open Access Journals (Sweden)

Dong Wang

Full Text Available BACKGROUND: Leprosy is a chronic infectious disease caused by Mycobacterium leprae, an unculturable pathogen with an exceptionally eroded genome. The high level of inactivation of gene function in M. leprae, including many genes in its metabolic pathways, has led to a dependence on host energy production and nutritional products. We hypothesized that host cellular powerhouse--the mitochondria--may affect host susceptibility to M. leprae and the onset of clinical leprosy, and this may be reflected by mitochondrial DNA (mtDNA background and mtDNA copy number. METHODS: We analyzed the mtDNA sequence variation of 534 leprosy patients and 850 matched controls from Yunnan Province and classified each subject by haplogroup. mtDNA copy number, taken to be proportional to mtDNA content, was measured in a subset of these subjects (296 patients and 231 controls and 12 leprosy patients upon diagnosis. RESULTS: Comparison of matrilineal components of the case and control populations revealed no significant difference. However, measurement of mtDNA copy number showed that lepromatous leprosy patients had a significantly higher mtDNA content than controls (P = 0.008. Past medical treatments had no effect on the alteration of mtDNA copy number. CONCLUSIONS: Our results suggested that mtDNA content, but not haplogroup, affects leprosy and this influence is limited to the clinical subtype of lepromatous leprosy.

Flipped SU(5) times U(1) in superconformal models

Energy Technology Data Exchange (ETDEWEB)

Bailin, D.; Katechou, E.K. (Sussex Univ., Brighton (United Kingdom). School of Mathematical and Physical Sciences); Love, A. (London Univ. (United Kingdom))

1992-01-10

This paper reports that flipped SU(5) {times} U(1) models are constructed in the framework of tensoring of N = 2 superconformal minimal models quotiented by discrete symmetries. Spontaneous breaking of flipped SU(5) {times} U(1) and extra U(1) factors in the gauge group along F-flat directions of the effective potential is studied.

Comparative investigation of the solution species [U(CO3)5]6- and the crystal structure of Na6[U(CO3)5].12H2O.

Science.gov (United States)

Hennig, Christoph; Ikeda-Ohno, Atsushi; Emmerling, Fanziska; Kraus, Werner; Bernhard, Gert

2010-04-21

The limiting U(IV) carbonate species in aqueous solution was investigated by comparing its structure parameters with those of the complex preserved in a crystal structure. The solution species prevails in aqueous solution of 0.05 M U(IV) and 1 M NaHCO(3) at pH 8.3. Single crystals of Na(6)[U(CO(3))(5)].12H(2)O were obtained directly from this mother solution. The U(IV) carbonate complex in the crystal structure was identified as a monomeric [U(CO(3))(5)](6-) anionic complex. The interatomic distances around the U(IV) coordination polyhedron show average distances of U-O = 2.461(8) A, U-C = 2.912(4) A and U-O(dist) = 4.164(6) A. U L(3)-edge EXAFS spectra were collected from the solid Na(6)[U(CO(3))(5)].12H(2)O and the corresponding solution. The first shell of the Fourier transforms (FTs) revealed, in both samples, a coordination of ten oxygen atoms at an average U-O distance of 2.45 +/- 0.02 A, the second shell originates from five carbon atoms with a U-C distance of 2.91 +/- 0.02 A, and the third shell was fit with single and multiple scattering paths of the distal oxygen at 4.17 +/- 0.02 A. These data indicate the identity of the [U(CO(3))(5)](6-) complex in solid and solution state. The high negative charge of the [U(CO(3))(5)](6-) anion is compensated by Na(+) cations. In solid state the Na(+) cations form a bridging network between the [U(CO(3))(5)](6-) units, while in liquid state the Na(+) cations seem to be located close to the anionic complex. The average metal-oxygen distances of the coordination polyhedron show a linear correlation to the radius contraction of the neighbouring actinide(IV) ions and indicate the equivalence of the [An(CO(3))(5)](6-) coordination within the series of thorium, uranium, neptunium and plutonium.

Human Y Chromosome Haplogroup N: A Non-trivial Time-Resolved Phylogeography that Cuts across Language Families.

Science.gov (United States)

Ilumäe, Anne-Mai; Reidla, Maere; Chukhryaeva, Marina; Järve, Mari; Post, Helen; Karmin, Monika; Saag, Lauri; Agdzhoyan, Anastasiya; Kushniarevich, Alena; Litvinov, Sergey; Ekomasova, Natalya; Tambets, Kristiina; Metspalu, Ene; Khusainova, Rita; Yunusbayev, Bayazit; Khusnutdinova, Elza K; Osipova, Ludmila P; Fedorova, Sardana; Utevska, Olga; Koshel, Sergey; Balanovska, Elena; Behar, Doron M; Balanovsky, Oleg; Kivisild, Toomas; Underhill, Peter A; Villems, Richard; Rootsi, Siiri

2016-07-07

The paternal haplogroup (hg) N is distributed from southeast Asia to eastern Europe. The demographic processes that have shaped the vast extent of this major Y chromosome lineage across numerous linguistically and autosomally divergent populations have previously been unresolved. On the basis of 94 high-coverage re-sequenced Y chromosomes, we establish and date a detailed hg N phylogeny. We evaluate geographic structure by using 16 distinguishing binary markers in 1,631 hg N Y chromosomes from a collection of 6,521 samples from 56 populations. The more southerly distributed sub-clade N4 emerged before N2a1 and N3, found mostly in the north, but the latter two display more elaborate branching patterns, indicative of regional contrasts in recent expansions. In particular, a number of prominent and well-defined clades with common N3a3'6 ancestry occur in regionally dissimilar northern Eurasian populations, indicating almost simultaneous regional diversification and expansion within the last 5,000 years. This patrilineal genetic affinity is decoupled from the associated higher degree of language diversity. Copyright © 2016 American Society of Human Genetics. Published by Elsevier Inc. All rights reserved.

Identification of West Eurasian mitochondrial haplogroups by mtDNA SNP screening: results of the 2006-2007 EDNAP collaborative exercise

DEFF Research Database (Denmark)

Parson, Walther; Fendt, Liane; Ballard, David

2008-01-01

no previous experience with the technology and/or mtDNA analysis. The results of this collaborative exercise stimulate the expansion of screening methods in forensic laboratories to increase efficiency and performance of mtDNA typing, and thus demonstrates that mtDNA SNP typing is a powerful tool for forensic......The European DNA Profiling (EDNAP) Group performed a collaborative exercise on a mitochondrial (mt) DNA screening assay that targeted 16 nucleotide positions in the coding region and allowed for the discrimination of major west Eurasian mtDNA haplogroups. The purpose of the exercise was to evaluate...

Impaired spermatogenesis and gr/gr deletions related to Y chromosome haplogroups in Korean men.

Directory of Open Access Journals (Sweden)

Jin Choi

Full Text Available Microdeletion of the Azoospermia Factor (AZF regions in Y chromosome is a well-known genetic cause of male infertility resulting from spermatogenetic impairment. However, the partial deletions of AZFc region related to spermatogenetic impairment are controversial. In this study, we characterized partial deletion of AZFc region in Korean patients with spermatogenetic impairment and assessed whether the DAZ and CDY1 contributes to the phenotype in patients with gr/gr deletions. Total of 377 patients with azoo-/oligozoospermia and 217 controls were analyzed using multiplex polymerase chain reaction (PCR, analysis of DAZ-CDY1 sequence family variants (SFVs, and quantitative fluorescent (QF-PCR. Of the 377 men with impaired spermatogenesis, 59 cases (15.6% had partial AZFc deletions, including 32 gr/gr (8.5%, 22 b2/b3 (5.8%, four b1/b3 (1.1% and one b3/b4 (0.3% deletion. In comparison, 14 of 217 normozoospermic controls (6.5% had partial AZFc deletions, including five gr/gr (2.3% and nine b2/b3 (4.1% deletions. The frequency of gr/gr deletions was significantly higher in the azoo-/oligozoospermic group than in the normozoospermic control group (p = 0.003; OR = 3.933; 95% CI = 1.509-10.250. Concerning Y haplogroup, we observed no significant differences in the frequency of gr/gr deletions between the case and the control groups in the YAP+ lineages, while gr/gr deletion were significantly higher in azoo-/oligozoospermia than normozoospermia in the YAP- lineage (p = 0.004; OR = 6.341; 95% CI = 1.472-27.312. Our data suggested that gr/gr deletion is associated with impaired spermatogenesis in Koreans with YAP- lineage, regardless of the gr/gr subtypes.

A Cultural Hybridization Perspective: Emerging Academic Subculture among International Students from East Asia in U.S.

Science.gov (United States)

Li, Jian

2016-01-01

This research examines the emerging academic subculture of international students from East Asia in U.S. academics from the cultural hybridization perspective. In a knowledge-based economy, international education plays a pivotal role in the global educational environment. Advocacy of international student mobility is essential; international…

Carriers of mitochondrial DNA macrohaplogroup R colonized Eurasia and Australasia from a southeast Asia core area.

Science.gov (United States)

Larruga, Jose M; Marrero, Patricia; Abu-Amero, Khaled K; Golubenko, Maria V; Cabrera, Vicente M

2017-05-23

The colonization of Eurasia and Australasia by African modern humans has been explained, nearly unanimously, as the result of a quick southern coastal dispersal route through the Arabian Peninsula, the Indian subcontinent, and the Indochinese Peninsula, to reach Australia around 50 kya. The phylogeny and phylogeography of the major mitochondrial DNA Eurasian haplogroups M and N have played the main role in giving molecular genetics support to that scenario. However, using the same molecular tools, a northern route across central Asia has been invoked as an alternative that is more conciliatory with the fossil record of East Asia. Here, we assess as the Eurasian macrohaplogroup R fits in the northern path. Haplogroup U, with a founder age around 50 kya, is one of the oldest clades of macrohaplogroup R in western Asia. The main branches of U expanded in successive waves across West, Central and South Asia before the Last Glacial Maximum. All these dispersions had rather overlapping ranges. Some of them, as those of U6 and U3, reached North Africa. At the other end of Asia, in Wallacea, another branch of macrohaplogroup R, haplogroup P, also independently expanded in the area around 52 kya, in this case as isolated bursts geographically well structured, with autochthonous branches in Australia, New Guinea, and the Philippines. Coeval independently dispersals around 50 kya of the West Asia haplogroup U and the Wallacea haplogroup P, points to a halfway core area in southeast Asia as the most probable centre of expansion of macrohaplogroup R, what fits in the phylogeographic pattern of its ancestor, macrohaplogroup N, for which a northern route and a southeast Asian origin has been already proposed.

17 CFR 259.5s - Form U5S, for annual reports filed under section 5(c) of the Act.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form U5S, for annual reports filed under section 5(c) of the Act. 259.5s Section 259.5s Commodity and Securities Exchanges SECURITIES... 1935 Forms for Registration and Annual Supplements § 259.5s Form U5S, for annual reports filed under...

Mitochondrial DNA polymorphisms associated with longevity in a Finnish population.

Science.gov (United States)

Niemi, Anna-Kaisa; Hervonen, Antti; Hurme, Mikko; Karhunen, Pekka J; Jylhä, Marja; Majamaa, Kari

2003-01-01

Sequence variation in mitochondrial DNA (mtDNA) may cause slight differences both in the functioning of the respiratory chain and in free radical production, and an association between certain mtDNA haplogroups and longevity has been suggested. In order to determine further the role of mtDNA in longevity, we studied the frequencies of mtDNA haplogroups and haplogroup clusters among elderly subjects and controls in a Finnish population. Samples were obtained from 225 persons aged 90-91 years (Vitality 90+) and from 400 middle-aged controls and 257 infants. MtDNA haplogroups were determined by restriction fragment length polymorphism. The haplogroup frequencies of the Vitality 90+ group differed from both those of the middle-aged controls ( P=0.01) and the infants ( P=0.00005), haplogroup H being less frequent than among the middle-aged subjects ( P=0.001) and infants ( P=0.00001), whereas haplogroups U and J were more frequent. Haplogroup clusters also differed between Vitality 90+ and both the middle-aged subjects ( P=0.002) and infants ( P=0.00001), the frequency of haplogroup cluster HV being lower in the former and that of UK and WIX being higher. These data suggest an association between certain mtDNA haplogroups or haplogroup clusters and longevity. Furthermore, our data appear to favour the presence of advantageous polymorphisms and support a role for mitochondria and mtDNA in the degenerative processes involved in ageing.

Mitochondrial DNA signals of late glacial recolonization of Europe from near eastern refugia.

Science.gov (United States)

Pala, Maria; Olivieri, Anna; Achilli, Alessandro; Accetturo, Matteo; Metspalu, Ene; Reidla, Maere; Tamm, Erika; Karmin, Monika; Reisberg, Tuuli; Hooshiar Kashani, Baharak; Perego, Ugo A; Carossa, Valeria; Gandini, Francesca; Pereira, Joana B; Soares, Pedro; Angerhofer, Norman; Rychkov, Sergei; Al-Zahery, Nadia; Carelli, Valerio; Sanati, Mohammad Hossein; Houshmand, Massoud; Hatina, Jiři; Macaulay, Vincent; Pereira, Luísa; Woodward, Scott R; Davies, William; Gamble, Clive; Baird, Douglas; Semino, Ornella; Villems, Richard; Torroni, Antonio; Richards, Martin B

2012-05-04

Human populations, along with those of many other species, are thought to have contracted into a number of refuge areas at the height of the last Ice Age. European populations are believed to be, to a large extent, the descendants of the inhabitants of these refugia, and some extant mtDNA lineages can be traced to refugia in Franco-Cantabria (haplogroups H1, H3, V, and U5b1), the Italian Peninsula (U5b3), and the East European Plain (U4 and U5a). Parts of the Near East, such as the Levant, were also continuously inhabited throughout the Last Glacial Maximum, but unlike western and eastern Europe, no archaeological or genetic evidence for Late Glacial expansions into Europe from the Near East has hitherto been discovered. Here we report, on the basis of an enlarged whole-genome mitochondrial database, that a substantial, perhaps predominant, signal from mitochondrial haplogroups J and T, previously thought to have spread primarily from the Near East into Europe with the Neolithic population, may in fact reflect dispersals during the Late Glacial period, ∼19-12 thousand years (ka) ago. Copyright © 2012 The American Society of Human Genetics. Published by Elsevier Inc. All rights reserved.

A single methyltransferase YefA (RlmCD) catalyses both m5U747 and m5U1939 modifications in Bacillus subtilis 23S rRNA

DEFF Research Database (Denmark)

Desmolaize, Benoit; Fabret, Céline; Brégeon, Damien

2011-01-01

Escherichia coli possesses three paralogues. These comprise the methyltransferases TrmA that targets U54 in tRNAs, RlmC that modifies U747 in 23S rRNA and RlmD that is specific for U1939 in 23S rRNA. The tRNAs and rRNAs of the Gram-positive bacterium Bacillus subtilis have the same three m(5)U modifications....... However, as previously shown, the m(5)U54 modification in B. subtilis tRNAs is catalysed in a fundamentally different manner by the folate-dependent enzyme TrmFO, which is unrelated to the E. coli TrmA. Here, we show that methylation of U747 and U1939 in B. subtilis rRNA is catalysed by a single enzyme...

Y-chromosome phylogeographic analysis of the Greek-Cypriot population reveals elements consistent with Neolithic and Bronze Age settlements.

Science.gov (United States)

Voskarides, Konstantinos; Mazières, Stéphane; Hadjipanagi, Despina; Di Cristofaro, Julie; Ignatiou, Anastasia; Stefanou, Charalambos; King, Roy J; Underhill, Peter A; Chiaroni, Jacques; Deltas, Constantinos

2016-01-01

The archeological record indicates that the permanent settlement of Cyprus began with pioneering agriculturalists circa 11,000 years before present, (ca. 11,000 y BP). Subsequent colonization events followed, some recognized regionally. Here, we assess the Y-chromosome structure of Cyprus in context to regional populations and correlate it to phases of prehistoric colonization. Analysis of haplotypes from 574 samples showed that island-wide substructure was barely significant in a spatial analysis of molecular variance (SAMOVA). However, analyses of molecular variance (AMOVA) of haplogroups using 92 binary markers genotyped in 629 Cypriots revealed that the proportion of variance among the districts was irregularly distributed. Principal component analysis (PCA) revealed potential genetic associations of Greek-Cypriots with neighbor populations. Contrasting haplogroups in the PCA were used as surrogates of parental populations. Admixture analyses suggested that the majority of G2a-P15 and R1b-M269 components were contributed by Anatolia and Levant sources, respectively, while Greece Balkans supplied the majority of E-V13 and J2a-M67. Haplotype-based expansion times were at historical levels suggestive of recent demography. Analyses of Cypriot haplogroup data are consistent with two stages of prehistoric settlement. E-V13 and E-M34 are widespread, and PCA suggests sourcing them to the Balkans and Levant/Anatolia, respectively. The persistent pre-Greek component is represented by elements of G2-U5(xL30) haplogroups: U5*, PF3147, and L293. J2b-M205 may contribute also to the pre-Greek strata. The majority of R1b-Z2105 lineages occur in both the westernmost and easternmost districts. Distinctively, sub-haplogroup R1b- M589 occurs only in the east. The absence of R1b- M589 lineages in Crete and the Balkans and the presence in Asia Minor are compatible with Late Bronze Age influences from Anatolia rather than from Mycenaean Greeks.

O(5) x U(1) electroweak theory

International Nuclear Information System (INIS)

Mukku, C.; Sayed, W.A.

1981-01-01

An anomaly-free O(5) x U(1) theory of electroweak interactions is described which provides a unified description of electroweak phenomena for two families of standard leptons and quarks. No ''new'' nonsequential-type fermions are introduced, unlike the case for all past studies based on this group. The present scheme requires the introduction of two further charged and three more neutral gauge fields over and above those of SU(2) x U(1) giving rise to new neutral and charged currents

Population History of the Red Sea. Genetic Exchanges Between the Arabian Peninsula and East Africa Signaled in the Mitochondrial DNA HV1 Haplogroup

Czech Academy of Sciences Publication Activity Database

Musilová, E.; Fernandes, V.; Silva, N. M.; Soares, P.; Alshamali, F.; Harich, N.; Cherni, L.; El Gaaied, A. B. A.; Al-Meeri, A.; Pereira, L.; Černý, Viktor

2011-01-01

Roč. 145, č. 4 (2011), s. 592-598 ISSN 0002-9483 R&D Projects: GA MŠk ME 917 Institutional research plan: CEZ:AV0Z80020508 Keywords : mtDNA genomes * HV1 haplogroup * Arabian Peninsula * East Africa Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 2.824, year: 2011 http://onlinelibrary.wiley.com/doi/10.1002/ajpa.21522/abstract;jsessionid=06420E45513D054B63DFDE068F111692.d03t01

Cost-effectiveness analysis of allopurinol versus febuxostat in chronic gout patients: a U.S. payer perspective.

Science.gov (United States)

Gandhi, Pranav K; Gentry, William M; Ma, Qinli; Bottorff, Michael B

2015-02-01

Gout is a chronic inflammatory condition associated with poor urate metabolism. Xanthine oxidase inhibitors such as allopurinol and febuxostat are recommended to reduce uric acid levels and to prevent gout attacks in adult patients. Under budget-driven constraints, health care payers are faced with the broader challenge of assessing the economic value of these agents for formulary placement. However, the economic value of allopurinol versus febuxostat has not be assessed in patients with gout over a 5-year time period in the United States. To evaluate the cost-effectiveness of allopurinol versus febuxostat in adult patients with gout over a 5-year time period from a U.S. health care payer's perspective. A Markov model was developed to compare the total direct costs and success of serum uric acid (sUA) level reduction associated with allopurinol and febuxostat. Treatment success was defined as patient achievement of a sUA level less than  6 mg/dL (0.36 mmol/L) at 6 months. Event probabilities were based on published phase III randomized clinical trials and included long-term sequelae from open-label extension studies. A hypothetical cohort of 1,000 adult gout patients with sUA levels of ≥ 8 mg/dL (0.48 mmol/L) who had received either allopurinol 300 mg or febuxostat 80 mg at model entry transitioned among the 4 health states defined by treatment success, treatment failure and switch, treatment dropout, and death. The length of each Markov cycle was 6 months. Costs were gathered from the RED BOOK, Medicare fee schedules, Healthcare Cost and Utilization Project's Nationwide Inpatient Sample, and for a limited number of inputs, expert consultation. Direct costs included treatment drug costs, costs for prophylaxis drugs, diagnostic laboratory tests, and the treatment and management of acute gout flare. Resource utilization was based on clinical evidence and expert consultation. All costs were inflated to 2014 U.S. dollars and were discounted at 3% in the base case

Photoassociation spectroscopy of 87Rb2 (5s1/2+5p1/2)0u+ long-range molecular states: Coupling with the (5s1/2+5p3/2)0u+ series analyzed using the Lu-Fano approach

International Nuclear Information System (INIS)

Jelassi, H.; Viaris de Lesegno, B.; Pruvost, L.

2006-01-01

We report on photoassociation of cold 87 Rb atoms providing the spectroscopy of (5s 1/2 +5p 1/2 )0 u + long-range molecular states, in the energy range of [-12.5, -0.7 cm -1 ] below the dissociation limit. A Lu-Fano approach coupled to the LeRoy-Bernstein formula is used to analyze the data. The Lu-Fano graph exhibits the coupling of the molecular series with the (5s 1/2 +5p 3/2 )0 u + one, which is due to spin effects in the molecule. A two-channel model involving an improved LeRoy-Bernstein formula allows us to characterize the molecular series, to localize (5s 1/2 +5p 3/2 )0 u + levels, to evaluate the coupling, and to predict the energy and width of the first predissociated level of (5s 1/2 +5p 3/2 )0 u + series. An experimental spectrum confirms the prediction

9 CFR 102.5 - U.S. Veterinary Biological Product License.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false U.S. Veterinary Biological Product... BIOLOGICAL PRODUCTS § 102.5 U.S. Veterinary Biological Product License. (a) Authorization to produce each biological product shall be specified on a U.S. Veterinary Biological Product License, issued by the...

A South American Prehistoric Mitogenome: Context, Continuity, and the Origin of Haplogroup C1d

Science.gov (United States)

Sans, Mónica; Figueiro, Gonzalo; Hughes, Cris E.; Lindo, John; Hidalgo, Pedro C.; Malhi, Ripan S.

2015-01-01

Based on mitochondrial DNA (mtDNA), it has been estimated that at least 15 founder haplogroups peopled the Americas. Subhaplogroup C1d3 was defined based on the mitogenome of a living individual from Uruguay that carried a lineage previously identified in hypervariable region I sequences from ancient and modern Uruguayan individuals. When complete mitogenomes were studied, additional substitutions were found in the coding region of the mitochondrial genome. Using a complete ancient mitogenome and three modern mitogenomes, we aim to clarify the ancestral state of subhaplogroup C1d3 and to better understand the peopling of the region of the Río de la Plata basin, as well as of the builders of the mounds from which the ancient individuals were recovered. The ancient mitogenome, belonging to a female dated to 1,610±46 years before present, was identical to the mitogenome of one of the modern individuals. All individuals share the mutations defining subhaplogroup C1d3. We estimated an age of 8,974 (5,748–12,261) years for the most recent common ancestor of C1d3, in agreement with the initial peopling of the geographic region. No individuals belonging to the defined lineage were found outside of Uruguay, which raises questions regarding the mobility of the prehistoric inhabitants of the country. Moreover, the present study shows the continuity of Native lineages over at least 6,000 years. PMID:26509686

SU(5) x U(1) phenomenology: Theorems on neutral-current analysis

International Nuclear Information System (INIS)

Zee, A.; Kim, J.E.

1980-01-01

We embed the SU(5) unified theory of Georgi and Glashow in a U(5) theory. This may result from the breaking of an SU(N), N>5, theory or of a GL(5,c) theory. At low energy this leads to an SU(2) x U(1) x U(1) electroweak theory. We show that, with a suitable choice of Higgs representations, the predictions of this theory for neutral-current experiments are characterized by three parameters. For appropriate values of these parameters, the predictions are practically indistinguishable from the standard SU(2) x U(1) theory. Certain theorems on the analysis of neutral-current interactions are proved. (Section V is independent for readers who are interested only in the theorems.) More accurate neutral-current measurement might answer the question of whether SU(5) x U(1) is relevant. Possible verification of the present electroweak theory can result from (roughly) an order suppression relative to the standard prediction on the asymmetries in e + e - → μ + μ - and discovery of two Z bosons around 90 --100 GeV. GL(n,c) gauge theories are formulated in the Appendix

Stress corrosion of the alloy U-7.5 Nb-2.5 Zr

International Nuclear Information System (INIS)

Lepoutre, D.; Nomine, A.M.; Miannay, D.

1983-09-01

Oxide formed on U-7.5 Nb-2.5 Zr at room temperature during stress corrosion cracking in oxygen is identical to the natural oxide of the alloy. It is formed by UO 2 with Nb and Zr and is associated with an increased Nb content at the interface. This oxide would be responsible for cracking [fr

Atomistic simulations of nanocrystalline U0.5Th0.5O2 solid solution under uniaxial tension

Directory of Open Access Journals (Sweden)

Hongxing Xiao

2017-12-01

Full Text Available Molecular dynamics simulations were performed to investigate the uniaxial tensile properties of nanocrystalline U0.5Th0.5O2 solid solution with the Born–Mayer–Huggins potential. The results indicated that the elastic modulus increased linearly with the density relative to a single crystal, but decreased with increasing temperature. The simulated nanocrystalline U0.5Th0.5O2 exhibited a breakdown in the Hall–Petch relation with mean grain size varying from 3.0 nm to 18.0 nm. Moreover, the elastic modulus of U1-yThyO2 solid solutions with different content of thorium at 300 K was also studied and the results accorded well with the experimental data available in the literature. In addition, the fracture mode of nanocrystalline U0.5Th0.5O2 was inclined to be ductile because the fracture behavior was preceded by some moderate amount of plastic deformation, which is different from what has been seen earlier in simulations of pure UO2.

An Empirical Comparison of the EQ-5D-5L, DEMQOL-U and DEMQOL-Proxy-U in a Post-Hospitalisation Population of Frail Older People Living in Residential Aged Care.

Science.gov (United States)

Ratcliffe, Julie; Flint, Thomas; Easton, Tiffany; Killington, Maggie; Cameron, Ian; Davies, Owen; Whitehead, Craig; Kurrle, Susan; Miller, Michelle; Liu, Enwu; Crotty, Maria

2017-06-01

To empirically compare the measurement properties of the DEMQOL-U and DEMQOL-Proxy-U instruments to the EQ-5D-5L and its proxy version (CEQ-5D-5L) in a population of frail older people living in residential aged care in the post-hospitalisation period following a hip fracture. A battery of instruments to measure health-related quality of life (HRQoL), cognition, and clinical indicators of depression, pain and functioning were administered at baseline and repeated at 4 weeks' follow-up. Descriptive summary statistics were produced and psychometric analyses were conducted to assess the levels of agreement, convergent validity and known group validity between clinical indicators and HRQoL measures. There was a large divergence in mean (SD) utility scores at baseline for the EQ-5D-5L and DEMQOL-U [EQ-5D-5L mean 0.21 (0.19); DEMQOL-U mean 0.79 (0.14)]. At 4 weeks' follow-up, there was a marked improvement in EQ-5D-5L scores whereas DEMQOL-U scores had deteriorated. [EQ-5D-5L mean 0.45 (0.38); DEMQOL-U mean 0.58 (0.38)]. The EQ-5D and CEQ-5D-5L were more responsive to the physical recovery trajectory experienced by frail older people following surgery to repair a fractured hip, whereas the DEMQOL-U and DEMQOL-Proxy-U appeared more responsive to the changes in delirium and dementia symptoms often experienced by frail older people in this period. This study presents important insights into the HRQoL of a relatively under-researched population of post-hospitalisation frail older people in residential care. Further research should investigate the implications for economic evaluation of self-complete versus proxy assessment of HRQoL and the choice of preference-based instrument for the measurement and valuation of HRQoL in older people exhibiting cognitive decline, dementia and other co-morbidities.

60,000 years of interactions between Central and Eastern Africa documented by major African mitochondrial haplogroup L2.

Science.gov (United States)

Silva, Marina; Alshamali, Farida; Silva, Paula; Carrilho, Carla; Mandlate, Flávio; Jesus Trovoada, Maria; Černý, Viktor; Pereira, Luísa; Soares, Pedro

2015-07-27

Mitochondrial DNA (mtDNA) haplogroup L2 originated in Western Africa but is nowadays spread across the entire continent. L2 movements were previously postulated to be related to the Bantu expansion, but L2 expansions eastwards probably occurred much earlier. By reconstructing the phylogeny of L2 (44 new complete sequences) we provide insights on the complex net of within-African migrations in the last 60 thousand years (ka). Results show that lineages in Southern Africa cluster with Western/Central African lineages at a recent time scale, whereas, eastern lineages seem to be substantially more ancient. Three moments of expansion from a Central African source are associated to L2: (1) one migration at 70-50 ka into Eastern or Southern Africa, (2) postglacial movements (15-10 ka) into Eastern Africa; and (3) the southward Bantu Expansion in the last 5 ka. The complementary population and L0a phylogeography analyses indicate no strong evidence of mtDNA gene flow between eastern and southern populations during the later movement, suggesting low admixture between Eastern African populations and the Bantu migrants. This implies that, at least in the early stages, the Bantu expansion was mainly a demic diffusion with little incorporation of local populations.

Synthesis of (R)-5-(Di[2,3-3H2]propylamino)-5,6-dihydro-4H-imidazo[4,5,1-ij]quinolin-2(1H)-one-([3H]U-86170) and (R)-5-([2,3-3H2]propylamino)-5,6-dihydro-4H-imidazo(4,5,1-ij) quinolin-2(1H)-one ([3H]U-91356)

International Nuclear Information System (INIS)

Moon, M.W.; Hsi, R.S.P.

1992-01-01

(R)-5-(diallylamino)-5,6-dihydro-4H-imidazo[4,5,1-ij]quinolin-2(1H)-one (12b) was prepared in 9% overall yield from 3-aminoquinoline. Reaction of 12b in ethyl acetate with tritium gas in presence of a 5% platinum on carbon catalyst afforded a mixture of (R)-5-(di[2,3- 3 H 2 ]propylamino)-5,6-dihydro-4H-imidazo[4,5,1-ij]-quinolin-2(1H)-one ([ 3 H]U-86170, 69 Ci/mmol) and (R)-5-([2,3- 3 H 2 ]-propylamino)5,6-dihydro-4H-imidazo-[4,5,1-ij]quinolin-2(1H)-one ( [ 3 H]U-91356, 34 Ci/mmol) which was separated by preparative reverse-phase chromatography. U-86170 and U-91356 are potent dopamine D2 agonists. The labelled compounds are useful for drug disposition studies. [ 3 H]U-86170 is also useful as a dopamine D2 agonist radioligand for receptor binding studies. (author)

Annex 5 - Fabrication of U-Al alloy; Prilog 5 - Dobijanje legure U-Al

Energy Technology Data Exchange (ETDEWEB)

Drobnjak, Dj; Lazarevic, Dj; Mihajlovic, A [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

1961-12-15

Alloy U-Al with low content of aluminium is often used for fabrication of fuel elements because it is stable under moderate neutron flux density. Additionally this type of alloys show much better characteristics than pure uranium under reactor operating conditions (temperature, mechanical load, corrosion effect of water). This report contains the analysis of the phase diagram of U-Al alloy with low content of aluminium, applied procedure for alloying and casting with detailed description of equipment. Characteristics of the obtained alloy are described and conclusions about the experiment and procedure are presented. Sistem U-Al sa niskim sadrzajem aluminijuma jedan je od cesto koriscenih za izradu gorivnih elemenata, jer je dovoljno stabilan pri umerenim gustinama fluksa. Pored toga, u uslovima karakteristicnim za rad nuklearnog reaktora (temperatura, gradijent temperature, mehanicka naprezanja, koroziono dejstvo vode) legure ovog sistema pokazuju daleko bolja svojstva od nelegiranog urana. Referat sadrzi analizu dijagrama stanja U-Al legure sa niskim sadrzajem aluminijuma, primenjeni postupak legiranja i livenja sa opisom pojedinih uredjaja i operacija. Takodje su opisana svojstva dobijene legure i dat je zakljucak o eksperimentu i tehnici rada (author)

Baryon number generation in a flipped SU(5) x U(1) model

International Nuclear Information System (INIS)

Campbell, B.; Hagelin, J.; Nanopoulos, D.V.; Olive, K.A.

1988-01-01

We consider the possibilities for generating a baryon asymmetry in the early universe in a flipped SU(5) x U(1) model inspired by the superstring. Depending on the temperature of the radiation background after inflation we can distinguish between two scenarios for baryogenesis: (1) After reheating the original SU(5) x U(1) symmetry is restored, or there was no inflation at all; (2) reheating after inflation is rather weak and SU(5) x U(1) is broken. In either case the asymmetry is generated by the out-of-equilibrium decays of a massive SU(3) x SU(2) x U(1) singlet field φ m . In the flipped SU(5) x U(1) model, gauge symmetry breaking is triggered by strong coupling phenomena, and is in general accompanied by the production of entropy. We examine constraints on the reheating temperature and the strong coupling scale in each of the scenarios. (orig.)

O(5) x U(1) electroweak theory

International Nuclear Information System (INIS)

Mukku, C.; Sayed, W.A.

1980-12-01

An anomaly free O(5) x U(1) theory of electroweak interactions is described which provides a unified description of electroweak phenomena for two families of standard leptons and quarks. No ''new'' non-sequential type fermions of the standard model are introduced as has been the case for all past studies based on this group. The present scheme requires the introduction of two further charged and three more neutral gauge fields over and above the Wsup(+-), Z and photon fields of SU(2) x U(1) giving rise to new neutral and charged currents. In this note we outline our reasons for proposing the present electroweak scheme, give the basic structure of the model, discuss the symmetry breaking pattern which ensures that SU(2)sub(L) x U(1) is the low energy symmetry, point out the new interactions present in the extended framework and obtain limits on the masses of all the gauge fields. (author)

A Stable U Isotopic Perspective on the U Budget and Global Extent of Modern Anoxia in the Ocean.

Science.gov (United States)

Tissot, F.; Dauphas, N.

2015-12-01

Isotopic fractionation between U4+ and U6+makes U stable isotopes potential tracers of global paleoredox conditions. In this work [1], we put the U-proxy up to a test against a highly constrained system: the modern ocean. We measured a large number of seawater samples from geographically diverse locations and found that the open ocean has a homogenous isotopic composition at δ238USW= -0.392 ± 0.005 ‰ (rel. to CRM-112a). From our measurement of rock samples (n=64) and compilations of literature data (n=380), we then estimated the U isotopic compositions of the various reservoirs involved in the modern oceanic U budget, as well as the fractionation factors associated with U incorporation into those reservoirs. Using a steady-state model, we compared the isotopic composition of the seawater predicted by the four most recent U oceanic budgets [2-5] to the modern seawater value we measured. Three of these budgets [2-4] predict a seawater isotopic composition in very good agreement with the observed δ238USW, which strengthens our confidence in the isotopic fractionation factors associated with each deposition environment and the fact that U is at steady-state in the modern ocean. The U oceanic budget of Henderson and Anderson (2003) does not reproduce the observed seawater composition because the U flux to anoxic/euxinic sediments relative to the total U flux out of the ocean is high in their model, which our analysis shows cannot be correct. The U isotopic composition of seawater is used to constrain the extent of anoxia in the modern ocean (% of seafloor covered by anoxic/euxinic sediments), which is 0.21 ± 0.09 %. This work demonstrates that stable isotopes of U can indeed trace the extent of anoxia in the modern global ocean, thereby validating the application of U isotope measurements to paleoredox reconstructions. Based on the above work, we will present the best estimate of the modern oceanic U budget. [1] Tissot F.L.H., Dauphas N. (2015) Geochim Cosmochim

22 CFR 212.42 - Exemption from 5 U.S.C. 552.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Exemption from 5 U.S.C. 552. 212.42 Section 212.42 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT PUBLIC INFORMATION Exemptions From Disclosure § 212.42 Exemption from 5 U.S.C. 552. Whenever a request is made which involves access to records...

The Y-chromosome haplogroup C3*-F3918, likely attributed to the Mongol Empire, can be traced to a 2500-year-old nomadic group.

Science.gov (United States)

Zhang, Ye; Wu, Xiyan; Li, Jiawei; Li, Hongjie; Zhao, Yongbin; Zhou, Hui

2018-02-01

The Mongol Empire had a significant role in shaping the landscape of modern populations. Many populations living in Eurasia may have been the product of population mixture between ancient Mongolians and natives following the expansion of Mongol Empire. Geneticists have found that most of these populations carried the Y-haplogroup C3* (C-M217). To trace the history of haplogroup (Hg) C3* and to further understand the origin and development of Mongolians, ancient human remains from the Jinggouzi, Chenwugou and Gangga archaeological sites, which belonged to the Donghu, Xianbei and Shiwei, respectively, were analysed. Our results show that nine of the eleven males of the Gangga site, two of the eight males of Chengwugou site and all of the twelve males of Jinggouzi site were found to have mutations at M130 (Hg C), M217 (Hg C3), L1373 (C2b, ISOGG2015), with the absence of mutations at M93 (Hg C3a), P39 (Hg C3b), M48 (Hg C3c), M407 (Hg C3d) and P62 (Hg C3f). These samples were attributed to the Y-chromosome Hg C3* (Hg C2b, ISOGG2015), and most of them were further typed as Hg C2b1a based on the mutation at F3918. Finally, we inferred that the Y-chromosome Hg C3*-F3918 can trace its origins to the Donghu ancient nomadic group.

Phenomenology with F-theory S U (5 )

Science.gov (United States)

Leontaris, George K.; Shafi, Qaisar

2017-09-01

We explore the low-energy phenomenology of an F-theory-based S U (5 ) model which, in addition to the known quarks and leptons, contains Standard Model (SM) singlets and vectorlike color triplets and S U (2 ) doublets. Depending on their masses and couplings, some of these new particles may be observed at the LHC and future colliders. We discuss the restrictions by Cabibbo-Kobayashi-Maskawa matrix constraints on their mixing with the ordinary down quarks of the three chiral families. The model is consistent with gauge coupling unification at the usual supersymmetric GUT scale; dimension-five proton decay is adequately suppressed, while dimension-six decay mediated by the superheavy gauge bosons is enhanced by a factor of 5-7. The third generation charged fermion Yukawa couplings yield the corresponding low-energy masses in reasonable agreement with observations. The hierarchical nature of the masses of lighter generations is accounted for via nonrenormalizable interactions, with the perturbative vacuum expectation values (VEVs) of the SM singlet fields playing an essential role.

Fuel cycle cost, reactor physics and fuel manufacturing considerations for Erbia-bearing PWR fuel with > 5 wt% U-235 content

Energy Technology Data Exchange (ETDEWEB)

Franceschini, F.; Lahoda, E. J.; Kucukboyaci, V. N. [Westinghouse Electric Co. LLC, 1000 Westinghouse Drive, Cranberry Township, PA 16066 (United States)

2012-07-01

The efforts to reduce fuel cycle cost have driven LWR fuel close to the licensed limit in fuel fissile content, 5.0 wt% U-235 enrichment, and the acceptable duty on current Zr-based cladding. An increase in the fuel enrichment beyond the 5 wt% limit, while certainly possible, entails costly investment in infrastructure and licensing. As a possible way to offset some of these costs, the addition of small amounts of Erbia to the UO{sub 2} powder with >5 wt% U-235 has been proposed, so that its initial reactivity is reduced to that of licensed fuel and most modifications to the existing facilities and equipment could be avoided. This paper discusses the potentialities of such a fuel on the US market from a vendor's perspective. An analysis of the in-core behavior and fuel cycle performance of a typical 4-loop PWR with 18 and 24-month operating cycles has been conducted, with the aim of quantifying the potential economic advantage and other operational benefits of this concept. Subsequently, the implications on fuel manufacturing and storage are discussed. While this concept has certainly good potential, a compelling case for its short-term introduction as PWR fuel for the US market could not be determined. (authors)

The worldwide spread of the tiger mosquito as revealed by mitogenome haplogroup diversity

Directory of Open Access Journals (Sweden)

Vincenza Battaglia

2016-11-01

Full Text Available In the last 40 years, the Asian tiger mosquito Aedes albopictus, indigenous to East Asia, has colonized every continent except Antarctica. Its spread is a major public health concern, given that this species is a competent vector for numerous arboviruses, including those causing dengue, chikungunya, West Nile and the recently emerged Zika fever. To acquire more information on the ancestral source(s of adventive populations and the overall diffusion process from its native range, we analyzed the mitogenome variation of 27 individuals from representative populations of Asia, the Americas and Europe. Phylogenetic analyses revealed five haplogroups in Asia, but population surveys appear to indicate that only three of these (A1a1, A1a2 and A1b were involved in the recent worldwide spread. We also found out that a derived lineage (A1a1a1 within A1a1, which is now common in Italy, most likely arose in North America from an ancestral Japanese source. These different genetic sources now coexist in many of the recently colonized areas, thus probably creating novel genomic combinations which might be one of the causes of the apparently growing ability of Ae. albopictus to expand its geographical range.

Genetic perspective of uniparental mitochondrial DNA landscape on the Punjabi population, Pakistan.

Science.gov (United States)

Bhatti, Shahzad; Abbas, Sana; Aslamkhan, Muhammad; Attimonelli, Marcella; Trinidad, Magali Segundo; Aydin, Hikmet Hakan; de Souza, Erica Martinha Silva; Gonzalez, Gerardo Rodriguez

2017-07-26

To investigate the uniparental genetic structure of the Punjabi population from mtDNA aspect and to set up an appropriate mtDNA forensic database, we studied maternally unrelated Punjabi (N = 100) subjects from two caste groups (i.e. Arain and Gujar) belonging to territory of Punjab. The complete control region was elucidated by Sanger sequencing and the subsequent 58 different haplotypes were designated into appropriate haplogroups according to the most recently updated mtDNA phylogeny. We found a homogenous dispersal of Eurasian haplogroup uniformity among the Punjab Province and exhibited a strong connotation with the European populations. Punjabi castes are primarily a composite of substantial South Asian, East Asian and West Eurasian lineages. Moreover, for the first time we have defined the newly sub-haplogroup M52b1 characterized by 16223 T, 16275 G and 16438 A in Gujar caste. The vast array of mtDNA variants displayed in this study suggested that the haplogroup composition radiates signals of extensive genetic conglomeration, population admixture and demographic expansion that was equipped with diverse origin, whereas matrilineal gene pool was phylogeographically homogenous across the Punjab. This context was further fully acquainted with the facts supported by PCA scatterplot that Punjabi population clustered with South Asian populations. Finally, the high power of discrimination (0.8819) and low random match probability (0.0085%) proposed a worthy contribution of mtDNA control region dataset as a forensic database that considered a gold standard of today to get deeper insight into the genetic ancestry of contemporary matrilineal phylogeny.

Mitochondrial DNA heritage of Cres Islanders--example of Croatian genetic outliers.

Science.gov (United States)

Jeran, Nina; Havas Augustin, Dubravka; Grahovac, Blaienka; Kapović, Miljenko; Metspalu, Ene; Villems, Richard; Rudan, Pavao

2009-12-01

Diversity of mitochondrial DNA (mtDNA) lineages of the Island of Cres was determined by high-resolution phylogenetic analysis on a sample of 119 adult unrelated individuals from eight settlements. The composition of mtDNA pool of this Island population is in contrast with other Croatian and European populations. The analysis revealed the highest frequency of haplogroup U (29.4%) with the predominance of one single lineage of subhaplogroup U2e (20.2%). Haplogroup H is the second most prevalent one with only 27.7%. Other very interesting features of contemporary Island population are extremely low frequency of haplogroup J (only 0.84%), and much higher frequency of haplogroup W (12.6%) comparing to other Croatian and European populations. Especially interesting finding is a strikingly higher frequency of haplogroup N1a (9.24%) presented with African/south Asian branch almost absent in Europeans, while its European sister-branch, proved to be highly prevalent among Neolithic farmers, is present in contemporary Europeans with only 0.2%. Haplotype analysis revealed that only five mtDNA lineages account for almost 50% of maternal genetic heritage of this island and they present supposed founder lineages. All presented findings confirm that genetic drift, especially founder effect, has played significant role in shaping genetic composition of the isolated population of the Island of Cres. Due to presented data contemporary population of Cres Island can be considered as genetic "outlier" among Croatian populations.

Hypervariable region polymorphism of mtDNA of recurrent oral ulceration in Chinese.

Directory of Open Access Journals (Sweden)

Mao Sun

Full Text Available BACKGROUND: MtDNA haplogroups could have important implication for understanding of the relationship between the mutations of the mitochondrial genome and diseases. Distribution of a variety of diseases among these haplogroups showed that some of the mitochondrial haplogroups are predisposed to disease. To examine the susceptibility of mtDNA haplogroups to ROU, we sequenced the mtDNA HV1, HV2 and HV3 in Chinese ROU. METHODOLOGY/PRINCIPAL FINDINGS: MtDNA haplogroups were analyzed in the 249 cases of ROU patients and the 237 cases of healthy controls respectively by means of primer extension analysis and DNA sequencing. Haplogroups G1 and H were found significantly more abundant in ROU patients than in healthy persons, while haplogroups D5 and R showed a trend toward a higher frequency in control as compared to those in patients. The distribution of C-stretch sequences polymorphism in mtDNA HV1, HV2 and HV3 regions was found in diversity. CONCLUSIONS/SIGNIFICANCE: For the first time, the relationship of mtDNA haplogroups and ROU in Chinese was investigated. Our results indicated that mtDNA haplogroups G1 and H might constitute a risk factor for ROU, which possibly increasing the susceptibility of ROU. Meanwhile, haplogroups D5 and R were indicated as protective factors for ROU. The polymorphisms of C-stretch sequences might being unstable and influence the mtDNA replication fidelity.

Y-chromosomal diversity in the population of Guinea-Bissau: a multiethnic perspective

Directory of Open Access Journals (Sweden)

Jobling Mark A

2007-07-01

Full Text Available Abstract Background The geographic and ethnolinguistic differentiation of many African Y-chromosomal lineages provides an opportunity to evaluate human migration episodes and admixture processes, in a pan-continental context. The analysis of the paternal genetic structure of Equatorial West Africans carried out to date leaves their origins and relationships unclear, and raises questions about the existence of major demographic phenomena analogous to the large-scale Bantu expansions. To address this, we have analysed the variation of 31 binary and 11 microsatellite markers on the non-recombining portion of the Y chromosome in Guinea-Bissau samples of diverse ethnic affiliations, some not studied before. Results The Guinea-Bissau Y chromosome pool is characterized by low haplogroup diversity (D = 0.470, sd 0.033, with the predominant haplogroup E3a*-M2 shared among the ethnic clusters and reaching a maximum of 82.2% in the Mandenka people. The Felupe-Djola and Papel groups exhibit the highest diversity of lineages and harbor the deep-rooting haplogroups A-M91, E2-M75 and E3*-PN2, typical of Sahel's more central and eastern areas. Their genetic distinction from other groups is statistically significant (P = 0.01 though not attributable to linguistic, geographic or religious criteria. Non sub-Saharan influences were associated with the presence of haplogroup R1b-P25 and particular lineages of E3b1-M78. Conclusion The predominance and high diversity of haplogroup E3a*-M2 suggests a demographic expansion in the equatorial western fringe, possibly supported by a local agricultural center. The paternal pool of the Mandenka and Balanta displays evidence of a particularly marked population growth among the Guineans, possibly reflecting the demographic effects of the agriculturalist lifestyle and their putative relationship to the people that introduced early cultivation practices into West Africa. The paternal background of the Felupe-Djola and Papel

Indian signatures in the westernmost edge of the European Romani diaspora: new insight from mitogenomes.

Science.gov (United States)

Gómez-Carballa, Alberto; Pardo-Seco, Jacobo; Fachal, Laura; Vega, Ana; Cebey, Miriam; Martinón-Torres, Nazareth; Martinón-Torres, Federico; Salas, Antonio

2013-01-01

In agreement with historical documentation, several genetic studies have revealed ancestral links between the European Romani and India. The entire mitochondrial DNA (mtDNA) of 27 Spanish Romani was sequenced in order to shed further light on the origins of this population. The data were analyzed together with a large published dataset (mainly hypervariable region I [HVS-I] haplotypes) of Romani (N=1,353) and non-Romani worldwide populations (N>150,000). Analysis of mitogenomes allowed the characterization of various Romani-specific clades. M5a1b1a1 is the most distinctive European Romani haplogroup; it is present in all Romani groups at variable frequencies (with only sporadic findings in non-Romani) and represents 18% of their mtDNA pool. Its phylogeographic features indicate that M5a1b1a1 originated 1.5 thousand years ago (kya; 95% CI: 1.3-1.8) in a proto-Romani population living in Northwest India. U3 represents the most characteristic Romani haplogroup of European/Near Eastern origin (12.4%); it appears at dissimilar frequencies across the continent (Iberia: ≈ 31%; Eastern/Central Europe: ≈ 13%). All U3 mitogenomes of our Iberian Romani sample fall within a new sub-clade, U3b1c, which can be dated to 0.5 kya (95% CI: 0.3-0.7); therefore, signaling a lower bound for the founder event that followed admixture in Europe/Near East. Other minor European/Near Eastern haplogroups (e.g. H24, H88a) were also assimilated into the Romani by introgression with neighboring populations during their diaspora into Europe; yet some show a differentiation from the phylogenetically closest non-Romani counterpart. The phylogeny of Romani mitogenomes shows clear signatures of low effective population sizes and founder effects. Overall, these results are in good agreement with historical documentation, suggesting that cultural identity and relative isolation have allowed the Romani to preserve a distinctive mtDNA heritage, with some features linking them unequivocally to their

Global impacts of U.S. bioenergy production and policy: A general equilibrium perspective

Science.gov (United States)

Evans, Samuel Garner

The conversion of biomass to energy represents a promising pathway forward in efforts to reduce fossil fuel use in the transportation and electricity sectors. In addition to potential benefits, such as greenhouse gas reductions and increased energy security, bioenergy production also presents a unique set of challenges. These challenges include tradeoffs between food and fuel production, distortions in energy markets, and terrestrial emissions associated with changing land-use patterns. Each of these challenges arises from market-mediated responses to bioenergy production, and are therefore largely economic in nature. This dissertation directly addresses these opportunities and challenges by evaluating the economic impacts of U.S. bioenergy production and policy, focusing on both existing and future biomass-to-energy pathways. The analysis approaches the issue from a global, economy-wide perspective, reflecting two important facts. First, that large-scale bioenergy production connects multiple sectors of the economy due to the use of agricultural land resources for biomass production, and competition with fossil fuels in energy markets. Second, markets for both agricultural and energy commodities are highly integrated globally, causing domestic policies to have international effects. The reader can think of this work as being comprised of three parts. Part I provides context through an extensive review of the literature on the market-mediated effects of conventional biofuel production (Chapter 2) and develops a general equilibrium modeling framework for assessing the extent to which these phenomenon present a challenge for future bioenergy pathways (Chapter 3). Part II (Chapter 4) explores the economic impacts of the lignocellulosic biofuel production targets set in the U.S. Renewable Fuel Standard on global agricultural and energy commodity markets. Part III (Chapter 5) extends the analysis to consider potential inefficiencies associated with policy

Obtaining of U-2.5Zr7.5Nb and U-3Zr-9Nb alloys by sintering process

International Nuclear Information System (INIS)

Mazzeu, Thiago de Oliveira; Paula, Joao Bosco de; Ferraz, Wilmar Barbosa; Santos, Ana Maria Matildes dos; Brina, Jose Giovanni Mascarenhas

2011-01-01

The development of metallic fuels with low enrichment to be used in research and test reactors, as well in the future pressurized water reactors, focuses on the search for uranium alloys of high density. Alloying elements such as Zr, Nb and Mo are added to uranium to improve fuel performance in reactors. In this context, the Centro de Desenvolvimento da Tecnologia Nuclear (CDTN) in Belo Horizonte is developing the U-2.5Zr-7.5Nb and U- 3Zr-9Nb (weight %) alloys by the innovative process of sintering that utilizes raw materials in the form of powders. The powders were pressed at 400MPa and then sintered under a vacuum of about 5 x 10-6 Torr at temperatures ranging from 1050 deg to 1300 deg C. The densities of the alloys were measured geometrically and by hydrostatic method using water. The microstructures of the pellets were observed by scanning electron microscopy (SEM) and the elements of alloying were identified by energy dispersive X-ray spectroscopy (SEM/EDS) analysis. The obtained results showed a small increasing density with rising sintering temperature. The highest density achieved was approximately 80% of theoretical density. It was also qualitatively observed that the superficial oxidation of the pellets increased with increasing sintering temperature thus avoiding the fusion of the alloys at higher temperatures. (author)

LEU fuel development at CERCA. Status as of October 1996: U5Si4: A new phase in the U/Si diagram

International Nuclear Information System (INIS)

Durand, J.P.; Olagnon, G.; Colomb, P.; Lavastre, Y.; Grasse, M.; Noel, H.; Queneau, V.

1996-01-01

A fundamental study has been carried out by CERCA and the French CNRS (National Scientific Research Center) as a partner in order to get a better understanding of the U 3 Si 2 casting process. On the occasion of this study, a new binary phase, U 5 Si 4 , has been discovered in the USi phase equilibrium diagram. Synthesis conditions of U 5 Si 4 have been determined and the impact of such a discovery is evaluated regarding the production process of U 3 Si 2 ingots. It can be concluded that keeping the CERCA's casting tools and within the allowed limits of production parameters, the U 3 Si 2 ingots are homogenous without any detectable trace of U 5 Si 4 even if a long term heat treatment at the hot rolling temperature is carried out. On the production point of view, perfect knowledge of both metallurgical phase synthesis and the casting process guarantee the quality of U 3 Si 2 ingots and powder produced by CERCA. (author)

More flipped SU(5) x U(1) baryosynthesis

Energy Technology Data Exchange (ETDEWEB)

Ellis, J.; Hagelin, J.S.; Nanopoulos, D.V.; Olive, K.A.

1988-06-30

We supplement a previous discussion of baryosynthesis in flipped SU(5)xU(1) GUTs by including (1) the large incoherent field energy density which is likely when SU(5) is broken, and (2) the possibility of additional Higgs triplet fields suggested by four-dimensional string model-building. We consider strong (weak) reheating scenarios in which the Universe is (is not) SU(5) symmetric after inflation. We find an adequate baryon asymmetry subsequent to strong reheating, whatever the number of Higgs triplets (although beware of possible difficulties with quasi-stable relic particles), whereas weak reheating requires at least two Higgs triplets.

Development and characterization of monolithic fuel miniplate alloy U-2.5Zr-7.5Nb, coated in zircaloy; Desenvolvimento e caracterizacao do combustivel nuclear tipo placa monolitico da liga U-2,5Zr-7,5Nb revestido em zircaloy

Energy Technology Data Exchange (ETDEWEB)

Machado, Geraldo Correa

2014-06-01

The autocthonal production of nuclear fuel in Brazil for test and research reactors is restricted to MTR (Material Test Reactor) fuel type dispersion plate, using U3Si2 alloy, coated and dispersed in aluminum, developed by IPEN-SP for use in IEA-R1 reactor. Moreover, the UO{sub 2} fuel rod type for power reactors is manufactured by Rezende (RJ) with a German technology by INB under license. Currently, Brazil is performing two programs of developing reactors. Currently, Brazil is developing two reactors. One of them is the development, by CNEN, the Brazilian Multipurpose Reactor (RMB), for testing, research and radioisotope production. The other one is the development a power reactor for naval propulsion, conducted by the Brazilian Navy. This dissertation presents the development and characterization of monolithic fuel miniplate alloy U-2.5Zr-7.5Nb, coated in zircaloy (ZRY), on a laboratory scale. Due to its innovative features and properties, this fuel can be used as fuel in both test reactors, research and producing radioisotopes for power reactors as small and medium sizes. Thus, this high potential fuel can be used in domestic reactors currently under development. The development of monolithic fuel plate type is made using the technique called 'picture-frame' where a sandwich composed of a monolith alloy U-2.5Zr- 7.5Nb coupled to a frame and coated sheets of Zry is obtained. The alloy U-2.5Zr-7.5Nb was obtained by melting in an induction furnace and then was cast into rectangular ingots of graphite, thus achieving an ingot with approximate dimensions of 170 x 50 x 60 mm. The obtained ingot was hot rolled at 850 ºC, with a 50 % reduction in thickness, in order to refine the raw structure of fusion. Samples cut from the alloy U-2.5Zr-7.5Nb, with dimensions 20 x 20 x 6 mm were placed in frames and plates Zry and joined by TIG (Tungsten Inert Gas) under an atmosphere of argon, obtaining a set of 10 mm thick, 45 mm wide and 100 mm long. The sandwiches were

The flipped SU(5)xU(1) string model revamped

Energy Technology Data Exchange (ETDEWEB)

Antoniadis, I.; Ellis, J.; Hagelin, J.S.; Nanopoulos, D.V. (European Organization for Nuclear Research, Geneva (Switzerland))

1989-11-02

We present a refined version of our three-generation flipped SU(5)xU(1) string model with the following properties. The complete massless spectrum is derived and shown to be free of all gauge and mixed anomalies apart from a single anomalous U(1). The imaginary part of the dilaton supermultiplet is eaten by the anomalous U(1) gauge boson, and the corresponding D-term is cancelled by large VEVs for singlet fields that break surplus U(1) gauge factors, leaving a supersymmetric vacuum with an SU(5)xU(1) visible gauge group and an SO(10)xSO(6) hidden gauge group. There are sufficient Higgs multiplets to break the visible gauge symmetry down to the standard model in an essentially unique way. All trilinear superpotential couplings have been calculated and there are in particular some giving m{sub t}, m{sub b}, m{sub tau}ne0. A renormalization group analysis shows that m{sub t}<190 GeV and m{sub b}{approx equal}3m{sub tau}. Light Higgs doublets are split automatically from heavy Higgs triplets, leaving no residual dimension-five operators for baryon decay, and the baryon lifetime tau{sub B} {approx equal} 2x10{sup 34{plus minus}2} yr. There are no tree-level flavour-changing neutral currents, but muyieldsegamma may occur at a detectable level: B(muyieldsegamma){proportional to} 10{sup -11}-10{sup -14}. (orig.).

The Future Security Environment: Why the U.S. Army Must Differentiate and Grow Millennial Officer Talent

Science.gov (United States)

2015-09-01

and M. Epstein, “ Millennials and the World of Work: An Organizational and Management Perspective,” Journal of Business and Psychology, Vol. 25, 2010...Why the U.S. Army Must Differentiate and Grow Millennial Officer Talent FOR THIS AND OTHER PUBLICATIONS, VISIT US AT http://www.carlisle.army.mil...SUBTITLE The Future Security Environment: Why the U.S. Army Must Differentiate and Grow Millennial Officer Talent 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c

Perspectives on Trends, Effectiveness, and Impediments to Prescribed Burning in the Southern U.S.

Directory of Open Access Journals (Sweden)

Leda N. Kobziar

2015-02-01

Full Text Available The southern region of the U.S. uses prescribed fire as a management tool on more of its burnable land than anywhere in the U.S., with ecosystem restoration, wildlife habitat enhancement, and reduction of hazardous fuel loads as typical goals. Although the region performs more than 50,000 prescribed fire treatments each year, evaluation of their effects on wildfire suppression resources or behavior/effects is limited. To better understand trends in the use and effectiveness of prescribed fire, we conducted a region-wide survey of 523 fire use practitioners, working on both public and private lands. A 1–2 year prescribed fire interval was consistently viewed as effective in decreasing wildfire ignitions, behavior, and severity, as well as reducing suppression resources needed where wildfire occurred. Yet fewer than 15% of practitioners viewed burn intervals of 3–4 years as effective in reducing ignitions, underscoring the importance of high-frequency burning in vegetation communities where fuel recovery is rapid. Public lands managers identified limited budget and staffing as major institutional impediments to prescribed fire, in contrast to private individuals, more of whom chose liability as a key challenge. Differences in responses across ownership type, state, and vegetation type call for a broader perspective on how fire managers in the southern U.S. view prescribed fire.

Testable flipped SU(5)xU(1){sub X} models

Energy Technology Data Exchange (ETDEWEB)

Jiang Jing [Institute of Theoretical Science, University of Oregon, Eugene, OR 97403 (United States); Li Tianjun [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States) and Institute of Theoretical Physics, Chinese Academy of Sciences, Beijing 100080 (China) and Department of Physics and Astronomy, Rutgers University, Piscataway, NJ 08854 (United States)]. E-mail: tjli@physics.rutgers.edu; Nanopoulos, Dimitri V. [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States); Astroparticle Physics Group, Houston Advanced Research Center (HARC), Mitchell Campus, Woodlands, TX 77381 (United States); Academy of Athens, Division of Natural Sciences, 28 Panepistimiou Avenue, Athens 10679 (Greece)

2007-06-11

The little hierarchy between the GUT scale and the string scale may give us some hints that can be tested at the LHC. To achieve string-scale gauge coupling unification, we introduce additional vector-like particles. We require that these vector-like particles be standard, form complete GUT multiplets, and have masses around the TeV scale or close to the string scale. Interestingly, only the flipped SU(5)xU(1){sub X} models can work elegantly. We consider all possible sets of vector-like particles with masses around the TeV scale. And we introduce vector-like particles with masses close to the string scale which can mimic the string-scale threshold corrections. We emphasize that all of these vector-like particles can be obtained in the interesting flipped SU(5)xU(1){sub X} string models from the four-dimensional free fermionic string construction. Assuming the low-energy supersymmetry, high-scale supersymmetry, and split supersymmetry, we show that the string-scale gauge coupling unification can indeed be achieved in the flipped SU(5)xU(1){sub X} models. These models can be tested at the LHC by observing simple sets of vector-like particles at the TeV scale. Moreover, we discuss a simple flipped SU(5)xU(1){sub X} model with string-scale gauge coupling unification and high-scale supersymmetry by introducing only one pair of the vector-like particles at the TeV scale, and we predict the corresponding Higgs boson masses. Also, we briefly comment on the string-scale gauge coupling unification in the model with low-energy supersymmetry by introducing only one pair of the vector-like particles at the intermediate scale. And we briefly comment on the mixings among the SM fermions and the corresponding extra vector-like particles.

238U photonuclear studies with 5-10 MeV photons

International Nuclear Information System (INIS)

Hawkes, N.P.

1986-02-01

The 238 U photofission and photoneutron cross sections, and the mean number -ν of prompt neutrons per fission, have been measured between 5 and 10 MeV. The experiment was carried out using bremsstrahlung from the electron linear accelerator HELIOS at Harwell. Neutrons from (γ,f) and (γ,n) reactions on 238 U were detected, and neutron multiplicity distributions recorded. Photoneutron events were separated from photofission events by means of their different multiplicities. (author)

All Small Nuclear RNAs (snRNAs) of the [U4/U6.U5] Tri-snRNP Localize to Nucleoli; Identification of the Nucleolar Localization Element of U6 snRNA

Science.gov (United States)

Gerbi, Susan A.; Lange, Thilo Sascha

2002-01-01

Previously, we showed that spliceosomal U6 small nuclear RNA (snRNA) transiently passes through the nucleolus. Herein, we report that all individual snRNAs of the [U4/U6.U5] tri-snRNP localize to nucleoli, demonstrated by fluorescence microscopy of nucleolar preparations after injection of fluorescein-labeled snRNA into Xenopus oocyte nuclei. Nucleolar localization of U6 is independent from [U4/U6] snRNP formation since sites of direct interaction of U6 snRNA with U4 snRNA are not nucleolar localization elements. Among all regions in U6, the only one required for nucleolar localization is its 3′ end, which associates with the La protein and subsequently during maturation of U6 is bound by Lsm proteins. This 3′-nucleolar localization element of U6 is both essential and sufficient for nucleolar localization and also required for localization to Cajal bodies. Conversion of the 3′ hydroxyl of U6 snRNA to a 3′ phosphate prevents association with the La protein but does not affect U6 localization to nucleoli or Cajal bodies. PMID:12221120

K X-rays and nuclear reaction times in the deep inelastic reactions U+U and U+Pb at 7.5 MeV/amu

International Nuclear Information System (INIS)

Stoller, C.

1985-01-01

The K-shell ionisation probability of the heavy reaction products emerging from binary deep inelastic collisions of U + U and U + Pb at 7.5 MeV/amu has been measured as a function of the total kinetic energy loss - Q. After subtraction of the ionisation probability due to internal conversion of γ-rays, a strongly Q-dependent Psub(K) is found, in agreement with theoretical predictions relating the change in ionisation probability to the nuclear sticking time. The deduced nuclear reaction times are in qualitative agreement with predictions from nuclear models of deep inelastic reactions. (orig.)

Development and characterization of monolithic fuel miniplate alloy U-2.5Zr-7.5Nb, coated in zircaloy

International Nuclear Information System (INIS)

Machado, Geraldo Correa

2014-01-01

The autocthonal production of nuclear fuel in Brazil for test and research reactors is restricted to MTR (Material Test Reactor) fuel type dispersion plate, using U3Si2 alloy, coated and dispersed in aluminum, developed by IPEN-SP for use in IEA-R1 reactor. Moreover, the UO 2 fuel rod type for power reactors is manufactured by Rezende (RJ) with a German technology by INB under license. Currently, Brazil is performing two programs of developing reactors. Currently, Brazil is developing two reactors. One of them is the development, by CNEN, the Brazilian Multipurpose Reactor (RMB), for testing, research and radioisotope production. The other one is the development a power reactor for naval propulsion, conducted by the Brazilian Navy. This dissertation presents the development and characterization of monolithic fuel miniplate alloy U-2.5Zr-7.5Nb, coated in zircaloy (ZRY), on a laboratory scale. Due to its innovative features and properties, this fuel can be used as fuel in both test reactors, research and producing radioisotopes for power reactors as small and medium sizes. Thus, this high potential fuel can be used in domestic reactors currently under development. The development of monolithic fuel plate type is made using the technique called 'picture-frame' where a sandwich composed of a monolith alloy U-2.5Zr- 7.5Nb coupled to a frame and coated sheets of Zry is obtained. The alloy U-2.5Zr-7.5Nb was obtained by melting in an induction furnace and then was cast into rectangular ingots of graphite, thus achieving an ingot with approximate dimensions of 170 x 50 x 60 mm. The obtained ingot was hot rolled at 850 ºC, with a 50 % reduction in thickness, in order to refine the raw structure of fusion. Samples cut from the alloy U-2.5Zr-7.5Nb, with dimensions 20 x 20 x 6 mm were placed in frames and plates Zry and joined by TIG (Tungsten Inert Gas) under an atmosphere of argon, obtaining a set of 10 mm thick, 45 mm wide and 100 mm long. The sandwiches were hot rolled to

The effects of 5f localization on the electronic and magnetic properties of the hexagonal U{sub 3}ZrSb{sub 5}

Energy Technology Data Exchange (ETDEWEB)

Merabiha, O.; Seddik, T. [Laboratoire de Physique Quantique et de Modélisation Mathématique, Université de Mascara, Mascara 29000 (Algeria); Khenata, R., E-mail: khenata_rabah@yahoo.fr [Laboratoire de Physique Quantique et de Modélisation Mathématique, Université de Mascara, Mascara 29000 (Algeria); Murtaza, G., E-mail: murtaza@icp.edu.pk [Materials Modeling Lab, Department of Physics, Islamia College University, Peshawar (Pakistan); Bouhemadou, A. [Laboratory for Developing New Materials and their Characterization, Department of Physics, Faculty of Science, University of Setif, 19000 Setif (Algeria); Takagiwa, Y. [Department of Advanced Materials Science, The University of Tokyo (Japan); Bin Omran, S. [Department of Physics and Astronomy, King Saud University, P.O. Box 2455, Riyadh 11451 (Saudi Arabia); Rached, D. [Magnetic Materials Laboratory, Department of Physics, Faculty of Sciences, University of Sidi Bel-Abbes, 22000 Sidi Bel-Abbes (Algeria)

2014-02-15

Highlights: • The calculated structural parameters of hexagonal U{sub 3}ZrSb{sub 5} are found in good agreement with the experimental data. • U{sub 3}ZrSb{sub 5} is found to be ferromagnetic material. • Evident effects of the Hubbard U parameter in the uranium “5f” states are noted. • Our band structure calculation show the metallic behavior of this ferromagnetic compound. • The thermodynamic properties are predicted through the quasi-harmonic Debye model. -- Abstract: Structural, magnetic, electronic and thermodynamic properties of the hexagonal U{sub 3}ZrSb{sub 5} are theoretically investigated by using the full potential linearized augmented plane wave plus local orbital’s (FP-LAPW + lo) method. The exchange–correlation potential was treated with the generalized gradient approximation GGA of Wu and Cohen. Moreover, the GGA + U approximation (where U is the Hubbard correlation terms) is employed to treat the f electrons properly. The calculated structural parameters are in good agreement with the experimental data. The magnetic study reveals that U{sub 3}ZrSb{sub 5} is a ferromagnetic material. Furthermore, we present a comparative study between the band structures, electronic structures, total and partial densities of states and local moments calculated within both GGA and GGA + U schemes. Our band structure calculations show the metallic behavior of this ferromagnetic compound. The thermodynamic properties are predicted through the quasi-harmonic Debye model, in which the lattice vibrations are taken into account. The variation of relative change in volume, heat capacities and the Debye temperature with temperature and pressure are successfully achieved.

Structure and physical properties of ternary uranium transition-metal antimonides U3MSb5 (M = Zr, Hf, Nb)

International Nuclear Information System (INIS)

Tkachuk, Andriy V.; Muirhead, Craig P.T.; Mar, Arthur

2006-01-01

The ternary uranium transition-metal antimonides U 3 MSb 5 (M = Zr, Hf, Nb) were prepared by arc-melting reactions followed by annealing at 800 deg. C, or by use of a Sn flux. These compounds extend the previously known series U 3 MSb 5 (M = Ti, V, Cr, Mn) and RE 3 MSb 5 (RE = La, Ce, Pr, Nd, Sm; M = Ti, Zr, Hf, Nb). The crystal structures of U 3 MSb 5 were determined by single-crystal X-ray diffraction data (Pearson symbol hP18, hexagonal, space group P6 3 /mcm, Z = 2; U 3 ZrSb 5 , a = 9.2223(3) A, c = 6.1690(2) A; U 3 HfSb 5 , a = 9.2084(4) A, c = 6.1629(3) A; U 3 NbSb 5 , a = 9.1378(4) A, c 6.0909(6) A). U 3 TaSb 5 has also been identified in microcrystalline form (a = 9.233(3) A, c = 6.142(3) A). Four-probe electrical resistivity measurements on single crystals and dc magnetic susceptibility measurements on powders indicated prominent transitions that are attributed to ferromagnetic ordering. The Curie temperatures, T C , located from ac magnetic susceptibility curves, are 135 K for U 3 ZrSb 5 , 141 K for U 3 HfSb 5 , and 107 K for U 3 NbSb 5

First TREAT transient overpower tests on U-Pu-Zr fuel: M5 and M6

International Nuclear Information System (INIS)

Robinson, W.R.; Bauer, T.H.; Wright, A.E.; Rhodes, E.A.; Stanford, G.S.; Klickman, A.E.

1987-01-01

Transient Reactor Test Facility (TREAT) tests M5 and M6 were the first transient overpower (TOP) test of the margin to cladding breach and prefailure elongation of metallic U-Pu-Zr ternary fuel, the reference fuel of the integral fast reactor concept. Similar tests on U-5 wt% Fs fueled Experimental Breeder Reactor (EBR)-II driver pins were previously performed and reported. Results from these earlier tests indicated a margin to failure of ∼ 4 times nominal power and significant axial elongation prior to failure, a feature that was very pronounced at low burnups. While these two fuels types are similar in many respects, the ternary alloy exhibits a much more complex physical structure and is typically irradiated at much higher temperatures. Thus, a prime motivation for performing M5 and M6 was to compare the safety-related fuel performance characteristics of U-Fs and U-Pu-Zr. Tests M5 and M6 indicate that, under the TOP conditions used in the tests, ternary fuel displayed about the same margin to failure as U-Fs fuel. At low burnups, ternary fuel showed less prefailure axial elongation than observed in U-Fs pins, but elongations of 3 to 5% might turn out to be typical. Finally, fuel from the breached ternary pin in M6 showed, qualitatively, the same benignly dispersive behavior as U-Fs

Flipped SU(5)xU(1){sub X} models from F-theory

Energy Technology Data Exchange (ETDEWEB)

Jiang Jing [Department of Physics, University of Wisconsin, Madison, WI 53706 (United States); Li Tianjun, E-mail: tjli@physics.rutgers.ed [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States); Key Laboratory of Frontiers in Theoretical Physics, Institute of Theoretical Physics, Chinese Academy of Sciences, Beijing 100190 (China); Nanopoulos, Dimitri V. [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States); Astroparticle Physics Group, Houston Advanced Research Center (HARC), Mitchell Campus, Woodlands, TX 77381 (United States); Academy of Athens, Division of Natural Sciences, 28 Panepistimiou Avenue, Athens 10679 (Greece); Xie Dan [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States)

2010-05-01

We systematically construct flipped SU(5)xU(1){sub X} models without and with bulk vector-like particles from F-theory. To realize the decoupling scenario, we introduce sets of vector-like particles in complete SU(5)xU(1) multiplets at the TeV scale, or at the intermediate scale, or at the TeV scale and high scale. To avoid the Landau pole problem for the gauge couplings, we can only introduce five sets of vector-like particles around the TeV scale. These vector-like particles can couple to the Standard Model singlet fields, and obtain suitable masses by Higgs mechanism. We study gauge coupling unification in detail. We show that the U(1){sub X} flux contributions to the gauge couplings preserve the SU(5)xU(1){sub X} gauge coupling unification. We calculate the SU(3){sub C}xSU(2){sub L} unification scales, and the SU(5)xU(1){sub X} unification scales and unified couplings. In most of our models, the high-scale or bulk vector-like particles can be considered as string-scale threshold corrections since their masses are close to the string scale. Furthermore, we discuss the phenomenological consequences of our models. In particular, in the models with TeV-scale vector-like particles, the vector-like particles can be observed at the Large Hadron Collider, the proton decay is within the reach of the future Hyper-Kamiokande experiment, the lightest CP-even Higgs boson mass can be increased, the hybrid inflation can be naturally realized, and the correct cosmic primordial density fluctuations can be generated.

Karakterisasi Paduan AlMgSi Untuk Kelongsong Bahan Bakar U3Si2/Al Dengan Densitas Uranium 5,2 gU/cm3

Directory of Open Access Journals (Sweden)

Aslina Br. Ginting

2018-03-01

Full Text Available Meningkatnya densitas uranium dari 2,96 gU/cm3 menjadi 5,2 gU/cm3 bahan bakar U3Si2/Al harus diikuti dengan penggunaan kelongsong yang kompatibel. Bahan bakar berdensitas tinggi mempunyai kekerasan yang tinggi, sehingga bila menggunakan paduan AlMg2 sebagai kelongsong dapat menyebabkan terjadi dogbone pada saat perolan. Selain fenomena dogbone, pada saat bahan bakar tersebut digunakan di reaktor dapat terjadi swelling karena meningkatnya hasil fisi maupun burn up. Oleh karena itu, perlu dicari pengganti bahan kelongsong untuk bahan bakar U3Si2/Al densitas tinggi. Pada penelitian ini telah dilakukan karakterisasi paduan AlMgSi sebagai kandidat pengganti kelongsong AlMg2. Karakterisasi yang dilakukan meliputi analisis termal, kekerasan, mikrostruktur dan laju korosi. Analisis termal dilakukan menggunakan DTA (Differential Thermal Analysis dan DSC (Differential Scanning Calorimetry. Analisis kekerasan menggunakan alat uji kekerasan mikro, mikrostruktur menggunakan SEM (Scanning Electron Microscope dan analisis laju korosi dilakukan dengan pemanasan pada temperatur 150 oC selama 77 jam di dalam autoclave. Hasil analisis menunjukkan bahwa kelongsong AlMgSi maupun AlMg2 mempunyai kompatibilitas panas dengan bahan bakar U3Si2/Al cukup stabil hingga temperatur 650 oC. Kelongsong AlMgSi mempunyai kekerasan sebesar 115 HVN dan kelongsong AlMg2 sebesar 70,1 HVN. Sementara itu, analisis mikrostruktur menunjukkan bahwa morfologi ikatan antarmuka (interface bonding kelongsong AlMgSi lebih baik dari kelongsong AlMg2, demikian halnya dengan laju korosi bahwa kelongsong AlMgSi mempunyai laju korosi lebih kecil dibanding kelongsong AlMg2. Hasil karakterisasi termal, kekerasan, mikrostruktur dan laju korosi menunjukkan bahwa PEB U3Si2/Al densitas 5,2 gU/cm3 menggunakan kelongsong AlMgSi lebih baik dibanding PEB U3Si2/Al  densitas 5,2 gU/cm3  menggunakan kelongsong AlMg2. Kata kunci: U3Si2/Al, densitas 5,2 gU/cm3, kelongsong AlMgSi dan AlMg2.

Implications of Anomalous U(1) Symmetry in Unified Models the Flipped SU(5) x U(1) Paradigm

CERN Document Server

Ellis, Jonathan Richard; Rizos, J; Ellis, John

2000-01-01

A generic feature of string-derived models is the appearance of an anomalousAbelian U(1)_A symmetry which, among other properties, constrains the Yukawacouplings and distinguishes the three families from each other. In this paper,we discuss in a model-independent way the general constraints imposed by such aU(1)_A symmetry on fermion masses, R-violating couplings and proton-decayoperators in a generic flipped SU(5) x U(1)' model. We construct all possibleviable fermion mass textures and give various examples of effective low-energymodels which are distinguished from each other by their different predictionsfor B-, L- and R-violating effects. We pay particular attention to predictionsfor neutrino masses, in the light of the recent Super-Kamiokande data.

Preparation and certification of a uranium isotope certified reference material JAERI-U5

International Nuclear Information System (INIS)

Tamura, Shuzo; Hashitani, Hiroshi

1982-06-01

The Committee on Analytical Chemistry of Nuclear Fuels and Reactor Materials, JAERI had planned to prepare a new reference material, JAERI-U5 for uranium isotopic measurement since 1978. The reference material is composed of 6 samples of different enrichment in the range of 0.2 to 4.5 wt. percents of 235 U. The preparation includes dissolution of raw materials, blending of solutions, precipitation of ammonium diuranate, drying and ignition to U 3 O 8 . A mass-spectrometric collaborative analysis was carried out by well-trained two laboratories in this country, JAERI and PNC. The certified values were decided from the result of the collaborative work. As the measurements were based on NBS SRM's, JAERI-U5 should be called tertiary standard. The materials are packed in bottles of low-potassium-content glass for a possible use in non-destructive gamma-rays spectrometry. The reference material has been distributing from JAERI with a price of yen 140,000 per set (6 samples of 2 g of each) since 1979. (author)

Level-2 perspectives computed quickly and spontaneously: Evidence from eight- to 9.5-year-old children.

Science.gov (United States)

Elekes, Fruzsina; Varga, Máté; Király, Ildikó

2017-11-01

It has been widely assumed that computing how a scene looks from another perspective (level-2 perspective taking, PT) is an effortful process, as opposed to the automatic capacity of tracking visual access to objects (level-1 PT). Recently, adults have been found to compute both forms of visual perspectives in a quick but context-sensitive way, indicating that the two functions share more features than previously assumed. However, the developmental literature still shows the dissociation between automatic level-1 and effortful level-2 PT. In the current paper, we report an experiment showing that in a minimally social situation, participating in a number verification task with an adult confederate, eight- to 9.5-year-old children demonstrate similar online level-2 PT capacities as adults. Future studies need to address whether online PT shows selectivity in children as well and develop paradigms that are adequate to test preschoolers' online level-2 PT abilities. Statement of Contribution What is already known on this subject? Adults can access how objects appear to others (level-2 perspective) spontaneously and online Online level-1, but not level-2 perspective taking (PT) has been documented in school-aged children What the present study adds? Eight- to 9.5-year-olds performed a number verification task with a confederate who had the same task Children showed similar perspective interference as adults, indicating spontaneous level-2 PT Not only agent-object relations but also object appearances are computed online by eight- to 9.5-year-olds. © 2017 The British Psychological Society.

Towards a Transborder Perspective: U.S.-Mexico Relations

Directory of Open Access Journals (Sweden)

Lynn Stephen

2014-06-01

This article embeds a discussion of transborder communities –communities spread out in multiple locations in the U.S. and Mexico– in the history of U.S.-Mexico relations. These relations are read through the colonial and contemporary mapping of space, place, people, race, and ethnicity both literally and metaphorically as well as through U.S. immigration policy in the 19th and 20th centuries. The concept of “transborder,” which can include borders of coloniality, ethnicity, race, nation, and region, can help us to illuminate U.S.-Mexico relationships through time, the racialization of Mexicans in the U.S., and contemporary dynamics of migration and immigration. The crossing of many borders and the carrying of these borders within one’s experience allows us to see migration and immigration in terms of family relationships, social, economic, and cultural relationships, communities, and networks.

Naturally light neutrinos in the flipped SU(5)xU(1) superstring model

Energy Technology Data Exchange (ETDEWEB)

Antoniadis, I.; Rizos, J. (Centre de Physique Theorique, Ecole Polytechnique, 91 - Palaiseau (France)); Tamvakis, K. (Physics Dept., Univ. Ioannina (Greece))

1992-04-16

We analyze the SU(5)xU(1)'xU(1){sup 4}xSO(10)xSU(4) superstring model, taking into account non-renormalizable superpotential interactions up to sixth order, and find that all neutrinos stay naturally light within the experimental mass bounds. (orig.).

U.S. Perspectives on the Joint Convention

International Nuclear Information System (INIS)

Strosnider, J.; Federline, M.; Camper, L.; Abu-Eid, R.; Gnugnoli, G.; Gorn, J.; Bubar, P.; Tonkay, D.

2006-01-01

The Joint Convention on the Safety of Spent Fuel Management and on the Safety of Radioactive Waste Management (Joint Convention) is an international convention, under the auspices of the International Atomic Energy Agency (IAEA). It is a companion to a suite of international conventions on nuclear safety and physical security, which serve to promote a global culture for the safe use of radioactive materials. Although the U.S. was the first nation to sign the Joint Convention on September 29, 1997, the ratification process was a challenging experience for the U.S., in the face of legislative priorities dominated by concerns for national security and threats from terrorism after September 11, 2001. Notwithstanding these prevailing circumstances, the U.S. ratified the Joint Convention in 2003, just prior to the First Review Meeting of the Contracting Parties, and participated fully therein. For the United States, participation as a Contracting Party provides many benefits. These range from working with other Parties to harmonize international approaches to achieve strong and effective nuclear safety programs on a global scale, to stimulating initiatives to improve safety systems within our own domestic programs, to learning about technical innovations by other Parties that can be useful to U.S. licensees, utilities, and industry in managing safety and its associated costs in our waste management activities. The Joint Convention process also provides opportunities to identify future areas of bilateral and multilateral technical and regulatory cooperation with other Parties, as well as an opportunity for U.S. vendors and suppliers to broaden their market to include foreign clients for safety improvement equipment and services. The Joint Convention is consistent with U.S. foreign policy considerations to support, as a priority, the strengthening of the worldwide safety culture in the use of nuclear energy. Because of its many benefits, we believe it is important to take

Indeks Massa Tubuh (IMT/U berhubungan dengan daya ingat anak usia 5-6 tahun

Directory of Open Access Journals (Sweden)

Eny Palupi

2017-05-01

Full Text Available Background: Lack of nutrient during the early-life might impair the brain development which is not able to be paid-off on later life.  Objectives: To explore the potential relationship between a series of nutritional status (weight-for-age, height-for-age and BMI-for-age and a series of brain development indicators (memory, learning, attention, IQ and EQ. Methods: Brain development indicators were assessed using Projective Multi-phase Orientation method. This study was conducted among 118 boys and 103 girls age 5-6 years old from 5 different rural and urban areas in Bogor, West-Java, Indonesia, between November 2012 to December 2013. Non-parametric test and Principal Component Analysis were applied for data analysis. Results: There was a positive relationship (p<0.05 between BMI and memory ability but failed to reveal any significant differences between the cognitive abilities assessed and two other child growth indicators (weight-for-age and height-for-age. A Mann-Whitney U test showed that children with BMI-for-age z score ≥ -3 (n=170 had significantly (p<0.05 better memory’s ability (50.49±11.92 compared to children with BMI-for-age z score < -3 (n=51 (46.65±11.13. Conclusions: BMI-for-age was potential as a predictor for brain development of children age 5-6 years old. Correlation between the balance proportion of weight and height and the optimal hippocampal development in early-life stage was suspected as the reason behind this evidence.Latar belakang: Kekurangan gizi pada masa awal kehidupan diprediksi mampu mempengaruhi perkembangan otak yang tidak mungkin untuk diperbaiki pada tahap perkembangan berikutnya.Tujuan: Penelitian ini bertujuan menganalisis potensi hubungan antara status gizi (BB/U, TB/, dan IMT/U dengan beberapa indikator perkembangan otak (memory, learning, attention, intelligence quotient (IQ, dan emotional quotient (EQ. Metode: Penelitian ini menggunakan desain cross sectional study yang melibatkan 118 anak laki

Fission cross section ratios for 233,234,236U relative to 235U from 0.5 to 400 MeV

International Nuclear Information System (INIS)

Lisowski, P.W.; Gavron, A.; Parker, W.E.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.

1991-01-01

Neutron-induced fission cross section ratios from 0.5 to 400 MeV for samples of 233, 234, 236 U relative to 235 U have been measured at the WNR neutron Source at Los Alamos. The fission reaction rate was determined using a fast parallel plate ionization chamber at a 20-m flight path. Cross sections over most the energy range were also extracted using the neutron fluence determined with three different proton telescope arrangements. Those data provided the shape of the 235 U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for 235 U(n,f) at 14.1 MeV to allow us to obtain cross section section values from the ratio data and our values for 235 U(n,f). 6 refs., 1 fig

Fission cross section ratios for 233,234,236U relative to 235U from 0.5 to 400 MeV

International Nuclear Information System (INIS)

Lisowski, P.W.; Gavron, A.; Parker, W.E.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.

1992-01-01

Neutron-induced fission cross section ratios from 0.5 to 400 MeV for samples of 233,234,236 U relative to 235 U have been measured at the WNR neutron Source at Los Alamos. The fission reaction rate was determined using a fast parallel plate ionization chamber at a 20-m flight path. Cross sections over most of the energy range were also extracted using the neutron fluence determined with three different proton telescope arrangements. Those data provided the shape of the 235 U(n, f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for 235 U(n, f) at 14.1 MeV which will allow us to obtain cross section values from the ratio data and our values for 235 U(n, f). (orig.)

Study of phase transformation of U-2,5Zr-7,5Nb e U-3Zr-9Nb alloys for application in advanced nuclear fuel; Estudo das transformacoes de fases nas ligas U-2,5Zr-7,5Nb e U-3Zr-9Nb para aplicacao em combustivel nuclear avancado

Energy Technology Data Exchange (ETDEWEB)

Pais, Rafael Witter Dias

2015-07-01

Metal fuels are relevant in the nuclear area due to the versatility of its use in the nuclear fuel cycle. Among the alloys of uranium investigated with high potential for use in nuclear power reactors, U-Zr-Nb alloys appear as an important alternative because of their superior physico-chemical and metallurgical properties. These alloys have also potential for use in nuclear testing, research and production radioisotopes of high performance nuclear reactors. Therefore, the development of these alloys is strategic since they are planned to be used in national reactors as RMB (Brazilian Multipurpose Reactor) and LABGENE (Electrical Generation Core Laboratory), currently under development in Brazil. In this work it was realized a extensive study in the scope of the manufacturing, heat treatment and phase transformations of U-2,5Zr-7,5Nb (m/m%) and U-3ZR-9NB (m/m%) fuel alloys. Ingots of both alloys were produced employing a specific methodology developed in this study. This methodology comprised the melting process in a vacuum induction furnace at high temperatures (1500 °C) and thermal-mechanical processing to break the as-cast structure. Samples with typical dimensions (17 x 7 x 2.5 mm) free from macrostructural defects were homogenized at 1000 °C in vacuum of 10{sup -5} torr for 17.5 hours with a 10°C/min cooling rate until to 820 °C and, subsequently, quenched in water. The samples, randomly selected, were subjected to isothermal treatment tests under different conditions of time and temperature. Isothermal treatments for transformation and retention phases were carried out in a special assembly designed for this work. After the tests, the samples were characterized by the usual phase characterization techniques with particular emphasis for the X-ray diffraction technique. In this way, the Rietveld refinement method was applied. In the case of uranium based alloys it is quite challenging due to the lack of data in the literature. In this work a strategy for the

Split-Family SUSY, U(2)^5 Flavour Symmetry and Neutrino Physics

CERN Document Server

Jones-Pérez, Joel

2014-01-01

In split-family SUSY, one can use a U(2)^3 symmetry to protect flavour observables in the quark sector from SUSY contributions. However, attempts to extend this procedure to the lepton sector by using an analogous U(2)^5 symmetry fail to reproduce the neutrino data without introducing some form of fine-tuning. In this work, we solve this problem by shifting the U(2)^2 symmetry acting on leptons towards the second and third generations. This allows neutrino data to be reproduced without much difficulties, as well as protecting the leptonic flavour observables from SUSY. Key signatures are a $\\mu\\to e\\gamma$ branching ratio possibly observable in the near future, as well as having selectrons as the lightest sleptons.

Spatiotemporal Distribution of U5MR and Their Relationship with Geographic and Socioeconomic Factors in China.

Science.gov (United States)

Li, Zeng; Fu, Jingying; Jiang, Dong; Lin, Gang; Dong, Donglin; Yan, Xiaoxi

2017-11-21

Epidemiological studies conducted around the world have reported that the under-five mortality rate (U5MR) is closely associated with income and educational attainment. However, geographic elements should also remain a major concern in further improving child health issues, since they often play an important role in the survival environment. This study was undertaken to investigate the relationship between the U5MR, geographic, and socioeconomic factors, and to explore the associated spatial variance of the relationship in China using the geographically weighted regression (GWR) model. The results indicate that the space pattern of a high U5MR had been narrowed notably during the period from 2001 to 2010. Nighttime lights (NL) and the digital elevation model (DEM) both have obvious influences on the U5MR, with the NL having a negative impact and DEM having a positive impact. Additionally, the relationship between the NL and DEM varied over space in China. Moreover, the relevance between U5MR and DEM was narrowed in 2010 compared to 2001, which indicates that the development of economic and medical standards can overcome geographical limits.

Spatiotemporal Distribution of U5MR and Their Relationship with Geographic and Socioeconomic Factors in China

Directory of Open Access Journals (Sweden)

Zeng Li

2017-11-01

Full Text Available Epidemiological studies conducted around the world have reported that the under-five mortality rate (U5MR is closely associated with income and educational attainment. However, geographic elements should also remain a major concern in further improving child health issues, since they often play an important role in the survival environment. This study was undertaken to investigate the relationship between the U5MR, geographic, and socioeconomic factors, and to explore the associated spatial variance of the relationship in China using the geographically weighted regression (GWR model. The results indicate that the space pattern of a high U5MR had been narrowed notably during the period from 2001 to 2010. Nighttime lights (NL and the digital elevation model (DEM both have obvious influences on the U5MR, with the NL having a negative impact and DEM having a positive impact. Additionally, the relationship between the NL and DEM varied over space in China. Moreover, the relevance between U5MR and DEM was narrowed in 2010 compared to 2001, which indicates that the development of economic and medical standards can overcome geographical limits.

The U5.0 Undulator for the ALS

International Nuclear Information System (INIS)

Hoyer, E.; Chin, J.; Halbach, K.; Hassenzahl, W.V.; Humphries, D.; Kincaid, B.; Lancaster, H.; Plate, D.

1991-05-01

The U5.0 Undulator, an 89 period, 5 cm period length, 4.6 m long insertion device has been designed and is in fabrication. This undulator will be the first high brightness source, in the 50 to 1500 eV range, for the Advanced Light Source (ALS) and is scheduled for completion in 1992. A modular hybrid configuration utilizing Nd-Fe-B permanent magnet material and vanadium permendur is used that achieves 0.837 Tesla effective peak field. Correction of the vertical field integral is with permanent magnet rotors at the ends. Gap adjustment is with an arrangement of roller screws, chains drives, a gear reduction unit and a stepper motor driven by a closed loop control system. The vacuum chamber design is a two-piece, machined and welded 5083-H321 aluminum construction of 5.1 m length. Magnetic design, subsystem design and fabrication progress are presented. 12 refs., 4 figs., 2 tabs

Thermal expansion studies on UMoO5, UMoO6, Na2U(MoO4)3 and Na4U(MoO4)4

International Nuclear Information System (INIS)

Keskar, Meera; Dahale, N.D.; Krishnan, K.

2009-01-01

In the present work, thermal expansion behavior of lower valent sodium uranium molybdates, i.e., Na 2 U(MoO 4 ) 3 and Na 4 U(MoO 4 ) 4 were studied under vacuum in the temperature range of 298-873 K using high temperature X-ray diffractometry (HTXRD). Expansion behaviors of UMoO 5 and UMoO 6 were also studied in vacuum from 298 to 873 K and 773 K, respectively. UMoO 5 was synthesized by reacting UO 2 with MoO 3 in equi-molar proportion in evacuated sealed quartz ampoule at 1173 K for 14 h. Na 2 U(MoO 4 ) 3 and Na 4 U(MoO 4 ) 4 were prepared by reacting UMoO 5 and MoO 3 with 1 and 2 moles of Na 2 MoO 4 , respectively, at 873 K in evacuated sealed quartz ampoule. XRD data of UMoO 5 and UMoO 6 were indexed on orthorhombic and monoclinic systems, respectively, whereas, the data of Na 2 U(MoO 4 ) 3 and Na 4 U(MoO 4 ) 4 were indexed on tetragonal system. The lattice parameters and cell volume of all the four compounds, fit into polynomial expression with respect to temperature, showed positive thermal expansion (PTE) up to 873 K.

Idiosyncratic recognition of UUG/UUA codons by modified nucleoside 5-taurinomethyluridine, τm5U present at 'wobble' position in anticodon loop of tRNALeu: A molecular modeling approach.

Directory of Open Access Journals (Sweden)

Asmita S Kamble

Full Text Available Lack of naturally occurring modified nucleoside 5-taurinomethyluridine (τm5U at the 'wobble' 34th position in tRNALeu causes mitochondrial myopathy, encephalopathy, lactic acidosis and stroke-like episodes (MELAS. The τm5U34 specifically recognizes UUG and UUA codons. Structural consequences of τm5U34 to read cognate codons have not been studied so far in detail at the atomic level. Hence, 50ns multiple molecular dynamics (MD simulations of various anticodon stem loop (ASL models of tRNALeu in presence and absence of τm5U34 along with UUG and UUA codons were performed to explore the dynamic behaviour of τm5U34 during codon recognition process. The MD simulation results revealed that τm5U34 recognizes G/A ending codons by 'wobble' as well as a novel 'single' hydrogen bonding interactions. RMSD and RMSF values indicate the comparative stability of the ASL models containing τm5U34 modification over the other models, lacking τm5U34. Another MD simulation study of 55S mammalian mitochondrial rRNA with tRNALeu showed crucial interactions between the A-site residues, A918, A919, G256 and codon-anticodon bases. Thus, these results could improve our understanding about the decoding efficiency of human mt tRNALeu with τm5U34 to recognize UUG and UUA codons.

Migration of Chadic speaking pastoralists within Africa based on population structure of Chad Basin and phylogeography of mitochondrial L3f haplogroup.

Science.gov (United States)

Cerný, Viktor; Fernandes, Verónica; Costa, Marta D; Hájek, Martin; Mulligan, Connie J; Pereira, Luísa

2009-03-23

Chad Basin, lying within the bidirectional corridor of African Sahel, is one of the most populated places in Sub-Saharan Africa today. The origin of its settlement appears connected with Holocene climatic ameliorations (aquatic resources) that started ~10,000 years before present (YBP). Although both Nilo-Saharan and Niger-Congo language families are encountered here, the most diversified group is the Chadic branch belonging to the Afro-Asiatic language phylum. In this article, we investigate the proposed ancient migration of Chadic pastoralists from Eastern Africa based on linguistic data and test for genetic traces of this migration in extant Chadic speaking populations. We performed whole mitochondrial genome sequencing of 16 L3f haplotypes, focused on clade L3f3 that occurs almost exclusively in Chadic speaking people living in the Chad Basin. These data supported the reconstruction of a L3f phylogenetic tree and calculation of times to the most recent common ancestor for all internal clades. A date ~8,000 YBP was estimated for the L3f3 sub-haplogroup, which is in good agreement with the supposed migration of Chadic speaking pastoralists and their linguistic differentiation from other Afro-Asiatic groups of East Africa. As a whole, the Afro-Asiatic language family presents low population structure, as 92.4% of mtDNA variation is found within populations and only 3.4% of variation can be attributed to diversity among language branches. The Chadic speaking populations form a relatively homogenous cluster, exhibiting lower diversification than the other Afro-Asiatic branches (Berber, Semitic and Cushitic). The results of our study support an East African origin of mitochondrial L3f3 clade that is present almost exclusively within Chadic speaking people living in Chad Basin. Whole genome sequence-based dates show that the ancestral haplogroup L3f must have emerged soon after the Out-of-Africa migration (around 57,100 +/- 9,400 YBP), but the "Chadic" L3f3 clade has

Social perspective: the missing element in mental health practice

National Research Council Canada - National Science Library

U'Ren, Richard C

2011-01-01

.... ________________________________________________________________ Library and Archives Canada Cataloguing in Publication U'Ren, Richard, 1939- Social perspective : the missing element in mental health practice / Richard U'Ren...

Axion inflation, proton decay, and leptogenesis in S U (5 )×U (1 )P Q

Science.gov (United States)

Boucenna, Sofiane M.; Shafi, Qaisar

2018-04-01

We implement inflation in a nonsupersymmetric S U (5 ) model based on a nonminimal coupling of the axion field to gravity. The isocurvature fluctuations are adequately suppressed, axions comprise the dark matter, proton lifetime estimates are of order 8 ×1034- 3 ×1035 yr , and the observed baryon asymmetry arises via nonthermal leptogenesis. The presence of low-scale colored scalars ensures unification of the Standard Model gauge couplings and also helps in stabilizing the electroweak vacuum.

The first peopling of South America: new evidence from Y-chromosome haplogroup Q.

Science.gov (United States)

Battaglia, Vincenza; Grugni, Viola; Perego, Ugo Alessandro; Angerhofer, Norman; Gomez-Palmieri, J Edgar; Woodward, Scott Ray; Achilli, Alessandro; Myres, Natalie; Torroni, Antonio; Semino, Ornella

2013-01-01

Recent progress in the phylogenetic resolution of the Y-chromosome phylogeny permits the male demographic dynamics and migratory events that occurred in Central and Southern America after the initial human spread into the Americas to be investigated at the regional level. To delve further into this issue, we examined more than 400 Native American Y chromosomes (collected in the region ranging from Mexico to South America) belonging to haplogroup Q - virtually the only branch of the Y phylogeny observed in modern-day Amerindians of Central and South America - together with 27 from Mongolia and Kamchatka. Two main founding lineages, Q1a3a1a-M3 and Q1a3a1-L54(xM3), were detected along with novel sub-clades of younger age and more restricted geographic distributions. The first was also observed in Far East Asia while no Q1a3a1-L54(xM3) Y chromosome was found in Asia except the southern Siberian-specific sub-clade Q1a3a1c-L330. Our data not only confirm a southern Siberian origin of ancestral populations that gave rise to Paleo-Indians and the differentiation of both Native American Q founding lineages in Beringia, but support their concomitant arrival in Mesoamerica, where Mexico acted as recipient for the first wave of migration, followed by a rapid southward migration, along the Pacific coast, into the Andean region. Although Q1a3a1a-M3 and Q1a3a1-L54(xM3) display overlapping general distributions, they show different patterns of evolution in the Mexican plateau and the Andean area, which can be explained by local differentiations due to demographic events triggered by the introduction of agriculture and associated with the flourishing of the Great Empires.

Absence of U(1) anomalous superamplitudes in N≥5 supergravities

Energy Technology Data Exchange (ETDEWEB)

Freedman, Daniel Z. [Stanford Institute for Theoretical Physics and Department of Physics, Stanford University,Stanford, CA 94305 (United States); Center for Theoretical Physics and Department of Mathematics,Massachusetts Institute of Technology,Cambridge, MA 02139 (United States); Kallosh, Renata; Murli, Divyanshu [Stanford Institute for Theoretical Physics and Department of Physics, Stanford University,Stanford, CA 94305 (United States); Proeyen, Antoine Van [KU Leuven, Institute for Theoretical Physics,Celestijnenlaan 200D, B-3001, Leuven (Belgium); Yamada, Yusuke [Stanford Institute for Theoretical Physics and Department of Physics, Stanford University,Stanford, CA 94305 (United States)

2017-05-12

We list all potential candidates for U(1) anomalous non-local 1-loop 4-point amplitudes and higher loop UV divergences in N≥5 supergravities. The relevant chiral superinvariants are constructed from linearized chiral superfields and define the corresponding superamplitudes. The anomalous amplitudes, of the kind present in N=4, are shown to be absent in N≥5. In N=6 supergravity the result is deduced from the double-copy (N=4){sub YM}×(N=2){sub YM} model, whereas in N=5,8 the result on absence of anomalous amplitudes is derived in supergravities as well as in the (N=4){sub YM}×(N−4){sub YM} double-copy models.

Some comments on flipped SU(5) times U(1) and flipped unification in general

Energy Technology Data Exchange (ETDEWEB)

Barr, S.M. (Bartol Research Institute, University of Delaware, Newark, Delaware 19716 (US))

1989-10-01

A general group-theoretical discussion of flipped embeddings is given. In addition to the well-known flipped SU(5) and flipped SO(10), the existence of flipped E{sub 6} and E{sub 7} is shown, as well as several families and special cases of flipped embeddings. A possible physical reason, essentially based on the group theory of flipped embeddings, why nature prefers the low-energy group SU(3){times}SU(2){times}U(1) to alternatives such as SU(4){times}U(1) and SU(5) is pointed out.

Some comments on flipped SU(5)xU(1) and flipped unification in general

International Nuclear Information System (INIS)

Barr, S.M.

1989-01-01

A general group-theoretical discussion of flipped embeddings is given. In addition to the well-known flipped SU(5) and flipped SO(10), the existence of flipped E 6 and E 7 is shown, as well as several families and special cases of flipped embeddings. A possible physical reason, essentially based on the group theory of flipped embeddings, why nature prefers the low-energy group SU(3)xSU(2)xU(1) to alternatives such as SU(4)xU(1) and SU(5) is pointed out

Study of phase transformation of U-2,5Zr-7,5Nb e U-3Zr-9Nb alloys for application in advanced nuclear fuel

International Nuclear Information System (INIS)

Pais, Rafael Witter Dias

2015-01-01

Metal fuels are relevant in the nuclear area due to the versatility of its use in the nuclear fuel cycle. Among the alloys of uranium investigated with high potential for use in nuclear power reactors, U-Zr-Nb alloys appear as an important alternative because of their superior physico-chemical and metallurgical properties. These alloys have also potential for use in nuclear testing, research and production radioisotopes of high performance nuclear reactors. Therefore, the development of these alloys is strategic since they are planned to be used in national reactors as RMB (Brazilian Multipurpose Reactor) and LABGENE (Electrical Generation Core Laboratory), currently under development in Brazil. In this work it was realized a extensive study in the scope of the manufacturing, heat treatment and phase transformations of U-2,5Zr-7,5Nb (m/m%) and U-3ZR-9NB (m/m%) fuel alloys. Ingots of both alloys were produced employing a specific methodology developed in this study. This methodology comprised the melting process in a vacuum induction furnace at high temperatures (1500 °C) and thermal-mechanical processing to break the as-cast structure. Samples with typical dimensions (17 x 7 x 2.5 mm) free from macrostructural defects were homogenized at 1000 °C in vacuum of 10 -5 torr for 17.5 hours with a 10°C/min cooling rate until to 820 °C and, subsequently, quenched in water. The samples, randomly selected, were subjected to isothermal treatment tests under different conditions of time and temperature. Isothermal treatments for transformation and retention phases were carried out in a special assembly designed for this work. After the tests, the samples were characterized by the usual phase characterization techniques with particular emphasis for the X-ray diffraction technique. In this way, the Rietveld refinement method was applied. In the case of uranium based alloys it is quite challenging due to the lack of data in the literature. In this work a strategy for the

Drosophila SMN complex proteins Gemin2, Gemin3, and Gemin5 are components of U bodies

International Nuclear Information System (INIS)

Cauchi, Ruben J.; Sanchez-Pulido, Luis; Liu, Ji-Long

2010-01-01

Uridine-rich small nuclear ribonucleoproteins (U snRNPs) play key roles in pre-mRNA processing in the nucleus. The assembly of most U snRNPs takes place in the cytoplasm and is facilitated by the survival motor neuron (SMN) complex. Discrete cytoplasmic RNA granules called U bodies have been proposed to be specific sites for snRNP assembly because they contain U snRNPs and SMN. U bodies invariably associate with P bodies, which are involved in mRNA decay and translational control. However, it remains unknown whether other SMN complex proteins also localise to U bodies. In Drosophila there are four SMN complex proteins, namely SMN, Gemin2/CG10419, Gemin3 and Gemin5/Rigor mortis. Drosophila Gemin3 was originally identified as the Drosophila orthologue of human and yeast Dhh1, a component of P bodies. Through an in silico analysis of the DEAD-box RNA helicases we confirmed that Gemin3 is the bona fide Drosophila orthologue of vertebrate Gemin3 whereas the Drosophila orthologue of Dhh1 is Me31B. We then made use of the Drosophila egg chamber as a model system to study the subcellular distribution of the Gemin proteins as well as Me31B. Our cytological investigations show that Gemin2, Gemin3 and Gemin5 colocalise with SMN in U bodies. Although they are excluded from P bodies, as components of U bodies, Gemin2, Gemin3 and Gemin5 are consistently found associated with P bodies, wherein Me31B resides. In addition to a role in snRNP biogenesis, SMN complexes residing in U bodies may also be involved in mRNP assembly and/or transport.

Drosophila SMN complex proteins Gemin2, Gemin3, and Gemin5 are components of U bodies

Energy Technology Data Exchange (ETDEWEB)

Cauchi, Ruben J.; Sanchez-Pulido, Luis [MRC Functional Genomics Unit, Department of Physiology, Anatomy and Genetics, University of Oxford, Oxford OX1 3QX (United Kingdom); Liu, Ji-Long, E-mail: jilong.liu@dpag.ox.ac.uk [MRC Functional Genomics Unit, Department of Physiology, Anatomy and Genetics, University of Oxford, Oxford OX1 3QX (United Kingdom)

2010-08-15

Uridine-rich small nuclear ribonucleoproteins (U snRNPs) play key roles in pre-mRNA processing in the nucleus. The assembly of most U snRNPs takes place in the cytoplasm and is facilitated by the survival motor neuron (SMN) complex. Discrete cytoplasmic RNA granules called U bodies have been proposed to be specific sites for snRNP assembly because they contain U snRNPs and SMN. U bodies invariably associate with P bodies, which are involved in mRNA decay and translational control. However, it remains unknown whether other SMN complex proteins also localise to U bodies. In Drosophila there are four SMN complex proteins, namely SMN, Gemin2/CG10419, Gemin3 and Gemin5/Rigor mortis. Drosophila Gemin3 was originally identified as the Drosophila orthologue of human and yeast Dhh1, a component of P bodies. Through an in silico analysis of the DEAD-box RNA helicases we confirmed that Gemin3 is the bona fide Drosophila orthologue of vertebrate Gemin3 whereas the Drosophila orthologue of Dhh1 is Me31B. We then made use of the Drosophila egg chamber as a model system to study the subcellular distribution of the Gemin proteins as well as Me31B. Our cytological investigations show that Gemin2, Gemin3 and Gemin5 colocalise with SMN in U bodies. Although they are excluded from P bodies, as components of U bodies, Gemin2, Gemin3 and Gemin5 are consistently found associated with P bodies, wherein Me31B resides. In addition to a role in snRNP biogenesis, SMN complexes residing in U bodies may also be involved in mRNP assembly and/or transport.

Fission cross section ratios for sup 233,234,236 U relative to sup 235 U from 0. 5 to 400 MeV

Energy Technology Data Exchange (ETDEWEB)

Lisowski, P.W.; Gavron, A.; Parker, W.E.; Balestrini, S.J. (Los Alamos National Lab., NM (USA)); Carlson, A.D.; Wasson, O.A. (National Inst. of Standards and Technology, Gaithersburg, MD (USA)); Hill, N.W. (Oak Ridge National Lab., TN (USA))

1991-01-01

Neutron-induced fission cross section ratios from 0.5 to 400 MeV for samples of {sup 233, 234, 236}U relative to {sup 235}U have been measured at the WNR neutron Source at Los Alamos. The fission reaction rate was determined using a fast parallel plate ionization chamber at a 20-m flight path. Cross sections over most the energy range were also extracted using the neutron fluence determined with three different proton telescope arrangements. Those data provided the shape of the {sup 235}U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for {sup 235}U(n,f) at 14.1 MeV to allow us to obtain cross section section values from the ratio data and our values for {sup 235}U(n,f). 6 refs., 1 fig.

Investigation of phase transformations of U2.5Zr7.5Nb and U3Zr9Nb alloys aging at 600 deg C

International Nuclear Information System (INIS)

Cantagalli, Natalia Mattar; Tanure, Leandro Paulo de Almeida Reis; Braga, Daniel Martins; Santos, Ana Maria Matildes dos; Ferraz, Wilmar Barbosa

2009-01-01

Investigation has been made of the effects of high-temperature aging (600 deg C) on the phase transformations in the U2.5Zr7.5Nb and U3Zr9Nb alloys. These alloys have been produced with vacuum induction melting (VIM) furnace in cast ingots. The ingots were homogenized at 1000 deg C for 24 hours in vacuum of -4 torr, and cooled to room temperature at a rate of 3 deg C/min. Specimens from these homogeneous materials, cut in 3 mm high and 10 mm diameter, were reheated to γ phase at 850 deg C, for 1 hour, and aging at 600 deg C at different times from 0.5 to 24 hours. The phases decomposition were characterized by X-ray diffraction (XRD), metallographic, micro-probe analyze by energy dispersive spectrometry (EDS) and microhardness methods. It was verified that the decomposition of the δ phase proceeds in two steps. The first is a discontinuous precipitation of a lamellar two-phase aggregate composed of alpha solid solution and a metastable gamma phase. The metastable gamma phase has a constant composition at given temperature. After longer annealing, it decomposes eutectoidally into the equilibrium (α + δ 2 ) phases mixture. During this process a modification of the original lamellar microstructure takes place. The obtained metastable phases of these alloys of different compositions were analyzed in relation to their constitution, heat treatability and micrographic features and the results confronted with available distinct uranium alloys data from literature. (author)

An ecological perspective on U.S. industrial poultry production: the role of anthropogenic ecosystems on the emergence of drug-resistant bacteria from agricultural environments.

Science.gov (United States)

Davis, Meghan F; Price, Lance B; Liu, Cindy Meng-Hsin; Silbergeld, Ellen K

2011-06-01

The industrialization of food animal production, specifically the widespread use of antimicrobials, not only increased pressure on microbial populations, but also changed the ecosystems in which antimicrobials and bacteria interact. In this review, we argue that industrial food animal production (IFAP) is appropriately defined as an anthropogenic ecosystem. This paper uses an ecosystem perspective to frame an examination of these changes in the context of U.S. broiler chicken production. This perspective emphasizes multiple modes by which IFAP has altered microbiomes and also suggests a means of generating hypotheses for understanding and predicting the ecological impacts of IFAP in terms of the resistome and the flow of resistance within and between microbiomes. Copyright © 2011 Elsevier Ltd. All rights reserved.

Migration of Chadic speaking pastoralists within Africa based on population structure of Chad Basin and phylogeography of mitochondrial L3f haplogroup

Directory of Open Access Journals (Sweden)

Mulligan Connie J

2009-03-01

Full Text Available Abstract Background Chad Basin, lying within the bidirectional corridor of African Sahel, is one of the most populated places in Sub-Saharan Africa today. The origin of its settlement appears connected with Holocene climatic ameliorations (aquatic resources that started ~10,000 years before present (YBP. Although both Nilo-Saharan and Niger-Congo language families are encountered here, the most diversified group is the Chadic branch belonging to the Afro-Asiatic language phylum. In this article, we investigate the proposed ancient migration of Chadic pastoralists from Eastern Africa based on linguistic data and test for genetic traces of this migration in extant Chadic speaking populations. Results We performed whole mitochondrial genome sequencing of 16 L3f haplotypes, focused on clade L3f3 that occurs almost exclusively in Chadic speaking people living in the Chad Basin. These data supported the reconstruction of a L3f phylogenetic tree and calculation of times to the most recent common ancestor for all internal clades. A date ~8,000 YBP was estimated for the L3f3 sub-haplogroup, which is in good agreement with the supposed migration of Chadic speaking pastoralists and their linguistic differentiation from other Afro-Asiatic groups of East Africa. As a whole, the Afro-Asiatic language family presents low population structure, as 92.4% of mtDNA variation is found within populations and only 3.4% of variation can be attributed to diversity among language branches. The Chadic speaking populations form a relatively homogenous cluster, exhibiting lower diversification than the other Afro-Asiatic branches (Berber, Semitic and Cushitic. Conclusion The results of our study support an East African origin of mitochondrial L3f3 clade that is present almost exclusively within Chadic speaking people living in Chad Basin. Whole genome sequence-based dates show that the ancestral haplogroup L3f must have emerged soon after the Out-of-Africa migration (around

Migration of Chadic speaking pastoralists within Africa based on population structure of Chad Basin and phylogeography of mitochondrial L3f haplogroup

Science.gov (United States)

Černý, Viktor; Fernandes, Verónica; Costa, Marta D; Hájek, Martin; Mulligan, Connie J; Pereira, Luísa

2009-01-01

Background Chad Basin, lying within the bidirectional corridor of African Sahel, is one of the most populated places in Sub-Saharan Africa today. The origin of its settlement appears connected with Holocene climatic ameliorations (aquatic resources) that started ~10,000 years before present (YBP). Although both Nilo-Saharan and Niger-Congo language families are encountered here, the most diversified group is the Chadic branch belonging to the Afro-Asiatic language phylum. In this article, we investigate the proposed ancient migration of Chadic pastoralists from Eastern Africa based on linguistic data and test for genetic traces of this migration in extant Chadic speaking populations. Results We performed whole mitochondrial genome sequencing of 16 L3f haplotypes, focused on clade L3f3 that occurs almost exclusively in Chadic speaking people living in the Chad Basin. These data supported the reconstruction of a L3f phylogenetic tree and calculation of times to the most recent common ancestor for all internal clades. A date ~8,000 YBP was estimated for the L3f3 sub-haplogroup, which is in good agreement with the supposed migration of Chadic speaking pastoralists and their linguistic differentiation from other Afro-Asiatic groups of East Africa. As a whole, the Afro-Asiatic language family presents low population structure, as 92.4% of mtDNA variation is found within populations and only 3.4% of variation can be attributed to diversity among language branches. The Chadic speaking populations form a relatively homogenous cluster, exhibiting lower diversification than the other Afro-Asiatic branches (Berber, Semitic and Cushitic). Conclusion The results of our study support an East African origin of mitochondrial L3f3 clade that is present almost exclusively within Chadic speaking people living in Chad Basin. Whole genome sequence-based dates show that the ancestral haplogroup L3f must have emerged soon after the Out-of-Africa migration (around 57,100 ± 9,400 YBP), but

Y-chromosomal variation in sub-Saharan Africa: insights into the history of Niger-Congo groups.

Science.gov (United States)

de Filippo, Cesare; Barbieri, Chiara; Whitten, Mark; Mpoloka, Sununguko Wata; Gunnarsdóttir, Ellen Drofn; Bostoen, Koen; Nyambe, Terry; Beyer, Klaus; Schreiber, Henning; de Knijff, Peter; Luiselli, Donata; Stoneking, Mark; Pakendorf, Brigitte

2011-03-01

Technological and cultural innovations as well as climate changes are thought to have influenced the diffusion of major language phyla in sub-Saharan Africa. The most widespread and the richest in diversity is the Niger-Congo phylum, thought to have originated in West Africa ∼ 10,000 years ago (ya). The expansion of Bantu languages (a family within the Niger-Congo phylum) ∼ 5,000 ya represents a major event in the past demography of the continent. Many previous studies on Y chromosomal variation in Africa associated the Bantu expansion with haplogroup E1b1a (and sometimes its sublineage E1b1a7). However, the distribution of these two lineages extends far beyond the area occupied nowadays by Bantu-speaking people, raising questions on the actual genetic structure behind this expansion. To address these issues, we directly genotyped 31 biallelic markers and 12 microsatellites on the Y chromosome in 1,195 individuals of African ancestry focusing on areas that were previously poorly characterized (Botswana, Burkina Faso, Democratic Republic of Congo, and Zambia). With the inclusion of published data, we analyzed 2,736 individuals from 26 groups representing all linguistic phyla and covering a large portion of sub-Saharan Africa. Within the Niger-Congo phylum, we ascertain for the first time differences in haplogroup composition between Bantu and non-Bantu groups via two markers (U174 and U175) on the background of haplogroup E1b1a (and E1b1a7), which were directly genotyped in our samples and for which genotypes were inferred from published data using linear discriminant analysis on short tandem repeat (STR) haplotypes. No reduction in STR diversity levels was found across the Bantu groups, suggesting the absence of serial founder effects. In addition, the homogeneity of haplogroup composition and pattern of haplotype sharing between Western and Eastern Bantu groups suggests that their expansion throughout sub-Saharan Africa reflects a rapid spread followed by

Y-chromosomal variation in Sub-Saharan Africa: insights into the history of Niger-Congo groups

Science.gov (United States)

de Filippo, Cesare; Barbieri, Chiara; Whitten, Mark; Mpoloka, Sununguko Wata; Gunnarsdóttir, Ellen Drofn; Bostoen, Koen; Nyambe, Terry; Beyer, Klaus; Schreiber, Henning; de Knijff, Peter; Luiselli, Donata; Stoneking, Mark; Pakendorf, Brigitte

2013-01-01

Technological and cultural innovations, as well as climate changes, are thought to have influenced the diffusion of major language phyla in sub-Saharan Africa. The most widespread and the richest in diversity is the Niger-Congo phylum, thought to have originated in West Africa ~10,000 years ago. The expansion of Bantu languages (a family within the Niger-Congo phylum) ~5,000 years ago represents a major event in the past demography of the continent. Many previous studies on Y chromosomal variation in Africa associated the Bantu expansion with haplogroup E1b1a (and sometimes its sub-lineage E1b1a7). However, the distribution of these two lineages extends far beyond the area occupied nowadays by Bantu speaking people, raising questions on the actual genetic structure behind this expansion. To address these issues, we directly genotyped 31 biallelic markers and 12 microsatellites on the Y chromosome in 1195 individuals of African ancestry focusing on areas that were previously poorly characterized (Botswana, Burkina Faso, D.R.C, and Zambia). With the inclusion of published data, we analyzed 2736 individuals from 26 groups representing all linguistic phyla and covering a large portion of Sub-Saharan Africa. Within the Niger-Congo phylum, we ascertain for the first time differences in haplogroup composition between Bantu and non-Bantu groups via two markers (U174 and U175) on the background of haplogroup E1b1a (and E1b1a7), which were directly genotyped in our samples and for which genotypes were inferred from published data using Linear Discriminant Analysis on STR haplotypes. No reduction in STR diversity levels was found across the Bantu groups, suggesting the absence of serial founder effects. In addition, the homogeneity of haplogroup composition and pattern of haplotype sharing between Western and Eastern Bantu groups suggest that their expansion throughout Sub-Saharan Africa reflects a rapid spread followed by backward and forward migrations. Overall, we found

Mitochondrial genomic analysis of late onset Alzheimer's disease reveals protective haplogroups H6A1A/H6A1B: the Cache County Study on Memory in Aging.

Directory of Open Access Journals (Sweden)

Perry G Ridge

Full Text Available Alzheimer's disease (AD is the most common cause of dementia and AD risk clusters within families. Part of the familial aggregation of AD is accounted for by excess maternal vs. paternal inheritance, a pattern consistent with mitochondrial inheritance. The role of specific mitochondrial DNA (mtDNA variants and haplogroups in AD risk is uncertain.We determined the complete mitochondrial genome sequence of 1007 participants in the Cache County Study on Memory in Aging, a population-based prospective cohort study of dementia in northern Utah. AD diagnoses were made with a multi-stage protocol that included clinical examination and review by a panel of clinical experts. We used TreeScanning, a statistically robust approach based on haplotype networks, to analyze the mtDNA sequence data. Participants with major mitochondrial haplotypes H6A1A and H6A1B showed a reduced risk of AD (p=0.017, corrected for multiple comparisons. The protective haplotypes were defined by three variants: m.3915G>A, m.4727A>G, and m.9380G>A. These three variants characterize two different major haplogroups. Together m.4727A>G and m.9380G>A define H6A1, and it has been suggested m.3915G>A defines H6A. Additional variants differentiate H6A1A and H6A1B; however, none of these variants had a significant relationship with AD case-control status.Our findings provide evidence of a reduced risk of AD for individuals with mtDNA haplotypes H6A1A and H6A1B. These findings are the results of the largest study to date with complete mtDNA genome sequence data, yet the functional significance of the associated haplotypes remains unknown and replication in others studies is necessary.

Volatile compound diversity and conserved alarm behaviour in Triatoma dimidiata.

Science.gov (United States)

May-Concha, Irving; Rojas, Julio C; Cruz-López, Leopoldo; Ibarra-Cerdeña, Carlos N; Ramsey, Janine M

2015-02-06

Triatoma dimidiata (Latreille) is a key vector complex of Trypanosoma cruzi, etiologic agent of Chagas disease, as it spans North, Central, and South America. Although morphological and genetic studies clearly indicate existence of at least five clades within the species, there has been no robust or systematic revision, or appropriate nomenclature change for species within the complex. Three of the clades (haplogroups) are distributed in Mexico, and recent evidence attests to dispersal of clades across previously "presumed" monotypic geographic regions. Evidence of niche conservatism among sister species of this complex suggests that geographic dispersal is possible for non-sympatric populations, although no information is available on the behavioural aspects of potential interclade interactions, for instance whether differentiation of chemical signaling or response to these signals could impede communication among the haplogroups. Volatiles emitted by disturbed bugs, Brindley's (BGs), and metasternal (MGs) glands were identified using solid-phase micro-extraction (SPME) and gas chromatography coupled mass spectrometry (GC-MS). Volatile compounds emitted by BGs and MGs, and those secreted by disturbed nymphs and adults, of the three Mexican T. dimidiata haplogroups were tested for avoidance behaviour by conspecific nymphs and adults using an olfactometer. Triatoma dimidiata haplogroups all have three age-related alarm responses: absence of response by early stage nymphs, stage-specific response by 4-5th stage nymphs, and a shared 4-5th nymph and adult response to adult compounds. Disturbed bugs released 15 to 24 compounds depending on the haplogroup, among which were three pyrazines, the first report of these organoleptics in Triatominae. Isobutyric acid from BGs was the most abundant molecule in the response in all haplogroups, in addition to 15 (h1) to 21 (h2 and h3) MG compounds. Avoidance behaviour of disturbed bugs and volatiles emitted by BGs were haplogroup

The anomalous U(1)_{anom} symmetry and flavors from an SU(5) × SU(5)' GUT in Z_{12-I} orbifold compactification

Science.gov (United States)

Kim, Jihn E.; Kyae, Bumseok; Nam, Soonkeon

2017-12-01

In string compactifications, frequently the anomalous U(1) gauge symmetry appears which belongs to E_8 × E_8' of the heterotic string. This anomalous U(1) gauge boson obtains mass at the compactification scale (≈ 10^{18 } {GeV}) by absorbing one pseudoscalar (corresponding to the model-independent axion) from the second rank antisymmetric tensor field B_{MN}. Below the compactification scale a global symmetry U(1)_{anom} results whose charge Q_anom is the original gauge U(1) charge. This is the most natural global symmetry, realizing the "invisible" axion. This global symmetry U(1)_{anom} is suitable for a flavor symmetry. In the simplest compactification model with the flipped SU(5) grand unification, all the low energy parameters are calculated in terms of the vacuum expectation values of the standard model singlets.

The mitogenome of a 35,000-year-old Homo sapiens from Europe supports a Palaeolithic back-migration to Africa.

Science.gov (United States)

Hervella, M; Svensson, E M; Alberdi, A; Günther, T; Izagirre, N; Munters, A R; Alonso, S; Ioana, M; Ridiche, F; Soficaru, A; Jakobsson, M; Netea, M G; de-la-Rua, C

2016-05-19

After the dispersal of modern humans (Homo sapiens) Out of Africa, hominins with a similar morphology to that of present-day humans initiated the gradual demographic expansion into Eurasia. The mitogenome (33-fold coverage) of the Peştera Muierii 1 individual (PM1) from Romania (35 ky cal BP) we present in this article corresponds fully to Homo sapiens, whilst exhibiting a mosaic of morphological features related to both modern humans and Neandertals. We have identified the PM1 mitogenome as a basal haplogroup U6*, not previously found in any ancient or present-day humans. The derived U6 haplotypes are predominantly found in present-day North-Western African populations. Concomitantly, those found in Europe have been attributed to recent gene-flow from North Africa. The presence of the basal haplogroup U6* in South East Europe (Romania) at 35 ky BP confirms a Eurasian origin of the U6 mitochondrial lineage. Consequently, we propose that the PM1 lineage is an offshoot to South East Europe that can be traced to the Early Upper Paleolithic back migration from Western Asia to North Africa, during which the U6 lineage diversified, until the emergence of the present-day U6 African lineages.

YebU is a m5C methyltransferase specific for 16 S rRNA nucleotide 1407

DEFF Research Database (Denmark)

Andersen, Niels Møller; Douthwaite, Stephen

2006-01-01

generally require specific enzymes, and only one m5C rRNA methyltransferase, RsmB (formerly Fmu) that methylates nucleotide C967, has previously been identified. BLAST searches of the E.coli genome revealed a single gene, yebU, with sufficient similarity to rsmB to encode a putative m5C RNA...... methyltransferase. This suggested that the yebU gene product modifies C1407 and/or C1962. Here, we analysed the E.coli rRNAs by matrix assisted laser desorption/ionization mass spectrometry and show that inactivation of the yebU gene leads to loss of methylation at C1407 in 16 S rRNA, but does not interfere...

Mitochondrial and genomic ancestry are associated with etiology of heart failure in Brazilian patients.

Science.gov (United States)

Cardena, M M S G; Ribeiro-Dos-Santos, A K; Santos, S E B; Mansur, A J; Bernardez-Pereira, S; Santos, P C J L; Pereira, A C; Fridman, C

2016-02-01

There is a high prevalence of heart failure (HF) in the general population, but it is more common in black people. We evaluated the association between genomic ancestry and mitochondrial haplogroups (mt-haplogroups) with HF etiology in 503 Brazilian patients. We elicited Mt-haplogroups by analyzing the control region of mitochondrial DNA, and genomic ancestry, by using 48 autosomal insertion-deletion ancestry informative markers. Hypertensive (28.6%, n=144) and ischemic (28.4%, n=143) etiologies of HF were the most prevalent herein. Our results showed that 233 individuals (46.3%) presented African mitochondrial (mt)-haplogroups, and the major contribution in the genomic ancestry analysis was the European ancestry (57.5% (±22.1%)). African mt-haplogroups were positively associated with a diagnosis of hypertensive cardiomyopathy (odds ratio, OR 1.55, confidence interval, CI 95% 1.04-2.44, P=0.04) when compared with European mt-haplogroups. Regarding the genomic ancestry, the African ancestry variant had higher risks (OR 7.84, 95% CI 2.81-21.91, Pancestry variant had lower risks (OR 0.14, 95% CI 0.04-5.00, Pancestry showed an OR of 4.05 (CI 95% 1.53-10.74, P=0.005), whereas African ancestry showed an OR of 0.17 (CI 95% 0.06-0.48, P=0.001) for developing ischemic etiology. In conclusion, this study supports the importance of using ancestry informative markers and mitochondrial DNA to study the genetics of complex diseases in admixed populations to improve the management, treatment and prevention of these illnesses. Therefore, the ancestry informative markers and mt-haplogroups could provide new biomarkers to be associated with HF etiologies and be used as a premise for more specific management.

O(5)sub(L)xO(5)sub(R)xU(1)sub(V) electro-weak gauge theory and the neutrino pairing mechanism

International Nuclear Information System (INIS)

Samiullah, M.; Mubarak, A.

1981-08-01

The possibility of using the group O(5)sub(L)xO(5)sub(R)xU(1)sub(V) for unifying the weak and electromagnetic interactions is studied. We are led to an anomaly free theory. Potentially the theory has the advantage of incorporating the previous results. For example, all the results of O(5)sub(L)xU(1) studies are, as a special case, obtainable at low energies. In the process of breaking the symmetry down to Weinberg-Salam theory at the level of SU(2)sub(L)xSU(2)sub(R)xU(1)sub(V), we have employed the neutrino proposed by Mannheim. We have been able to reproduce several of the conventional electroweak aspects such as the parity violation in both the lepton and charged quark sectors, Weinberg mixing pattern in the neutral current sector while keeping the left-handed neutrinos massless. All the salient features of low energy phenomenology are shown to follow. (author)

The Budget Impact of Including Necitumumab on the Formulary for First-Line Treatment of Metastatic Squamous Non-Small Cell Lung Cancer: U.S. Commercial Payer and Medicare Perspectives.

Science.gov (United States)

Bly, Christopher A; Molife, Cliff; Brown, Jacqueline; Tawney, Mahesh K; Carter, Gebra Cuyun; Cinfio, Frank N; Klein, Robert W

2018-06-01

Necitumumab (Neci) was the first biologic approved by the FDA for use in combination with gemcitabine and cisplatin (Neci + GCis) in first-line treatment of metastatic squamous non-small cell lung cancer (msqNSCLC). The potential financial impact on a health plan of adding Neci + GCis to drug formularies may be important to value-based decision makers in the United States, given ever-tightening budget constraints. To estimate the budget impact of introducing Neci + GCis for first-line treatment of msqNSCLC from U.S. commercial and Medicare payer perspectives. The budget impact model estimates the costs of msqNSCLC before and after adoption of Neci + GCis in hypothetical U.S. commercial and Medicare health plans over a 3-year time horizon. The eligible patient population was estimated from U.S. epidemiology statistics. Clinical data were obtained from randomized clinical trials, U.S. prescribing information, and clinical guidelines. Market share projections were based on market research data. Cost data were obtained from online sources and published literature. The incremental aggregate annual health plan, per-patient-per-year (PPPY), and per-member-per-month (PMPM) costs were estimated in 2015 U.S. dollars. One-way sensitivity analyses were conducted to assess the effect of model parameters on results. In a hypothetical 1,000,000-member commercial health plan with an estimated population of 30 msqNSCLC patients receiving first-line chemotherapy, the introduction of Neci + GCis at an initial market share of approximately 5% had an overall year 1 incremental budget impact of $88,394 ($3,177 PPPY, $0.007 PMPM), representing a 2.9% cost increase and reaching $304,079 ($10,397 PPPY, $0.025 PMPM) or a 7.4% cost increase at a market share of 14.7% in year 3. This increase in total costs was largely attributable to Neci drug costs and, in part, due to longer survival and treatment duration for patients treated with Neci+GCis. Overall, treatment costs increased by $81

Manipulating multiple order parameters via oxygen vacancies: The case of E u0.5B a0.5Ti O3 -δ

Science.gov (United States)

Li, Weiwei; He, Qian; Wang, Le; Zeng, Huizhong; Bowlan, John; Ling, Langsheng; Yarotski, Dmitry A.; Zhang, Wenrui; Zhao, Run; Dai, Jiahong; Gu, Junxing; Shen, Shipeng; Guo, Haizhong; Pi, Li; Wang, Haiyan; Wang, Yongqiang; Velasco-Davalos, Ivan A.; Wu, Yangjiang; Hu, Zhijun; Chen, Bin; Li, Run-Wei; Sun, Young; Jin, Kuijuan; Zhang, Yuheng; Chen, Hou-Tong; Ju, Sheng; Ruediger, Andreas; Shi, Daning; Borisevich, Albina Y.; Yang, Hao

2017-09-01

Controlling functionalities, such as magnetism or ferroelectricity, by means of oxygen vacancies (VO) is a key issue for the future development of transition-metal oxides. Progress in this field is currently addressed through VO variations and their impact on mainly one order parameter. Here we reveal a mechanism for tuning both magnetism and ferroelectricity simultaneously by using VO. Combining experimental and density-functional theory studies of E u0.5B a0.5Ti O3 -δ , we demonstrate that oxygen vacancies create T i3 +3 d1 defect states, mediating the ferromagnetic coupling between the localized Eu 4 f7 spins, and increase an off-center displacement of Ti ions, enhancing the ferroelectric Curie temperature. The dual function of Ti sites also promises a magnetoelectric coupling in the E u0.5B a0.5Ti O3 -δ .

Existence of the uranyl ion at regular Sr site in U doped SrBPO5

International Nuclear Information System (INIS)

Mithlesh Kumar; Mohapatra, M.; Natarajan, V.

2014-01-01

Actinide doped alkaline earth borophosphates of the general formula MBPO 5 (M = Ca 2+ , Sr 2+ , Ba 2+ ) are of special interest due to array of defect centers that can be generated in these compounds by internal (α and γ) irradiation effects. Further, the crystalline alkaline earth borophosphates are also reported to be isostructural with stillwellite-LnBSiO 5 , which are built up by BO 4 and SiO 4 tetrahedra. This structure suggests that the host MBPO 5 should be a good matrix for luminescence investigations for suitable activator ions. The important advantages of MBPO 5 type systems are their high luminescence, moderate preparation temperature and low thermal degradation. XRD pattern of the prepared phosphor confirmed the formation of SrBPO 5 in a single phase. The presence of uranium in SrBPO 5 sample was ascertained from Energy Dispersive X-ray Fluorescence (EDXRF) measurements performed on a Jordan Valley instrument. The U content in the sample was found to be about 0.85%. An Inductively Coupled Plasma Atomic Emission Spectrometric (ICP-AES), Jobin Yvon, France was used for analysis of the sample, which showed all other metallic impurities except U to be present at concentrations below 5 :U, PL, TSL and ESR studies were conducted on the solid state route samples. PL and TSL techniques were used with a view to understand the species responsible for the luminescence and its site symmetry

Aboriginal Australian mitochondrial genome variation - an increased understanding of population antiquity and diversity

Science.gov (United States)

Nagle, Nano; van Oven, Mannis; Wilcox, Stephen; van Holst Pellekaan, Sheila; Tyler-Smith, Chris; Xue, Yali; Ballantyne, Kaye N.; Wilcox, Leah; Papac, Luka; Cooke, Karen; van Oorschot, Roland A. H.; McAllister, Peter; Williams, Lesley; Kayser, Manfred; Mitchell, R. John; Adhikarla, Syama; Adler, Christina J.; Balanovska, Elena; Balanovsky, Oleg; Bertranpetit, Jaume; Clarke, Andrew C.; Comas, David; Cooper, Alan; der Sarkissian, Clio S. I.; Dulik, Matthew C.; Gaieski, Jill B.; Ganeshprasad, Arunkumar; Haak, Wolfgang; Haber, Marc; Hobbs, Angela; Javed, Asif; Jin, Li; Kaplan, Matthew E.; Li, Shilin; Martínez-Cruz, Begoña; Matisoo-Smith, Elizabeth A.; Melé, Marta; Merchant, Nirav C.; Owings, Amanda C.; Parida, Laxmi; Pitchappan, Ramasamy; Platt, Daniel E.; Quintana-Murci, Lluis; Renfrew, Colin; Royyuru, Ajay K.; Santhakumari, Arun Varatharajan; Santos, Fabrício R.; Schurr, Theodore G.; Soodyall, Himla; Soria Hernanz, David F.; Swamikrishnan, Pandikumar; Vilar, Miguel G.; Wells, R. Spencer; Zalloua, Pierre A.; Ziegle, Janet S.

2017-03-01

Aboriginal Australians represent one of the oldest continuous cultures outside Africa, with evidence indicating that their ancestors arrived in the ancient landmass of Sahul (present-day New Guinea and Australia) ~55 thousand years ago. Genetic studies, though limited, have demonstrated both the uniqueness and antiquity of Aboriginal Australian genomes. We have further resolved known Aboriginal Australian mitochondrial haplogroups and discovered novel indigenous lineages by sequencing the mitogenomes of 127 contemporary Aboriginal Australians. In particular, the more common haplogroups observed in our dataset included M42a, M42c, S, P5 and P12, followed by rarer haplogroups M15, M16, N13, O, P3, P6 and P8. We propose some major phylogenetic rearrangements, such as in haplogroup P where we delinked P4a and P4b and redefined them as P4 (New Guinean) and P11 (Australian), respectively. Haplogroup P2b was identified as a novel clade potentially restricted to Torres Strait Islanders. Nearly all Aboriginal Australian mitochondrial haplogroups detected appear to be ancient, with no evidence of later introgression during the Holocene. Our findings greatly increase knowledge about the geographic distribution and phylogenetic structure of mitochondrial lineages that have survived in contemporary descendants of Australia’s first settlers.

THE IMPLICATIONS OF EMERGENCE OF CHINA TOWARDS ASEAN-5: FDI-GDP PERSPECTIVE

OpenAIRE

Puah, Chin-Hong; Kueh, Jerome Swee-Hui; Lau, Evan

2007-01-01

The relationship between Foreign Direct Investment (FDI) and Gross Domestic Products (GDP) had become the centre piece of recent researches in identifying the short run and long run implications between the two variables. Using the hypotheses of FDI led GDP and GDP led FDI as theoretical framework, this study intends to analyze the implications of the rise of China towards the ASEAN-5 countries, namely Indonesia, Malaysia, the Philippines, Singapore and Thailand from the perspective of FDI an...

A survey of the mechanical properties of uranium alloys U-5Mo-3Nb wt.% and U-3Mo-3Nb wt.%

Energy Technology Data Exchange (ETDEWEB)

Dupont, G.

1969-04-15

In a continuing program on the development of soft and ductile uranium alloys for armament applications, two compositions were studied. These gamma extruded uranium alloys were U-5Mo-3Nb wt.% and U-3Mo-3Nb wt.%. This study was carried out to determine the influence of tempering heat treatments associated with extrusion on the ductility of these uranium alloys. The mechanical properties of both alloys were measured in the extruded condition, in the extruded and annealed condition and in the quenched and tempered condition. A maximum elongation of 13.7% in tension with a low amount of work hardening was obtained for the U-3Mo-3Nb wt.% alloy after 1 1/2 hours anneal at 1200 deg F (650 deg C) followed by a rapid cooling in water at 70 deg F (21 deg C). A maximum elongation of 17.3% with a large amount of work hardening was obtained for alloy U-5Mo-3Nb wt.% after vacuum annealing, normalizing, gamma phase solubilizing at 1500 deg F (815 deg C) and quenching in water at 700 deg F (210 deg C). The maximum ductility achieved in these two alloys by our approaches is low compared with the ductility of Armco Iron employed for the same applications in the field of ballistics.

Deep into the roots of the Libyan Tuareg: a genetic survey of their paternal heritage.

Science.gov (United States)

Ottoni, Claudio; Larmuseau, Maarten H D; Vanderheyden, Nancy; Martínez-Labarga, Cristina; Primativo, Giuseppina; Biondi, Gianfranco; Decorte, Ronny; Rickards, Olga

2011-05-01

Recent genetic studies of the Tuareg have begun to uncover the origin of this semi-nomadic northwest African people and their relationship with African populations. For centuries they were caravan traders plying the trade routes between the Mediterranean coast and south-Saharan Africa. Their origin most likely coincides with the fall of the Garamantes who inhabited the Fezzan (Libya) between the 1st millennium BC and the 5th century AD. In this study we report novel data on the Y-chromosome variation in the Libyan Tuareg from Al Awaynat and Tahala, two villages in Fezzan, whose maternal genetic pool was previously characterized. High-resolution investigation of 37 Y-chromosome STR loci and analysis of 35 bi-allelic markers in 47 individuals revealed a predominant northwest African component (E-M81, haplogroup E1b1b1b) which likely originated in the second half of the Holocene in the same ancestral population that contributed to the maternal pool of the Libyan Tuareg. A significant paternal contribution from south-Saharan Africa (E-U175, haplogroup E1b1a8) was also detected, which may likely be due to recent secondary introduction, possibly through slavery practices or fusion between different tribal groups. The difference in haplogroup composition between the villages of Al Awaynat and Tahala suggests that founder effects and drift played a significant role in shaping the genetic pool of the Libyan Tuareg. Copyright © 2011 Wiley-Liss, Inc.

Phylogeny and patterns of diversity of goat mtDNA haplogroup A revealed by resequencing complete mitogenomes.

Directory of Open Access Journals (Sweden)

Maria Grazia Doro

Full Text Available We sequenced to near completion the entire mtDNA of 28 Sardinian goats, selected to represent the widest possible diversity of the most widespread mitochondrial evolutionary lineage, haplogroup (Hg A. These specimens were reporters of the diversity in the island but also elsewhere, as inferred from their affiliation to each of 11 clades defined by D-loop variation. Two reference sequences completed the dataset. Overall, 206 variations were found in the full set of 30 sequences, of which 23 were protein-coding non-synonymous single nucleotide substitutions. Many polymorphic sites within Hg A were informative for the reconstruction of its internal phylogeny. Bayesian and network clustering revealed a general similarity over the entire molecule of sequences previously assigned to the same D-loop clade, indicating evolutionarily meaningful lineages. Two major sister groupings emerged within Hg A, which parallel distinct geographical distributions of D-loop clades in extant stocks. The pattern of variation in protein-coding genes revealed an overwhelming role of purifying selection, with the quota of surviving variants approaching neutrality. However, a simple model of relaxation of selection for the bulk of variants here reported should be rejected. Non-synonymous diversity of Hg's A, B and C denoted that a proportion of variants not greater than that allowed in the wild was given the opportunity to spread into domesticated stocks. Our results also confirmed that a remarkable proportion of pre-existing Hg A diversity became incorporated into domestic stocks. Our results confirm clade A11 as a well differentiated and ancient lineage peculiar of Sardinia.

Metallurgical characterization of melt-spun ribbons of U-5.4 wt%Nb alloy

Science.gov (United States)

Ma, Rong; Ren, Zhiyong; Tang, Qingfu; Chen, Dong; Liu, Tingyi; Su, Bin; Wang, Zhenhong; Luo, Chao

2018-06-01

The microstructures and micro-mechanical properties of the melt-spun ribbons of U-5.4 wt%Nb alloy were characterized using optical microscopy, scanning electron microscopy, X-ray diffraction and nanoindentation. Observed variations in microstructures and properties are related to the changes in ribbon thicknesses and cooling rates. The microstructures of the melt-spun ribbon consist of fine-scale columnar grains (∼1 μm) adjacent to the chill surface and coarse cellular grains in the remainder of the ribbon. In addition, the formation of inclusions in the ribbon is suppressed kinetically due to the high cooling rate during melt spinning. Compared with the water-quenched specimen prepared by traditional gravity casting and solution heat treatment, the elastic modulus values of the U-5.4 wt%Nb alloy were examined to vary with grain size and exhibited diverse energy dissipation capacities.

Comparison of Ground-Based PM2.5 and PM10 Concentrations in China, India, and the U.S.

Directory of Open Access Journals (Sweden)

Xingchuan Yang

2018-07-01

Full Text Available Urbanization and industrialization have spurred air pollution, making it a global problem. An understanding of the spatiotemporal characteristics of PM2.5 and PM10 concentrations (particulate matter with an aerodynamic diameter of less than 2.5 μm and 10 μm, respectively is necessary to mitigate air pollution. We compared the characteristics of PM2.5 and PM10 concentrations and their trends of China, India, and the U.S. from 2014 to 2017. Particulate matter levels were lowest in the U.S., while China showed higher concentrations, and India showed the highest. Interestingly, significant declines in PM2.5 and PM10 concentrations were found in some of the most polluted regions in China as well as the U.S. No comparable decline was observed in India. A strong seasonal trend was observed in China and India, with the highest values occurring in winter and the lowest in summer. The opposite trend was noted for the U.S. PM2.5 was highly correlated with PM10 for both China and India, but the correlation was poor for the U.S. With regard to reducing particulate matter pollutant concentrations, developing countries can learn from the experiences of developed nations and benefit by establishing and implementing joint regional air pollution control programs.

46 CFR 68.5 - Requirements for citizenship under 46 U.S.C. App. 883-1.

Science.gov (United States)

2010-10-01

... territories or possessions, not less than 75 percent of the raw materials used or sold in its operations. Note... 46 Shipping 2 2010-10-01 2010-10-01 false Requirements for citizenship under 46 U.S.C. App. 883-1... Engaging in Limited Coastwise Trade § 68.5 Requirements for citizenship under 46 U.S.C. App. 883-1. A...

Accurate 238U(n , 2 n )237U reaction cross-section measurements from 6.5 to 14.8 MeV

Science.gov (United States)

Krishichayan, Bhike, M.; Tornow, W.; Tonchev, A. P.; Kawano, T.

2017-10-01

The cross section for the 238U(n ,2 n )237U reaction has been measured in the incident neutron energy range from 6.5 to 14.8 MeV in small energy steps using an activation technique. Monoenergetic neutron beams were produced via the 2H(d ,n )3He and 3H(d ,n )4He reactions. 238U targets were activated along with Au and Al monitor foils to determine the incident neutron flux. The activity of the reaction products was measured in TUNL's low-background counting facility using high-resolution γ -ray spectroscopy. The results are compared with previous measurements and latest data evaluations. Statistical-model calculations, based on the Hauser-Feshbach formalism, have been carried out using the CoH3 code and are compared with the experimental results. The present self-consistent and high-quality data are important for stockpile stewardship and nuclear forensic purposes as well as for the design and operation of fast reactors.

5 CFR 890.1209 - Responsibilities of the U.S. Department of State.

Science.gov (United States)

2010-01-01

... (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL EMPLOYEES HEALTH BENEFITS PROGRAM Benefits for... of title 5 U.S. Code by reason of other health insurance coverage as provided in section 599C of... married or single for the purpose of coverage under a self only or a self and family enrollment as set...

Mitochondrial lineage M1 traces an early human backflow to Africa.

Science.gov (United States)

González, Ana M; Larruga, José M; Abu-Amero, Khaled K; Shi, Yufei; Pestano, José; Cabrera, Vicente M

2007-07-09

The out of Africa hypothesis has gained generalized consensus. However, many specific questions remain unsettled. To know whether the two M and N macrohaplogroups that colonized Eurasia were already present in Africa before the exit is puzzling. It has been proposed that the east African clade M1 supports a single origin of haplogroup M in Africa. To test the validity of that hypothesis, the phylogeographic analysis of 13 complete mitochondrial DNA (mtDNA) sequences and 261 partial sequences belonging to haplogroup M1 was carried out. The coalescence age of the African haplogroup M1 is younger than those for other M Asiatic clades. In contradiction to the hypothesis of an eastern Africa origin for modern human expansions out of Africa, the most ancestral M1 lineages have been found in Northwest Africa and in the Near East, instead of in East Africa. The M1 geographic distribution and the relative ages of its different subclades clearly correlate with those of haplogroup U6, for which an Eurasian ancestor has been demonstrated. This study provides evidence that M1, or its ancestor, had an Asiatic origin. The earliest M1 expansion into Africa occurred in northwestern instead of eastern areas; this early spread reached the Iberian Peninsula even affecting the Basques. The majority of the M1a lineages found outside and inside Africa had a more recent eastern Africa origin. Both western and eastern M1 lineages participated in the Neolithic colonization of the Sahara. The striking parallelism between subclade ages and geographic distribution of M1 and its North African U6 counterpart strongly reinforces this scenario. Finally, a relevant fraction of M1a lineages present today in the European Continent and nearby islands possibly had a Jewish instead of the commonly proposed Arab/Berber maternal ascendance.

Mitochondrial lineage M1 traces an early human backflow to Africa

Directory of Open Access Journals (Sweden)

Pestano José

2007-07-01

Full Text Available Abstract Background The out of Africa hypothesis has gained generalized consensus. However, many specific questions remain unsettled. To know whether the two M and N macrohaplogroups that colonized Eurasia were already present in Africa before the exit is puzzling. It has been proposed that the east African clade M1 supports a single origin of haplogroup M in Africa. To test the validity of that hypothesis, the phylogeographic analysis of 13 complete mitochondrial DNA (mtDNA sequences and 261 partial sequences belonging to haplogroup M1 was carried out. Results The coalescence age of the African haplogroup M1 is younger than those for other M Asiatic clades. In contradiction to the hypothesis of an eastern Africa origin for modern human expansions out of Africa, the most ancestral M1 lineages have been found in Northwest Africa and in the Near East, instead of in East Africa. The M1 geographic distribution and the relative ages of its different subclades clearly correlate with those of haplogroup U6, for which an Eurasian ancestor has been demonstrated. Conclusion This study provides evidence that M1, or its ancestor, had an Asiatic origin. The earliest M1 expansion into Africa occurred in northwestern instead of eastern areas; this early spread reached the Iberian Peninsula even affecting the Basques. The majority of the M1a lineages found outside and inside Africa had a more recent eastern Africa origin. Both western and eastern M1 lineages participated in the Neolithic colonization of the Sahara. The striking parallelism between subclade ages and geographic distribution of M1 and its North African U6 counterpart strongly reinforces this scenario. Finally, a relevant fraction of M1a lineages present today in the European Continent and nearby islands possibly had a Jewish instead of the commonly proposed Arab/Berber maternal ascendance.

Milestone Report - Complete New Adsorbent Materials for Marine Testing to Demonstrate 4.5 g-U/kg Adsorbent

Energy Technology Data Exchange (ETDEWEB)

Janke, Christopher James [ORNL; Das, Sadananda [ORNL; Oyola, Yatsandra [ORNL; Mayes, Richard T. [ORNL; Saito, Tomonori [ORNL; Brown, Suree [ORNL; Gill, Gary [PNNL; Kuo, Li-Jung [PNNL; Wood, Jordana [PNNL

2014-08-01

This report describes work on the successful completion of Milestone M2FT-14OR03100115 (8/20/2014) entitled, “Complete new adsorbent materials for marine testing to demonstrate 4.5 g-U/kg adsorbent”. This effort is part of the Seawater Uranium Recovery Program, sponsored by the U.S. Department of Energy, Office of Nuclear Energy, and involved the development of new adsorbent materials at the Oak Ridge National Laboratory (ORNL) and marine testing at the Pacific Northwest National Laboratory (PNNL). ORNL has recently developed two new families of fiber adsorbents that have demonstrated uranium adsorption capacities greater than 4.5 g-U/kg adsorbent after marine testing at PNNL. One adsorbent was synthesized by radiation-induced graft polymerization of itaconic acid and acrylonitrile onto high surface area polyethylene fibers followed by amidoximation and base conditioning. This fiber showed a capacity of 4.6 g-U/kg adsorbent in marine testing at PNNL. The second adsorbent was prepared by atom-transfer radical polymerization of t-butyl acrylate and acrylonitrile onto halide-functionalized round fibers followed by amidoximation and base hydrolysis. This fiber demonstrated uranium adsorption capacity of 5.4 g-U/kg adsorbent in marine testing at PNNL.

Neutronic feasibility studies using U-Mo dispersion fuel (9 Wt % Mo, 5.0 gU/cm3) for LEU conversion of the MARIA (Poland), IR-8 (Russia), and WWR-SM (Uzbekistan) research reactors

International Nuclear Information System (INIS)

Bretscher, M.M.; Deen, J.R.; Hanan, N.A.; Matos, E.

2000-01-01

U-Mo alloys dispersed in an Al matrix offer the potential for high-density uranium fuels needed for the LEU conversion of many research reactors. On-going fuel qualification tests by the US RERTR Program show good irradiation properties of U-Mo alloy dispersion fuel containing 7-10 weight percent molybdenum. For the neutronic studies in this paper the alloy was assumed to contain 9 wt % Mo (U-9Mo) with a uranium density in the fuel meat of 5.00 gU/cm 3 which corresponds to 32.5 volume % U-9Mo. Fuels containing U-9Mo have been used in Russian reactors since the 1950's. For the three research reactors analyzed here, LEU fuel element thicknesses are the same as those for the Russian-fabricated HEU reference fuel elements. Relative to the reference fuels containing 80-90% enriched uranium, LEU U-9Mo Al-dispersion fuel with 5.00 gU/cm 3 doubles the cycle length of the MARIA reactor and increases the IR-8 cycle length by about 11%. For the WWR-SM reactor, the cycle length, and thus the number of fuel assemblies used per year, is nearly unchanged. To match the cycle length of the 36% enriched fuel currently used in the WWR-SM reactor will require a uranium density in the LEU U-9Mo Al-dispersion fuel of about 5.4 gU/cm 3 . The 5.00 gU/cm 3 LEU fuel causes thermal neutron fluxes in water holes near the edge of the core to decrease by (6-8)% for all three reactors. (author)

Annex 5 - Fabrication of U-Al alloy

International Nuclear Information System (INIS)

Drobnjak, Dj.; Lazarevic, Dj.; Mihajlovic, A.

1961-01-01

Alloy U-Al with low content of aluminium is often used for fabrication of fuel elements because it is stable under moderate neutron flux density. Additionally this type of alloys show much better characteristics than pure uranium under reactor operating conditions (temperature, mechanical load, corrosion effect of water). This report contains the analysis of the phase diagram of U-Al alloy with low content of aluminium, applied procedure for alloying and casting with detailed description of equipment. Characteristics of the obtained alloy are described and conclusions about the experiment and procedure are presented [sr

Assessment of the concentrations of U and Th in PM2.5 from Mexico City and their potential human health risk

International Nuclear Information System (INIS)

Mendez-Garcia, Carmen Grisel; Solis-Rosales, Corina; Rafael Chavez-Lomeli, Efrain

2017-01-01

This is one of the first studies in small particulate matter (PM 2.5 ) by inductively coupled plasma sector field mass spectrometry to measure the activity concentrations of isotopic uranium ( 234 , 235 and 238 U) and thorium ( 232 Th) in these fine particulates, to know their origin and their impact on human health in Mexico City. A different isotopic composition from the natural uranium composition was found. The 235 U/ 238 U atom ratio values are considered as low enrichment uranium, around 2% of 235 U enrichment. Both 235 U/ 238 U and 234 U/ 238 U ratios suggested anthropological rather natural source is impacting the composition of uranium in PM 2.5 . (author)

MEDICIS(ASTEC-V2) sensitivity calculations for investigation of the crust formation in VB-U5 and VB-U6 VULCANO tests

International Nuclear Information System (INIS)

Stefanova, A.; Grudev, P.; Gencheva, R.

2011-01-01

This paper presents the results from sensitivity calculations made with MEDICIS(ASTECv2) for investigation of the crust formation during the Molten Corium-Concrete Interaction(MCCI) in VB-U5 and VB-U6 VULCANO tests. All calculations are made with MEDICIS computer code. The main goal of these analyses is to assess how the assumptions for crust formation or not formation influence over the concrete ablation. Three calculations have been done for each one of the experiments with different crust thickness and lock of crust formation at the bottom, side and upper surface. (authors)

Mitochondrial DNA variation in the Viking age population of Norway.

Science.gov (United States)

Krzewińska, Maja; Bjørnstad, Gro; Skoglund, Pontus; Olason, Pall Isolfur; Bill, Jan; Götherström, Anders; Hagelberg, Erika

2015-01-19

The medieval Norsemen or Vikings had an important biological and cultural impact on many parts of Europe through raids, colonization and trade, from about AD 793 to 1066. To help understand the genetic affinities of the ancient Norsemen, and their genetic contribution to the gene pool of other Europeans, we analysed DNA markers in Late Iron Age skeletal remains from Norway. DNA was extracted from 80 individuals, and mitochondrial DNA polymorphisms were detected by next-generation sequencing. The sequences of 45 ancient Norwegians were verified as genuine through the identification of damage patterns characteristic of ancient DNA. The ancient Norwegians were genetically similar to previously analysed ancient Icelanders, and to present-day Shetland and Orkney Islanders, Norwegians, Swedes, Scots, English, German and French. The Viking Age population had higher frequencies of K*, U*, V* and I* haplogroups than their modern counterparts, but a lower proportion of T* and H* haplogroups. Three individuals carried haplotypes that are rare in Norway today (U5b1b1, Hg A* and an uncommon variant of H*). Our combined analyses indicate that Norse women were important agents in the overseas expansion and settlement of the Vikings, and that women from the Orkneys and Western Isles contributed to the colonization of Iceland. © 2014 The Author(s) Published by the Royal Society. All rights reserved.

Phenomenological analysis of supersymmetric σ-models on coset spaces SO(10)/U(5) and E6/[SO(10)xU(1)

International Nuclear Information System (INIS)

Nyawelo, T.S.

2004-12-01

We discuss some phenomenological aspects of gauged supersymmetric σ-models on homogeneous coset-spaces E 6 /[SO(10)xU(1)] and SO(10)/U(5) which are some of the most interesting for phenomenology. We investigate in detail the vacuum configurations of these models, and study the resulting consequences for supersymmetry breaking and breaking of the internal symmetry. Some supersymmetric minima for both models with gauged full isometry groups E 6 and SO(10) are physically problematic as the Kaehler metric becomes singular ad hence the kinetic terms of the Goldstone boson multiplets vanish. This leads us to introduce recently proposed soft supersymmetry-breaking mass terms which displace the minimum away from the singulax point. A non-singular Kaehler metric breaks the linear subgroup SO(10)xU(1) of the E 6 model spontaneously. The particle spectrum of all these different models is computed. (author)

Interaction of Cucurbit(5)uril with U(VI) in formic acid water medium

International Nuclear Information System (INIS)

Rawat, Neetika; Kar, Aishwarya; Tomar, B.S.; Nayak, S.K.; Mohapatra, M.

2015-01-01

Cucurbit(n)urils (CBn) are a new class of macrocyclic cage compounds capable of binding organic and inorganic species, owing to their unique pumpkin like structure comprising of both hydrophobic cavity and hydrophilic portal. Complexation of U(VI) with Cucurbit(5)uril (CB5) in 50 wt% formic acid medium has been studied by UV-Vis spectroscopy. In order to understand the species formed, the interaction of formic acid with CB5 was studied by monitoring fluorescence of CB5. Formic was found to form 1:1 species with interaction constant (K) 17.4 M -1 . (author)

238U neutron-induced fission cross section for incident neutron energies between 5 eV and 3.5 MeV

International Nuclear Information System (INIS)

Difilippo, F.C.; Perez, R.B.; de Saussure, G.; Olsen, D.K.; Ingle, R.W.

1979-01-01

A measurement of the 238 U neutron-induced fission cross section was performed at the ORELA Linac facility in the neutron energy range between 5 eV and 3.5 MeV. The favorable signal-to-background ratio and high resolution of this experiment resulted in the identificaion of 85 subthreshold fission resonances or clusters of resonances in the neutron energy region between 5 eV and 200 keV. The fission data below 100 keV are characteristic of a weak coupling situation between Class I and Class II levels. The structure of the fission levels at the 720 eV and 1210 eV fission clusters is discussed. There is an apparent enhancement of the fission cross section at the opening of the 2 + neutron inelastic channel in 238 U at 45 keV. An enhancement of the subthreshold fission cross section between 100 keV and 200 keV is tentatively interpreted in terms of the presence of a Class II, partially damped vibrational level. There is a marked structure in the fission cross section above 200 keV up to and including the plateau between 2 and 3.5 MeV. 11 figures and 6 tables

Retracing the phenomenology of the flipped SU(5)xU(1) superstring model

Energy Technology Data Exchange (ETDEWEB)

Rizos, J.; Tamvakis, K. (Ioannina Univ. (Greece). Dept. of Physics)

1990-11-22

We study in detail gauge symmetry breaking in the SU(5)xU(1)'xU(1){sup 4}xSO(10)xSO(6) superstring model, solving the D- and F-flatness conditions and taking into account quartic and quintic superpotential terms. We find that, to this order, the model describes two massive generations of quarks and leptons as well as a massless generation expected to receive naturally suppressed masses from higher order non-renormalizable terms. We show that D-flatness restricts the number of massless isodoublets to four. We also extract an inequality relating the top quark mass to M{sub W}. (orig.).

Examination of the potential problems resulting from the settling of U5 procedure (filtered venting of the containment) on French PWR'S

International Nuclear Information System (INIS)

L'Homme, A.; Serviere, G.

1988-06-01

A filtered venting system of the containment including a sand bed (U5 procedure) is now settled on french PWR's. In this paper, one reviews the problems which are raised, concerning either the efficiency of the system or the safety of the nuclear unit. Two types of situations are examined: design situations, for which the U5 procedure is not used, and hypothetical accidental situations, for which the U5 procedure could be used

Venus - 3D Perspective View of Sapas Mons

Science.gov (United States)

1992-01-01

Sapas Mons is displayed in the center of this computer-generated three-dimensional perspective view of the surface of Venus. The viewpoint is located 527 kilometers (327 miles) northwest of Sapas Mons at an elevation of 4 kilometers (2.5 miles) above the terrain. Lava flows extend for hundreds of kilometers across the fractured plains shown in the foreground to the base of Sapas Mons. The view is to the southeast with Sapas Mons appearing at the center with Maat Mons located in the background on the horizon. Sapas Mons, a volcano 400 kilometers (248 miles) across and 1.5 kilometers (0.9 mile) high is located at approximately 8 degrees north latitude, 188 degrees east longitude, on the western edge of Atla Regio. Its peak sits at an elevation of 4.5 kilometers (2.8 miles) above the planet's mean elevation. Sapas Mons is named for a Phoenician goddess. The vertical scale in this perspective has been exaggerated 10 times. Rays cast in a computer intersect the surface to create a three-dimensional perspective view. Simulated color and a digital elevation map developed by the U.S. Geological Survey are used to enhance small-scale structure. The simulated hues are based on color images recorded by the Soviet Venera 13 and 14 spacecraft. The image was produced by the Solar System Visualization project and the Magellan Science team at the JPL Multimission Image Processing Laboratory and is a single frame from a video released at the April 22, 1992 news conference.

New Contexts in Teaching and Learning: International Perspectives, Birmingem, 2006

Directory of Open Access Journals (Sweden)

Jana Baćević

2016-03-01

Full Text Available "New Contexts in Teaching and Learning:International Perspectives" četvrta je međunarodna godišnja konferencija koju organizuje Centar za sociologiju, antropologiju i politiku (C-SAP u okviru Akademije za visoko obrazovanje Univerziteta u Birmingemu.

Particle-hole excitations in the interacting boson model; 4, the U(5)-SU(3) coupling

CERN Document Server

De Coster, C; Heyde, Kris L G; Jolie, J; Lehmann, H; Wood, J L

1999-01-01

In the extended interacting boson model (EIBM) both particle- and hole-like bosons are incorporated to encompass multi-particle-multi-hole excitations at and near to closed shells.We apply the group theoretical concepts of the EIBM to the particular case of two coexisting systems in the same nucleus exhibiting a U(5) (for the regular configurations) and an SU(3) symmetry (for the intruder configurations).Besides the description of ``global'' symmetry aspects in terms of I-spin , also the very specific local mixing effects characteristic for the U(5)-SU(3) symmetry coupling are studied.The model is applied to the Po isotopes and a comparison with a morerealistic calculation is made.

Gauging U.S.-Indian Strategic Cooperation

Science.gov (United States)

2007-03-01

Perkovich, arguing from what is unabashedly a Liberal- Humanist perspective, has concluded, deepened U.S.-Indian relations that have the effect of...lesson. This nuclear deal (rightly or wrongly) has been characterized as a means to resolve New Delhi’s existential problems with the United States

SU(5)×U(1)X grand unification with minimal seesaw and Z‧-portal dark matter

Science.gov (United States)

Okada, Nobuchika; Okada, Satomi; Raut, Digesh

2018-05-01

We propose a grand unified SU (5) × U(1)X model, where the standard SU(5) grand unified theory is supplemented by minimal seesaw and a right-handed neutrino dark matter with an introduction of a global Z2-parity. In the presence of three right-handed neutrinos (RHNs), the model is free from all gauge and mixed-gravitational anomalies. The SU(5) symmetry is broken into the Standard Model (SM) gauge group at MGUT ≃ 4 ×1016GeV in the standard manner, while the U(1)X symmetry breaking occurs at the TeV scale, which generates the TeV-scale mass of the U(1)X gauge boson (Z‧ boson) and the three Majorana RHNs. A unique Z2-odd RHN is stable and serves as the dark matter (DM) in the present Universe, while the remaining two RHNs work to generate the SM neutrino masses through the minimal seesaw. We investigate the Z‧-portal RHN DM scenario in this model context. We find that the constraints from the DM relic abundance, and the Z‧ boson search at the Large Hadron Collider (LHC), and the perturbativity bound on the U(1)X gauge coupling are complementary to narrow down the allowed parameter region in the range of 3.0 ≤mZ‧ [TeV ] ≤ 9.2 for the Z‧ boson mass. The allowed region for mZ‧ ≤ 5TeV will be fully covered by the future LHC experiments. We also briefly discuss the successful implementation of Baryogenesis and cosmological inflation scenarios in the present model.

U S spacesuits

CERN Document Server

Thomas, Kenneth S

2012-01-01

Spacesuits are far more than garments. They are a personalized spacecraft that allows direct contact and interaction with everything beyond our world, and a last refuge for survival in a disaster. Creating safe, reliable, and comfortable spacesuits is an ongoing challenge that has spanned over four decades. "U. S. Spacesuits, 2nd Edition" by Kenneth S. Thomas and Harold J. McMann details the technical evolution of U. S. spacesuits from their roots in high altitude aviation and vacuum tube development to present day, with an additional look into the future. This primary source of spacesuit information explains the functions, historical development, and use of spacesuits from a worldwide perspective. In this new edition, the authors update the story of U.S. spacesuit development and efforts, from the design challenges modern engineers face to the latest roles of spacesuits in space exploration. The book also provides a close up look at NASA's new Constellation Space Suit System as well as Apollo prototype confi...

Analyzing Perspective Taking Skills of 5- to 6-Year-Old Preschool Children in Relation to Their Self-Perception and Gender

Science.gov (United States)

Gülay Ogelman, Hülya; Seçer, Zarife; Önder, Alev

2013-01-01

The purpose of this study is to analyze the ability of preschool children to take on a perspective, based on their self-perception and gender. A relational survey method was used, with 124 children between ages 5 and 6 participating--74 girls (59.7%) and 50 boys (40.3%). The Self-Perception Scale for Children and Perspective-Taking Test was…

RA research nuclear reactor operation in forced regime, Annex 5; Prilog 5 - Rad istrazivackog nuklearnog reaktora RA u forsiranom rezimu, Prvo saopstenje

Energy Technology Data Exchange (ETDEWEB)

Mitrovic, S [Institute of Nuclear Sciences Boris Kidric, Reaktor RA, Vinca, Beograd (Serbia and Montenegro)

1964-12-15

In order to increase the flux and experimental potentials of the RA reactor, properties of the reactor operating in the forced regime have been inspected four times, twice with the spent fuel (core C), and twice with partly fresh fuel (cores E and F). Forced regime means power higher than nominal 6.5 MW. From the analyses of technology parameters during operation in the forced regime at power levels of 7 and 11 MW, state and behaviour of the components, efficiency of the biological protection and other parameters it was concluded that the reactor operation is possible at power levels of 10 MW during a whole year, and under certain conditions even longer operation at power levels up to 15 MW. This paper examines the reactor operation conditions in the forced regime and gives conclusions related to real increase of the experimental possibilities, isotope production and economic factors. Radi povecanja fluksa i eksperimentalnih mogucnosti reaktora RA, cetiri puta su proverene osobine reaktora u forsiranom rezimu, tj. na snagama vecim od nominalne (6,5 MW) i to dva puta sa istrosenim gorivom (jezgro C) i dva puta sa delimicno svezim (jezgra E i F). Iz analize tehnoloskih parametara u toku eksperimentalno rada reaktora u forsiranom rezimu na snagama od 7 do 11 MW, stanja i ponasanja opreme, efikasnosti bioloske zastite i ostalih parametara, zakljucuje se da je moguc permanentan rad reaktora tokom cele godine na snagama do 10 MW, a pod izvesnim uslovima i duzi rad na snagama do 15 MW. U radu su diskutovani uslovi rada reaktora u forsiranom rezimu i donose se zakljucci o realnom povecanju eksperimentalnih mogucnosti, proizvodnje radioizotopa i o ekonomskim faktorima (author)

Current Military Needs. War Gaming Department Perspectives, Connections 2008

Science.gov (United States)

2008-03-12

competitive U 1 : E x t r e m i s m d i s e m p o w e r e d / p a s s i v e s u p e r e m p o w e r e d...Current Military Needs War Gaming Department Perspectives Connections 2008 Stephen Downes-Martin, Ph.D. Professor, Center for Naval Warfare Studies...policy of the War Gaming Department, the CNWS, the U.S. Naval War College, the U.S. Navy,

Pipelines from the north : a U.S. perspective

International Nuclear Information System (INIS)

Slutz, J.

2003-01-01

The United States will continue to look to Canada and Alaska for a significant part of its natural gas supply in an effort to meet its growing demand for energy. The United States depends on Canadian gas as a reliable and secure supply of energy, and is therefore examining natural gas markets and the wide range of supply opportunities. This presentation highlighted changes in cross border natural gas trade in North America and noted that 94 per cent of natural gas going to the United States from Canada is shipped via pipeline. On the liquefied natural gas (LNG) front, U.S. exports to Mexico now exceed imports, but import volumes from Trinidad and Nigeria are increasing as expected. Total import volumes in 2001 surpassed the previous year. A look at the infrastructure of LNG in the United States was also presented along with the advantages and limitations of each option. Cost comparisons were also presented. It was noted that any import or LNG project would result in unique economics. LNG projects are now cheaper because of better engineering, economies of scale and better pipeline economics. The U.S. National Energy Policy recommends that the pipeline to bring Alaskan gas to U.S. markets should be constructed as soon as possible. It was emphasized that any project to ship natural gas from Alaska to the lower 48 will need to work closely with Canada in order to be successful. 15 figs

238U, 234U and 232Th in seawater

International Nuclear Information System (INIS)

Chen, J.H.; Edwards, R.L.; Wasserburg, G.J.

1986-01-01

We have developed techniques to determine 238 U, 234 U and 232 Th concentrations in seawater by isotope dilution mass spectrometry. Using these techniques, we have measured 238 U, 234 U and 232 Th in vertical profiles of unfiltered, acidified seawater from the Atlantic and 238 U and 234 U in vertical profiles from the Pacific. Determinations of 234 U/ 238 U at depths ranging from 0 to 4900 m in the Atlantic (7 0 44'N, 40 0 43'W) and the Pacific (14 0 41'N, 160 0 01'W) Oceans are the same within experimental error (±5per mille, 2σ). The average of these 234 U/ 238 U measurements is 144±2per mille (2σ) higher than the equilibrium ratio of 5.472 x 10 -5 . U concentrations, normalized to 35per mille salinity, range from 3.162 to 3.281 ng/g, a range of 3.8%. The average concentration of the Pacific samples (31 0 4'N, 159 0 1'W) is ∝1% higher than that of the Atlantic (7 0 44'N, 40 0 43'W and 31 0 49'N, 64 0 6'W). 232 Th concentrations from an Atlantic profile range from 0.092 to 0.145 pg/g. The observed constancy of the 234 U/ 238 U ratio is consistent with the predicted range of 234 U/ 238 U using a simple two-box model and the residence time of deep water in the ocean determined from 14 C. The variation in salinity-normalized U concentrations suggests that U may be much more reactive in the marine environment than previously thought. (orig./WB)

Energy Dependence of Fission Product Yields from 235U, 238U and 239Pu for Incident Neutron Energies Between 0.5 and 14.8 MeV

Science.gov (United States)

Gooden, Matthew; Bredeweg, Todd; Fowler, Malcolm; Vieira, David; Wilhelmy, Jerry; Tonchev, Anton; Stoyer, Mark; Bhike, Megha; Finch, Sean; Krishichayan, Fnu; Tornow, Werner

2017-09-01

The energy dependence of a number of cumulative fission product yields (FPY) have been measured using quasi- monoenergetic neutron beams for three actinide targets, 235U, 238U and 239Pu, between 0.5 and 14.8 MeV. The FPYs were measured by a combi- nation of fission counting using specially designed dual-fission chambers and -ray counting. Each dual-fission chamber is a back-to-back ioniza- tion chamber encasing an activation target in the center with thin de- posits of the same target isotope in each chamber. This method allows for the direct measurement of the total number of fissions in the activa- tion target with no reference to the fission cross-section, thus reducing uncertainties. γ-ray counting of the activation target was performed on well-shielded HPGe detectors over a period of 2 months post irradiation to properly identify fission products. Reported are absolute cumulative fission product yields for incident neutron energies of 0.5, 1.37, 2.4, 3.6, 4.6 and 14.8 MeV. New data in the second chance fission region of 5.5 - 9 MeV are included. Work performed for the U.S. Department of Energy by Los Alamos National Security, LLC under Contract DE-AC52-06NA25396.

The U5.0 Undulator for the ALS

International Nuclear Information System (INIS)

Hoyer, E.; Chin, J.; Halbach, K.; Hassenzahl, W.V.; Humphries, D.; Kincaid, B.; Lancaster, H.; Plate, D.

1991-01-01

the U5.0 Undulator, and 89 period, 5 cm period length, 4.6 m long insertion device has been designed, is being fabricated and is scheduled for completion in early 1992. This undulator will be the first high brightness source, in the 50 to 1500 eV range, for the Advanced Light Source (ALS) at the Lawrence Berkeley Laboratory. A hybrid magnetic configuration using Nd-Fe-B permanent magnet material and vanadium permendur poles has been selected to achieve the field quality needed to meet performance requirements. The magnetic structure is modular with each half consisting of 5 assembly sections, which provide the periodic structure, and end structures, for entrance and exit correction, mounted on a steel backing beam. Each assembly section consists of 35 half-period pole assemblies bolted to a mount. The required 0.837 Tesla effective peak field at a 1.4 cm gap has been verified with model measurements. Vertical field integral correction is accomplished with the end structures, each having an arrangement of permanent magnet rotors which will be adjusted to minimize electron beam missteering over the undulator operating field range. To reduce the effect of environmental fields, the steel backing beams are connected through parallel, low-reluctance, Ni-Fe hinges. The magnetic structure is connected through four roller-nuts to the drive system that provides gap adjustment with an arrangement of roller screws, chain drives, a gear reduction unit and a stepper motor driven by a closed loop control system. Magnetic structure and drive system support are from a 2.4 m high structure which includes a support base with four vertical supports. The vacuum chamber design is a two-piece machined and welded 5083-H321 aluminum construction of 5.1 m length. Pumping is with a combination of ion, TSP and NEG pumps. Magnetic design, subsystem design and fabrication progress are presented

Ce2Co3Ge5: a new U2Co3Si5 - type valance fluctuating compound

International Nuclear Information System (INIS)

Layek, Samar; Hossain, Zakir

2010-01-01

Poly crystalline sample of Ce 2 Co 3 Ge 5 have been prepared by arc melting and consequently annealing at 1100 deg C. Rietveld refinement of XRD shows that it crystallize in the orthorhombic U 2 Co 3 Si 5 structure (space group Ibam) with crystal parameters a= 9.802A, b= 11.777A and c= 5.941A and unit cell volume V= 684.8 A 3 The unit cell volume of Ce 2 Co 3 Ge 5 is seen clearly to deviate from that expected on the basis of lanthanide contraction. From susceptibility measurement, effective magnetic moment of this compound μ eff = 0.95 μ B which is lower than magnetic moment free for Ce 3+ ions (2.54 μB) but higher than that of non-magnetic Ce 4+ state (0 μ B ). All these results clearly indicated Ce 2 Co 3 Ge 5 to be a mixed valance compound. (author)

Individual plant examination program: Perspectives on reactor safety and plant performance. Parts 2--5: Final report; Volume 2

International Nuclear Information System (INIS)

1997-12-01

This report provides perspectives gained by reviewing 75 Individual Plant Examination (IPE) submittals pertaining to 108 nuclear power plant units. IPEs are probabilistic analyses that estimate the core damage frequency (CDF) and containment performance for accidents initiated by internal events. The US Nuclear Regulatory Commission (NRC) reviewed the IPE submittals with the objective of gaining perspectives in three major areas: (1) improvements made to individual plants as a result of their IPEs and the collective results of the IPE program, (2) plant-specific design and operational features and modeling assumptions that significantly affect the estimates of CDF and containment performance, and (3) strengths and weaknesses of the models and methods used in the IPEs. These perspectives are gained by assessing the core damage and containment performance results, including overall CDF, accident sequences, dominant contributions to component failure and human error, and containment failure modes. Methods, data, boundary conditions, and assumptions used in the IPEs are considered in understanding the differences and similarities observed among the various types of plants. This report is divided into three volumes containing six parts. Part 1 is a summary report of the key perspectives gained in each of the areas identified above, with a discussion of the NRC's overall conclusions and observations. Part 2 discusses key perspectives regarding the impact of the IPE Program on reactor safety. Part 3 discusses perspectives gained from the IPE results regarding CDF, containment performance, and human actions. Part 4 discusses perspectives regarding the IPE models and methods. Part 5 discusses additional IPE perspectives. Part 6 contains Appendices A, B and C which provide the references of the information from the IPEs, updated PRA results, and public comments on draft NUREG-1560 respectively

Individual plant examination program: Perspectives on reactor safety and plant performance. Parts 2--5: Final report; Volume 2

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-12-01

This report provides perspectives gained by reviewing 75 Individual Plant Examination (IPE) submittals pertaining to 108 nuclear power plant units. IPEs are probabilistic analyses that estimate the core damage frequency (CDF) and containment performance for accidents initiated by internal events. The US Nuclear Regulatory Commission (NRC) reviewed the IPE submittals with the objective of gaining perspectives in three major areas: (1) improvements made to individual plants as a result of their IPEs and the collective results of the IPE program, (2) plant-specific design and operational features and modeling assumptions that significantly affect the estimates of CDF and containment performance, and (3) strengths and weaknesses of the models and methods used in the IPEs. These perspectives are gained by assessing the core damage and containment performance results, including overall CDF, accident sequences, dominant contributions to component failure and human error, and containment failure modes. Methods, data, boundary conditions, and assumptions used in the IPEs are considered in understanding the differences and similarities observed among the various types of plants. This report is divided into three volumes containing six parts. Part 1 is a summary report of the key perspectives gained in each of the areas identified above, with a discussion of the NRC`s overall conclusions and observations. Part 2 discusses key perspectives regarding the impact of the IPE Program on reactor safety. Part 3 discusses perspectives gained from the IPE results regarding CDF, containment performance, and human actions. Part 4 discusses perspectives regarding the IPE models and methods. Part 5 discusses additional IPE perspectives. Part 6 contains Appendices A, B and C which provide the references of the information from the IPEs, updated PRA results, and public comments on draft NUREG-1560 respectively.

Gauge symmetry breaking in the hidden sector of the flipped SU(5)xU(1) superstring model

Energy Technology Data Exchange (ETDEWEB)

Antoniadis, I.; Rizos, J. (Centre de Physique Theorique, Ecole Polytechnique, 91 - Palaiseau (France)); Tamvakis, K. (Theoretical Physics Div., Univ. Ioannina (Greece))

1992-03-26

We analyze the SU(5)xU(1)'xU(1){sup 4}xSO(10)xSU(4) superstring model with a spontaneously broken hidden sector down to SO(7)xSO(5) taking into account non-renormalizable superpotential terms up to eight order. As a result of the hidden sector breaking the 'exotic' states get a mass and the 'observable' spectrum is composed of the standard three families. In addition, Cabibbo mixing arises at sixth order and an improved fermion mass hierarchy emerges. (orig.).

Mitochondrial DNA control region analysis of three ethnic groups in the Republic of Macedonia

Science.gov (United States)

Jankova-Ajanovska, Renata; Zimmermann, Bettina; Huber, Gabriela; Röck, Alexander W.; Bodner, Martin; Jakovski, Zlatko; Janeska, Biljana; Duma, Aleksej; Parson, Walther

2014-01-01

A total of 444 individuals representing three ethnic groups (Albanians, Turks and Romanies) in the Republic of Macedonia were sequenced in the mitochondrial control region. The mtDNA haplogroup composition differed between the three groups. Our results showed relatively high frequencies of haplogroup H12 in Albanians (8.8%) and less in Turks (3.3%), while haplogroups M5a1 and H7a1a were dominant in Romanies (13.7% and 10.3%, respectively) but rare in the former two. This highlights the importance of regional sampling for forensic mtDNA databasing purposes. These population data will be available on EMPOP under accession numbers EMP00644 (Albanians), EMP00645 (Romanies) and EMP00646 (Turks). PMID:25051224

Global implications of U.S. power deregulation

International Nuclear Information System (INIS)

Maschoff, D.C.

1996-01-01

With U.S. power deregulation remaining a topic that is dominating the entire North American energy marketplace, this paper provides an update of events occurring in U.S. electric power markets, offering some observations about changes due to increasing competition in electric power markets, and discusses some reasons why the events in U.S. electric power markets will soon transform global energy markets. How quickly is the move from local service territory to global markets proceeding? More than fifty U.S. utility companies with revenues of over $1 billion (U.S.) will soon be actively seeking and participating in global business opportunities. Using the same logic that led them to pursue utility initiatives nationally, U.S. utilities will use their core capabilities to compete in global energy services markets. In connection with these global initiatives, U.S. utilities will bring the same fuel-neutral, gas-electric perspective to international electric power and natural gas markets. (Author)

Interaction between Y chromosome haplogroup O3* and 4-n-octylphenol exposure reduces the susceptibility to spermatogenic impairment in Han Chinese.

Science.gov (United States)

Hu, Weiyue; Chen, Minjian; Ji, Juan; Qin, Yufeng; Zhang, Feng; Xu, Miaofei; Wu, Wei; Du, Guizhen; Wu, Di; Han, Xiumei; Jin, Li; Xia, Yankai; Lu, Chuncheng; Wang, Xinru

2017-10-01

Certain genetic background (mainly Y chromosome haplogroups, Y-hg) may modify the susceptibility of certain environmental exposure to some diseases. Compared with respective main effects of genetic background or environmental exposure, interactions between them reflect more realistic combined effects on the susceptibility to a disease. To identify the interactions on spermatogenic impairment, we performed Y chromosome haplotyping and measurement of 9 urinary phenols concentrations in 774 infertile males and 520 healthy controls in a Han Chinese population, and likelihood ratio tests were used to examine the interactions between Y-hgs and phenols. Originally, we observed that Y-hg C and Y-hg F * might modify the susceptibility to male infertility with urinary 4-n-octylphenol (4-n-OP) level (P inter = 0.005 and 0.019, respectively). Subsequently, based on our results, two panels were tested to identify the possible protective sub-branches of Y-hg F * to 4-n-OP exposure, and Y-hg O3 * was uncovered to interact with 4-n-OP (P inter = 0.019). In conclusion, while 4-n-OP shows an adverse effect on spermatogenesis, Y-hg O3 * makes individuals more adaptive to such an effect for maintaining basic reproductive capacity. Copyright © 2017 Elsevier Inc. All rights reserved.

Contemporary Perspectives on the Constitution and Separation of Powers.

Science.gov (United States)

American Bar Association, Chicago, IL. Special Committee on Youth Education for Citizenship.

A collection of essays designed to provide educators and other interested individuals with contemporary perspectives on the U.S. Constitution and separation of powers is presented. Separation of powers refers to one of the enduring principles of the U.S. constitutional system of government, in which governmental powers are subject to a division of…

Structure of tris(trimethylsilylcyclopentadienyl)uranium(III), [(CH3)3SiC5H43U

International Nuclear Information System (INIS)

Brennan, J.; Andersen, R.A.; Zalkin, A.

1986-02-01

Crystals of [(CH 3 ) 3 SiC 5 H 4 ] 3 U are orthorhombic, Pbca, with a = 22.630(8), b = 29.177(10) and c = 8.428(3) A at 23 0 C. For Z = 8 the calculated density is 1.551 g/cm 3 . The structure was refined by full-matrix least-squares to a conventional R factor of 0.041 [2251 data, F 2 > 2 sigma(F 2 )]. The uranium atom is bonded to the three cyclopentadienyl rings in a pentahapto fashion and is in the plane of the ring centroids. The U to ring distances are 2.54, 2.47 and 2.51 A, and the average U-C distance is 2.78 +- 0.04 A. 7 refs., 1 fig., 3 tabs

The sequential-separation of Tc, Np and residual U from metal ions -30% TBP/0.5% TOA/n-dodecane extraction system

International Nuclear Information System (INIS)

Lee, I. H.; Kim, S. H.; Lim, J. K.; Kim, K. W.; Kwon, S. K.

2002-01-01

This study on the enhancement of Tc extraction and the selective separation of Tc, Np and residual U by means of adding a small amount of tri-n-octylamine(TOA) in the 30% vol. tributyl phosphate(TBP)/n-dodecane was performed. Co-extraction of Tc, Np and U from the 10 components simulated radwaste solution containing the 0.005M-K 2 Cr 2 O 7 as an oxidant of Np by 30% TBP/0.5% TOA, and selective stripping of Tc, Np and U from the loaded organic phase were investigated, and their operation conditions were evaluated. Tc, Np and U was effectively co-extracted at O/A=1 and 1M HNO 3 . In this condition, the co-extraction yields of Tc, Np and U were 81.9%, 86%, 89.2%, respectively and those of Am, Eu, Nd, Mo and Fe were below 5%. For the selective stripping of extracted Tc, Np and U, however, sequentially 5M HNO 3 and O/A=1 for Tc, reduction of Np(VI) to Np(V) with 0.175M n-butyraldehyde (NBA) and O/A=2 for Np, and 0.15M Na 2 CO 3 and O/A=1 for U were used, respectively. In this case, 79% of Tc(co-stripping of less than 4% Np and U), 84% of Np(co-stripping of about 6% U), above 99% of U could be recovered, respectively

Constraints from proton decay in the flipped SU(5)xU(1) superstring model

Energy Technology Data Exchange (ETDEWEB)

Leontaris, G.K.; Tamvakis, K. (Ioannina Univ. (Greece). Theoretical Physics Div.)

1991-05-16

We discuss the constraints the emerge from the existence of dimension-5 baryon-violating operators in the flipped SU(5) x U(1) superstring model. These are constraints on matter field assignments and on singlet VEV values. Although baryon-violating dimension-5 operators that appear as quintic non-renormalizable terms vanish as has been proven before and as we verify here, effective dimension-5 operators resulting from Higgs exchange put non-trivial but feasible constraints on the model. Constraints are also extracted from the presence of higher order non-renormalizable terms that generate such operators which do not a priori vanish. (orig.).

Phenomenological implications of the flipped SU(5) x U(1) superstring model

Energy Technology Data Exchange (ETDEWEB)

Tamvakis, K. (Physics Dept., Univ. of Ioannina (Greece))

1991-07-01

We study in detail gauge symmetry breaking in the SU(5)xU(1)'xU(1){sup 4}xSO(10)xSO(6) superstring model, solving the D and F-flatness conditions and taking into account quartic and quintic superpotential terms. We find that, to this order, the model describes two massive generations of quarks and leptons as well as a massless generation expected to receive naturally suppressed masses from higher order non-renormalizable terms. D and F-flatness restricts the number of massless isodoublets to four. We solve the coupled renormalization group equations for the gauge and Yukawa couplings in the two-loop approximation and obtain the top-quark mass as a function of two parameters of the model which could be chosen to be ratios of singlet v.e.v's associated with the surplus (U(1)){sup 4} breaking. We obtain a heavy top-quark with 150GeV {<=} m{sub 1} < 200GeV, for most part of the parameter space, while lower values are possible only in a very small extermal region. We also compute the allowed range of unification parameters (M{sub x}, sin{sup 2} {theta}{sub w}, {alpha}{sub 3}(M{sub w})) in the presence of a heavy top quark. (orig.).

Neutron induced 238U subthreshold fission cross section for neutron energies between 5 eV and 3.5 MeV

International Nuclear Information System (INIS)

Perez, R.B.; Difilippo, F.C.; Saussure, G. de; Ingle, R.W.

1978-01-01

A measurement of the 238 U fission cross section between 5 eV and 3.5 MeV was performed. Included is the identification of 85 resonances or clusters of resonances below 200 keV. Also the fission widths for the 27 resolved class I levels were computed from their fission areas, and a neutron width of 0.005 MeV was estimated for the quasi-class II level in the 721 eV fission cluster. The fission level spacing and cross sections are discussed. 9 references

Comparison of neutral density profiles measured using Dα and C5+ in NSTX-U

Science.gov (United States)

Bell, R. E.; Scotti, F.; Diallo, A.; Leblanc, B. P.; Podesta, M.; Sabbagh, S. A.

2017-10-01

Edge neutral density profiles determined from two different measurements are compared on NSTX-U plasmas. Neutral density measurements were not typical on NSTX plasmas. An array of fibers dedicated to the measurement of passive emission of C5+, used to subtract background emission for charge exchange recombination spectroscopy (CHERS), can be used to infer deuterium neutral density near the plasma edge. The line emission from C5+ is dominated by charge exchange with neutral deuterium near the plasma edge. An edge neutral density diagnostic consisting of a camera with a Dα filter was installed on NSTX-U. The line-integrated measurements from both diagnostics are inverted to obtain local emissivity profiles. Neutral density is then inferred using atomics rates from ADAS and profile measurements from Thomson scattering and CHERS. Comparing neutral density profiles from the two diagnostic measurements helps determine the utility of using the more routinely available C5+ measurements for neutral density profiles. Initial comparisons show good agreement between the two measurements inside the separatrix. Supported by US DoE Contracts DE-AC02-09CH11466 and DE-AC52-07NA27344.

Phylogeographic history of grey wolves in Europe

Directory of Open Access Journals (Sweden)

Dykyy Ihor

2010-04-01

Full Text Available Abstract Background While it is generally accepted that patterns of intra-specific genetic differentiation are substantially affected by glacial history, population genetic processes occurring during Pleistocene glaciations are still poorly understood. In this study, we address the question of the genetic consequences of Pleistocene glaciations for European grey wolves. Combining our data with data from published studies, we analysed phylogenetic relationships and geographic distribution of mitochondrial DNA haplotypes for 947 contemporary European wolves. We also compared the contemporary wolf sequences with published sequences of 24 ancient European wolves. Results We found that haplotypes representing two haplogroups, 1 and 2, overlap geographically, but substantially differ in frequency between populations from south-western and eastern Europe. A comparison between haplotypes from Europe and other continents showed that both haplogroups are spread throughout Eurasia, while only haplogroup 1 occurs in contemporary North American wolves. All ancient wolf samples from western Europe that dated from between 44,000 and 1,200 years B.P. belonged to haplogroup 2, suggesting the long-term predominance of this haplogroup in this region. Moreover, a comparison of current and past frequencies and distributions of the two haplogroups in Europe suggested that haplogroup 2 became outnumbered by haplogroup 1 during the last several thousand years. Conclusions Parallel haplogroup replacement, with haplogroup 2 being totally replaced by haplogroup 1, has been reported for North American grey wolves. Taking into account the similarity of diets reported for the late Pleistocene wolves from Europe and North America, the correspondence between these haplogroup frequency changes may suggest that they were associated with ecological changes occurring after the Last Glacial Maximum.

Enbrittlement of the U-7,5 Nb-2,5 Zr uranium alloy in gaseous environments

International Nuclear Information System (INIS)

Lepoutre, D.

1984-10-01

Stress corrosion cracking in air, oxygen, hydrogen, water, carbon dioxide of an uranium alloy U 7.5 Nb 2.5 Zr is experimentally studied. The stress corrosion tests are performed with fatigue precracked Single Edge Notched specimens, and the Linear Elastic Fracture Mechanic concept is used to describe the stress state at the crack tip. The s.c.c. maps and the cracking kinetics are determined as a function of stress intensity factor, temperature and pressure. In oxygen, an embrittlement is observed in all the tests, for any temperature and pressure; cracking is transgranular and thermally activated. We propose a model which takes in account the concomitant buildup of an oxide film and niobium interfacial segregated zone. In hydrogen, an embrittlement is observed only at low pressure: hydriding occurs at high pressure. A brittle phase failure mechanism is proposed to explain the embrittling effect of hydrogen. Cracking in oxygen at low pressure is inhibited by water and carbon dioxide. Finally oxygen is the specie responsible for cracking in laboratory air [fr

Perspective of energy policy in the U.S

International Nuclear Information System (INIS)

Pasamehmetoglu, Kemal O.

2004-01-01

U.S. National Energy Policy encourages the expanded use of nuclear energy while emphasizing the need for improved safeguards and proliferation resistance. The National Energy Policy, published in May 2001 cites that 'The National Energy Policy Development (NEPD) Group recommends that the President support the expansion of nuclear energy in the United States as a major component of our national energy policy.' However, the U.S. policy also emphasizes that the expansion of nuclear energy must be supported by the development of advanced safeguards and more proliferation resistant technologies. U.S. energy policy promotes emission free energy that is sustainable and economically viable. Current carbon dioxide concentrations in the atmosphere are approaching a record levels Of 380 ppm. It is widely believed that we are quickly approaching a 'carbon wall' when the concentrations reach somewhere between 450 ppm and 750 ppm. Further increases in CO 2 concentrations in the atmosphere are likely to result in serious changes in the atmosphere, even though the severity of the consequences may be debatable. Thus, to meet the growing energy demand worldwide, emission free energy sources are needed. At present, nuclear power is the only large-scale energy production technology that is economically competitive with fossil fuels. U.S. energy policy promotes the expansion of nuclear power while continuing research in 'renewable energy' forms. Meeting the growing energy demand of developing nations by clean energy forms is essential for world peace, prosperity and environmental integrity. Energy use will grow as developing countries achieve affluence. Affluence in developing countries will lead to more stable and peaceful world. Note that a world of 10 billion people consuming energy as US citizens do today would raise the world energy demand by 10 fold. Such a growth via the use of fossil fuel will result in resource shortfalls and regional conflicts, and serious environmental

uVis Studio

DEFF Research Database (Denmark)

Pantazos, Kostas; Kuhail, Mohammad Amin; Lauesen, Søren

2013-01-01

Vis Studio. Instead of programming, developers apply a Drag-Drop-Set-View-Interact approach. Developers bind controls to data, and the Studio gives immediate visual feedback in the Design Panel. This is a novel feature, called What-You-Bind-Is-What- You-Get. The Studio also provides Modes that allow......A toolkit facilitates the visualization development process. The process can be further enhanced by integrating the toolkits in development environments. This paper describes how the uVis toolkit, a formula-based visualiza- tion toolkit, has been extended with a development environment, called u...... developers to interact and view the visualization from the end-user's perspective without switching workspace, and Auto-Completion; a feature of the Property Grid that provides suggestions not only for the formula language syntax but also for the tables, the table elds and the relationships in the database...

Life cycle greenhouse gas emissions from U.S. liquefied natural gas exports: implications for end uses.

Science.gov (United States)

Abrahams, Leslie S; Samaras, Constantine; Griffin, W Michael; Matthews, H Scott

2015-03-03

This study analyzes how incremental U.S. liquefied natural gas (LNG) exports affect global greenhouse gas (GHG) emissions. We find that exported U.S. LNG has mean precombustion emissions of 37 g CO2-equiv/MJ when regasified in Europe and Asia. Shipping emissions of LNG exported from U.S. ports to Asian and European markets account for only 3.5-5.5% of precombustion life cycle emissions, hence shipping distance is not a major driver of GHGs. A scenario-based analysis addressing how potential end uses (electricity and industrial heating) and displacement of existing fuels (coal and Russian natural gas) affect GHG emissions shows the mean emissions for electricity generation using U.S. exported LNG were 655 g CO2-equiv/kWh (with a 90% confidence interval of 562-770), an 11% increase over U.S. natural gas electricity generation. Mean emissions from industrial heating were 104 g CO2-equiv/MJ (90% CI: 87-123). By displacing coal, LNG saves 550 g CO2-equiv per kWh of electricity and 20 g per MJ of heat. LNG saves GHGs under upstream fugitive emissions rates up to 9% and 5% for electricity and heating, respectively. GHG reductions were found if Russian pipeline natural gas was displaced for electricity and heating use regardless of GWP, as long as U.S. fugitive emission rates remain below the estimated 5-7% rate of Russian gas. However, from a country specific carbon accounting perspective, there is an imbalance in accrued social costs and benefits. Assuming a mean social cost of carbon of $49/metric ton, mean global savings from U.S. LNG displacement of coal for electricity generation are $1.50 per thousand cubic feet (Mcf) of gaseous natural gas exported as LNG ($.028/kWh). Conversely, the U.S. carbon cost of exporting the LNG is $1.80/Mcf ($.013/kWh), or $0.50-$5.50/Mcf across the range of potential discount rates. This spatial shift in embodied carbon emissions is important to consider in national interest estimates for LNG exports.

Some maternal lineages of domestic horses may have origins in East Asia revealed with further evidence of mitochondrial genomes and HVR-1 sequences

Directory of Open Access Journals (Sweden)

Hongying Ma

2018-06-01

Full Text Available Objectives There are large populations of indigenous horse (Equus caballus in China and some other parts of East Asia. However, their matrilineal genetic diversity and origin remained poorly understood. Using a combination of mitochondrial DNA (mtDNA and hypervariable region (HVR-1 sequences, we aim to investigate the origin of matrilineal inheritance in these domestic horses. Methods To investigate patterns of matrilineal inheritance in domestic horses, we conducted a phylogenetic study using 31 de novo mtDNA genomes together with 317 others from the GenBank. In terms of the updated phylogeny, a total of 5,180 horse mitochondrial HVR-1 sequences were analyzed. Results Eightteen haplogroups (Aw-Rw were uncovered from the analysis of the whole mitochondrial genomes. Most of which have a divergence time before the earliest domestication of wild horses (about 5,800 years ago and during the Upper Paleolithic (35–10 KYA. The distribution of some haplogroups shows geographic patterns. The Lw haplogroup contained a significantly higher proportion of European horses than the horses from other regions, while haplogroups Jw, Rw, and some maternal lineages of Cw, have a higher frequency in the horses from East Asia. The 5,180 sequences of horse mitochondrial HVR-1 form nine major haplogroups (A-I. We revealed a corresponding relationship between the haplotypes of HVR-1 and those of whole mitochondrial DNA sequences. The data of the HVR-1 sequences also suggests that Jw, Rw, and some haplotypes of Cw may have originated in East Asia while Lw probably formed in Europe. Conclusions Our study supports the hypothesis of the multiple origins of the maternal lineage of domestic horses and some maternal lineages of domestic horses may have originated from East Asia.

Multi-Perspective Vehicle Detection and Tracking

DEFF Research Database (Denmark)

Dueholm, Jacob Velling; Kristoffersen, Miklas Strøm; Satzoda, Ravi K.

2016-01-01

this dataset is introduced along with its challenges and evaluation metrics. A vision-based multi-perspective dataset is presented, containing a full panoramic view from a moving platform driving on U.S. highways capturing 2704x1440 resolution images at 12 frames per second. The dataset serves multiple......The research community has shown significant improvements in both vision-based detection and tracking of vehicles, working towards a high level understanding of on-road maneuvers. Behaviors of surrounding vehicles in a highway environment is found as an interesting starting point, of why...... purposes to be used as traditional detection and tracking, together with tracking of vehicles across perspectives. Each of the four perspectives have been annotated, resulting in more than 4000 bounding boxes in order to evaluate and compare novel methods....

Quantification of "2"3"2Th, "2"3"4U, "2"3"5U and "2"3"8U in river mollusks by magnetic sector mass spectrometry with inductively coupled plasma source (Icp-SFMS)

International Nuclear Information System (INIS)

Arevalo R, D. L.; Hernandez M, H.; Romero G, E. T.; Lara A, N.; Alfaro de la T, M. C.

2016-09-01

The present work deals with the methodology established for the quantification of "2"3"2Th, "2"3"4U, "2"3"8U and "2"3"5U in the shell of gastropod mollusks collected in the rivers Valles, Coy and Axtla of San Luis Potosi, Mexico, which belong to the Panuco River basin; these rivers have as main source of pollution the discharge of municipal sewage, waste from small industries, agricultural and cattle residues and from natural sources. Conventional methods for measuring radio-nuclides are confronted with certain conditions related to the requirement in measurement, basically in the characterization that is related to the concepts of precision and accuracy. The analysis of the gastropod mollusk shell was performed by the Icp-SFMS technique; the main advantages of this technique lie in the isotope quantification capacity, the high precision and the low limits of detection, in this study are very important because these elements are in concentrations between ppb and ppt. This technique allowed the analysis of the samples having a complex matrix by the presence CaCO_3 minimizing the interferences thanks to the ionization efficiency of the Ar plasma. For the species Pachychilus monachus were found concentrations of "2"3"2Th of 0.16-5.37 μg/g and of total U of 0.101-4.081 μg/g being this species where the highest values of total U were found. For Thiara (melanoids) tuberculata the lowest values were found among the different species ("2"3"2Th 0.61-3.61 μg/g and total U 0.006-0.042 μg/g), for Pachychilus suturalis, values of "2"3"2Th of 0.58-6.4 μg/g and for Pachychilus sp. were found between 0.26-7.62 μg/g and for total U values between 0.28-3.33 μg/g. The method offers several advantages: speed, good precision, low values of quantification limits and high sensitivity in the measurement of radio-nuclides and heavy metals. (Author)

The linked units of 5S rDNA and U1 snDNA of razor shells (Mollusca: Bivalvia: Pharidae).

Science.gov (United States)

Vierna, J; Jensen, K T; Martínez-Lage, A; González-Tizón, A M

2011-08-01

The linkage between 5S ribosomal DNA and other multigene families has been detected in many eukaryote lineages, but whether it provides any selective advantage remains unclear. In this work, we report the occurrence of linked units of 5S ribosomal DNA (5S rDNA) and U1 small nuclear DNA (U1 snDNA) in 10 razor shell species (Mollusca: Bivalvia: Pharidae) from four different genera. We obtained several clones containing partial or complete repeats of both multigene families in which both types of genes displayed the same orientation. We provide a comprehensive collection of razor shell 5S rDNA clones, both with linked and nonlinked organisation, and the first bivalve U1 snDNA sequences. We predicted the secondary structures and characterised the upstream and downstream conserved elements, including a region at -25 nucleotides from both 5S rDNA and U1 snDNA transcription start sites. The analysis of 5S rDNA showed that some nontranscribed spacers (NTSs) are more closely related to NTSs from other species (and genera) than to NTSs from the species they were retrieved from, suggesting birth-and-death evolution and ancestral polymorphism. Nucleotide conservation within the functional regions suggests the involvement of purifying selection, unequal crossing-overs and gene conversions. Taking into account this and other studies, we discuss the possible mechanisms by which both multigene families could have become linked in the Pharidae lineage. The reason why 5S rDNA is often found linked to other multigene families seems to be the result of stochastic processes within genomes in which its high copy number is determinant.

The anomalous U(1){sub anom} symmetry and flavors from an SU(5) x SU(5){sup '} GUT in Z{sub 12-I} orbifold compactification

Energy Technology Data Exchange (ETDEWEB)

Kim, Jihn E. [Kyung Hee University, Department of Physics, Seoul (Korea, Republic of); Center for Axion and Precision Physics Research (IBS), Daejeon (Korea, Republic of); Kyae, Bumseok [Pusan National University, Department of Physics, Busan (Korea, Republic of); Nam, Soonkeon [Kyung Hee University, Department of Physics, Seoul (Korea, Republic of)

2017-12-15

In string compactifications, frequently the anomalous U(1) gauge symmetry appears which belongs to E{sub 8} x E{sub 8}{sup '} of the heterotic string. This anomalous U(1) gauge boson obtains mass at the compactification scale (∼ 10{sup 18} GeV) by absorbing one pseudoscalar (corresponding to the model-independent axion) from the second rank antisymmetric tensor field B{sub MN}. Below the compactification scale a global symmetry U(1){sub anom} results whose charge Q{sub anom} is the original gauge U(1) charge. This is the most natural global symmetry, realizing the ''invisible'' axion. This global symmetry U(1){sub anom} is suitable for a flavor symmetry. In the simplest compactification model with the flipped SU(5) grand unification, all the low energy parameters are calculated in terms of the vacuum expectation values of the standard model singlets. (orig.)

First TREAT [Transient Reactor Test Facility] transient overpower tests on U-Pu-Zr fuel: M5 and M6

International Nuclear Information System (INIS)

Robinson, W.R.; Bauer, T.H.; Wright, A.E.; Rhodes, E.A.; Stanford, G.S.; Klickman, A.E.

1987-01-01

Transient Reactor Test Facility (TREAT) tests M5 and M6 were the first transient overpower (TOP) tests of the margin to cladding breach and prefailure elongation of metallic U-Pu-Zr ternary fuel, the reference fuel of the Integral Fast Reactor concept. Similar tests on U-Fs fueled EBR-II driver pins were previously performed and reported [1,2]. Results from these earlier tests indicated a margin to failure of about 4 times nominal power and significant axial elongation prior to failure, a feature that was very pronounced at low burnups. While these two fuel types are similar in many respects, the ternary alloy exhibits a much more complex physical structure and is typically irradiated at much higher temperatures. Thus, a prime motivation for performing M5 and M6 was to compare the safety related fuel performance characteristics of U-Fs and U-Pu-Zr. This report described conditions, results, and conclusions of testing of these fuel types

Power project finance outside the U.S.: S and P's rating perspective

International Nuclear Information System (INIS)

Chew, William

1994-01-01

The growing prevalence of capital market debt financing for power projects outside the U.S. highlights the importance of understanding the risks this type of project poses, both for sponsors and potential investors. Based on its initial review of non-U.S. projects, S and P believes the stronger among them clearly have the potential to achieve ratings equal to or higher than those of U.S. projects. Nevertheless, sponsors still will need to address some of the risks such projects entail. S and P has established criteria that apply to power projects in all markets; however, it also has identified additional risks for projects outside the U.S. that should be addressed. (author)

"Sexting" among U.S. adolescents: psychological and legal perspectives.

Science.gov (United States)

Judge, Abigail M

2012-01-01

This article will discuss the phenomenon of "sexting" (i.e., the exchange of sexually explicit images between adolescents via cell phone) in the United States, with a particular focus on clinical and legal implications. Although sexting is frequently discussed in the popular press, there is virtually no scientific literature available on this topic. In contrast, the legal literature has discussed sexting more comprehensively due to the implications of child pornography statutes for the social response to involved youth. This article will consider sexting from a clinical and legal perspective, and recommend ways to understand and address this practice clinically with adolescent patients.

The role and contributions of IMGs: a U.S. perspective.

Science.gov (United States)

Cohen, Jordan J

2006-12-01

At 25% of the nation's physician workforce, international medical graduates (IMGs) contribute significantly to the U.S. health care system. Beyond their sheer numbers, however, IMGs have played critically important roles, both in aggregate and as individuals. By choosing to pursue specialties less attractive to U.S. medical graduates, IMGs have filled important gaps that otherwise would have seriously compromised the effectiveness of the U.S. health care system. Moreover, individual IMGs have made notable contributions to the improvement of clinical practice, to biomedical and health services research, and to medical education. The Educational Commission for Foreign Medical Graduates (ECFMG), through its certification process, has enabled the best and the brightest medical students from other nations to train in the United States and can take justifiable pride in the undeniably positive impact IMGs have had on U.S. health care. It is imperative to note, however, that while the United States and other developing nations have benefited enormously from this "medical migration," there is considerable concern about the damaging effects on many countries in the developing world. Among the options to consider in offsetting the negative consequences of this so-called brain drain is working to improve the medical education available to aspiring physicians in "donor" countries. In facilitating such a process, the ECFMG and its partner, the Foundation for Advancement of International Medical Education and Research, have the opportunity to amplify their contributions significantly by building on their established programs of international assistance in improving medical education.

Multiplexed SNP Typing of Ancient DNA Clarifies the Origin of Andaman mtDNA Haplogroups amongst South Asian Tribal Populations

Science.gov (United States)

Endicott, Phillip; Metspalu, Mait; Stringer, Chris; Macaulay, Vincent; Cooper, Alan; Sanchez, Juan J.

2006-01-01

The issue of errors in genetic data sets is of growing concern, particularly in population genetics where whole genome mtDNA sequence data is coming under increased scrutiny. Multiplexed PCR reactions, combined with SNP typing, are currently under-exploited in this context, but have the potential to genotype whole populations rapidly and accurately, significantly reducing the amount of errors appearing in published data sets. To show the sensitivity of this technique for screening mtDNA genomic sequence data, 20 historic samples of the enigmatic Andaman Islanders and 12 modern samples from three Indian tribal populations (Chenchu, Lambadi and Lodha) were genotyped for 20 coding region sites after provisional haplogroup assignment with control region sequences. The genotype data from the historic samples significantly revise the topologies for the Andaman M31 and M32 mtDNA lineages by rectifying conflicts in published data sets. The new Indian data extend the distribution of the M31a lineage to South Asia, challenging previous interpretations of mtDNA phylogeography. This genetic connection between the ancestors of the Andamanese and South Asian tribal groups ∼30 kya has important implications for the debate concerning migration routes and settlement patterns of humans leaving Africa during the late Pleistocene, and indicates the need for more detailed genotyping strategies. The methodology serves as a low-cost, high-throughput model for the production and authentication of data from modern or ancient DNA, and demonstrates the value of museum collections as important records of human genetic diversity. PMID:17218991

Flavor violations in no-scale flipped SU(5)xU(1)

Energy Technology Data Exchange (ETDEWEB)

Faraggi, A.E.; Lopez, J.L.; Nonopoulos, D.V.; Yuan, K.

1989-05-04

We study lepton-number violations in the flipped SU(5)xU(1) model in the context of no-scale supergravity. We find that the experimental limits on ..mu..->e..gamma.., ..mu..->eeanti e, and ..mu.. conversion in nuclei generally imply an upper bound on the top quark mass and a lower bound on the gaugino mass. We conclude that the seed of supersymmetry breaking in no-scale models (gaugino masses) radically changes some results obtained in ''minimal'' N=1 supergravity in the leptonic sector, while results in the hadronic sector (e.g. K-anti K, B-anti B mixings, and b->s..gamma..) remain essentially unchanged.

Fusion--fission energy systems, some utility perspectives

International Nuclear Information System (INIS)

Huse, R.A.; Burger, J.M.; Lotker, M.

1974-01-01

Some of the issues that are important in assessing fusion-- fission energy systems from a utility perspective are discussed. A number of qualitative systems-oriented observations are given along with some economic quantification of the benefits from fusion--fission hybrids and their allowed capital cost. (U.S.)

Inelastic scattering of 1-2.5 MeV neutrons by 235U and 238U nuclei

International Nuclear Information System (INIS)

Kornilov, N.V.; Kagalenko, A.B.; Baryba, V.Ya.; Balitskij, A.V.; Androsenko, A.A.; Androsenko, P.A.

1993-07-01

The inelastic scattering cross-sections of 1-2.5 MeV neutrons for 235 U and 238 0 nuclei were measured. A detailed description is given of the data processing procedures used, and the methods for determining the neutron flux in the sample. The Monte Carlo method was used to calculate the corrections for multiple neutron scattering and neutron flux attenuation in the sample. Pursuant to an analysis of the fission neutron spectra, we concluded that the systematic error level of the results is ± 3.27%. The results of these cross-section and spectrum measurements for inelastically scattered neutrons are compared with results from other sources and existing evaluations, the possible causes of the divergences for neutrons with an energy level of less than 1 MeV are analysed, and suggestions are put forward for future research work. (author)

Superheavy contributions to FCNC in the flipped SU(5) x U(1)

Energy Technology Data Exchange (ETDEWEB)

Gabbiani, F.; Masiero, A.

1988-08-04

In the supersymmetric GUT's the presence of the superheavy fields yields new contributions to flavour-changing neutral-current effects at low energy. We analyse this phenomenon in the context of the flipped SU(5) x U(1) superstring (-inspired) model. We show that possibly sizeable flavour leptonic changes (..mu.. -> e..gamma.., ..mu.. -> eeanti e, ..mu..-e conversion in nuclei) are generated. K-anti K, B-anti B mixings and b -> s..gamma.. constrain new couplings at the superlarge scale, which are unrelated to the standard Yukawa coefficients.

Dissociative subtype of DSM-5 posttraumatic stress disorder in U.S. veterans.

Science.gov (United States)

Tsai, Jack; Armour, Cherie; Southwick, Steven M; Pietrzak, Robert H

2015-01-01

The Diagnostic and Statistical Manual of Mental Disorders, 5th edition (DSM-5) formally introduced a dissociative subtype of posttraumatic stress disorder (PTSD). This study examined the proportion of U.S. veterans with DSM-5 PTSD that report dissociative symptoms; and compared veterans with PTSD with and without the dissociative subtype and trauma-exposed controls on sociodemographics, clinical characteristics, and quality of life. Multivariable analyses were conducted on a nationally representative sample of 1484 veterans from the National Health and Resilience in Veterans Study (second baseline survey conducted September-October, 2013). Of the 12.0% and 5.2% of veterans who screened positive for lifetime and past-month DSM-5 PTSD, 19.2% and 16.1% screened positive for the dissociative subtype, respectively. Among veterans with PTSD, those with the dissociative subtype reported more severe PTSD symptoms, comorbid depressive and anxiety symptoms, alcohol use problems, and hostility than those without the dissociative subtype. Adjusting for PTSD symptom severity, those with the dissociative subtype continued to report more depression and alcohol use problems. These results underscore the importance of assessing, monitoring, and treating the considerable proportion of veterans with PTSD and dissociative symptoms. Published by Elsevier Ltd.

Ten perspectives on Nordic energy

Energy Technology Data Exchange (ETDEWEB)

Tennbakk, Berit

2006-10-15

Summary: Perspective no. 1: Costly early learning from the EU ETS - Unforeseen price levels hit industries hard; Perspective no. 2: Market based support schemes - Do they work as intended? Perspective no. 3: New decade in the Nordic energy markets. Perspective no. 4: Reduced CO{sub 2} emissions and more renewables - Are we getting there or not? Perspective no. 5: Interpretation of financial requirements - An impediment to sound investments? Perspective no. 6: Who should invest in infrastructure - Public or private investors? Perspective no. 7: Re regulation is not the answer - Need for coordination calls for a visible hand? Perspective no. 8: Increased infrastructure investments - Due to EU ETS and support schemes for RES. Perspective no. 9: Energy, welfare and industry - Complex links make policy making difficult. Perspective no. 10 'Fuel' for an energy policy discussion - A Nordic energy policy agenda? (AG)

Ancient mtDNA genetic variants modulate mtDNA transcription and replication.

Directory of Open Access Journals (Sweden)

Sarit Suissa

2009-05-01

Full Text Available Although the functional consequences of mitochondrial DNA (mtDNA genetic backgrounds (haplotypes, haplogroups have been demonstrated by both disease association studies and cell culture experiments, it is not clear which of the mutations within the haplogroup carry functional implications and which are "evolutionary silent hitchhikers". We set forth to study the functionality of haplogroup-defining mutations within the mtDNA transcription/replication regulatory region by in vitro transcription, hypothesizing that haplogroup-defining mutations occurring within regulatory motifs of mtDNA could affect these processes. We thus screened >2500 complete human mtDNAs representing all major populations worldwide for natural variation in experimentally established protein binding sites and regulatory regions comprising a total of 241 bp in each mtDNA. Our screen revealed 77/241 sites showing point mutations that could be divided into non-fixed (57/77, 74% and haplogroup/sub-haplogroup-defining changes (i.e., population fixed changes, 20/77, 26%. The variant defining Caucasian haplogroup J (C295T increased the binding of TFAM (Electro Mobility Shift Assay and the capacity of in vitro L-strand transcription, especially of a shorter transcript that maps immediately upstream of conserved sequence block 1 (CSB1, a region associated with RNA priming of mtDNA replication. Consistent with this finding, cybrids (i.e., cells sharing the same nuclear genetic background but differing in their mtDNA backgrounds harboring haplogroup J mtDNA had a >2 fold increase in mtDNA copy number, as compared to cybrids containing haplogroup H, with no apparent differences in steady state levels of mtDNA-encoded transcripts. Hence, a haplogroup J regulatory region mutation affects mtDNA replication or stability, which may partially account for the phenotypic impact of this haplogroup. Our analysis thus demonstrates, for the first time, the functional impact of particular mt

Phenomenological constraints imposed by the hidden sector in the flipped SU(5)xU(1) superstring model

Energy Technology Data Exchange (ETDEWEB)

Leontaris, G.K.; Rizos, J.; Tamvakis, K. (Ioannina Univ. (Greece). Theoretical Physics Div.)

1990-06-28

We calculate the trilinear superpotential of the hidden sector of the three generation flipped SU(5)xU(1)xU(1){sup 4}xSO(10)xSU(4) superstring model. We perform a renormalization group analysis of the model taking into account the hidden sector. We find that, in all relevant cases, fractionally charged tetraplets of the hidden SO(6) gauge group are confined at a high scale. Nevertheless, their contribution to the observable U(1) gauge coupling evolution results in a drastic reduction of the available freedom in the values of a{sub 3}(m{sub w}), sin{sup 2}{theta}{sub w} and M{sub x} that allow superunification. (orig.).

U.S. and foreign breeder reactors

International Nuclear Information System (INIS)

Hill, E.H.

1977-01-01

The running battle between Congress and the Administration over the Clinch River Breeder Reactor Plant (CRBRP) Project has provoked an increased interest in domestic and foreign breeder reactor programs. Perhaps an understanding of the history of breeders here and abroad will serve to place the CRBRP in perspective and allow some analysis of how the U.S. appears on the global canvas. Breeder reactor technology has, for the most part, settled down to concentration on the liquid metal fast breeder reactor (LMFBR). This is the result of 32 years of experience with reactors employing a fast neutron flux and even longer experience with liquid metal coolants. However, a number of U.S. utilities are sponsoring a gas cooled fast reactor program as an alternative technology to the LMFBR. This development program is supported by the U.S. Department of Energy

Life and Death--A Cross-Cultural Perspective.

Science.gov (United States)

Cohen, Stewart

1992-01-01

Describes the celebration of death in Mexico and gives an alternative perspective from which to examine current U.S. attitudes and practices concerning death. Discusses the role that children play in the Todos Santos, or Day of the Dead, festival and the imagery and ceremonies of the festival. (LB)

Department of Energy perspective on high-level waste standards for Yucca Mountain

International Nuclear Information System (INIS)

Brocoum, S.J.; Gil, A.V.; Van Luik, A.E.; Lugo, M.A.

1996-01-01

This paper provides a regulatory perspective from the viewpoint of the potential licensee, the U.S. Department of Energy (DOE), on the National Academy of Sciences (NAS) report on Yucca Mountain standards issued in August 1995, and on how the recommendations in that report should be considered in the development of high-level radioactive waste standards applicable to Yucca Mountain. The paper first provides an overview of the DOE perspective and then discusses several of the issues that are of most importance in the development of the regulatory framework for Yucca Mountain, including both the U.S. Environmental Protection Agency (EPA) standard and the U.S. Nuclear Regulatory Commission (NRC) implementing regulation. These issues include: the regulatory time frame, the risk/dose limit, the definition of the reference biosphere, human intrusion, and natural processes and events

A Perspective on Research Challenges in Information Security

Science.gov (United States)

2011-11-01

UNCLASSIFIED A Perspective on Research Challenges in Information Security Tamas Abraham, David Adie, Angela Billard, Paul Buckland, Michael Frangos ...Abstract (U) 4. AUTHORS Tamas Abraham, David Adie, Angela Billard, Paul Buckland, Michael Frangos , Ben Long, Mar- tin Lucas, Paul Montague, Dean Philp

Development and evaluation of a collection apparatus for recoil products for study of the deexcitation process of "2"3"5"mU

International Nuclear Information System (INIS)

Shigekawa, Y.; Kasamatsu, Y.; Shinohara, A.

2016-01-01

The nucleus "2"3"5"mU is an isomer with extremely low excitation energy (76.8 eV) and decays dominantly through the internal conversion (IC) process. Because outer-shell electrons are involved in the IC process, the decay constant of "2"3"5"mU depends on its chemical environment. We plan to study the deexcitation process of "2"3"5"mU by measuring the energy spectra of IC electrons in addition to the decay constants for various chemical forms. In this paper, the preparation method of "2"3"5"mU samples from "2"3"9Pu by using alpha-recoil energy is reported. A Collection Apparatus for Recoil Products was fabricated, and then collection efficiencies under various conditions were determined by collecting "2"2"4Ra recoiling out of "2"2"8Th electrodeposited and precipitated sources. The pressure in the apparatus (vacuum or 1 atm of N_2 gas) affected the variations of the collection efficiencies depending on the negative voltage applied to the collector. The maximum values of the collection efficiencies were mainly affected by the thickness of the "2"2"8Th sources. From these results, the suitable conditions of the "2"3"9Pu sources for preparation of "2"3"5"mU were determined. In addition, dissolution efficiencies were determined by washing collected "2"2"4Ra with solutions. When "2"2"4Ra was collected in 1 atm of N_2 gas and dissolved with polar solutions such as water, the dissolution efficiencies were nearly 100%. The method of rapid dissolution of recoil products would be applicable to rapid preparation of short-lived "2"3"5"mU samples for various chemical forms.

The possibility of the mixed valence state in the uranium intermetallic compounds: UCoGa5, U2Ru2Sn and U2RuGa8

International Nuclear Information System (INIS)

Troc, Robert

2007-01-01

The mixed valence (MV) phenomenon has been observed so far in a large number of various compounds but containing only lanthanides. These properties are usually associated with the mixing of the localised f-state and the band states. The usual valence state for magnetic uranium intermetallics is the trivalent state 5f 3 or hybridised 5f 2 6d 1 , both are nearly degenerate in energy and can compete for a stability of the compound. In some cases a gain in an energy minimum may be achieved by very fast fluctuating between these two states with a time of 10 -14 s, which does not allow to yield the ordered state even if the exchange interactions (favourite the U-U distances) would be able for that. The latter cases seem to concern the described here intermetallics: one ternary compound based on Co, UCoGa 5 , and the two uranium ternary compounds based on Ru, namely U 2 Ru 2 Sn and U 2 RuGa 8 which all crystallize in a tetragonal unit cell. All these compounds show a maximum in their temperature dependences of the magnetic susceptibility measured along and perpendicular to the c-axis. Such a behaviour, which is reminiscent of a number of Ce (Sm, Eu) and Yb compounds for which χ(T) has in the past been considered by Sales and Wohlleben (SW) by applying their ICF model or by Lawrance et al. following their scaling procedure. It turned out that these phenomenological models can also be applied to the considered here two Ru-based uranium ternaries from which some reliable energy parameters could be found. In order to further support the mixing valence scenario for the first such cases in uranium compounds presented here, the transport and thermodynamic properties are also discussed. However, some of the most important results confirming the MV state, e.g., in U 2 RuGa 8 , has recently been achieved from the inelastic neutron scattering performed in the Rutherford Appleton Laboratory on the ISIS facility. From these measurements a characteristic gap of 60 meV has been

Algebraic manipulation of the states associated with the U(5)containsO(5)containsO(3) chain of groups: Orthonormalization and matrix elements

International Nuclear Information System (INIS)

Yannouleas, C.; Pacheco, J.M.

1989-01-01

A collection of procedures able to perform algebraic manipulations for the orthonormalization and for the calculation of matrix elements between the states associated with the U(5)containsO(5)containsO(3) chain of groups is presented. These procedures combine both the exact- and the bigfloat-arithmetic modes and thus return arbitrarily accurate results; this is particulary relevant to the Gram-Schmidt orthonormalization, where strong cancellations usually pose serious problems in all floating-point implementations. (orig.)

Maternal genetic heritage of Southeastern Europe reveals a new Croatian isolate and a novel, local sub-branching in the x2 haplogroup.

Science.gov (United States)

Sarac, Jelena; Sarić, Tena; Auguštin, Dubravka Havaš; Jeran, Nina; Kovačević, Lejla; Cvjetan, Svjetlana; Lewis, Ana Perinić; Metspalu, Ene; Reidla, Maere; Novokmet, Natalija; Vidovič, Maruška; Nevajda, Branimir; Glasnović, Anton; Marjanović, Damir; Missoni, Saša; Villems, Richard; Rudan, Pavao

2014-05-01

High mtDNA variation in Southeastern Europe (SEE) is a reflection of the turbulent and complex demographic history of this area, influenced by gene flow from various parts of Eurasia and a long history of intermixing. Our results of 1035 samples (488 from Croatia, 239 from Bosnia and 130 from Herzegovina, reported earlier, and 97 Slovenians and 81 individuals from Žumberak, reported here for the first time) show that the SEE maternal genetic diversity fits within a broader European maternal genetic landscape. The study also shows that the population of Žumberak, located in the continental part of Croatia, developed some unique mtDNA haplotypes and elevated haplogroup frequencies due to distinctive demographic history and can be considered a moderate genetic isolate. We also report seven samples from the Bosnian population and one Herzegovinian sample designated as X2* individuals that could not be assigned to any of its sublineages (X2a'o) according to the existing X2 phylogeny. In an attempt to clarify the phylogeny of our X2 samples, their mitochondrial DNA has been completely sequenced. We suppose that these lineages are signs of local microdifferentiation processes that occurred in the recent demographic past in this area and could possibly be marked as SEE-specific X2 sublineages. © 2014 John Wiley & Sons Ltd/University College London.

Autosomal and uniparental portraits of the native populations of Sakha (Yakutia): implications for the peopling of Northeast Eurasia.

Science.gov (United States)

Fedorova, Sardana A; Reidla, Maere; Metspalu, Ene; Metspalu, Mait; Rootsi, Siiri; Tambets, Kristiina; Trofimova, Natalya; Zhadanov, Sergey I; Hooshiar Kashani, Baharak; Olivieri, Anna; Voevoda, Mikhail I; Osipova, Ludmila P; Platonov, Fedor A; Tomsky, Mikhail I; Khusnutdinova, Elza K; Torroni, Antonio; Villems, Richard

2013-06-19

Sakha--an area connecting South and Northeast Siberia--is significant for understanding the history of peopling of Northeast Eurasia and the Americas. Previous studies have shown a genetic contiguity between Siberia and East Asia and the key role of South Siberia in the colonization of Siberia. We report the results of a high-resolution phylogenetic analysis of 701 mtDNAs and 318 Y chromosomes from five native populations of Sakha (Yakuts, Evenks, Evens, Yukaghirs and Dolgans) and of the analysis of more than 500,000 autosomal SNPs of 758 individuals from 55 populations, including 40 previously unpublished samples from Siberia. Phylogenetically terminal clades of East Asian mtDNA haplogroups C and D and Y-chromosome haplogroups N1c, N1b and C3, constituting the core of the gene pool of the native populations from Sakha, connect Sakha and South Siberia. Analysis of autosomal SNP data confirms the genetic continuity between Sakha and South Siberia. Maternal lineages D5a2a2, C4a1c, C4a2, C5b1b and the Yakut-specific STR sub-clade of Y-chromosome haplogroup N1c can be linked to a migration of Yakut ancestors, while the paternal lineage C3c was most likely carried to Sakha by the expansion of the Tungusic people. MtDNA haplogroups Z1a1b and Z1a3, present in Yukaghirs, Evens and Dolgans, show traces of different and probably more ancient migration(s). Analysis of both haploid loci and autosomal SNP data revealed only minor genetic components shared between Sakha and the extreme Northeast Siberia. Although the major part of West Eurasian maternal and paternal lineages in Sakha could originate from recent admixture with East Europeans, mtDNA haplogroups H8, H20a and HV1a1a, as well as Y-chromosome haplogroup J, more probably reflect an ancient gene flow from West Eurasia through Central Asia and South Siberia. Our high-resolution phylogenetic dissection of mtDNA and Y-chromosome haplogroups as well as analysis of autosomal SNP data suggests that Sakha was colonized by

Laser beam absorption study of a 238U(5L60) vapor obtained with a hollow cathode lamp

International Nuclear Information System (INIS)

Gagne, J.M.; Leblanc, B.; Mongeau, B.; Carleer, M.; Bertrand, L.

1979-01-01

The density of U atoms in the 5 L 0 6 ground state present in a vapor of this element from a hollow cathode lamp has been measured using laser absorption spectroscopy. The influence of the carrier gases (Ar, Kr, Xe) on the density, the absorption coefficient profiles, and on the ratio of U atoms to the dissipated electrical power has been investigated. It has been found that, in our range of operating conditions, the xenon gas is the most efficient. With xenon, a density of 2.2 x 10 12 cm -3 ground-state U atoms is obtained when the lamp dissipates 40 W of electrical power

Hydrogen absorption properties of U6Mn and U6Ni

International Nuclear Information System (INIS)

Ito, H.; Yamawaki, M.; Yamamoto, T.

1998-01-01

The hydrogen absorption properties of U, U 6 Mn and U 6 Ni were investigated at hydrogen pressures below 10 5 Pa. The pressure-composition (P-C) isotherms of U, U 6 Mn and U 6 Ni were obtained and the amounts of absorbed hydrogen for U, U 6 Mn and U 6 Ni were determined to be 3, 16.6 and 16.0 for x in MH x , where M is U, U 6 Mn and U 6 Ni, respectively. The desorption plateau pressures at 573 K decreased in the order: U 6 Mn-H>U 6 Ni-H>U-H. In addition, the results for the amounts of absorbed hydrogen suggests the formation of ternary hydrides U 6 MnH 18 and U 6 NiH 14 . (orig.)

A producer's perspective on the viability of the U.S. uranium industry

International Nuclear Information System (INIS)

Beck, M.K.

1986-01-01

Even without import restrictions, there are U.S. production centers that can effectively compete with worldwide supply sources on a marginal cost basis. In order to be in operation when needed, producers projected to start up prior to 1990 need to secure contracts within the next year or two to provide sufficient lead time to bring the required facilities into operation. Now is the most opportune time to enter into a long-term contract with a U.S. supplier. Spot market prices have most likely bottomed out, as evidenced by the recent moderate increases in spot price indices. There are a few U.S. traditional mines that have low operating costs and can offer competitive terms. Due to their generally lower production costs in situ operations appear to offer the best near-term opportunity for new contracts with terms that would be competitive with those being offered by non-U.S. producers in the current market situation

LTE/Wi-Fi Coexistence in 5 GHz ISM Spectrum: Issues, Solutions and Perspectives

DEFF Research Database (Denmark)

Abinader, Fuad; A. de Sousa Jr., Vicente; Choudhurry, Sayantan

2018-01-01

solutions is the aggregation of ISM unlicensed spectrum to licensed bands, using wireless networks defined by IEEE and 3GPP. While Wi-Fi networks are aggregated to LTE small cells via LTE/WLAN Aggregation (LWA), in proposals like LTE-U and LAA-LTE, the LTE air interface itself is used for transmission...... on the unlicensed band. Wi-Fi technology is widespread and also operates in the 5 GHz ISM spectrum bands, which may bring performance issues due to the coexistence of both technologies in the same spectrum band. This work is dedicated to the study of coexistence between LTE and Wi-Fi access systems operating in 5...

Regulatory compliance for a Yucca Mountain Repository: A performance assessment perspective

International Nuclear Information System (INIS)

Dyer, J.R.; Van Luik, A.E.; Gil, A.V.; Brocoum, S.J.

1997-01-01

The U.S. Department of Energy's Yucca Mountain Site Characterization Project is scheduled to submit a License Application in the year 2002. The License Application is to show compliance with the regulations promulgated by the U.S. Nuclear Regulatory Commission which implement standards promulgated by the U.S. Environmental Protection Agency. These standards are being revised, and it is not certain what their exact nature will be in term of either the performance measure(s) or the time frames that are to be addressed. This paper provides some insights pertaining to this regulatory history, an update on Yucca Mountain performance assessments, and a Yucca Mountain Site Characterization Project perspective on proper standards based on Project experience in performance assessment for its proposed Yucca Mountain Repository system. The Project's performance assessment based perspective on a proper standard applicable to Yucca Mountain may be summarized as follows: a proper standard should be straight forward and understandable; should be consistent with other standards and regulations; and should require a degree of proof that is scientifically supportable in a licensing setting. A proper standard should have several attributes: (1) propose a reasonable risk level as its basis, whatever the quantitative performance measure is chosen to be, (2) state a definite regulatory time frame for showing compliance with quantitative requirements, (3) explicitly recognize that the compliance calculations are not predictions of actual future risks, (4) define the biosphere to which risk needs to be calculated in such a way as to constrain potentially endless speculation about future societies and future human actions, and (5) have as its only quantitative requirement the risk limit (or surrogate performance measure keyed to risk) for the total system

U(VI) sorption on kaolinite. Effects of pH, U(VI) concentration and oxyanions

International Nuclear Information System (INIS)

Liang Gao; Ziqian Yang; Keliang Shi; Xuefeng Wang; Zhijun Guo; Wangsuo Wu

2010-01-01

U(VI) sorption on kaolinite was studied as functions of contact time, pH, U(VI) concentration, solid-to-liquid ratio (m/V) by using a batch experimental method. The effects of sulfate and phosphate on U(VI) sorption were also investigated. It was found that the sorption kinetics of U(VI) can be described by a pseudo-second-order model. Potentiometric titrations at variable ionic strengths indicated that the titration curves of kaolinite were not sensitive to ionic strength, and that the pH of the zero net proton charge (pH PZNPC ) was at 6.9. The sorption of U(VI) on kaolinite increased with pH up to 6.5 and reached a plateau at pH >6.5. The presence of phosphate strongly increased U(VI) sorption especially at pH <5.5, which may be due to formation of ternary surface complexes involving phosphate. In contrast, the presence of sulfate did not cause any apparent effect on U(VI) sorption. A double layer model was used to interpret both results of potentiometric titrations and U(VI) sorption on kaolinite. (author)

Genetic analysis of maternal and paternal lineages in Kabardian horses by uniparental molecular markers

Directory of Open Access Journals (Sweden)

Aliy-bek D. Khaudov

2018-02-01

Full Text Available Studies of mitochondrial DNA (mtDNA as well as the non-recombining part of the Y chromosome help to understand the origin and distribution of maternal and paternal lineages. The Kabardian horse from Northern Caucasia which is well-known for strength, stamina and endurance in distance riding has a large gap in its breeding documentation especially in the recent past. A 309 bp fragment of the mitochondrial D-loop (156 Kabardian horses and six mutations in Y chromosome (49 Kabardian stallions, respectively, were analyzed to get a better insight into breeding history, phylogenetic relationship to related breeds, maternal and paternal diversity and genetic structure. We found a high mitochondrial diversity represented by 64 D-loop haplotypes out of 14 haplogroups. The most frequent haplogroups were G (19.5%, L (12.3%, Q (11.7%, and B (11.0%. Although these four haplogroups are also frequently found in Asian riding horses (e.g. Buryat, Kirghiz, Mongolian, Transbaikalian, Tuvinian the percentage of the particular haplogroups varies sometimes remarkable. In contrast, the obtained haplogroup pattern from Kabardian horse was more similar to that of breeds reared in the Middle East. No specific haplotype cluster was observed in the phylogenetic tree for Kabardian horses. On Kabardian Y chromosome, two mutations were found leading to three haplotypes with a percentage of 36.7% (haplotype HT1, 38.8% (haplotype HT2 and 24.5% (haplotype HT3, respectively. The high mitochondrial and also remarkable paternal diversity of the Kabardian horse is caused by its long history with a widely spread maternal origin and the introduction of Arabian as well as Thoroughbred influenced stallions for improvement. This high genetic diversity provides a good situation for the ongoing breed development and performance selection as well as avoiding inbreeding.

Electronic location and magnetism in uranium and neptunium mono-chalcogenides and mono-pnictides, study of the systems: U_xLa_1_-_x(S,Se), U_0_._2(La_0_._1_5Y_0_._8_5)_0_._8Te and NpAs_1_-_xSe_x

International Nuclear Information System (INIS)

Bombardi, Alessandro

2001-03-01

This thesis concerns the evolution of the magnetic properties in some solid solutions (U_xLa_1_-_x(S,Se), U_0_._2(La_0_._1_5Y_0_._8_5)_0_._8Te, NpAs_1_-_XSe_x) based on Uranium and Neptunium. This experimental study is an attempt to improve the comprehension of the behavior of the 5f electrons, which are generally considered as responsibles for the physical properties observed in these systems, when a modification 'under control' of their chemical environment occurs. The first part of this thesis is devoted to the study of the effect of the reduction of the density of the magnetic centers (substitution U → La) on some physical properties, mainly magnetic, of the U mono-chalcogenide systems. The ferromagnetic long-range ordering observed in US and USe abruptly collapses at a critical U concentration far above the percolation limit, whereas short-range ferromagnetic correlations are measured well below this critical concentration. Magnetic form factor and X-ray magnetic circular dichroism measurements were performed to relate experimentally the change observed in the macroscopic properties of the materials to the electronic structure. The second part is devoted to the study of the evolution of the magnetic structures in the NpAs_1_-_xSe_x system. In this case a p electron is added, presumably to the conduction band, thus modifying the chemical potential. The magnetic phase diagram up to a Se concentration of 20%, as determined by neutron diffraction, magnetization measurements, and Moessbauer spectroscopy is reported. (author) [fr

Preparation of 199Tl radionuclide on U-120 (R-7M) cyclotron

International Nuclear Information System (INIS)

Glukhov, G.G.; Komov, A.I.; Maslennikov, Yu.S.; Malinin, A.B.; Skuridin, V.S.

1989-01-01

The possibility of preparation of 199 Tl radionuclide, which can be successfully used instead of thallium-201 in radiopharmaceutical compound for medicine diagnosis due to nuclear-physical characteristics, is studied. It is established that thallium-199 free from thallium-298, but with thallium-200 impurity, is formed under irradiation of gold-197 target by 27.2-28 MeV energy α-particles. The construction of a thin-layer gold target allowing to decrease thallium-200 impurity up to >0.5 % is developed and tested. Perspectivity of thallium-199 production at domestic cyclotrons P-7M and u-120 is shown. 4 refs.; 2 figs.; 3 tabs

Neutron inelastic-scattering cross sections of 232Th, 233U, 235U, 238U, 239Pu and 240Pu

International Nuclear Information System (INIS)

Smith, A.B.; Guenther, P.T.

1982-01-01

Differential-neutron-emission cross sections of 232 Th, 233 U, 235 U, 238 U, 239 Pu and 240 Pu are measured between approx. = 1.0 and 3.5 MeV with the angle and magnitude detail needed to provide angle-integrated emission cross sections to approx. 232 Th, 233 U, 235 U and 238 U inelastic-scattering values, poor agreement is observed for 240 Pu, and a serious discrepancy exists in the case of 239 Pu

Multifragmentation through exotic shape nuclei in α(5GeV/u)+Au reactions

International Nuclear Information System (INIS)

Maruyama, Tomoyuki

1996-01-01

We simulate the fragmentation processes in the α + Au collisions at the bombarding energy 5 GeV/u using the simplified RQMD approach. The statistical decay calculation is connected to obtain the final state. We find from the simulation that the residual nucleus created by this collision has an annular eclipse shape, and then expands more strongly to the transverse direction that to the beam-direction. Then the angular distribution of the intermediate mass fragments has a sideward peak; this result explains the experimental result. (author)

Molecular Genealogy of a Mongol Queen’s Family and Her Possible Kinship with Genghis Khan

Science.gov (United States)

Lkhagvasuren, Gavaachimed; Shin, Heejin; Lee, Si Eun; Tumen, Dashtseveg; Kim, Jae-Hyun; Kim, Kyung-Yong; Kim, Kijeong; Park, Ae Ja; Lee, Ho Woon; Kim, Mi Jin; Choi, Jaesung; Choi, Jee-Hye; Min, Na Young

2016-01-01

Members of the Mongol imperial family (designated the Golden family) are buried in a secret necropolis; therefore, none of their burial grounds have been found. In 2004, we first discovered 5 graves belonging to the Golden family in Tavan Tolgoi, Eastern Mongolia. To define the genealogy of the 5 bodies and the kinship among them, SNP and/or STR profiles of mitochondria, autosomes, and Y chromosomes were analyzed. Four of the 5 bodies were determined to carry the mitochondrial DNA haplogroup D4, while the fifth carried haplogroup CZ, indicating that this individual had no kinship with the others. Meanwhile, Y-SNP and Y-STR profiles indicate that the males examined belonged to the R1b-M343 haplogroup. Thus, their East Asian D4 or CZ matrilineal and West Eurasian R1b-M343 patrilineal origins reveal genealogical admixture between Caucasoid and Mongoloid ethnic groups, despite a Mongoloid physical appearance. In addition, Y chromosomal and autosomal STR profiles revealed that the four D4-carrying bodies bore the relationship of either mother and three sons or four full siblings with almost the same probability. Moreover, the geographical distribution of R1b-M343-carrying modern-day individuals demonstrates that descendants of Tavan Tolgoi bodies today live mainly in Western Eurasia, with a high frequency in the territories of the past Mongol khanates. Here, we propose that Genghis Khan and his family carried Y-haplogroup R1b-M343, which is prevalent in West Eurasia, rather than the Y-haplogroup C3c-M48, which is prevalent in Asia and which is widely accepted to be present in the family members of Genghis Khan. Additionally, Tavan Tolgoi bodies may have been the product of marriages between the lineage of Genghis Khan’s Borjigin clan and the lineage of either the Ongud or Hongirad clans, indicating that these individuals were members of Genghis Khan’s immediate family or his close relatives. PMID:27627454

Molecular Genealogy of a Mongol Queen's Family and Her Possible Kinship with Genghis Khan.

Science.gov (United States)

Lkhagvasuren, Gavaachimed; Shin, Heejin; Lee, Si Eun; Tumen, Dashtseveg; Kim, Jae-Hyun; Kim, Kyung-Yong; Kim, Kijeong; Park, Ae Ja; Lee, Ho Woon; Kim, Mi Jin; Choi, Jaesung; Choi, Jee-Hye; Min, Na Young; Lee, Kwang-Ho

2016-01-01

Members of the Mongol imperial family (designated the Golden family) are buried in a secret necropolis; therefore, none of their burial grounds have been found. In 2004, we first discovered 5 graves belonging to the Golden family in Tavan Tolgoi, Eastern Mongolia. To define the genealogy of the 5 bodies and the kinship among them, SNP and/or STR profiles of mitochondria, autosomes, and Y chromosomes were analyzed. Four of the 5 bodies were determined to carry the mitochondrial DNA haplogroup D4, while the fifth carried haplogroup CZ, indicating that this individual had no kinship with the others. Meanwhile, Y-SNP and Y-STR profiles indicate that the males examined belonged to the R1b-M343 haplogroup. Thus, their East Asian D4 or CZ matrilineal and West Eurasian R1b-M343 patrilineal origins reveal genealogical admixture between Caucasoid and Mongoloid ethnic groups, despite a Mongoloid physical appearance. In addition, Y chromosomal and autosomal STR profiles revealed that the four D4-carrying bodies bore the relationship of either mother and three sons or four full siblings with almost the same probability. Moreover, the geographical distribution of R1b-M343-carrying modern-day individuals demonstrates that descendants of Tavan Tolgoi bodies today live mainly in Western Eurasia, with a high frequency in the territories of the past Mongol khanates. Here, we propose that Genghis Khan and his family carried Y-haplogroup R1b-M343, which is prevalent in West Eurasia, rather than the Y-haplogroup C3c-M48, which is prevalent in Asia and which is widely accepted to be present in the family members of Genghis Khan. Additionally, Tavan Tolgoi bodies may have been the product of marriages between the lineage of Genghis Khan's Borjigin clan and the lineage of either the Ongud or Hongirad clans, indicating that these individuals were members of Genghis Khan's immediate family or his close relatives.

Forensic and phylogeographic characterisation of mtDNA lineages from Somalia

DEFF Research Database (Denmark)

Mikkelsen, Martin; Fendt, Liane; Röck, Alexander W.

2012-01-01

Somali individuals to enrich the severely underrepresented African mtDNA pool. The majority (60.5 %) of the haplotypes were of sub-Saharan origin with L0a1d, L2a1h and L3f being the most frequently observed haplogroups. This is in sharp contrast to previous data reported from the Y-chromosome, where only...... about 5 % of the observed haplogroups were of sub-Saharan provenance. We compared the genetic distances based on population pairwise F (st) values between 11 published East, Central and North African as well as western Asian populations and the Somali sequences and displayed them in a multi...

Characterizing genetic diversity of contemporary pacific chickens using mitochondrial DNA analyses.

Directory of Open Access Journals (Sweden)

Kelsey Needham Dancause

Full Text Available BACKGROUND: Mitochondrial DNA (mtDNA hypervariable region (HVR sequences of prehistoric Polynesian chicken samples reflect dispersal of two haplogroups--D and E--by the settlers of the Pacific. The distribution of these chicken haplogroups has been used as an indicator of human movement. Recent analyses suggested similarities between prehistoric Pacific and South American chicken samples, perhaps reflecting prehistoric Polynesian introduction of the chicken into South America. These analyses have been heavily debated. The current distribution of the D and E lineages among contemporary chicken populations in the Western Pacific is unclear, but might ultimately help to inform debates about the movements of humans that carried them. OBJECTIVES: We sought to characterize contemporary mtDNA diversity among chickens in two of the earliest settled archipelagos of Remote Oceania, the Marianas and Vanuatu. METHODS: We generated HVR sequences for 43 chickens from four islands in Vanuatu, and for 5 chickens from Guam in the Marianas. RESULTS: Forty samples from Vanuatu and three from Guam were assigned to haplogroup D, supporting this as a Pacific chicken haplogroup that persists in the Western Pacific. Two haplogroup E lineages were observed in Guam and two in Vanuatu. Of the E lineages in Vanuatu, one was identical to prehistoric Vanuatu and Polynesian samples and the other differed by one polymorphism. Contrary to our expectations, we observed few globally distributed domesticate lineages not associated with Pacific chicken dispersal. This might suggest less European introgression of chickens into Vanuatu than expected. If so, the E lineages might represent lineages maintained from ancient Pacific chicken introductions. The Vanuatu sample might thus provide an opportunity to distinguish between maintained ancestral Pacific chicken lineages and replacement by global domesticates through genomic analyses, which could resolve questions of contemporary

Genetic analysis of mitochondrial DNA control region variations in four tribes of Khyber Pakhtunkhwa, Pakistan.

Science.gov (United States)

Bhatti, Shahzad; Aslamkhan, M; Abbas, Sana; Attimonelli, Marcella; Aydin, Hikmet Hakan; de Souza, Erica Martinha Silva

2017-09-01

Due to its geo strategic position at the crossroad of Asia, Pakistan has gained crucial importance of playing its pivotal role in subsequent human migratory events, both prehistoric and historic. This human movement became possible through an ancient overland network of trails called "The Silk Route" linking Asia Minor, Middle East China, Central Asia and Southeast Asia. This study was conducted to analyze complete mitochondrial control region samples of 100 individuals of four major Pashtun tribes namely, Bangash, Khattak, Mahsuds and Orakzai in the province of Khyber Pakhtunkhwa, Pakistan. All Pashtun tribes revealed high genetic diversity which is comparable to the other Central Asian, Southeast Asian and European populations. The configuration of genetic variation and heterogeneity further unveiled through Multidimensional Scaling, Principal Component Analysis and phylogenetic analysis. The results revealed that Pashtun are the composite mosaic of West Eurasian ancestry of numerous geographic origin. They received substantial gene flow during different invasive movements and have a high element of the Western provenance. The most common haplogroups reported in this study are: South Asian haplogroups M (28%) and R (8%); whereas, West Asians haplogroups are present, albeit in high frequencies (67%) and widespread over all; HV (15%), U (17%), H (9%), J (8%), K (8%), W (4%), N (3%) and T (3%). Moreover, we linked the unexplored genetic connection between Ashkenazi Jews and Pashtun. The presence of specific haplotypes J1b (4%) and K1a1b1a (5%) pointed to a genetic connection of Jewish conglomeration in Khattak tribe. This was a result of an ancient genetic influx in the early Neolithic period that led to the formation of a diverse genetic substratum in present day Pashtun.

Genetic Ancestry using Mitochondrial DNA in patients with Triple-negative breast cancer (GAMiT study).

Science.gov (United States)

Rao, Roshni; Rivers, Aeisha; Rahimi, Asal; Wooldridge, Rachel; Rao, Madhu; Leitch, Marilyn; Euhus, David; Haley, Barbara B

2017-01-01

Triple-negative breast cancer (TNBC) lacks estrogen, progesterone, and human epidermal growth factor receptor 2 (HER2)/neu receptors, and is aggressive and therapeutically challenging. Genetic ancestry testing is an emerging medical field. Mitochondrial DNA (mtDNA), which is distinct from nuclear DNA, is maternally inherited and allows for origin determination. Patients with TNBC tend to be younger and are more likely to be African American, making this an ideal disease for mtDNA exploration. To the authors' knowledge, the current study is the first to perform mtDNA for self-described African American, White, and Hispanic patients with TNBC to identify mtDNA patterns. Patients with TNBC who were at any stage of therapy/survivorship were included. Self-reported ethnicity was confirmed at the time of the prospective buccal swab. Haplogroup prediction was performed on sequencing of hypervariable region 1. Using sequence similarity scores and lineage databases, sequence patterns were determined. Data regarding presentation and treatment, tumor features, and outcomes was collected. A total of 92 patients were included: 31 self-described African American, 31 White, and 30 Hispanic individuals. Hispanic patients were found to have the largest tumor size (4.5 cm; P = .01) and youngest age (41 years; Pancestry and haplogroups A, U, H, or B to be the most common mtDNA patterns. Twelve discordances (13%) between mtDNA analysis and self-described ethnicity were identified among the 92 patients. The highest discordance (26%; 8 patients) was noted in self-described Hispanic patients: 3 had Nigerian ancestry, and 1 individual demonstrated haplogroup K mtDNA (Ashkenazi Jewish ancestry). Discordance between self-reported ethnicity and mtDNA analysis was identified in 13% of patients with TNBC. The identification of mtDNA patterns with a predisposition toward TNBC may allow for risk stratification. Cancer 2017;107-113. © 2016 American Cancer Society. © 2016 American Cancer

Stem cell survival is severely compromised by the thymidineanalog EdU (5-ethynyl-2'-deoxyuridine), an alternative to BrdU for proliferation assays and stem cell tracing

DEFF Research Database (Denmark)

Andersen, Ditte C; Skovrind, Ida; Christensen, Marlene Louise

2013-01-01

Stem cell therapy has opened up the possibility of treating numerous degenerating diseases. However, we are still merely at the stage of identifying appropriate sources of stem cells and exploring their full differentiation potential. Thus, tracking the stem cells upon in vivo engraftment...... and during in vitro co-culture is very important and is an area of research embracing many pitfalls. 5-Ethynyl-2'-deoxyuridine (EdU), a rather new thymidine analog incorporated into DNA, has recently been suggested to be a novel highly valid alternative to other dyes for labeling of stem cells and subsequent...... tracing of their proliferation and differentiation ability. However, our results herein do not at any stage support this recommendation, since EdU severely reduces the viability of stem cells. Accordingly, we found that transplanted EdU-labeled stem cells hardly survive upon in vivo transplantation...

Angular distribution of photofission fragments in 238U at 5.43 MeV

International Nuclear Information System (INIS)

Kuniyoshi, S.; Mafra, O.Y.; Renner, C.; Goldemberg, J.

1974-01-01

The angular distribution of photofission fragments of 238 U, produced by 5.43 MeV monochromatic photons from the eta,γ reaction in sulphur, has been measured using glass plates as detectors. In the analysis of the results only the contributions from the (J sup(π), K) 1= (1 - ,0), (1 - ,1) and (2 + ,0) terms were considered. The coefficients of the angular distributions of the fission fragments were obtained. An analysis of the data available in the literature on the angular distribution near the photofission threshold is also presented

Angular distribution of photofission fragments in 238U at 5.43 MeV

International Nuclear Information System (INIS)

Kuniyoshi, Susumo

1973-01-01

The angular distribution of photofission fragments of 238 U, produced by 5.43 MeV monochromatic photons from the η,γ reaction in sulphur, has been measured using glass plates as detectors. In the analysis of the results only the contributions from the (J π , K) 1= (1 - ,0), (1 - ,1) and (2 + ,0) terms were considered. The coefficients of the angular distributions of the fission fragments were obtained. An analysis of the data available in the literature on the angular distribution near the photofission threshold is also presented. (author)

U.S. Army Unmanned Aircraft Systems (UAS) - A Historical Perspective to Identifying and Understanding Stakeholder Relationships

Science.gov (United States)

2014-06-01

U.S. Army (USA) to train Nike anti-aircraft missile crews and others through the 1970s. Mach 2 UAV targets consisted of several prototypes such as...manufacturers with the largest share of the global UAS market include General Atomics (20.4 percent), Northrop Grumman (18.9 percent), Boeing (1.5... mix of both manned and unmanned aircraft systems. By combining advanced sensors, tactical RSTA, MUM teaming of UAS, attack and reconnaissance

{sup 5}He ternary fission yields of {sup 252}Cf and {sup 235}U(n,f)

Energy Technology Data Exchange (ETDEWEB)

Hwang, J. K. [Department of Physics, Vanderbilt University, Nashville, Tennessee 37235 (United States); Ramayya, A. V. [Department of Physics, Vanderbilt University, Nashville, Tennessee 37235 (United States); Hamilton, J. H. [Department of Physics, Vanderbilt University, Nashville, Tennessee 37235 (United States); Beyer, C. J. [Department of Physics, Vanderbilt University, Nashville, Tennessee 37235 (United States); Kormicki, J. [Department of Physics, Vanderbilt University, Nashville, Tennessee 37235 (United States); Zhang, X. Q. [Department of Physics, Vanderbilt University, Nashville, Tennessee 37235 (United States); Rodin, A. [Flerov Laboratory for Nuclear Reactions, Joint Institute for Nuclear Research, Dubna, Russia (Russian Federation); Formichev, A. [Flerov Laboratory for Nuclear Reactions, Joint Institute for Nuclear Research, Dubna, Russia (Russian Federation); Kliman, J. [Flerov Laboratory for Nuclear Reactions, Joint Institute for Nuclear Research, Dubna, Russia (Russian Federation); Krupa, L. [Flerov Laboratory for Nuclear Reactions, Joint Institute for Nuclear Research, Dubna, Russia (Russian Federation)] (and others)

2000-04-01

The relative {sup 4}He and {sup 5}He ternary fission yields were determined from a careful analysis of the energy distribution of {alpha} spectra from a new measurement with a {sup 252}Cf source and from published data on {sup 252}Cf and {sup 235}U(n,f). The kinetic energies of the {sup 5}He and {sup 4}He ternary particles were found to be approximately 11 and 16 MeV, respectively. {sup 5}He particles contribute 10-20 % to the total alpha yield with the remainder originating from {sup 4}He accompanied fission. (c) 2000 The American Physical Society.

The Influence of U.S. Chain Restaurant Food Consumption and Obesity in China and South Korea: An Ecological Perspective of Food Consumption, Self-Efficacy in Weight Management, Willingness to Communicate About Weight/Diet, and Depression.

Science.gov (United States)

Wright, Kevin B; Mazzone, Raphael; Oh, Hyun; Du, Joshua; Smithson, Anne-Bennett; Ryan, Diane; MacNeil, David; Tong, Xing; Stiller, Carol

2016-11-01

This study examined the impact of U.S. chain restaurant food consumption in China and South Korea from an ecological perspective. Specifically, it explored the relationships among several environmental and individual variables that have been found to affect obesity/weight management in previous research, including the prevalence/popularity of U.S. chain restaurants in these countries, frequency of U.S. chain restaurant food consumption, self-efficacy in weight management, willingness to communicate about weight/diet, self-perceptions of weight/obesity stigma, body mass index (BMI), and depression. The results indicated that willingness to communicate about weight/diet predicted increased self-efficacy in weight management. Higher BMI scores were found to predict increased weight/obesity stigma, and increased frequency of U.S. restaurant food consumption, weight/obesity stigma, and reduced self-efficacy in weight management were found to predict increased levels of depression. The theoretical and practical implications of the findings are discussed, along with limitations and directions for future research.

Economics of license renewal in the U.S. - entergy's perspective

International Nuclear Information System (INIS)

Young, Garry G.

2003-01-01

License renewal of operating nuclear plants in the United States has become one of the most successful U.S. nuclear regulatory activities in the past few years. In 1995, the U.S. Nuclear Regulatory Commission (NRC) published a revised rule in 10 CFR Part 54 that provided the requirements for an operating nuclear plant to seek license renewal. At that time, many people believed that only a select few operating nuclear plants would pursue license renewal and that most plants would operate for no more than 40 years. By mid-2003, the owners of approximately 52% of the U.S. nuclear fleet of 103 operating nuclear plants have decided to pursue license renewal and more are expected to follow. This change in direction since 1995 can be attributed to the improving economics of U.S. nuclear power plant operation and to the improved regulatory process resulting from the 1995 revision to 10 CFR Part 54. In 2000, Entergy submitted a license renewal application for Arkansas Nuclear One, Unit 1 (ANO-1). This application was the third to be submitted to the NRC at a time when it was still unclear how successful the regulatory process might be. However, less than 17 months later, in June 2001, the NRC granted a renewed operating license for ANO-1 at a total cost of approximately $11 million. Due in part to the ANO-1 license renewal success, Entergy now has tentative plans to pursue license renewal for the entire fleet of operating nuclear power plants. Without license renewal, Entergy's current nuclear fleet capacity of approximately 9,000 MW(e) would begin to decline in 2012. With license renewal, Entergy's nuclear fleet capacity can remain in place until 2032. This projection does not include the expected improvements in capacity due to power uprate that is currently planned. The combination of power uprate and license renewal will add significant economic value to Entergy's nuclear fleet. One of the major factors in strong performance is capacity factor. In 1990, the average

Intake of 210Po, 234U and 238U radionuclides with beer in Poland

International Nuclear Information System (INIS)

Skwarzec, B.; Struminska, D.I.; Borylo, A.; Falandysz, J.

2004-01-01

238 U, 234 U and 210 Po activity concentrations were determined in beer in Poland by alpha-spectrometry with low-level activity silicon detectors. The results revealed that the mean concentrations of 238 U, 234 U and 210 Po in the analyzed beer samples were 4.63, 4.11 and 4.94 mBq x dm -3 , respectively, the highest in Tyskie (5.71 for 210 Po, 5.06 for 234 U and 6.11 for 238 U) and the lowest in Lech (2.49 for 210 Po). The effective radiation dose due to uranium and polonium ingestions by beer was calculated and were compared to the effective radiation dose from drinking water. (author)

Downregulation of viral RNA translation by hepatitis C virus non-structural protein NS5A requires the poly(U/UC) sequence in the 3' UTR.

Science.gov (United States)

Hoffman, Brett; Li, Zhubing; Liu, Qiang

2015-08-01

Hepatitis C virus (HCV) non-structural protein 5A (NS5A) is essential for viral replication; however, its effect on HCV RNA translation remains controversial partially due to the use of reporters lacking the 3' UTR, where NS5A binds to the poly(U/UC) sequence. We investigated the role of NS5A in HCV translation using a monocistronic RNA containing a Renilla luciferase gene flanked by the HCV UTRs. We found that NS5A downregulated viral RNA translation in a dose-dependent manner. This downregulation required both the 5' and 3' UTRs of HCV because substitution of either sequence with the 5' and 3' UTRs of enterovirus 71 or a cap structure at the 5' end eliminated the effects of NS5A on translation. Translation of the HCV genomic RNA was also downregulated by NS5A. The inhibition of HCV translation by NS5A required the poly(U/UC) sequence in the 3' UTR as NS5A did not affect translation when it was deleted. In addition, we showed that, whilst the amphipathic α-helix of NS5A has no effect on viral translation, the three domains of NS5A can inhibit translation independently, also dependent on the presence of the poly(U/UC) sequence in the 3' UTR. These results suggested that NS5A downregulated HCV RNA translation through a mechanism involving the poly(U/UC) sequence in the 3' UTR.

Seawater 234U/238U recorded by modern and fossil corals

Science.gov (United States)

Chutcharavan, Peter M.; Dutton, Andrea; Ellwood, Michael J.

2018-03-01

U-series dating of corals is a crucial tool for generating absolute chronologies of Late Quaternary sea-level change and calibrating the radiocarbon timescale. Unfortunately, coralline aragonite is susceptible to post-depositional alteration of its primary geochemistry. One screening technique used to identify unaltered corals relies on the back-calculation of initial 234U/238U activity (δ234Ui) at the time of coral growth and implicitly assumes that seawater δ234U has remained constant during the Late Quaternary. Here, we test this assumption using the most comprehensive compilation to date of coral U-series measurements. Unlike previous compilations, this study normalizes U-series measurements to the same decay constants and corrects for offsets in interlaboratory calibrations, thus reducing systematic biases between reported δ234U values. Using this approach, we reassess (a) the value of modern seawater δ234U, and (b) the evolution of seawater δ234U over the last deglaciation. Modern coral δ234U values (145.0 ± 1.5‰) agree with previous measurements of seawater and modern corals only once the data have been normalized. Additionally, fossil corals in the surface ocean display δ234Ui values that are ∼5-7‰ lower during the last glacial maximum regardless of site, taxon, or diagenetic setting. We conclude that physical weathering of U-bearing minerals exposed during ice sheet retreat drives the increase in δ234U observed in the oceans, a mechanism that is consistent with the interpretation of the seawater Pb-isotope signal over the same timescale.

Action plan during reactor shutdown in October 1965, Annex 5; Prilog br. 5 - Plan radova u toku stajanja reaktora u mesecu oktobru 1965. godine

Energy Technology Data Exchange (ETDEWEB)

Nikolic, M [Reaktor RA, Odelenje odrzavanja, Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

1965-12-15

The action plan of the division for reactor maintenance during reactor shutdown includes detailed list of tasks for mechanics, electronic and electrical equipment group during the reactor shutdown period in October 1965. It contains tasks for planned shutdown periods in September, August, July, May, April, March, and February 1965. [Serbo-Croat] Plan radova Odelenja odrzavanja reaktora RA za period stajanja reaktora u oktobru mesecu 1965. sadrzi detaljnu listu zadataka masinske grupe, elektro grupe i elektronske grupe. Ovaj prilog sadrzi i zadatke koji ce biti obavljeni tokom planiranih perioda kada je reaktor zaustavljen u septembru, avgustu, julu, junu, maju, aprilu, martu i februaru 1965.

Nanocrystalline (U0.5Ce0.5)O2±x solid solutions through citrate gel-combustion

Science.gov (United States)

Maji, D.; Ananthasivan, K.; Venkata Krishnan, R.; Balakrishnan, S.; Amirthapandian, S.; Joseph, Kitheri; Dasgupta, Arup

2018-04-01

Nanocrystalline powders of (U0.5Ce0.5)O2±x solid solutions were synthesized in bulk (100-200 g) through the citrate gel combustion. The fuel (citric acid) to oxidant (nitrate) mole ratio (R) was varied from 0.1 to 1.0. Two independent lots of the products obtained through the gel-combustion were calcined at 973 K in air and in a mixture of argon containing 8% H2 respectively. All these powders were characterized for their bulk density, X-ray crystallite size, specific surface area, size distribution of the particles, porosity as well as residual carbon. The morphology and microstructures of these powders were studied by using scanning electron microscopy (SEM) and transmission electron microscopy (TEM) respectively. Nanocrystalline single phase fluorite solid solutions having a typical crystallite size of about (7-15 nm) were obtained. These powders were highly porous comprising cuboidal flaky agglomerates. The combustion mixture with an 'R' value of 0.25 was found to undergo volume combustion and was found to yield a product that was distinctly different. The systematic investigation on synthesis and characterization of nanocrystalline UCeO2 is reported for the first time.

Trends over 5 decades in U.S. occupation-related physical activity and their associations with obesity.

Science.gov (United States)

Church, Timothy S; Thomas, Diana M; Tudor-Locke, Catrine; Katzmarzyk, Peter T; Earnest, Conrad P; Rodarte, Ruben Q; Martin, Corby K; Blair, Steven N; Bouchard, Claude

2011-01-01

The true causes of the obesity epidemic are not well understood and there are few longitudinal population-based data published examining this issue. The objective of this analysis was to examine trends in occupational physical activity during the past 5 decades and explore how these trends relate to concurrent changes in body weight in the U.S. Analysis of energy expenditure for occupations in U.S. private industry since 1960 using data from the U.S. Bureau of Labor Statistics. Mean body weight was derived from the U.S. National Health and Nutrition Examination Surveys (NHANES). In the early 1960's almost half the jobs in private industry in the U.S. required at least moderate intensity physical activity whereas now less than 20% demand this level of energy expenditure. Since 1960 the estimated mean daily energy expenditure due to work related physical activity has dropped by more than 100 calories in both women and men. Energy balance model predicted weights based on change in occupation-related daily energy expenditure since 1960 for each NHANES examination period closely matched the actual change in weight for 40-50 year old men and women. For example from 1960-62 to 2003-06 we estimated that the occupation-related daily energy expenditure decreased by 142 calories in men. Given a baseline weight of 76.9 kg in 1960-02, we estimated that a 142 calories reduction would result in an increase in mean weight to 89.7 kg, which closely matched the mean NHANES weight of 91.8 kg in 2003-06. The results were similar for women. Over the last 50 years in the U.S. we estimate that daily occupation-related energy expenditure has decreased by more than 100 calories, and this reduction in energy expenditure accounts for a significant portion of the increase in mean U.S. body weights for women and men.

Genetic imprint of the Mongol: signal from phylogeographic analysis of mitochondrial DNA.

Science.gov (United States)

Cheng, Baoweng; Tang, Wenru; He, Li; Dong, Yongli; Lu, Jing; Lei, Yunping; Yu, Haijing; Zhang, Jiali; Xiao, Chunjie

2008-01-01

Mitochondrial deoxyribonucleic acid (DNA) from 201 unrelated Mongolian individuals in the three different regions was analyzed. The Mongolians took the dominant East Asian-specific haplogroups, and some European-prevalent haplogroups were detected. The East Asians-specific haplogroups distributed from east to west in decreasing frequencies, and the European-specific haplogroups distributed conversely. These genetic data suggest that the Mongolian empire played an important role in the maternal genetic admixture across Mongolians and even Central Asian populations, whereas the Silk Road might have contributed little in the admixture between the East Asians and the Europeans.

Torsten Husen: A Case of Ethnocentrism in U.S. Educational Research?

Science.gov (United States)

Greeson, Larry E.

1994-01-01

The paucity of citations of Torsten Husen writings is an example of cultural ethnocentrism and academic imperialism in U.S. educational and psychological research. Cross-cultural perspectives, interdisciplinary analyses, and global learning are proposed as methods of overcoming the methodological parochialism, overspecialization, and international…

Genetic Affiliation of Pre-Hispanic and Contemporary Mayas Through Maternal Linage.

Science.gov (United States)

Ochoa-Lugo, Mirna Isabel; Muñoz, María de Lourdes; Pérez-Ramírez, Gerardo; Beaty, Kristine G; López-Armenta, Mauro; Cervini-Silva, Javiera; Moreno-Galeana, Miguel; Meza, Adrián Martínez; Ramos, Eduardo; Crawford, Michael H; Romano-Pacheco, Arturo

2016-04-01

Maya civilization developed in Mesoamerica and encompassed the Yucatan Peninsula, Guatemala, Belize, part of the Mexican states of Tabasco and Chiapas, and the western parts of Honduras and El Salvador. This civilization persisted approximately 3,000 years and was one of the most advanced of its time, possessing the only known full writing system at the time, as well as art, sophisticated architecture, and mathematical and astronomical systems. This civilization reached the apex of its power and influence during the Preclassic period, from 2000 BCE to 250 CE. Genetic variation in the pre-Hispanic Mayas from archaeological sites in the Mexican states of Yucatan, Chiapas, Quintana Roo, and Tabasco and their relationship with the contemporary communities in these regions have not been previously studied. Consequently, the principal aim of this study was to determine mitochondrial DNA (mtDNA) variation in the pre-Hispanic Maya population and to assess the relationship of these individuals with contemporary Mesoamerican Maya and populations from Asia, Beringia, and North, Central, and South America. Our results revealed interactions and gene flow between populations in the different archaeological sites assessed in this study. The mtDNA haplogroup frequency in the pre-Hispanic Maya population (60.53%, 34.21%, and 5.26% for haplogroups A, C, and D, respectively) was similar to that of most Mexican and Guatemalan Maya populations, with haplogroup A exhibiting the highest frequency. Haplogroup B most likely arrived independently and mixed with populations carrying haplogroups A and C based on its absence in the pre-Hispanic Mexican Maya populations and low frequencies in most Mexican and Guatemalan Maya populations, although this also may be due to drift. Maya and Ciboneys sharing haplotype H10 belonged to haplogroup C1 and haplotype H4 of haplogroup D, suggesting shared regional haplotypes. This may indicate a shared genetic ancestry, suggesting more regional interaction

Criticality in the configuration-mixed interacting boson model: (1) U(5)-Q(χ)Q(χ) mixing

International Nuclear Information System (INIS)

Hellemans, V.; Van Isacker, P.; De Baerdemacker, S.; Heyde, K.

2007-01-01

The case of U(5)-Q(χ)Q(χ) mixing in the configuration-mixed interacting boson model is studied in its mean-field approximation. Phase diagrams with analytical and numerical solutions are constructed and discussed. Indications for first-order and second-order shape phase transitions can be obtained from binding energies and from critical exponents, respectively

Teaching International Business Law: A Liberal Arts Perspective

Science.gov (United States)

MacDonald, Diane B.; Ramaglia, Judith A.

2004-01-01

Integrating the liberal arts perspective in the study of international commerce allows students to examine the human side of doing business outside the U.S. and stimulates the imagination by exploring the contributions made to business practices by other cultures. This approach is one way to enrich the student learning experience and to make the…

Associations between male infertility and ancestry in South Americans: a case control study.

Science.gov (United States)

Skowronek, Maria Fernanda; Velazquez, Tatiana; Mut, Patricia; Figueiro, Gonzalo; Sans, Monica; Bertoni, Bernardo; Sapiro, Rossana

2017-07-26

Infertility affects 15% of human couples, with men being responsible in approximately 50% of cases. Moreover, the aetiology of male factor infertility is poorly understood. The majority of male factor infertility remains idiopathic and potentially genetic in origin. The association of the Y chromosome and mitochondrial haplogroups with male infertility has been previously reported. This association differs between studied populations and their geographical distributions. These effects have been only rarely analysed in mixed populations, such as South Americans. In this study, we analysed the contributions of the Y chromosome and mitochondrial haplogroups to male infertility in a mixed population. A case control study was conducted. Regular PCR and high-resolutionmelting- real-time PCR were performed to type haplogroups from fertile and infertile men. The sperm parameters from infertile men were compared in each haplogroup by logistic regression analysis and ANOVA. The genotyping confirmed the known admixture characteristic of the Uruguayan population. The European paternal contribution was higher than the maternal contribution in both fertile and infertile men. Neither maternal nor paternal ancestry presented differences between the cases and controls. Men belonging to the Y chromosome haplogroup F(xK) more frequently presented with an abnormal sperm morphology than men from other haplogroups. The sperm parameters were not associated with the mitochondrial haplogroups. The data presented in this study showed an association between male infertility and ancestry in the Uruguayan population. Specifically, abnormal sperm morphology was associated with the Y chromosome haplogroup F(xK). Since the Y chromosome lacks recombination, these data suggest that some genes that determine sperm morphology might be inherited in blocks with the region that determines specific haplogroups. However, the possible association between the Y chromosome haplogroup F(xK) and sperm

Uniform angular overlap model interpretation of the crystal field effect in U(5+) fluoride compounds

Energy Technology Data Exchange (ETDEWEB)

Gajek, Z.; Mulak, J. (W. Trzebiatowski Inst. of Low Temperature and Structure Research, Polish Academy of Sciences, Wroclaw (Poland))

1990-11-01

The uniform interpretation of the crystal field effect in three different U(5+) fluoride compounds: CsUF{sub 6}, {alpha}-UF{sub 5} and {beta}-UF{sub 5} within the angular overlap model (AOM) is given. Some characteristic relations between the AOM parameters and their distance dependencies resulting from ab initio calculations are introduced and examined from a phenomenological point of view. The traditional simplest approach with only one independent parameter, i.e. e{sub {sigma}} with e{sub {pi}}:e{sub {sigma}} = 0.32 and e{sub {delta}} = 0, is shown to provide a consistent interpretation of the crystal field effect of the whole class of the compounds. The parameters obtained for one compound are easily and successfully extrapolated to others. The specificity and importance of the e{sub {delta}} parameter for 5f{sup 1} systems is discussed. (orig.).

U.S. Chamber Adds Business Viewpoint on Schools' Quality

Science.gov (United States)

Archer, Jeff

2007-01-01

With a new and highly critical report card offering a business perspective on the effectiveness of state education systems, the U.S. Chamber of Commerce is pushing what it sees as a prescription for more innovative, efficient, and better-performing schools. For the chamber, the grades and policy platform further a concerted new effort to shape…

Acoustic Noise Test Report for the U.S. Department of Energy 1.5-Megawatt Wind Turbine

Energy Technology Data Exchange (ETDEWEB)

Roadman, Jason [National Renewable Energy Lab. (NREL), Golden, CO (United States); Huskey, Arlinda [National Renewable Energy Lab. (NREL), Golden, CO (United States)

2015-07-01

A series of tests were conducted to characterize the baseline properties and performance of the U.S. Department of Energy (DOE) 1.5-megawatt wind turbine (DOE 1.5) to enable research model development and quantify the effects of future turbine research modifications. The DOE 1.5 is built on the platform of GE's 1.5-MW SLE commercial wind turbine model. It was installed in a nonstandard configuration at the NWTC with the objective of supporting DOE Wind Program research initiatives such as A2e. Therefore, the test results may not represent the performance capabilities of other GE 1.5-MW SLE turbines. The acoustic noise test documented in this report is one of a series of tests carried out to establish a performance baseline for the DOE 1.5 in the NWTC inflow environment.

Preferences of AAA/AAG codon recognition by modified nucleosides, τm5s2U34 and t6A37 present in tRNALys.

Science.gov (United States)

Sonawane, Kailas D; Kamble, Asmita S; Fandilolu, Prayagraj M

2017-12-27

Deficiency of 5-taurinomethyl-2-thiouridine, τm 5 s 2 U at the 34th 'wobble' position in tRNA Lys causes MERRF (Myoclonic Epilepsy with Ragged Red Fibers), a neuromuscular disease. This modified nucleoside of mt tRNA Lys , recognizes AAA/AAG codons during protein biosynthesis process. Its preference to identify cognate codons has not been studied at the atomic level. Hence, multiple MD simulations of various molecular models of anticodon stem loop (ASL) of mt tRNA Lys in presence and absence of τm 5 s 2 U 34 and N 6 -threonylcarbamoyl adenosine (t 6 A 37 ) along with AAA and AAG codons have been accomplished. Additional four MD simulations of multiple ASL mt tRNA Lys models in the context of ribosomal A-site residues have also been performed to investigate the role of A-site in recognition of AAA/AAG codons. MD simulation results show that, ASL models in presence of τm 5 s 2 U 34 and t 6 A 37 with codons AAA/AAG are more stable than the ASL lacking these modified bases. MD trajectories suggest that τm 5 s 2 U recognizes the codons initially by 'wobble' hydrogen bonding interactions, and then tRNA Lys might leave the explicit codon by a novel 'single' hydrogen bonding interaction in order to run the protein biosynthesis process smoothly. We propose this model as the 'Foot-Step Model' for codon recognition, in which the single hydrogen bond plays a crucial role. MD simulation results suggest that, tRNA Lys with τm 5 s 2 U and t 6 A recognizes AAA codon more preferably than AAG. Thus, these results reveal the consequences of τm 5 s 2 U and t 6 A in recognition of AAA/AAG codons in mitochondrial disease, MERRF.

Balkan brachicerous cattle - the first domesticated cattle in Europe.

Science.gov (United States)

Hristov, Peter; Sirakova, Daniela; Mitkov, Ivan; Spassov, Nikolai; Radoslavov, Georgi

2018-01-01

The present study aimed to compare mitochondrial diversity among Balkan Neolithic/Chalcolithic cattle and present day Shorthorn Rhodopean cattle (Busha) to throw a new insight into European cattle domestication. The results showed that both ancient- and present-day samples belonged to the macrohaplogroup T. From the 28 sequences (8 ancient and 20 modern), the T1 and T2 haplogroup represent about 3.6% (1/28; 1/28). The T3 haplogroup was with the highest frequency - 57% (16/28). Based on the SNPs on 16057A and 16133C, the new T6 haplogroup was proposed. This haplogroup represents 75% from the ancient and 20% from the present day Bulgarian brachicerous cattle population. The survey in GenBank data base did not find a similar motif, except for the recent Serbian Busha cattle. Overall, these results showed that: (i) The newly named T6 haplogroup is Balkan specific; (ii) The T6 haplogroup survives in present day Bulgarian rhodopean cattle; (iii) The Balkan brachicerous cattle is the oldest European cattle breed.

Thermochemistry of rare earth doped uranium oxides LnxU1-xO2-0.5x+y (Ln = La, Y, Nd)

Science.gov (United States)

Zhang, Lei; Navrotsky, Alexandra

2015-10-01

Lanthanum, yttrium, and neodymium doped uranium dioxide samples in the fluorite structure have been synthesized, characterized in terms of metal ratio and oxygen content, and their enthalpies of formation measured by high temperature oxide melt solution calorimetry. For oxides doped with 10-50 mol % rare earth (Ln) cations, the formation enthalpies from constituent oxides (LnO1.5, UO2 and UO3 in a reaction not involving oxidation or reduction) become increasingly exothermic with increasing rare earth content, while showing no significant dependence on the varying uranium oxidation state. The oxidation enthalpy of LnxU1-xO2-0.5x+y is similar to that of UO2 to UO3 for all three rare earth doped systems. Though this may suggest that the oxidized uranium in these systems is energetically similar to that in the hexavalent state, thermochemical data alone can not constrain whether the uranium is present as U5+, U6+, or a mixture of oxidation states. The formation enthalpies from elements calculated from the calorimetric data are generally consistent with those from free energy measurements.

Korean American High School Students' Perspectives on U.S. History

Science.gov (United States)

An, Sohyun

2012-01-01

Along with the ever-increasing racial/ethnic diversity in U.S. schools, researchers began to investigate the impact of racial/ethnic identity on young people's understanding of the nation's history. Compared to other racial minorities, Asian American students have received little academic and educational attention. This article seeks to address…

Perspectives on managing nuclear safety at Cernavoda NPP past, present and future

International Nuclear Information System (INIS)

Serban, M.

1997-01-01

The presentation considers the following issues: background of Romanian nuclear programme; 1990 management issues involved in Cernavoda project, nuclear safety perspectives; Cernavoda U1 operating organization today (safety related issues); good practices at Cernavoda NPP

Perspectives on managing nuclear safety at Cernavoda NPP past, present and future

Energy Technology Data Exchange (ETDEWEB)

Serban, M [Technical Safety Directorate, Unit 1., Cernavoda Nuclear Power Plant (Romania)

1997-12-01

The presentation considers the following issues: background of Romanian nuclear programme; 1990 management issues involved in Cernavoda project, nuclear safety perspectives; Cernavoda U1 operating organization today (safety related issues); good practices at Cernavoda NPP.

Solar photovoltaics development. Status and perspectives

Energy Technology Data Exchange (ETDEWEB)

Fenhann, J.

1998-09-01

This is the final report on the status and long-term perspectives for the development of solar photovoltaics, contributing to the Macro Task E1 on production cost for fusion and alternative technologies, part of the programme for Socio-Economic Research on Fusion. After a short introduction about the most promising PV technologies the report concentrates on the present market trends showing that the PV sales has been growing 16% over the last 9 years, 28% over the last 3 years and expanded by 43% last year to a global total of 126.7 MWp 1n 1997. The annual shipment is largest in U.S. with 53 MWp followed by Japan and EU. Until now off-grid installation have dominated the solar PV market, since they are already economically competitive. However, often the financial mechanisms and necessary organisational set-up are missing. At the moment many big PV manufacturers are working to get good successful reference cases in developing countries. But now the on-grid installations in developed countries are beginning to increase. The main growth area in on-grid domestic installations, where there are big programs running in Japan (5000 MWp installed in 2010), U.S. (3000 MWp in 2010) and the Netherlands (1450 MWp in 2020). Looking at the perspectives a continuation of the high growth in solar PV production will continue supported by the United Nations Framework Convention on Climate Change and the Kyoto Protocol. The PV industry has already announced increases in production capacity large enough for a continuation of last year high growth. The report shows status and perspectives for production costs for solar PV until 2050. (au) 13 refs.

Aterosclerosis subclínica y perfil metabólico en mujeres asintomáticas de edad media, con TSH ≥ 2,5 uUI/mL

Directory of Open Access Journals (Sweden)

Rosa M. Pando-Álvarez

2012-04-01

Full Text Available El hipotiroidismo subclínico puede contribuir al desarrollo de patologías cardiovasculares y se ha demostrado que a partir de niveles de TSH >2,5uUI/mL se desarrolla disfunción endotelial. Objetivos: Determinar el grosor de la íntima media carotídea (GIMC, la presencia de placas en carótidas y el perfil metabólico en mujeres de edad media asintomáticas con TSH ≥2,5 uUI/mL y compararlas con aquellas con niveles <2,5 uUI/mL. Diseño: Estudio transversal y analítico. Lugar: Hospital Nacional Dos de Mayo e Instituto de Investigaciones Clínicas, Universidad Nacional Mayor de San Marcos, Lima, Perú. Participantes: Mujeres sin historia de enfermedad tiroidea, cardiovascular o diabetes. Intervenciones: En 60 mujeres sin historia de enfermedad tiroidea, cardiovascular o diabetes, con edad promedio de 53,8 ± 5,8 años, se determinó la tirotropina (TSH, colesterol total (CT, colesterol de densidad alta (HDL, triglicéridos (Tg, glucosa (G basal y a los 120 minutos (TTGO, insulina basal (Ins-B; se calculó las fracciones de colesterol de densidad baja (LDL, el nivel de insulinorresistencia (HOMA-IR, la presión arterial, perímetro de cintura abdominal, el índice de masa corporal (IMC y el GIMC mediante ecoDoppler. Principales medidas de resultados: TSH ≥2,5 uUI/mL, perfil metabólico y su relación con GIMC. Resultados: El 38,3% presentó TSH ≥2,5 y 61,7% TSH <2,5 uUI/mL. El 56% de mujeres con TSH ≥2,5 y 65% con TSH <2,5 uUI/ml fueron hipertensas, sin diferencia estadística. El perfil lipídico, G basal, Ins-B e índice HOMA-IR fueron semejantes en ambos grupos. Se observó niveles significativamente más altos del IMC, G a los 120 minutos, el GIMC en carótida izquierda y el mayor entre ambas carótidas en las mujeres con TSH ≥2,5 uUI/mL (p=0,03, p=0,01, p=0,008 y p=0,02, respectivamente. La presencia de placas en la carótida izquierda y en al menos una de las carótidas fue significativamente más frecuente entre aquellas con

Non-physical bullying: exploring the perspectives of Grade 5 girls

Directory of Open Access Journals (Sweden)

Estelle Swart

2009-08-01

Full Text Available Research into bullying has generated an awareness of many aspects of this phenomenon: it has shown a distinction between various types of bullying and how these are delineated by gender. It has also shown a scarcity of research on bullying amongst girls, a phenomenon which is rife. We report on a qualitative study, which explored and described the nature of bullying amongst girls, in order to make the invisible problem more visible and to make recommendations for intervention and prevention. In this interpretive study we explored bullying amongst girls by using the perspectives of Grade 5 girls in a parochial school in the Western Cape. Data were generated through the use of semistructured group interviews. We argue that there is no single solution to the problem. Each situation seems to require a unique set of rules, a unique understanding. This is supported by the main finding, namely, some girls have innate characteristics that help maintain bullying while others have characteristics that protect them from bullying. The environment also plays a large part in either maintaining bullying or protecting girls from bullying. The implication is that intervention and preventative strategies need to be based on these personal and contextual factors in order to effect change.

Exposure to child and adolescent psychiatry for medical students: are there optimal "teaching perspectives"?

Science.gov (United States)

Hunt, Jeffrey; Barrett, Rowland; Grapentine, W Lex; Liguori, Gina; Trivedi, Harsh K

2008-01-01

The ability to develop quality medical student exposures in child and adolescent psychiatry is critical to the professional development of these future physicians and to the growth of recruitment efforts into the field. This study identifies teaching perspectives among child and adolescent psychiatry faculty to determine whether there are optimal perspectives that positively influence medical student satisfaction. Eighty-eight third- and fourth-year students at an allopathic U.S. medical school assessed teacher performance over a 1-year period using a standard internal teacher evaluation. Three experienced faculty members teaching the medical student seminars each completed a Teaching Perspective Inventory. The authors compared the different teaching perspectives with student satisfaction scores on the standard teacher evaluation instrument. All teachers had two dominant perspectives and one recessive perspective. Each teacher had a predominant developmental perspective but they differed in other dominant and recessive perspectives. The transmission perspective was associated with significantly less favorable scores on the standard teacher evaluation compared to the apprenticeship and nurturing perspective. The authors discuss the value of teaching perspective identification among child and adolescent psychiatry faculty for medical student education.

Cold-Season Tornadoes: Climatological, Meteorological, and Social Perspectives

Science.gov (United States)

Childs, Samuel J.

Tornadoes that occur during the cold season, defined here as November-February (NDJF), pose many unique societal risks. For example, people can be caught off-guard because in general one does not expect severe weather and tornadoes during winter months. The public can also be unsuspecting of significant weather due to the bustle of major holidays like Thanksgiving, Christmas, and New Year's, when most people are concerned with family activities and not thinking about the weather. Cold-season tornadoes also have a propensity to be nocturnal and occur most frequently in the South and Southeastern U.S., where variable terrain, inadequate resources, and a relatively high mobile home density add additional social vulnerabilities. Over the period 1953-2015 within a study domain of (25-42.5°N, 75-100°W), some 937 people lost their lives as a result of NDJF tornadoes. Despite this enhanced societal risk of cold-season tornadoes in the South, very little attention has been given to their meteorological characteristics and climate patterns, and public awareness of their potential impacts is lacking. This thesis aims to greatly advance the current state of knowledge of NDJF tornadoes by providing an in-depth investigation from three different science perspectives. First, a climatology of all (E)F1-(E)F5 NDJF tornadoes is developed, spanning the period 1953-2015 within a domain of (25-42.5°N, 75-100°W), in order to assess frequency and spatial changes over time. A large increasing trend in cold-season tornado occurrence is found across much of the Southeastern U.S., with the greatest uptick in Tennessee, while a decreasing trend is found across eastern Oklahoma. Spectral analysis reveals a cyclic pattern of enhanced NDJF counts every 3-7 years, coincident with the known period for ENSO. Indeed, La Nina episodes are found to be correlated with NDJF tornado counts, although a stronger teleconnection correlation exists with the Arctic Oscillation (AO), which explains 25% of

When experiments go wrong: the U.S. perspective.

Science.gov (United States)

Capron, Alexander M

2004-01-01

The view that once prevailed in the U.S.--that research is no more dangerous than the activities of daily life--no longer holds in light of recent experience. Within the past few years, a number of subjects (including normal volunteers) have been seriously injured or killed in research conducted at prestigious institutions. Plainly, when we are talking about research going wrong, we're talking about something very important. We have seen that experiments can go wrong in several ways. Subjects can be injured--physically, mentally, or by having other interests violated. Investigators can commit fraud in data collection or can abuse subjects. And review mechanisms--such as IRBs--don't always work. The two major issues when research goes wrong in any of these ways are, first: What will be done for subjects who have suffered an injury or other wrong? and second: How will future problems be prevented? The present system in the U.S. is better at the second task than the first one. Part of the difficulty in addressing the first lies in knowing what "caused" an apparent injury. Moreover, since until recently the problem of research-related injuries was thought to be a small one, there was considerable resistance to setting up a non-fault compensation system, for fear that it would lead to payment in many cases where such compensation was not deserved. Now, with a further nudge from the NBAC there is renewed interest in developing a formal system to compensate for research injuries. Finally, I have tried to show that our system of local oversight is only partially effective in improving the design of experiments and the consent process in light of "unexpected (adverse) results." As many observers, including the federal General Accounting Office (GAO), have reported, the requirement for "continuing review" of approved research projects is the weak point in the IRB system. The probable solution would be to more strictly apply the requirement that investigators report back any

Industry perspectives on the U.S. used nuclear fuel management program

International Nuclear Information System (INIS)

Matzie, R.

2001-01-01

The U.S. used nuclear fuel management program is at a critical juncture. It has been 17 years since the U.S. Congress authorized geologic disposal of used nuclear fuel and 12 years since Congress elected to study Yucca Mountain, Nevada, as the nation's lone long-term disposal option. During this period, Yucca Mountain's ability to isolate long-lived radionuclides was the subject of considerable scientific study. Concurrently, specialists expended significant design effort on the engineered barriers that work in conjunction with the proposed repository's natural features to ensure that health protection standards are met. Confidence as to the soundness of the geologic disposal option is high. While technical progress on geologic disposal is substantial, policy level decision-making needed to move the program forward remains lacking. A number of important policy questions concerning used fuel management remain unanswered as this fuel accumulates at 103 operating U.S. commercial nuclear power reactors at 65 sites. Wet fuel storage space at those locations is becoming increasingly scarce. This paper will review both the scientific successes and policy challenges on the road to geologic disposal. It will outline the nation's used nuclear fuel storage needs, highlight what the nation's scientists have learned about geologic disposal, discuss what is being done to meet near-term interim storage requirements, describe the emerging regulatory framework associated with the program and summarize the ongoing policy debate. (author)

Mitochondrial DNA analysis of eneolithic trypillians from Ukraine reveals neolithic farming genetic roots.

Directory of Open Access Journals (Sweden)

Alexey G Nikitin

Full Text Available The agricultural revolution in Eastern Europe began in the Eneolithic with the Cucuteni-Trypillia culture complex. In Ukraine, the Trypillian culture (TC existed for over two millennia (ca. 5,400-2,700 BCE and left a wealth of artifacts. Yet, their burial rituals remain a mystery and to date almost nothing is known about the genetic composition of the TC population. One of the very few TC sites where human remains can be found is a cave called Verteba in western Ukraine. This report presents four partial and four complete mitochondrial genomes from nine TC individuals uncovered in the cave. The results of this analysis, combined with the data from previous reports, indicate that the Trypillian population at Verteba carried, for the most part, a typical Neolithic farmer package of mitochondrial DNA (mtDNA lineages traced to Anatolian farmers and Neolithic farming groups of central Europe. At the same time, the find of two specimens belonging to haplogroup U8b1 at Verteba can be viewed as a connection of TC with the Upper Paleolithic European populations. At the level of mtDNA haplogroup frequencies, the TC population from Verteba demonstrates a close genetic relationship with population groups of the Funnel Beaker/ Trichterbecker cultural complex from central and northern Europe (ca. 3,950-2,500 BCE.

Study of U - Pu - Fe alloys (Masurca critical experiment); Etudes d'alliages U-Pu-Fe (experience critique MASURCA)

Energy Technology Data Exchange (ETDEWEB)

Barthelemy, P; Boucher, R [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

1965-07-01

Three compositions have been studied: 73.5 U - 25 Pu - 1.5 Fe (weight %) 74 U - 25 Pu - 1 Fe 74.5 U - 25 Pu - 0.5 Fe Elaboration and Casting are easy. After two weeks in air 74.5 U - 25 Pu - 0.5 Fe alloys are reduced in powder. As-cast alloys containing 1 and 1,5% Fe are kept undamaged during several months. A rapid oxidisation of the alloys is however observed when the samples undergo the phase transformation (at 595 deg. C and 590 deg. C respectively). Ignition tests in the presence of air show that the oxidisation starts at about 250 deg. C and that the reaction does not spread. Ignition is not observed during heating from 20 to 660 deg. C. The transformation temperature, the melting temperature and the thermal expansion coefficients have been determined by dilatometry. Below the transformation temperature, the principal phases are U-Pu zeta and (U, Pu){sub 6}Fe. Thermal conductibility, Young modulus, density and heat of fusion have been measured. Compatibility tests show that between U-Pu-Fe and stainless steel a phase of (U, Pu){sub 6}Fe type is formed. The 74 U - 25 Pu - 1% Fe alloy seems to behave better than 73.5 U - 25 Pu - 1.5% Fe alloy because the (U, Pu){sub 6}Fe layer is two or three times smaller. Finally, the thermal stability has been studied with the 74 U - 25 Pu - 1% Fe alloy. A dilatometric anomaly (very weak expansion) occurs when the sample is heated above transformation temperature and cooled. But there is no anomaly by thermal cycling from 50 deg. C to 400 deg. C and there is no deterioration of alloys by heat treatments at 100 deg. C, 200 deg. C, 300 deg. C during 5 months under vacuum. (authors) [French] Trois compositions ont ete etudiees: 73,5 U - 25 Pu - 1,5 Fe (% ponderaux) 74 U - 25 Pu - 1 Fe 74,5 U - 25 Pu - 0,5 Fe Les elaborations et mises en forme sont-faciles. Les alliages a 0,5% de fer tombent en poudre apres 15 jours d'exposition a l'air. Les alliages a 1 et 1,5% de fer, bruts de coulee, se conservent plusieurs mois. Cependant

Becoming a uCity: The Case of Chicago

Directory of Open Access Journals (Sweden)

Zorica Nedovic-Budic

Full Text Available ABSTRACT: The concept of a ubiquitous city, or uCity, is gaining attention worldwide. In a uCity, anyone is enabled by information and communication technologies (ICT to do anything, anywhere, at any time. The uCity concept has spread more quickly than its implementation, which relies on a complex set of interrelated technologies, practices, and actors, including but not limited to the provision of ICT infrastructure, the availability and accessibility of information and services, and the adoption of mobile communication devices by a variety of users. To aid in measuring and implementing a uCity, we explore ways to measure the “ubiquity” of a city, with particular attention given to the first “A” above – i.e., “anyone”. Empirical findings from Chicago highlight: 1 ICT access, 2 the connectivity of institutions and individuals, and 3 the ubiquity of virtuality. A socio-technical perspective and social network and social capital theories guide this study. The underlying social and motivational processes are essential to all aspects of becoming a uCity. KEYWORDS: Ubiquitous city, urban planning, community informatics, Chicago

Evaluating U.S. oil security and import reliance

International Nuclear Information System (INIS)

Brown, Stephen P.A.; Huntington, Hillard G.

2015-01-01

We examine the literature that considers the consequences of U.S. reliance on imported oil. We take an approach that covers many ideas about the costs arising from U.S. reliance on imported oil, and we identify which of those ideas have broad support in the economics literature and which ideas have only limited support. We also quantify the costs of U.S. reliance on imported oil using two approaches. One is fairly narrow, conforms to the economics view of externalities, and yields small cost estimates. The other is relatively expansive, is favored by some policy analysts, and yields much larger cost estimates. We estimate these costs as expected U.S. economic losses over a time horizon from 2010 through 2035, while taking into account world oil market conditions, market power, probable oil supply disruptions, and the oil-market response to those supply disruptions. - Highlights: • A variety of perspectives on the consequences of U.S. reliance on imported oil. • Quantify and evaluate the costs of U.S. reliance on oil imports. • Narrower approaches are more consistent with the economic definition of externalities. • Narrower approaches yield recommendations for relatively modest policy. • Expansive approaches favored by some policy analysts support more aggressive policy

Cross-cultural communication capabilities of U.S. military trainers: host nation perspective.

Science.gov (United States)

Mahmood, Maysaa; Alameri, Ali; Jawad, Shakir; Alani, Yasir; Zuerlein, Scott; Nakano, Gregg; Anderson, Warner; Beadling, Charles

2013-06-01

A survey was conducted to assess trainee perception of the cross-cultural communication competency of U.S. military trainers and their satisfaction with the training they received. Findings from the survey show that U.S. military trainers rely significantly on local interpreters. This indicates variability in the ability of the trainers to communicate effectively with host nation partners, the variability being dependent on the capabilities of the individual interpreter. The findings illustrate the importance of providing military health personnel with training on how to work effectively with interpreters. The use of supplementary resources such as electronic translation devises when the interpreter is not capable of conveying health-related training information with the desired level of accuracy is recommended. Expanding the availability of general cultural training, which provides baseline information on local values, traditions, and customs in addition to health-specific cultural orientation, is also recommended to help military health trainers customize their training content and methods to fit the local environment. Reprint & Copyright © 2013 Association of Military Surgeons of the U.S.

78 FR 78838 - Grant of Interim Extension of the Term of U.S. Patent No. 5,496,801; Recombinant Human...

Science.gov (United States)

2013-12-27

...] Grant of Interim Extension of the Term of U.S. Patent No. 5,496,801; Recombinant Human Parathyroid...,801. FOR FURTHER INFORMATION CONTACT: Mary C. Till by telephone at (571) 272-7755; by mail marked to... No. 5,496,801. The patent claims the human biological product recombinant human parathyroid hormone...

The Future of Drought in the Southeastern U.S.: Projections from downscaled CMIP5 models

Science.gov (United States)

Keellings, D.; Engstrom, J.

2017-12-01

The Southeastern U.S. has been repeatedly impacted by severe droughts that have affected the environment and economy of the region. In this study the ability of 32 downscaled CMIP5 models, bias corrected using localized constructed analogs (LOCA), to simulate historical observations of dry spells from 1950-2005 are assessed using Perkins skill scores and significance tests. The models generally simulate the distribution of dry days well but there are significant differences between the ability of the best and worst performing models, particularly when it comes to the upper tail of the distribution. The best and worst performing models are then projected through 2099, using RCP 4.5 and 8.5, and estimates of 20 year return periods are compared. Only the higher skill models provide a good estimate of extreme dry spell lengths with simulations of 20 year return values within ± 5 days of observed values across the region. Projected return values differ by model grouping, but all models exhibit significant increases.

Locating the uracil-5-yl radical formed upon photoirradiation of 5-bromouracil-substituted DNA

Science.gov (United States)

Hashiya, Fumitaka; Saha, Abhijit; Kizaki, Seiichiro; Li, Yue; Sugiyama, Hiroshi

2014-01-01

In a previous study, we found that 2-deoxyribonolactone is effectively generated in the specific 5-bromouracil (BrU)-substituted sequence 5′-(G/C)[A]n = 1,2BrUBrU-3′ and proposed that a formed uracil-5-yl radical mainly abstracts the C1′ hydrogen from the 5′-side of BrUBrU under 302-nm irradiation condition. In the present work, we performed photoirradiation of BrU-substituted DNA in the presence of a hydrogen donor, tetrahydrofuran, to quench the uracil-5-yl radical to uracil and then subjected the sample to uracil DNA glycosylase digestion. Slab gel sequence analysis indicated that uracil residues were formed at the hot-spot sequence of 5′-(G/C)[A]n = 1,2BrUBrU-3′ in 302-nm irradiation of BrU-substituted DNA. Furthermore, we found that the uracil residue was also formed at the reverse sequence 5′-BrUBrU[A]n = 1,2(G/C)-3′, which suggests that both 5′-(G/C)[A]n = 1,2BrUBrU-3′ and 5′-BrUBrU[A]n = 1,2(G/C)-3′ are hot-spot sequences for the formation of the uracil-5-yl radical. PMID:25398904

Crystal-field analysis of U3+ ions in K2LaX5 (X=Cl, Br or I) single crystals

Science.gov (United States)

Karbowiak, M.; Edelstein, N.; Gajek, Z.; Drożdżyński, J.

1998-11-01

An analysis of low temperature absorption spectra of U3+ ions doped in K2LaX5 (X=Cl, Br or I) single crystals is reported. The energy levels of the U3+ ion in the single crystals were assigned and fitted to a semiempirical Hamiltonian representing the combined atomic and crystal-field interactions at the Cs symmetry site. An analysis of the nephelauxetic effect and crystal-field splittings in the series of compounds is also reported.

The Structure of the RNA m5C Methyltransferase YebU from Escherichia coli Reveals a C-terminal RNA-recruiting PUA Domain

DEFF Research Database (Denmark)

Hallberg, B. Martin; Ericsson, Ulrika B.; Johnson, Kenneth A

2006-01-01

potential that differ from other RNA-MTase structures, suggesting that YebU interacts with its RNA target in a different manner. Docking of YebU onto the 30 S subunit indicates that the PUA and MTase domains make several contacts with 16 S rRNA as well as with the ribosomal protein S12. The ribosomal...... protein interactions would explain why the assembled 30 S subunit, and not naked 16 S rRNA, is the preferred substrate for YebU....... by X-ray crystallography, and we present a molecular model for how YebU specifically recognizes, binds and methylates its ribosomal substrate. The YebU protein has an N-terminal SAM-binding catalytic domain with structural similarity to the equivalent domains in several other m(5)C RNA MTases including...

Modeling and measurement of the ALS U5 undulator end magnetic structures

International Nuclear Information System (INIS)

Humphries, D.; Halbach, K.; Hoyer, E.; Kincaid, B.; Marks, S.; Schlueter, R.

1993-05-01

The end structures for the ALS U5.0 undulators utilize a system of dual permanent magnet rotors intended to establish gap independent field performance. They may also be used for tuning of the first and second magnetic field integrals of these devices. The behavior of these structures has been studied by means of a two dimensional modeling with the POISSON Group of computer codes. A parametric study of the magnetic field distribution and first and second integrals of the fields has been conducted. In parallel, magnetic measurements of the final completed structures have been performed using an automated Hall probe measurement system. Results of the modeling and measurements are compared. Implications for tuning of the ends of the devices within the context of the electron beam parameters of the ALS are discussed

Calculation of the top quark mass in the flipped SU(5)xU(1) superstring model

Energy Technology Data Exchange (ETDEWEB)

Leontaris, G.K.; Rizos, J.; Tamvakis, K. (Ioannina Univ. (Greece). Dept. of Physics)

1990-11-08

We present a complete renormalization group calculation of the top-quark mass in the SU(5)xU(1) superstring model. We solve the coupled renormalization group equations for the gauge and Yukawa couplings in the two-loop approximation and obtain the top-quark mass as a function of two parameters of the model which could be chosen to be ratios of singlet VEVs associated with the surplus (U(1)){sup 4} breaking. We obtain a heavy top-quark with 150 GeV{le}m{sub t}<200 GeV, for most part of the parameter space, while lower values are possible only in a very small extremal region. We also compute the allowed range of unification parameters (M{sub x}, sin{sup 2}{theta}{sub w}, {alpha}{sub 3}(M{sub W})) in the presence of a heavy top-quark. (orig.).

Unexpected covalency from actinide 5f orbital interactions (An = Th, U, Np, Pu) determined from chlorine K-edge X-ray absorption spectroscopy and electronic structure theory

International Nuclear Information System (INIS)

Clark, D.L.; Batista, E.R.; Boland, K.S.

2010-01-01

We have employed Cl K-edge XAS and multiple levels of sophisticated electronic structure calculations on a series of simple octahedral light actinide (Th, U, Np, Pu) chloride salts, AnCl 6 n- in order to assess the relative roles of the valence 5f and 6d orbitals in chemical bonding. Chlorine K-edge X-ray absorption spectroscopy on AnCl 6 n- (An = Th, U, Np, Pu) systems indicates the presence of covalent interactions between both Cl 3p and An 5f and 6d orbitals, with the relative contributions changing across the series. Electronic structure calculations indicate the predominant covalent interactions are expected to occur through An-Cl bonding via t 1u and t 2u interactions with the An 5f orbitals, and through t 2g and e g interactions with An 6d orbitals. For the Cl K-edge data therefore, we expect bound state transitions from Cl 1s → e g (σ), t 2g (π), and t 1u (σ + π) orbitals. Qualitatively, the Cl K-edge data fulfills these expectations

Turning the Kaleidoscope: Five Perspectives on Procurement

DEFF Research Database (Denmark)

Munkgaard Møller, Morten; Vammen, Søren

Purpose of this paper The purpose of the paper is to provide a conceptual foundation to enhance the body of knowledge related to procurement and sourcing through a framework consisting of five perspectives. The perspectives are: (1) Strategic, (2) Organizational, (3) Capability, (4) Supplier......, and a (5) Customer Perspectives. The aim is to develop a holistic perspective of procurement by applying these five essential, but very different perspectives in order to achieve a holistic picture of the function. Design/methodology/approach The foundation is derived from various well-established theories...... within the five perspectives. Specifically, procurement was viewed from the perspective of organizational theory, network theory, resource/knowledge based views of the firm, transaction cost theory and various theories within the strategic field of research Findings By viewing procurement through...

Balinese Y-chromosome perspective on the peopling of Indonesia: genetic contributions from pre-neolithic hunter-gatherers, Austronesian farmers, and Indian traders.

Science.gov (United States)

Karafet, Tatiana M; Lansing, J S; Redd, Alan J; Reznikova, Svetlana; Watkins, Joseph C; Surata, S P K; Arthawiguna, W A; Mayer, Laura; Bamshad, Michael; Jorde, Lynn B; Hammer, Michael F

2005-02-01

The island of Bali lies near the center of the southern chain of islands in the Indonesian archipelago, which served as a stepping-stone for early migrations of hunter-gatherers to Melanesia and Australia and for more recent migrations of Austronesian farmers from mainland Southeast Asia to the Pacific. Bali is the only Indonesian island with a population that currently practices the Hindu religion and preserves various other Indian cultural, linguistic, and artistic traditions (Lansing 1983). Here, we examine genetic variation on the Y chromosomes of 551 Balinese men to investigate the relative contributions of Austronesian farmers and pre-Neolithic hunter-gatherers to the contemporary Balinese paternal gene pool and to test the hypothesis of recent paternal gene flow from the Indian subcontinent. Seventy-one Y-chromosome binary polymorphisms (single nucleotide polymorphisms, SNPs) and 10 Y-chromosome-linked short tandem repeats (STRs) were genotyped on a sample of 1,989 Y chromosomes from 20 populations representing Indonesia (including Bali), southern China, Southeast Asia, South Asia, the Near East, and Oceania. SNP genotyping revealed 22 Balinese lineages, 3 of which (O-M95, O-M119, and O-M122) account for nearly 83.7% of Balinese Y chromosomes. Phylogeographic analyses suggest that all three major Y-chromosome haplogroups migrated to Bali with the arrival of Austronesian speakers; however, STR diversity patterns associated with these haplogroups are complex and may be explained by multiple waves of Austronesian expansion to Indonesia by different routes. Approximately 2.2% of contemporary Balinese Y chromosomes (i.e., K-M9*, K-M230, and M lineages) may represent the pre-Neolithic component of the Indonesian paternal gene pool. In contrast, eight other haplogroups (e.g., within H, J, L, and R), making up approximately 12% of the Balinese paternal gene pool, appear to have migrated to Bali from India. These results indicate that the Austronesian expansion had a

Real, Regulated and Relative Poverty in the U.S.-Mexico Borderlands.

Science.gov (United States)

Stoddard, Ellwyn R.

The essay explores the extent to which poverty exists among the residents of the U.S.-Mexico Borderlands. The sequence followed in this analysis is an initial clarification of some conceptual perspectives surrounding the problem followed by a survey of current economic conditions and growth potential for the Borderlands region. Following a brief…

Evaluation of the electrochemical behavior of U2.5Zr7.5Nb and U3Zr9Nb uranium alloys in relation to the pH and the solution aeration

International Nuclear Information System (INIS)

Mansur, Fabio Abud; Santos, Ana Maria Matildes dos; Ferraz, Wilmar Barbosa; Figueiredo, Celia de Araujo

2011-01-01

The Centro de Desenvolvimento da Tecnologia Nuclear (CDTN) is developing, in cooperation with the Centro Tecnologico da Marinha (CTMSP), the advanced nuclear plate type fuel for the second core of the land-based reactor prototype of the Laboratorio de Geracao Nucleo-Eletrica (LABGENE). Recent investigations have shown that the fuel made of uranium-based niobium and zirconium alloys reaches the best performance relative to other fuels, e.g. UO 2 . Niobium and Zirconium also increase the corrosion resistance and the mechanical strength of the uranium alloys. By means of electrochemical techniques the corrosion behavior of alloys U 2 . 5 Zr 7.5 Nb and U 3 Zr 9 Nb, developed at CDTN and heat treated in the temperature range of 200 deg C to 600 deg C, was assessed. The effect of the parameters pH and solution aeration was studied as well as the influence of zirconium and niobium alloying elements in the corrosion of uranium. The techniques used were open circuit potential, electrochemical impedance and potentiodynamic anodic polarization at room temperature. The tests were performed in a three-electrode electrochemical cell with Ag/AgCl (3M KCl) as the reference electrode and a platinum plate as the auxiliary electrode. The potentiodynamic polarization curves of uranium and its alloys in acidic solutions showed regions with anodic currents limited by a passive film. The presence of niobium and zirconium contributed for the formation of this film. The impedance data showed the presence of two semicircles in the Bode diagram, indicating the occurrence of two distinct electrochemical processes. The data were fitted to an equivalent circuit model in order to obtain parameters of the electrochemical processes and evaluate the effect of the studied variables. (author)

78 FR 32241 - U.S. Air Force Seeks Industry Input for National Security Space Launch Assessment

Science.gov (United States)

2013-05-29

..., seeks industry views and perspectives to inform an on-going strategic National Security Space Launch... the U.S. Government. 2. What are the critical issues that concern current and prospective launch...

The reduction of summer sulfate and switch from summer to winter PM2.5 concentration maxima in the U.S.

Data.gov (United States)

U.S. Environmental Protection Agency — These four files each contain 24-hour PM2.5 concentrations collected between 2000-2015. This dataset is associated with the following publication: Chan, E., B....

The flavoprotein Mcap0476 (RlmFO) catalyzes m5U1939 modification in Mycoplasma capricolum 23S rRNA

DEFF Research Database (Denmark)

Lartigue, Carole; Lebaudy, Anne; Blanchard, Alain

2014-01-01

Efficient protein synthesis in all organisms requires the post-transcriptional methylation of specific ribosomal ribonucleic acid (rRNA) and transfer RNA (tRNA) nucleotides. The methylation reactions are almost invariably catalyzed by enzymes that use S-adenosylmethionine (AdoMet) as the methyl g...... specifically modifies m5U1939 in 23S rRNA, a conserved methylation catalyzed by AdoMet-dependent enzymes in all other characterized bacteria. The Mcap0476 methyltransferase (renamed RlmFO) represents the first folate-dependent flavoprotein seen to modify ribosomal RNA.......Efficient protein synthesis in all organisms requires the post-transcriptional methylation of specific ribosomal ribonucleic acid (rRNA) and transfer RNA (tRNA) nucleotides. The methylation reactions are almost invariably catalyzed by enzymes that use S-adenosylmethionine (AdoMet) as the methyl...... group donor. One noteworthy exception is seen in some bacteria, where the conserved tRNA methylation at m5U54 is added by the enzyme TrmFO using flavin adenine dinucleotide together with N5,N10-methylenetetrahydrofolate as the one-carbon donor. The minimalist bacterium Mycoplasma capricolum possesses...

38 CFR 8.16 - Conversion of a 5-year level premium term policy as provided for under § 1904 of title 38 U.S.C.

Science.gov (United States)

2010-07-01

... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Conversion of a 5-year level premium term policy as provided for under § 1904 of title 38 U.S.C. 8.16 Section 8.16 Pensions... Plan § 8.16 Conversion of a 5-year level premium term policy as provided for under § 1904 of title 38 U...

Through the Looking Glass: Realizing the Benefits of an International and Comparative Perspective on Teaching Public Affairs.

Science.gov (United States)

Klingner, Donald E.; Washington, Charles W.

2000-01-01

Discusses reasons why public administrators in the United States; tend to have a parochial U.S.-centered view of the public affairs discipline and the associated negative effects such views have on U.S. public affairs. Proposes an agenda for strengthening the development of an international and comparative perspective in teaching public affairs…

Interdiffusion between U(Mo,Pt) or U(Mo,Zr) and Al or Al A356 alloy

International Nuclear Information System (INIS)

Komar Varela, C.; Mirandou, M.; Arico, S.; Balart, S.; Gribaudo, L.

2009-01-01

Solid state reactions in chemical diffusion couples U-7 wt.%Mo-0.9 wt.%Pt/Al at 580 deg. C and U-7 wt.%Mo-0.9 wt.%Pt/Al A356 alloy, U-7 wt.%Mo-1 wt.%Zr/Al and U-7 wt.%Mo-1 wt.%Zr/Al A356 alloy at 550 deg. C were characterized. Results were obtained from optical and scanning electron microscopy, electron probe microanalysis and X-ray diffraction. The UAl 3, UAl 4 and Al 20 Mo 2 U phases were identified in the interaction layers of γU(Mo,Pt)/Al and γU(Mo,Zr)/Al diffusion couples. Al 43 Mo 4 U 6 ternary compound was also identified in γU(Mo,Zr)/Al due to the decomposition of γU(Mo,Zr) phase. The U(Al,Si) 3 and U 3 Si 5 phases were identified in the interaction layers of γU(Mo,Pt)/Al A356 and γU(Mo,Zr)/Al A356 diffusion couples. These phases are formed due to the migration of Si to the interaction layer. In the diffusion couple U(Mo,Zr)/Al A356, Zr 5 Al 3 phase was also identified in the interaction layer. The use of synchrotron radiation at Brazilian Synchrotron Light Laboratory (LNLS, CNPq, Campinas, Brazil) was necessary to achieve a complete crystallographic characterization.

3.5 keV X-ray line signal from dark matter decay in local U(1){sub B−L} extension of Zee-Babu model

Energy Technology Data Exchange (ETDEWEB)

Baek, Seungwon [School of Physics and Open KIAS Center, KIAS,85 Hoegiro Dongdaemun-gu, Seoul 130-722 (Korea, Republic of)

2015-08-06

We consider a local U(1){sub B−L} extension of Zee-Babu model to explain the recently observed 3.5 keV X-ray line signal. The model has three Standard model (SM)-singlet Dirac fermions with different U(1){sub B−L} charges. A complex scalar field charged under U(1){sub B−L} is introduced to break the U(1){sub B−L} symmetry. After U(1){sub B−L} symmetry breaking a remnant discrete symmetry stabilizes the lightest state of the Dirac fermions, which can be a stable dark matter (DM). The second lightest state, if mass splitting with the stable DM is about 3.5 keV, decays dominantly to the stable DM and 3.5 keV photon through two-loop diagrams, explaining the X-ray line signal. Two-loop suppression of the decay amplitude makes its lifetime much longer than the age of the universe and it can be a decaying DM candidate in large parameter region. We also introduce a real scalar field which is singlet under both the SM and U(1){sub B−L} and can explain the current relic abundance of the Dirac fermionic DMs. If the mixing with the SM Higgs boson is small, it does not contribute to DM direct detection. The main contribution to the scattering of DM off atomic nuclei comes from the exchange of U(1){sub B−L} gauge boson, Z{sup ′}, and is suppressed below current experimental bound when Z{sup ′} mass is heavy (≳10 TeV). If the singlet scalar mass is about 0.1–10 MeV, DM self-interaction can be large enough to solve small scale structure problems in simulations with the cold DM, such as, the core-vs-cusp problem and too-big-to-fail problem.

Combined hybrid functional and DFT+U calculations for metal chalcogenides

Energy Technology Data Exchange (ETDEWEB)

Aras, Mehmet; Kılıç, Çetin, E-mail: cetin-kilic@gyte.edu.tr [Department of Physics, Gebze Institute of Technology, Gebze, Kocaeli 41400 (Turkey)

2014-07-28

In the density-functional studies of materials with localized electronic states, the local/semilocal exchange-correlation functionals are often either combined with a Hubbard parameter U as in the LDA+U method or mixed with a fraction of exactly computed (Fock) exchange energy yielding a hybrid functional. Although some inaccuracies of the semilocal density approximations are thus fixed to a certain extent, the improvements are not sufficient to make the predictions agree with the experimental data. Here, we put forward the perspective that the hybrid functional scheme and the LDA+U method should be treated as complementary, and propose to combine the range-separated Heyd-Scuseria-Ernzerhof (HSE) hybrid functional with the Hubbard U. We thus present a variety of HSE+U calculations for a set of II-VI semiconductors, consisting of zinc and cadmium monochalcogenides, along with comparison to the experimental data. Our findings imply that an optimal value U{sup *} of the Hubbard parameter could be determined, which ensures that the HSE+U{sup *} calculation reproduces the experimental band gap. It is shown that an improved description not only of the electronic structure but also of the crystal structure and energetics is obtained by adding the U{sup *} term to the HSE functional, proving the utility of HSE+U{sup *} approach in modeling semiconductors with localized electronic states.

The U5.0 Undulator for the Advanced Light Source

International Nuclear Information System (INIS)

Hoyer, E.; Chin, J.; Halbach, K.; Hassenzahl, W.V.; Humphries, D.; Kincaid, B.; Lancaster, H.; Plate, D.

1992-01-01

The U5.0 Undulator, an 89 period, 5 cm period length, 4.6 m long insertion device has been designed, is being fabricated, and is scheduled for completion in early 1992. This undulator will be the first high brightness source, in the 50 to 1,500 eV range, for the Advanced Light Source at the Lawrence Berkeley Laboratory. A hybrid magnetic configuration using Nd--Fe--B permanent magnet material and vanadium permendur poles has been selected to achieve the field quality needed to meet performance requirements. The magnetic structure is modular with each half consisting of five assembly sections, which provide the periodic structure, and end structures, for entrance and exit correction, mounted on a steel backing beam. Each assembly section consists of 35 half-period pole assemblies bolted to a mount. The required 0.837 T effective peak field at a 1.4 cm gap has been verified with model measurements. Vertical field integral correction is accomplished with the end structures, each having an arrangement of permanent magnet rotors which will be adjusted to minimize electron beam missteering over the undulator operating field range. To reduce the effect of environmental fields, the steel backing beams are connected through parallel, low-reluctance, Ni--Fe hinges. The magnetic structure is connected through four rollernuts to the drive system that provides gap adjustment with an arrangement of roller screws, chain drives, a gear reduction unit, and a stepper motor driven by a closed loop control system. Magnetic structure and drive system support are from a 2.4 m high structure which includes a support base with four vertical supports. The vacuum chamber design is a two-piece machined and welded 5083-H321 aluminum construction of 5.1 m length. Pumping is with a combination of ion, titanium sublimation pump and nonevaporable getter pumps. Magnetic design, subsystem design, and fabrication progress are presented

Multidisciplinary Perspectives towards the Education of Young Low-Income Immigrant Children

Science.gov (United States)

Isik-Ercan, Zeynep; Demir-Dagdas, Tuba; Cakmakci, Huzeyfe; Cava-Tadik, Yasemin; Intepe-Tingir, Seyma

2017-01-01

This paper examines the issues surrounding low-income immigrants in the U.S. and the ways they shape the educational experiences of their young children. Using a multidisciplinary lens including sociology, family studies, education, and mental health, the authors analyse multiple perspectives towards the educational experiences of children in…

Study of U - Pu - Fe alloys (Masurca critical experiment)

International Nuclear Information System (INIS)

Barthelemy, P.; Boucher, R.

1965-01-01

Three compositions have been studied: 73.5 U - 25 Pu - 1.5 Fe (weight %) 74 U - 25 Pu - 1 Fe 74.5 U - 25 Pu - 0.5 Fe Elaboration and Casting are easy. After two weeks in air 74.5 U - 25 Pu - 0.5 Fe alloys are reduced in powder. As-cast alloys containing 1 and 1,5% Fe are kept undamaged during several months. A rapid oxidisation of the alloys is however observed when the samples undergo the phase transformation (at 595 deg. C and 590 deg. C respectively). Ignition tests in the presence of air show that the oxidisation starts at about 250 deg. C and that the reaction does not spread. Ignition is not observed during heating from 20 to 660 deg. C. The transformation temperature, the melting temperature and the thermal expansion coefficients have been determined by dilatometry. Below the transformation temperature, the principal phases are U-Pu zeta and (U, Pu) 6 Fe. Thermal conductibility, Young modulus, density and heat of fusion have been measured. Compatibility tests show that between U-Pu-Fe and stainless steel a phase of (U, Pu) 6 Fe type is formed. The 74 U - 25 Pu - 1% Fe alloy seems to behave better than 73.5 U - 25 Pu - 1.5% Fe alloy because the (U, Pu) 6 Fe layer is two or three times smaller. Finally, the thermal stability has been studied with the 74 U - 25 Pu - 1% Fe alloy. A dilatometric anomaly (very weak expansion) occurs when the sample is heated above transformation temperature and cooled. But there is no anomaly by thermal cycling from 50 deg. C to 400 deg. C and there is no deterioration of alloys by heat treatments at 100 deg. C, 200 deg. C, 300 deg. C during 5 months under vacuum. (authors) [fr

Australian and U.S. news media portrayal of sharks and their conservation.

Science.gov (United States)

Muter, Bret A; Gore, Meredith L; Gledhill, Katie S; Lamont, Christopher; Huveneers, Charlie

2013-02-01

Investigation of the social framing of human-shark interactions may provide useful strategies for integrating social, biological, and ecological knowledge into national and international policy discussions about shark conservation. One way to investigate social opinion and forces related to sharks and their conservation is through the media's coverage of sharks. We conducted a content analysis of 300 shark-related articles published in 20 major Australian and U.S. newspapers from 2000 to 2010. Shark attacks were the emphasis of over half the articles analyzed, and shark conservation was the primary topic of 11% of articles. Significantly more Australian articles than U.S. articles treated shark attacks (χ(2) = 3.862; Australian 58% vs. U.S. 47%) and shark conservation issues (χ(2) = 6.856; Australian 15% vs. U.S. 11%) as the primary article topic and used politicians as the primary risk messenger (i.e., primary person or authority sourced in the article) (χ(2) = 7.493; Australian 8% vs. U.S. 1%). However, significantly more U.S. articles than Australian articles discussed sharks as entertainment (e.g., subjects in movies, books, and television; χ(2) = 15.130; U.S. 6% vs. Australian 1%) and used scientists as the primary risk messenger (χ(2) = 5.333; U.S. 25% vs. Australian 15%). Despite evidence that many shark species are at risk of extinction, we found that most media coverage emphasized the risks sharks pose to people. To the extent that media reflects social opinion, our results highlight problems for shark conservation. We suggest that conservation professionals purposefully and frequently engage with the media to highlight the rarity of shark attacks, discuss preventative measures water users can take to reduce their vulnerability to shark encounters, and discuss conservation issues related to local and threatened species of sharks. When integrated with biological and ecological data, social-science data may help generate a more comprehensive perspective

Tank 241-U-102, Grab Samples 2U-99-1, 2U-99-2 and 2U-99-3 Analytical Results for the Final Report

International Nuclear Information System (INIS)

STEEN, F.H.

1999-01-01

This document is the final report for tank 241-U-102 grab samples. Five grab samples were collected from riser 13 on May 26, 1999 and received by the 222-S laboratory on May 26 and May 27, 1999. Samples 2U-99-3 and 2U-99-4 were submitted to the Process Chemistry Laboratory for special studies. Samples 2U-99-1, 2U-99-2 and 2U-99-5 were submitted to the laboratory for analyses. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan for Fiscal year 1999 (TSAP) (Sasaki, 1999) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Fowler 1995, Mulkey and Miller 1998). The analytical results are presented in the data summary report. None of the subsamples submitted for differential scanning calorimetry (DSC), total organic carbon (TOC) and plutonium 239 (Pu239) analyses exceeded the notification limits as stated in TSAP

A high performance Ge/Si0.5Ge0.5/Si heterojunction dual sources tunneling transistor with a U-shaped channel

Science.gov (United States)

Li, Wei; Liu, Hongxia; Wang, Shulong; Wang, Qianqiong; Chen, Shupeng

2017-06-01

In this paper, a new Ge/Si0.5Ge0.5/Si heterojunction dual sources tunneling transistor with a U-shaped channel (Ge_DUTFET) is proposed and investigated by Silvaco-Atlas simulation. The line tunneling perpendicular to channel and point tunneling parallel to channel simultaneously occur on both sides of the gate. The Ge is chosen as the source region material to increase the line tunneling current. The designed heterojunction between the Ge source and Si channel decreases the point tunneling barrier width to enhance the point tunneling current. And this heterojunction can also promote the Ge_DUTFET to occur point tunneling at the small gate voltage, which makes it obtain the smaller turn-on voltage. Furthermore, the Si0.5Ge0.5 buffer layer is also helpful for the enhancement of performance. The simulation results reveal that Ge_DUTFET has the better performance compared with the Si_DUTFET. The on-state current and average subthreshold swing of Ge_DUTFET are 1.11 × 10-5A/μm and 35.1mV/dec respectively. The max cut-off frequency (fT) and gain bandwidth product (GBW) are 26.6 GHz and 16.6 GHz respectively. The fT and GBW of the Ge_DUTFET are respectively increased by ∼27.4% and ∼84.3% compared with the Si_DUTFET.

An Analysis of the U.S. Wood Products Import Sector: Prospects for Tropical Wood Products Exporters

Directory of Open Access Journals (Sweden)

W.A.R.T.W. Bandara

2012-10-01

Full Text Available The U.S. has dramatically altered its wood product imports and exports during the past few years,and at present, it is the second largest wood product importer in the world. Hence, an understanding ofmarket structures, factors in selecting foreign suppliers, and the emphasis placed on environmentalissues/certification are critical to understand from the perspective of wood products importers in the U.S.This study provides an analysis of the U.S. wood products import sector with special emphasis on currentand future opportunities for tropical wood products exporters to the U.S. market.In this study, 158 wood products importers in the U.S. were surveyed using a mailingquestionnaire. The adjusted response rate was 40.6 percent. Results indicated that most of the respondentswere small to medium scale firms, but major importers of wood products. According to respondents,wood products to the U.S. mainly come from Brazil, Chile, and China. From the importers’ perspective,Brazilian wood products ranked first for its quality followed by wood products from Chile and Finland.Product quality, long term customer relationships, on-time delivery of orders, fair prices, and supplierreputation were the factors deemed important in selecting overseas suppliers. Majority of respondentswere importing certified wood products. FSC, SFI, and ISO 14000 were the mostly accepted certificationprograms. However, certification was not a major factor in foreign supplier selection criteria. Whenconsidered the U.S. wood products importers’ tendency to diversify their products and species imported,attractive opportunities exist for wood products suppliers from tropical countries.

Revised Late Oligocene to Early Miocene magnetic stratigraphy recorded by drift sediments at Sites U1405 and U1406, IODP Expedition 342 (Newfoundland, NW Atlantic)

Science.gov (United States)

van Peer, Tim; Xuan, Chuang; Wilson, Paul; Liebrand, Diederik; Lippert, Peter

2015-04-01

The nannofossil oozes drilled at IODP Expedition 342 (Paleogene Newfoundland Sediment Drifts) Sites U1405 and U1406 provide an exceptional sedimentary archive of the Late Oligocene to Early Miocene due to high sedimentation rates (2-6 cm/kyr at U1406 and up to 20 cm/kyr at U1405) and their ideal location below the Deep Western Boundary Current. These drift sediment sequences provide a unique opportunity to study the Oligocene-Miocene Transition (OMT) and Mi1-event (a transient 1‰ positive oxygen isotope excursion) at an unprecedented resolution from a Northern Hemisphere perspective. The exact timing of the OMT and its rate of change require a reliable and high-resolution magnetic stratigraphic age control, as Chron C6Cn with its three subchrons roughly spans the Mi1 event and the reversal C6Cn.2n/C6Cn.2r defines the Oligocene-Miocene boundary. Natural Remanent Magnetisation (NRM) was measured on 140 m of u-channel samples at U1405 and 190 m at U1406. The u-channel sample based magnetostratigraphy is in good agreement with that based on the shipboard data and reveal distinctive well-defined patterns of normal and reversed polarities, which can be correlated to the Geomagnetic Polarity Time Scale between C6Bn.2n and C9n (ca. 22.2 to 27 Ma) at U1406 and between C6Bn.2n and C6Cr (ca. 22.2 to 23.5 Ma) at U1405. Furthermore, putative cryptochrons in Chron C6Br and C7Ar, previously reported at Site U1334 (IODP Expedition 320), are observed in the u-channel magnetic stratigraphy for Sites U1405 and U1406. Anhysteretic Remanent Magnetisation (ARM) intensity variations are combined with X-Ray Fluorescence (XRF) generated elemental measurements to refine the shipboard splice of both U1405 and U1406. Latest Oligocene to earliest Miocene splice refinements are complicated by the presence of large-scale stratigraphic gaps (up to 25 m at U1405) unrelated to drilling disturbances. The depth and estimated age of these stratigraphic gaps vary from hole to hole, and do not appear

Stimulation of Pol III-dependent 5S rRNA and U6 snRNA gene expression by AP-1 transcription factors.

Science.gov (United States)

Ahuja, Richa; Kumar, Vijay

2017-07-01

RNA polymerase III transcribes structurally diverse group of essential noncoding RNAs including 5S ribosomal RNA (5SrRNA) and U6 snRNA. These noncoding RNAs are involved in RNA processing and ribosome biogenesis, thus, coupling Pol III activity to the rate of protein synthesis, cell growth, and proliferation. Even though a few Pol II-associated transcription factors have been reported to participate in Pol III-dependent transcription, its activation by activator protein 1 (AP-1) factors, c-Fos and c-Jun, has remained unexplored. Here, we show that c-Fos and c-Jun bind to specific sites in the regulatory regions of 5S rRNA (type I) and U6 snRNA (type III) gene promoters and stimulate their transcription. Our chromatin immunoprecipitation studies suggested that endogenous AP-1 factors bind to their cognate promoter elements during the G1/S transition of cell cycle apparently synchronous with Pol III transcriptional activity. Furthermore, the interaction of c-Jun with histone acetyltransferase p300 promoted the recruitment of p300/CBP complex on the promoters and facilitated the occupancy of Pol III transcriptional machinery via histone acetylation and chromatin remodeling. The findings of our study, together, suggest that AP-1 factors are novel regulators of Pol III-driven 5S rRNA and U6 snRNA expression with a potential role in cell proliferation. © 2017 Federation of European Biochemical Societies.

Strikingly different penetrance of LHON in two Chinese families with primary mutation G11778A is independent of mtDNA haplogroup background and secondary mutation G13708A

International Nuclear Information System (INIS)

Wang Huawei; Jia Xiaoyun; Ji Yanli; Kong Qingpeng; Zhang Qingjiong; Yao Yonggang; Zhang Yaping

2008-01-01

The penetrance of Leber's hereditary optic neuropathy (LHON) in families with primary mitochondrial DNA (mtDNA) mutations is very complex. Matrilineal and nuclear genetic background, as well as environmental factors, have been reported to be involved in different affected pedigrees. Here we describe two large Chinese families that show a striking difference in the penetrance of LHON, in which 53.3% and 15.0% of members were affected (P < 0.02), respectively. Analysis of the complete mtDNA genome of the two families revealed the presence of the primary mutation G11778A and several other variants suggesting the same haplogroup status G2a. The family with higher penetrance contained a previously described secondary mutation G13708A, which presents a polymorphism in normal Chinese samples and does not affect in vivo mitochondrial oxidative metabolism as described in a previous study. Evolutionary analysis failed to indicate any putatively pathogenic mutation that cosegregated with G11778A in these two pedigrees. Our results suggest that the variable penetrance of LHON in the two Chinese families is independent of both their mtDNA haplotype background and a secondary mutation G13708A. As a result, it is likely that unknown nuclear gene involvement and/or other factors contribute to the strikingly different penetrance of LHON

Genetic association study of common mitochondrial variants on body fat mass.

Directory of Open Access Journals (Sweden)

Tie-Lin Yang

Full Text Available Mitochondria play a central role in ATP production and energy metabolism. Previous studies suggest that common variants in mtDNA are associated with several common complex diseases, including obesity. To test the hypothesis that common mtDNA variants influence obesity-related phenotypes, including BMI and body fat mass, we genotyped a total of 445 mtSNPs across the whole mitochondrial genome in a large sample of 2,286 unrelated Caucasian subjects. 72 of these 445 mtSNPs passed quality control criteria, and were used for subsequent analyses. We also classified all subjects into nine common European haplogroups. Association analyses were conducted for both BMI and body fat mass with single mtSNPs and mtDNA haplogroups. Two mtSNPs, mt4823 and mt8873 were detected to be significantly associated with body fat mass, with adjusted P values of 4.94 × 10⁻³ and 4.58 × 10⁻², respectively. The minor alleles mt4823 C and mt8873 A were associated with reduced fat mass values and the effect size (β was estimated to be 3.52 and 3.18, respectively. These two mtSNPs also achieved nominally significant levels for association with BMI. For haplogroup analyses, we found that haplogroup X was strongly associated with both BMI (adjusted P = 8.31 × 10⁻³ and body fat mass (adjusted P = 5.67×10⁻⁴ Subjects classified as haplogroup X had lower BMI and fat mass values, with the β estimated to be 2.86 and 6.03, respectively. Our findings suggest that common variants in mitochondria might play a role in variations of body fat mass. Further molecular and functional studies will be needed to clarify the potential mechanism.

Modernization of US Nuclear Forces: Costs in Perspective

International Nuclear Information System (INIS)

Tapia-Jimenez, D.

2017-01-01

This short research paper addresses two topics that have emerged in the debate about whether, when, and how to modernize U.S. nuclear forces.1 The first topic relates to the size and scale of the planned nuclear force, with some critics of the modernization plan arguing that the United States is simply replicating the Cold War force for a very different era. The second topic relates to the cost of the modernization effort, with some critics arguing that the cost is unaffordable.2 This paper begins with a review of the changes in the size and scale of U.S. nuclear forces since the Cold War. It then examines the expected costs of modernization in a comparative perspective.

Modernization of US Nuclear Forces: Costs in Perspective

Energy Technology Data Exchange (ETDEWEB)

Tapia-Jimenez, D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-04-12

This short research paper addresses two topics that have emerged in the debate about whether, when, and how to modernize U.S. nuclear forces.1 The first topic relates to the size and scale of the planned nuclear force, with some critics of the modernization plan arguing that the United States is simply replicating the Cold War force for a very different era. The second topic relates to the cost of the modernization effort, with some critics arguing that the cost is unaffordable.2 This paper begins with a review of the changes in the size and scale of U.S. nuclear forces since the Cold War. It then examines the expected costs of modernization in a comparative perspective.

Banking on Solar: An Analysis of Banking Opportunities in the U.S. Distributed Photovoltaic Market

Energy Technology Data Exchange (ETDEWEB)

Feldman, D.; Lowder, T.

2014-11-01

This report provides a high-level overview of the developing U.S. solar loan product landscape, from both a market and economic perspective. It covers current and potential U.S. solar lending institutions; currently available loan products; loan program structures and post-loan origination options; risks and uncertainties of the solar asset class as it pertains to lenders; and an economic analysis comparing loan products to third party-financed systems in California.

The U S national parks in international perspective: The Yellowstone model or conservation syncretism?

Science.gov (United States)

John Schelhas

2010-01-01

In recent years, international conservation scholars and practitioners have largely dismissed the U.S. national park experience, often termed the “Yellowstone model,” as being too protectionist and exclusionary, and therefore irrelevant and even detrimental to park management and policy in lesser developed countries. A review of the U.S. national park experience finds...

IoT’s Tiny Steps towards 5G: Telco’s Perspective

Directory of Open Access Journals (Sweden)

Enida Cero

2017-10-01

Full Text Available The numerous and diverse applications of the Internet of Things (IoT have the potential to change all areas of daily life of individuals, businesses, and society as a whole. The vision of a pervasive IoT spans a wide range of application domains and addresses the enabling technologies needed to meet the performance requirements of various IoT applications. In order to accomplish this vision, this paper aims to provide an analysis of literature in order to propose a new classification of IoT applications, specify and prioritize performance requirements of such IoT application classes, and give an insight into state-of-the-art technologies used to meet these requirements, all from telco’s perspective. A deep and comprehensive understanding of the scope and classification of IoT applications is an essential precondition for determining their performance requirements with the overall goal of defining the enabling technologies towards fifth generation (5G networks, while avoiding over-specification and high costs. Given the fact that this paper presents an overview of current research for the given topic, it also targets the research community and other stakeholders interested in this contemporary and attractive field for the purpose of recognizing research gaps and recommending new research directions.

Aperçu de la culture du voandzou ( Vigna subterranea (L.) Verdcourt ...

African Journals Online (AJOL)

Aperçu de la culture du voandzou ( Vigna subterranea (L.) Verdcourt) au Burkina Faso: enjeux et perspectives d'amélioration de sa productivité. ... 2016 International Formulae Group. All rights reserved. ... The favorite variety is the cream-colored white hilum for its organoleptic, agronomic and aesthetic qualities. Lack of ...

G U Kulkarni

Indian Academy of Sciences (India)

Home; Journals; Bulletin of Materials Science. G U Kulkarni. Articles written in Bulletin of Materials Science. Volume 24 Issue 5 October 2001 pp 515-521 Magnetic Materials. Submicron particles of Co, Ni and Co–Ni alloys · P Saravanan T A Jose P John Thomas G U Kulkarni · More Details Abstract Fulltext PDF. Magnetic ...

Evaluating climatic response to external radiative forcing during the late Miocene to early Pliocene: New perspectives from eastern equatorial Pacific (IODP U1338) and North Atlantic (ODP 982) locations

Science.gov (United States)

Drury, Anna Joy; John, Cédric M.; Shevenell, Amelia E.

2016-01-01

Orbital-scale climate variability during the latest Miocene-early Pliocene is poorly understood due to a lack of high-resolution records spanning 8.0-3.5 Ma, which resolve all orbital cycles. Assessing this variability improves understanding of how Earth's system sensitivity to insolation evolves and provides insight into the factors driving the Messinian Salinity Crisis (MSC) and the Late Miocene Carbon Isotope Shift (LMCIS). New high-resolution benthic foraminiferal Cibicidoides mundulus δ18O and δ13C records from equatorial Pacific International Ocean Drilling Program Site U1338 are correlated to North Atlantic Ocean Drilling Program Site 982 to obtain a global perspective. Four long-term benthic δ18O variations are identified: the Tortonian-Messinian, Miocene-Pliocene, and Early-Pliocene Oxygen Isotope Lows (8-7, 5.9-4.9, and 4.8-3.5 Ma) and the Messinian Oxygen Isotope High (MOH; 7-5.9 Ma). Obliquity-paced variability dominates throughout, except during the MOH. Eleven new orbital-scale isotopic stages are identified between 7.4 and 7.1 Ma. Cryosphere and carbon cycle sensitivities, estimated from δ18O and δ13C variability, suggest a weak cryosphere-carbon cycle coupling. The MSC termination coincided with moderate cryosphere sensitivity and reduced global ice sheets. The LMCIS coincided with reduced carbon cycle sensitivity, suggesting a driving force independent of insolation changes. The response of the cryosphere and carbon cycle to obliquity forcing is established, defined as Earth System Response (ESR). Observations reveal that two late Miocene-early Pliocene climate states existed. The first is a prevailing dynamic state with moderate ESR and obliquity-driven Antarctic ice variations, associated with reduced global ice volumes. The second is a stable state, which occurred during the MOH, with reduced ESR and lower obliquity-driven variability, associated with expanded global ice volumes.

Analysis list: mab-5 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available mab-5 Embryo,Larvae + ce10 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/target/m...ab-5.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/target/mab-5.5.tsv http://dbarchive.biosciencedbc....jp/kyushu-u/ce10/target/mab-5.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/mab-5.Embryo.tsv,http://dbarchive.bioscien...cedbc.jp/kyushu-u/ce10/colo/mab-5.Larvae.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/ce10/colo/Embryo.gml,http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/Larvae.gml ...

Energy Level Statistics of SO(5) Limit of Super-symmetry U(6/4) in Interacting Boson-Fermion Model

International Nuclear Information System (INIS)

Bai Hongbo; Zhang Jinfu; Zhou Xianrong

2005-01-01

We study the energy level statistics of the SO(5) limit of super-symmetry U(6/4) in odd-A nucleus using the interacting boson-fermion model. The nearest neighbor spacing distribution (NSD) and the spectral rigidity (Δ 3 ) are investigated, and the factors that affect the properties of level statistics are also discussed. The results show that the boson number N is a dominant factor. If N is small, both the interaction strengths of subgroups SO B (5) and SO BF (5) and the spin play important roles in the energy level statistics, however, along with the increase of N, the statistics distribution would tend to be in Poisson form.

Microresonator-Based Optical Frequency Combs: A Time Domain Perspective

Science.gov (United States)

2016-04-19

AFRL-AFOSR-VA-TR-2016-0165 (BRI) Microresonator-Based Optical Frequency Combs: A Time Domain Perspective Andrew Weiner PURDUE UNIVERSITY 401 SOUTH...Optical Frequency Combs: A Time Domain Perspective 5a. CONTRACT NUMBER 5b. GRANT NUMBER FA9550-12-1-0236 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S...average 1 hour per response, including the time for reviewing instructions, searching existing data sources, gathering and maintaining the data

Analysis list: Smarca5 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Smarca5 Breast,Embryonic fibroblast + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Smarca...5.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Smarca5.5.tsv http://dbarch...ive.biosciencedbc.jp/kyushu-u/mm9/target/Smarca5.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Smarca...5.Breast.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Smarca5.Em

Colorimetric on-line control of U

International Nuclear Information System (INIS)

Perez, J.J.; Boisde, G.; Dedaldechamp, P.; Dureault, B.

The instrumentation developed for the automatic colorimetric control of U is presented. Two techniques are used: absorptiometry of U ions using optical probes enabling to measure in situ the solutions containing 0.5 g U(IV)/l or 1 g U(VI)/l; colorimetry of the U-DBM complexe after separation of U by TOPO (this technique is applied to the control of U at the ppm level). The automatic devices used are described. They are experimented in laboratory or in pilot-plant [fr

The Druze: a population genetic refugium of the Near East.

Directory of Open Access Journals (Sweden)

Liran I Shlush

Full Text Available BACKGROUND: Phylogenetic mitochondrial DNA haplogroups are highly partitioned across global geographic regions. A unique exception is the X haplogroup, which has a widespread global distribution without major regions of distinct localization. PRINCIPAL FINDINGS: We have examined mitochondrial DNA sequence variation together with Y-chromosome-based haplogroup structure among the Druze, a religious minority with a unique socio-demographic history residing in the Near East. We observed a striking overall pattern of heterogeneous parental origins, consistent with Druze oral tradition, together with both a high frequency and a high diversity of the mitochondrial DNA (mtDNA X haplogroup within a confined regional subpopulation. Furthermore demographic modeling indicated low migration rates with nearby populations. CONCLUSIONS: These findings were enabled through the use of a paternal kindred based sampling approach, and suggest that the Galilee Druze represent a population isolate, and that the combination of a high frequency and diversity of the mtDNA X haplogroup signifies a phylogenetic refugium, providing a sample snapshot of the genetic landscape of the Near East prior to the modern age.

CCR5 signalling, but not DARC or D6 regulatory, chemokine receptors are targeted by herpesvirus U83A chemokine which delays receptor internalisation via diversion to a caveolin-linked pathway.

Science.gov (United States)

Catusse, Julie; Clark, David J; Gompels, Ursula A

2009-07-30

Herpesviruses have evolved chemokines and chemokine receptors, which modulate the recruitment of human leukocytes during the inflammatory response to infection. Early post-infection, human herpesvirus 6A (HHV-6A) infected cells express the chemokine receptor U51A and chemokine U83A which have complementary effects in subverting the CC-chemokine family thereby controlling anti-viral leukocyte recruitment. Here we show that, to potentiate this activity, the viral chemokine can also avoid clearance by scavenger chemokine receptors, DARC and D6, which normally regulate an inflammatory response. Conversely, U83A delays internalisation of its signalling target receptor CCR5 with diversion to caveolin rich membrane domains. This mechanism can redirect displaced human chemokines to DARC and D6 for clearance of the anti-viral inflammatory response, leaving the viral chemokine unchecked. Cell models for competitive binding assays were established using radiolabeled human chemokines and cold U83A on CCR5, DARC or D6 expressing cells. Flow cytometry was used to assess specific chemotaxis of CCR5 bearing cells to U83A, and internalisation of CCR5 specific chemokine CCL4 after stimulation with U83A. Internalisation analyses were supported by confocal microscopy of internalisation and co-localisation of CCR5 with caveosome marker caveolin-1, after virus or human chemokine stimulation. U83A displaced efficiently human chemokines from CCR5, with a high affinity of 0.01nM, but not from DARC or D6. Signalling via CCR5 resulted in specific chemoattraction of primary human leukocytes bearing CCR5. However, U83A effective binding and signalling to CCR5 resulted in delayed internalisation and recycling up to 2 hours in the absence of continual re-stimulation. This resulted in diversion to a delayed caveolin-linked pathway rather than the rapid clathrin mediated endocytosis previously shown with human chemokines CCL3 or CCL4. U83A diverts human chemokines from signalling, but not

CCR5 signalling, but not DARC or D6 regulatory, chemokine receptors are targeted by herpesvirus U83A chemokine which delays receptor internalisation via diversion to a caveolin-linked pathway

Directory of Open Access Journals (Sweden)

Gompels Ursula A

2009-07-01

Full Text Available Abstract Background Herpesviruses have evolved chemokines and chemokine receptors, which modulate the recruitment of human leukocytes during the inflammatory response to infection. Early post-infection, human herpesvirus 6A (HHV-6A infected cells express the chemokine receptor U51A and chemokine U83A which have complementary effects in subverting the CC-chemokine family thereby controlling anti-viral leukocyte recruitment. Here we show that, to potentiate this activity, the viral chemokine can also avoid clearance by scavenger chemokine receptors, DARC and D6, which normally regulate an inflammatory response. Conversely, U83A delays internalisation of its signalling target receptor CCR5 with diversion to caveolin rich membrane domains. This mechanism can redirect displaced human chemokines to DARC and D6 for clearance of the anti-viral inflammatory response, leaving the viral chemokine unchecked. Methods Cell models for competitive binding assays were established using radiolabeled human chemokines and cold U83A on CCR5, DARC or D6 expressing cells. Flow cytometry was used to assess specific chemotaxis of CCR5 bearing cells to U83A, and internalisation of CCR5 specific chemokine CCL4 after stimulation with U83A. Internalisation analyses were supported by confocal microscopy of internalisation and co-localisation of CCR5 with caveosome marker caveolin-1, after virus or human chemokine stimulation. Results U83A displaced efficiently human chemokines from CCR5, with a high affinity of 0.01nM, but not from DARC or D6. Signalling via CCR5 resulted in specific chemoattraction of primary human leukocytes bearing CCR5. However, U83A effective binding and signalling to CCR5 resulted in delayed internalisation and recycling up to 2 hours in the absence of continual re-stimulation. This resulted in diversion to a delayed caveolin-linked pathway rather than the rapid clathrin mediated endocytosis previously shown with human chemokines CCL3 or CCL4

The relevance of economic data in the decision-making process for orbital launch vehicle programs, a U.S. perspective

Science.gov (United States)

Hertzfeld, Henry R.; Williamson, Ray A.; Peter, Nicolas

2007-12-01

Over the past fifteen years, major U.S. initiatives for the development of new launch vehicles have been remarkably unsuccessful. The list is long: NLI, SLI, and X-33, not to mention several cancelled programs aimed at high speed airplanes (NASP, HSCT) which would share some similar technological problems. The economic aspects of these programs are equally as important to their success as are the technical aspects. In fact, by largely ignoring economic realities in the decisions to undertake these programs and in subsequent management decisions, space agencies (and their commercial partners) have inadvertently contributed to the eventual demise of these efforts. The transportation revolution that was envisaged by the promises of these programs has never occurred. Access to space is still very expensive; reliability of launch vehicles has remained constant over the years; and market demand has been relatively low, volatile and slow to develop. The changing international context of the industry (launching overcapacity, etc.) has also worked against the investment in new vehicles in the U.S. Today, unless there are unforeseen technical breakthroughs, orbital space access is likely to continue as it has been with high costs and market stagnation. Space exploration will require significant launching capabilities. The details of the future needs are not yet well defined. But, the question of the launch costs, the overall demand for vehicles, and the size and type of role that NASA will play in the overall launch market is likely to influence the industry. This paper will emphasize the lessons learned from the economic and management perspective from past launch programs, analyze the issues behind the demand for launches, and project the challenges that NASA will face as only one new customer in a very complex market situation. It will be important for NASA to make launch vehicle decisions based as much on economic considerations as it does on solving new technical

The future of environmental protection: A U.S. regulator's perspective

International Nuclear Information System (INIS)

Dicus, G.J.

2002-01-01

The U.S. has the largest number of nuclear installations of any country in the world. This puts us at an extreme end of the spectrum. As a result, I have touched on many issues relative to environmental protection. Therefore in summary, let me list these issues: Before moving ahead, look at what has been done thus far. Executive policy and a national regulatory infrastructure. - Environmental Impact Statements. - Environmental Justice. Standards determined by law or courts. Consultation with other national agencies and countries. Improving the timetable for issuing regulations and supporting guidance. Improved communications and training of staff. Transparency and flexibility throughout the regulatory process. Differences in regulatory approaches are OK, as long as the end result is to achieve sound national environmental and public health and safety policy. I believe that this series of conferences represents an excellent opportunity to come to resolution about the future of environmental regulations and policies. Having this information will assist us in harmonizing any proposed recommendation(s) for radiological protection of the environment involving commodities containing radioactive materials or unrestricted release of slightly radioactive materials by using the existing environmental radiation protection framework as a starting point. Doing so in an open, encompassing manner will, in my opinion, go a long way towards resolving some of the current controversies about radiation protection standards in the U.S., as well as around the world, with the desirable end result of increasing public confidence in our environmental radiation protection programs. (author)

Adducts of UF5 with SbF5 and structure of UF5 . 2SbF5

International Nuclear Information System (INIS)

Sawodny, W.; Rediess, K.

1980-01-01

Both α-UF 5 and β-UF 5 form only a 1:2 compound UF 5 . 2SbF 5 reacting directly with SbF 5 , from which UF 5 . SbF 5 can be obtained by thermal decomposition. UF 5 . 2SbF 5 crystallizes in the monoclinic space group P2 1 /c with the following lattice constants a = 8.110(4), b = 14.129(6), c = 10.032(6) A and β = 96.97(5) 0 ; Z = 4. An X-ray study shows centrosymmetric four-membered rings of alternating UF 8 and SbF 6 polyhedra connected by other SbF 6 entities. This structure is similar to that of UOF 5 . 2SbF 5 , but the distorted pentagonal-bipyramidal coordination of the U atom found there is increased to a dodecahedral coordination by an additional U-F-Sb bridge, though with a somewaht larger UF distance. (author)

Human U87 astrocytoma cell invasion induced by interaction of βig-h3 with integrin α5β1 involves calpain-2.

Directory of Open Access Journals (Sweden)

Jie Ma

Full Text Available It is known that βig-h3 is involved in the invasive process of many types of tumors, but its mechanism in glioma cells has not been fully clarified. Using immunofluorescent double-staining and confocal imaging analysis, and co-immunoprecipitation assays, we found that βig-h3 co-localized with integrin α5β1 in U87 cells. We sought to elucidate the function of this interaction by performing cell invasion assays and gelatin zymography experiments. We found that siRNA knockdowns of βig-h3 and calpain-2 impaired cell invasion and MMP secretion. Moreover, βig-h3, integrins and calpain-2 are known to be regulated by Ca(2+, and they are also involved in tumor cell invasion. Therefore, we further investigated if calpain-2 was relevant to βig-h3-integrin α5β1 interaction to affect U87 cell invasion. Our data showed that βig-h3 co-localized with integrin α5β1 to enhance the invasion of U87 cells, and that calpain-2, is involved in this process, acting as a downstream molecule.

New Fiber Materials with Sorption Capacity at 5.0 g-U/kg Adsorbent under Marine Testing Conditions

Energy Technology Data Exchange (ETDEWEB)

Saito, Tomonori [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Brown, S. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Das, Sadananda [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Mayes, Richard T. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Janke, Christopher James [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dai, Sheng [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Kuo, Li-Jung [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Strivens, Jonathan E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Schlafer, Nicholas [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Wood, J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Gill, G. A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Flicker Byers, M. [Univ. of Texas, Austin, TX (United States); Schneider, Eric [Univ. of Texas, Austin, TX (United States)

2016-03-30

capacities: RIGP adsorbent achieved 5.00 ± 0.15 g U/kg-ads., while ATRP adsorbent achieved 6.56 ± 0.33 g U/kg-ads., after 56 days of seawater exposure. These achieved values are the highest adsorption capacities ever reported for uranium extraction from seawater. The study successfully demonstrated new fiber materials with sorption capacity at 5.0 g-U/kg adsorbent under marine testing conditions. Further optimization, investigation of other new materials as well as deepening our understanding will develop adsorbents that have even higher uranium adsorption capacity, increased selectivity, and faster kinetics.

Temperature behavior of 12 wt.% U TRIGA fuel

Energy Technology Data Exchange (ETDEWEB)

Levine, S H; Geisler, G C; Totenbier, R E [Pennsylvania State University (United States)

1974-07-01

Stainless steel clad 12 wt % U TRIGA fuel elements have been used to refuel the Penn State University's Breazeale Reactor (PSBR). When 12 wt % U fuel containing nominally 55 gms of {sup 235}U per fuel element is substituted for the 8.5 wt % U fuel containing nominally 38 gms {sup 235}U, higher fuel temperatures were produced in the 12 wt % U fuel than in the 8.5 wt % U fuel at the same reactor powers. The higher fuel temperature can be related to the higher power densities in the 12 wt % U fuel. The power density is calculated to be 35% higher in the 12 wt % U fuel when 6 of these fuel elements are substituted for 8.5 wt % U fuel in the innermost ring, the B ring. Temperatures have been calculated for the 12 wt % U fuel in the above configuration for both steady state and pulse conditions, assuming a 35% higher fuel density in the 12 wt % U fuel and the results compare favorably with the experimental measurements. This is particularly true when the comparison is made with temperature data taken after exposing the new fuel elements to a series of pulses. These calculations and data will be presented at the meeting. (author)

Analysis list: Ddx5 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Ddx5 Blood + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Ddx5.1.tsv h...ttp://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Ddx5.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Dd...x5.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Ddx5.Blood.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Blood.gml ...

Strongest experimental constraints on SU(5)xU(1) supergravity models

International Nuclear Information System (INIS)

Lopez, J.L.; Nanopoulos, D.V.; Park, G.T.; Zichichi, A.

1994-01-01

We consider a class of well-motivated string-inspired flipped SU(5) supergravity models which include four supersymmetry-breaking scenarios: no-scale, strict no-scale, dilaton, and special dilaton, such that only three parameters are needed to describe all new phenomena (m t ,tanβ,m g ). We show that the CERN LEP precise measurements of the electroweak parameters in the form of the ε 1 variable and the CLEO II allowed range for B(b→sγ) are at present the most important experimental constraints on this class of models. For m t approx-gt 155 (165) GeV, the ε 1 constraint [at 90 (95)% C.L.] requires the presence of light charginos (m χ1 ± approx-lt 50--100 GeV depending on m t ). Since all sparticle masses are proportional to m g , m χ1 ± approx-lt 100 GeV implies m χ1 0 approx-lt 55 GeV, m χ2 0 approx-lt 100 GeV, m g approx-lt 360 GeV, m q approx-lt 350 (365) GeV, m e R approx-lt 80 (125) GeV, m e L approx-lt 120 (155) GeV, and m n u approx-lt 100 (140) GeV in the no-scale (dilaton) flipped SU(5) supergravity model. The B(b→sγ) constraint excludes a significant fraction of the otherwise allowed region in the (m χ1 ± ,tanβ) plane (irrespective of the magnitude of the chargino mass), while future experimental improvements will result in decisive tests of these models

Measurements at the RA Reactor related to the VISA-2 project - Part 3, calculation of VISA-2 samples influence on the reactor reactivity, on the depression of thermal neutron flux in VK-5 channel and VISA-2 samples; Fizicka merenja na reaktoru RA u vezi projekta VISA-2 - III deo, Proracun uticaja uzoraka VISA-2 na reaktivnost reaktora, na depresiju fluksa termalnih neuntrona u kanalu VK-5 i u uzorcima VISA-2

Energy Technology Data Exchange (ETDEWEB)

Markovic, H; Martinc, R [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

1962-07-01

The objective of this task was to determine the thermal neutron flux in the RA reactor cell with VISA-2 samples, the influence of VISA-2 samples on the thermal neutron flux distribution in the vicinity of VK-5 channel and the antireactivity of VISA-2 samples placed in the RA reactor core. This distribution is needed for calculating the mean value of absorption and thermal efficiency factor in the reactor cell with the sample. Thermal neutron flux distribution without the sample was calculated by diffusion theory. Fast neutron flux space distribution was assumed to be constant, i.e. that it is dependent only on the nuclear properties of the materials. Macroscopic thermal neutron flux distribution was determined by two-group diffusion theory using the four factor formula applied for two regions: active RA region, and reactor region with calls containing VISA-2 samples. This calculation enables estimation of the VISA-2 samples influence on the thermal neutron flux distribution in the VK-5 channel. Antireactivity of VISA-2 samples was calculated by neutron diffusion theory applying the perturbation method. [Serbo-Croat] Cilj ovog zadatka je da se odredi raspodela fluksa termalnih neutrona u celiji reaktora RA sa uzorcima VISA-2, uticaj uzoraka VISA-2 na makroskopsku raspodelu termalnih neutrona u blizini uzoraka, tj. u kanalu VK-5, kao i antiraktivnost uzoraka VISA-2 ubacenih u jezgro RA. Poznavanje ove raspodele potrebno je za izracunavanje srednje apsorpcije i faktora termalnog iskoriscenja u celiji reaktora sa uzorkom. Raspodela fluksa termalnih neutrona u celiji RA bez uzorka izracunata je na bazi difuzione teorije. Fluks brzih neutrona uzet je kao konstanta s obzirom na prostorne koordinate, tj. da zavisi samo od nuklearnih karakteristika materijala. Makroskopska raspodela fluksa termalnih neutrona u okolini VISA-2 odredjena je na bazi dvogrupne difuzione teorije preko formule cetiri faktora, primenjene na dve zone: prva aktivna zona RA, i druga reaktorka sredina

Peer Relationships: Comparison of homeless youth in the U.S. and South Korea

OpenAIRE

Thompson, Sanna J.; Kim, Jihye; McManus, Holly; Flynn, Patrick; Kim, Hyangcho

2007-01-01

Youth homelessness is a growing global concern; thus, homeless youth peer relationships in the U.S. and South Korea were examined. Although some aspects of street life transcended culture; individual and group behaviors varied according to perspectives related to individualism versus collectivism. Service delivery approaches are needed to develop culturally-specific interventions.

Peer Relationships: Comparison of homeless youth in the U.S. and South Korea.

Science.gov (United States)

Thompson, Sanna J; Kim, Jihye; McManus, Holly; Flynn, Patrick; Kim, Hyangcho

2007-01-01

Youth homelessness is a growing global concern; thus, homeless youth peer relationships in the U.S. and South Korea were examined. Although some aspects of street life transcended culture; individual and group behaviors varied according to perspectives related to individualism versus collectivism. Service delivery approaches are needed to develop culturally-specific interventions.

Cultural Perspectives on Aging and Well-Being: A Comparison of Japan and the U.S.

Science.gov (United States)

Karasawa, Mayumi; Curhan, Katherine B.; Markus, Hazel Rose; Kitayama, Shinobu S.; Love, Gayle Dienberg; Radler, Barry T.; Ryff, Carol D.

2011-01-01

This study investigated age differences in multiple aspects of psychological well-being among midlife and older adults in Japan (N = 482) and the U.S. (N = 3,032) to test the hypothesis that older Japanese adults would rate aspects of their well-being (personal growth, purpose in life, positive relations with others) more highly that older U.S. adults. Partial support was found: older adults in Japan showed higher scores on personal growth compared to midlife adults, whereas the opposite age pattern was found in the U.S. However, purpose in life showed lower scores for older adults in both cultural contexts. Interpersonal well-being, as hypothesized, was rated significantly higher, relative to the overall well-being, among Japanese compared to U.S. respondents, but only among younger adults. Women in both cultures showed higher interpersonal well-being, but also greater negative affect compared with men. Suggestions for future inquiries to advance understanding of aging and well-being in distinct cultural contexts are detailed. PMID:21922800

Static electric dipole polarizabilities of An5+/6+ and AnO2+/2+ (An = U, Np, and Pu) ions

International Nuclear Information System (INIS)

Parmar, Payal; Peterson, Kirk A.; Clark, Aurora E.

2014-01-01

The parallel components of static electric dipole polarizabilities have been calculated for the lowest lying spin-orbit states of the penta- and hexavalent oxidation states of the actinides (An) U, Np, and Pu, in both their atomic and molecular diyl ion forms (An 5+/6+ and AnO 2 +/2+ ) using the numerical finite-field technique within a four-component relativistic framework. The four-component Dirac-Hartree-Fock method formed the reference for MP2 and CCSD(T) calculations, while multireference Fock space coupled-cluster (FSCC), intermediate Hamiltonian Fock space coupled-cluster (IH-FSCC) and Kramers restricted configuration interaction (KRCI) methods were used to incorporate additional electron correlation. It is observed that electron correlation has significant (∼5 a.u. 3 ) impact upon the parallel component of the polarizabilities of the diyls. To the best of our knowledge, these quantities have not been previously reported and they can serve as reference values in the determination of various electronic and response properties (for example intermolecular forces, optical properties, etc.) relevant to the nuclear fuel cycle and material science applications. The highest quality numbers for the parallel components (α zz ) of the polarizability for the lowest Ω levels corresponding to the ground electronic states are (in a.u. 3 ) 44.15 and 41.17 for UO 2 + and UO 2 2+ , respectively, 45.64 and 41.42 for NpO 2 + and NpO 2 2+ , respectively, and 47.15 for the PuO 2 + ion

Static electric dipole polarizabilities of An(5+/6+) and AnO2 (+/2+) (An = U, Np, and Pu) ions.

Science.gov (United States)

Parmar, Payal; Peterson, Kirk A; Clark, Aurora E

2014-12-21

The parallel components of static electric dipole polarizabilities have been calculated for the lowest lying spin-orbit states of the penta- and hexavalent oxidation states of the actinides (An) U, Np, and Pu, in both their atomic and molecular diyl ion forms (An(5+/6+) and AnO2 (+/2+)) using the numerical finite-field technique within a four-component relativistic framework. The four-component Dirac-Hartree-Fock method formed the reference for MP2 and CCSD(T) calculations, while multireference Fock space coupled-cluster (FSCC), intermediate Hamiltonian Fock space coupled-cluster (IH-FSCC) and Kramers restricted configuration interaction (KRCI) methods were used to incorporate additional electron correlation. It is observed that electron correlation has significant (∼5 a.u.(3)) impact upon the parallel component of the polarizabilities of the diyls. To the best of our knowledge, these quantities have not been previously reported and they can serve as reference values in the determination of various electronic and response properties (for example intermolecular forces, optical properties, etc.) relevant to the nuclear fuel cycle and material science applications. The highest quality numbers for the parallel components (αzz) of the polarizability for the lowest Ω levels corresponding to the ground electronic states are (in a.u.(3)) 44.15 and 41.17 for UO2 (+) and UO2 (2+), respectively, 45.64 and 41.42 for NpO2 (+) and NpO2 (2+), respectively, and 47.15 for the PuO2 (+) ion.

Web 2.0 Technologies and Building Online Learning Communities: Students' Perspectives

Science.gov (United States)

Abdelmalak, Mariam Mousa Matta

2015-01-01

The purpose of this action research was to explore students' perspectives regarding using Web 2.0 technologies to develop a community of learners. The course described in this study was a fully online course in an Educational Learning Technologies master's program at a medium-sized university in the U.S. Southwest. A variety of Web 2.0 tools…

Evaluating the stability of DSM-5 PTSD symptom network structure in a national sample of U.S. military veterans.

Science.gov (United States)

von Stockert, Sophia H H; Fried, Eiko I; Armour, Cherie; Pietrzak, Robert H

2018-03-15

Previous studies have used network models to investigate how PTSD symptoms associate with each other. However, analyses examining the degree to which these networks are stable over time, which are critical to identifying symptoms that may contribute to the chronicity of this disorder, are scarce. In the current study, we evaluated the temporal stability of DSM-5 PTSD symptom networks over a three-year period in a nationally representative sample of trauma-exposed U.S. military veterans. Data were analyzed from 611 trauma-exposed U.S. military veterans who participated in the National Health and Resilience in Veterans Study (NHRVS). We estimated regularized partial correlation networks of DSM-5 PTSD symptoms at baseline (Time 1) and at three-year follow-up (Time 2), and examined their temporal stability. Evaluation of the network structure of PTSD symptoms at Time 1 and Time 2 using a formal network comparison indicated that the Time 1 network did not differ significantly from the Time 2 network with regard to network structure (p = 0.12) or global strength (sum of all absolute associations, i.e. connectivity; p = 0.25). Centrality estimates of both networks (r = 0.86) and adjacency matrices (r = 0.69) were highly correlated. In both networks, avoidance, intrusive, and negative cognition and mood symptoms were among the more central nodes. This study is limited by the use of a self-report instrument to assess PTSD symptoms and recruitment of a relatively homogeneous sample of predominantly older, Caucasian veterans. Results of this study demonstrate the three-year stability of DSM-5 PTSD symptom network structure in a nationally representative sample of trauma-exposed U.S. military veterans. They further suggest that trauma-related avoidance, intrusive, and dysphoric symptoms may contribute to the chronicity of PTSD symptoms in this population. Published by Elsevier B.V.

Are Universities Role Models for Communities? A Gender Perspective

OpenAIRE

Felicia Cornelia MACARIE; Octavian MOLDOVAN

2012-01-01

The present paper explores the degree in which universities could/should serve as role models for communities from the perspective of gender integration. Although the theoretical/ moral answer would be affirmative (universities should be in such a position that would allow local communities to regard them as role models of gender integration), the primary empirical analysis leads to another conclusion. A brief theoretical review (that connects gender discrimination, sustainable development, u...

CERCA's 25 years experience in U3Si2 fuel manufacturing

International Nuclear Information System (INIS)

Durand, JP.; Duban, B.; Lavastre, Y.; Perthuis, S. de

2003-01-01

This paper documents the experience gained at CERCA in manufacturing, testing, and inspecting U 3 Si 2 fuel elements for various Material Test Reactors (MTR) since the beginning of the RERTR Program in 1978, up to now. It emphasises how the company controls the product to insure compliance with the fuel-related safety parameters. Finally, those statements are considered in the UMo fuel production perspective. (author)

Increasing TRIGA fuel lifetime with 12 wt.% U TRIGA fuel

Energy Technology Data Exchange (ETDEWEB)

Naughton, W F; Cenko, M J; Levine, S H; Witzig, W F [Pennsylvania State University (United States)

1974-07-01

In-core fuel management studies have been performed for the Penn State Breazeale Reactor (PSBR) wherein 12 wt % U fuel elements are used to replace the standard 8.5 wt % U TRIGA fuel. The core configuration used to develop a calculational model was a 90-element hexagonal array, which is representative of the PSBR core, and consists of five hexagonal rings surrounding a central thimble containing water. The technique employed for refueling the core fully loaded with 8.5 wt % U fuel involves replacing 8.5 wt % U fuel with 12 wt % U fuel using an in-out reloading scheme. A batch reload consists of 6 new 12 wt % U fuel elements. Placing the 12 wt % U fuel in the B ring produces fuel temperatures ({approx}450 {sup o}C) that are well below the 800{sup o}C maximum limitation when the PSBR is operating at its maximum allowed power of 1 Megawatt. The advantages of using new 12 wt % U fuel to replace the burned up 8.5 wt % U fuel in the B ring over refueling strictly with 8.5 wt % U-Zr TRIGA fuel are clearly delineated in Table 1 where cost calculations used the General Atomic pre-1972 prices for TRIGA fuel, i.e., $1500 and $1650 for an 8.5 and 12 wt % U fuel element, respectively. Experimental results obtained to date utilizing the 12 wt % U fuel elements agree with the computed results. (author)

Studying Angular Distribution of Neutron for (p,n) Reaction from 0.5 GeV to 1.5 GeV on some Heavy Targets 238U, 206Pb, 197Au, 186W

International Nuclear Information System (INIS)

Nguyen Mong Giao; Tran Thanh Dung; Nguyen Thi Ai Thu; Huynh Thi Xuan Tham

2010-08-01

The angular distributions of neutron are calculated for a spallation reaction induced by proton energy from 0.5 GeV to 1.5 GeV on target nuclei 206 Pb, 197 Au, 238 U, 186 W. In this report, we use nuclear data of JENDL-HE with evaluated proton induced cross-sections up to 3 GeV. The obtained results have been discussed in detail. (author)

Evolutionary analyses of entire genomes do not support the association of mtDNA mutations with Ras/MAPK pathway syndromes.

Directory of Open Access Journals (Sweden)

Alberto Gómez-Carballa

Full Text Available BACKGROUND: There are several known autosomal genes responsible for Ras/MAPK pathway syndromes, including Noonan syndrome (NS and related disorders (such as LEOPARD, neurofibromatosis type 1, although mutations of these genes do not explain all cases. Due to the important role played by the mitochondrion in the energetic metabolism of cardiac muscle, it was recently proposed that variation in the mitochondrial DNA (mtDNA genome could be a risk factor in the Noonan phenotype and in hypertrophic cardiomyopathy (HCM, which is a common clinical feature in Ras/MAPK pathway syndromes. In order to test these hypotheses, we sequenced entire mtDNA genomes in the largest series of patients suffering from Ras/MAPK pathway syndromes analyzed to date (n = 45, most of them classified as NS patients (n = 42. METHODS/PRINCIPAL FINDINGS: The results indicate that the observed mtDNA lineages were mostly of European ancestry, reproducing in a nutshell the expected haplogroup (hg patterns of a typical Iberian dataset (including hgs H, T, J, and U. Three new branches of the mtDNA phylogeny (H1j1, U5b1e, and L2a5 are described for the first time, but none of these are likely to be related to NS or Ras/MAPK pathway syndromes when observed under an evolutionary perspective. Patterns of variation in tRNA and protein genes, as well as redundant, private and heteroplasmic variants, in the mtDNA genomes of patients were as expected when compared with the patterns inferred from a worldwide mtDNA phylogeny based on more than 8700 entire genomes. Moreover, most of the mtDNA variants found in patients had already been reported in healthy individuals and constitute common polymorphisms in human population groups. CONCLUSIONS/SIGNIFICANCE: As a whole, the observed mtDNA genome variation in the NS patients was difficult to reconcile with previous findings that indicated a pathogenic role of mtDNA variants in NS.

Evolutionary Analyses of Entire Genomes Do Not Support the Association of mtDNA Mutations with Ras/MAPK Pathway Syndromes

Science.gov (United States)

Cerezo, María; Balboa, Emilia; Heredia, Claudia; Castro-Feijóo, Lidia; Rica, Itxaso; Barreiro, Jesús; Eirís, Jesús; Cabanas, Paloma; Martínez-Soto, Isabel; Fernández-Toral, Joaquín; Castro-Gago, Manuel; Pombo, Manuel; Carracedo, Ángel; Barros, Francisco

2011-01-01

Background There are several known autosomal genes responsible for Ras/MAPK pathway syndromes, including Noonan syndrome (NS) and related disorders (such as LEOPARD, neurofibromatosis type 1), although mutations of these genes do not explain all cases. Due to the important role played by the mitochondrion in the energetic metabolism of cardiac muscle, it was recently proposed that variation in the mitochondrial DNA (mtDNA) genome could be a risk factor in the Noonan phenotype and in hypertrophic cardiomyopathy (HCM), which is a common clinical feature in Ras/MAPK pathway syndromes. In order to test these hypotheses, we sequenced entire mtDNA genomes in the largest series of patients suffering from Ras/MAPK pathway syndromes analyzed to date (n = 45), most of them classified as NS patients (n = 42). Methods/Principal Findings The results indicate that the observed mtDNA lineages were mostly of European ancestry, reproducing in a nutshell the expected haplogroup (hg) patterns of a typical Iberian dataset (including hgs H, T, J, and U). Three new branches of the mtDNA phylogeny (H1j1, U5b1e, and L2a5) are described for the first time, but none of these are likely to be related to NS or Ras/MAPK pathway syndromes when observed under an evolutionary perspective. Patterns of variation in tRNA and protein genes, as well as redundant, private and heteroplasmic variants, in the mtDNA genomes of patients were as expected when compared with the patterns inferred from a worldwide mtDNA phylogeny based on more than 8700 entire genomes. Moreover, most of the mtDNA variants found in patients had already been reported in healthy individuals and constitute common polymorphisms in human population groups. Conclusions/Significance As a whole, the observed mtDNA genome variation in the NS patients was difficult to reconcile with previous findings that indicated a pathogenic role of mtDNA variants in NS. PMID:21526175

238U-230Th dating of chevkinite in high-silica rhyolites from La Primavera and Yellowstone calderas

Science.gov (United States)

Vazquez, Jorge A.; Velasco, Noel O.; Schmitt, Axel K.; Bleick, Heather A.; Stelten, Mark E.

2014-01-01

Application of 238U-230Th disequilibrium dating of accessory minerals with contrasting stabilities and compositions can provide a unique perspective on magmatic evolution by placing the thermochemical evolution of magma within the framework of absolute time. Chevkinite, a Th-rich accessory mineral that occurs in peralkaline and metaluminous rhyolites, may be particularly useful as a chronometer of crystallization and differentiation because its composition may reflect the chemical changes of its host melt. Ion microprobe 128U-230Th dating of single chevkinite microphenocrysts from pre- and post-caldera La Primavera, Mexico, rhyolites yields model crystallization ages that are within 10's of k.y. of their corresponding K-Ar ages of ca. 125 ka to 85 ka, while chevkinite microphenocrysts from a post-caldera Yellowstone, USA, rhyolite yield a range of ages from ca. 110 ka to 250 ka, which is indistinguishable from the age distribution of coexisting zircon. Internal chevkinite-zircon isochrons from La Primavera yield Pleistocene ages with ~5% precision due to the nearly two order difference in Th/U between both minerals. Coupling chevkinite 238U-230Th ages and compositional analyses reveals a secular trend of Th/U and rare earth elements recorded in Yellowstone rhyolite, likely reflecting progressive compositional evolution of host magma. The relatively short timescale between chevkinite-zircon crystallization and eruption suggests that crystal-poor rhyolites at La Primavera were erupted shortly after differentiation and/or reheating. These results indicate that 238U-230Th dating of chevkinite via ion microprobe analysis may be used to date crystallization and chemical evolution of silicic magmas.

Study of [18F]FLT and [123I]IaraU for cellular imaging in HSV1 tk-transfected murine fibrosarcoma cells: evaluation of the tracer uptake using 5-fluoro, 5-iodo and 5-iodovinyl arabinosyl uridines as competitive probes

International Nuclear Information System (INIS)

Huang, Ho-Lien; Chiang, Li-Wu; Chen, Jia-Rong; Yang, Wen K.; Jeng, Kee-Ching; Chen, Jenn-Tzong; Duh, Ting-Shien; Lin, Wuu-Jyh; Farn, Shiou-Shiow; Chiang, Chi-Shiun; Huang, Chia-Wen; Lin, Kun-I; Yu, Chung-Shan

2012-01-01

As one of the most intensively studied probes for imaging of the cellular proliferation, [ 18 F]FLT was investigated whether the targeting specificity of thymidine kinase 1 (TK1) dependency could be enhanced through a synergistic effect mediated by herpes simplex type 1 virus (HSV1) tk gene in terms of the TK1 or TK2 expression. 5-[ 123 I]Iodo arabinosyl uridine ([ 123 I]IaraU) was prepared in a radiochemical yield of 8% and specific activity of 21 GBq/μmol, respectively. Inhibition of the cellular uptake of these two tracers was compared by using the arabinosyl uridine analogs such as 5-iodo, 5-fluoro and 5-(E)-iodovinyl arabinosyl uridine along with 2′-fluoro-5-iodo arabinosyl uridine (FIAU). Due to potential instability of the iodo group, accumulation index of 1.6 for [ 123 I]IaraU by HSV1-TK vs. control cells could virtually be achieved at 1.5 h, but dropped to 0.2 compared to 2.0 for [ 18 F]FLT at 5 h. The results from competitive inhibition by these nucleosides against the accumulation of [ 18 F]FLT implied that FLT exerted a mixed TK1- and TK2-dependent inhibition with HSV1-tk gene transfection because of the shifting of thymidine kinase status. Taken together, the combination of [ 18 F]FLT and HSV1-TK provides a synergistic imaging potency.

Study of [18F]FLT and [123I]IaraU for cellular imaging in HSV1 tk-transfected murine fibrosarcoma cells: evaluation of the tracer uptake using 5-fluoro, 5-iodo and 5-iodovinyl arabinosyl uridines as competitive probes.

Science.gov (United States)

Huang, Ho-Lien; Chiang, Li-Wu; Chen, Jia-Rong; Yang, Wen K; Jeng, Kee-Ching; Chen, Jenn-Tzong; Duh, Ting-Shien; Lin, Wuu-Jyh; Farn, Shiou-Shiow; Chiang, Chi-Shiun; Huang, Chia-Wen; Lin, Kun-I; Yu, Chung-Shan

2012-04-01

As one of the most intensively studied probes for imaging of the cellular proliferation, [(18)F]FLT was investigated whether the targeting specificity of thymidine kinase 1 (TK1) dependency could be enhanced through a synergistic effect mediated by herpes simplex type 1 virus (HSV1) tk gene in terms of the TK1 or TK2 expression. 5-[(123)I]Iodo arabinosyl uridine ([(123)I]IaraU) was prepared in a radiochemical yield of 8% and specific activity of 21 GBq/μmol, respectively. Inhibition of the cellular uptake of these two tracers was compared by using the arabinosyl uridine analogs such as 5-iodo, 5-fluoro and 5-(E)-iodovinyl arabinosyl uridine along with 2'-fluoro-5-iodo arabinosyl uridine (FIAU). Due to potential instability of the iodo group, accumulation index of 1.6 for [(123)I]IaraU by HSV1-TK vs. control cells could virtually be achieved at 1.5 h, but dropped to 0.2 compared to 2.0 for [(18)F]FLT at 5 h. The results from competitive inhibition by these nucleosides against the accumulation of [(18)F]FLT implied that FLT exerted a mixed TK1- and TK2-dependent inhibition with HSV1-tk gene transfection because of the shifting of thymidine kinase status. Taken together, the combination of [(18)F]FLT and HSV1-TK provides a synergistic imaging potency. Copyright © 2012 Elsevier Inc. All rights reserved.

Criticality in the configuration-mixed interacting boson model (1) $U(5)-\\hat{Q}(\\chi)\\cdot\\hat{Q}(\\chi)$ mixing

CERN Document Server

Hellemans, V; De Baerdemacker, S; Heyde, K

2008-01-01

The case of U(5)--$\\hat{Q}(\\chi)\\cdot\\hat{Q}(\\chi)$ mixing in the configuration-mixed Interacting Boson Model is studied in its mean-field approximation. Phase diagrams with analytical and numerical solutions are constructed and discussed. Indications for first-order and second-order shape phase transitions can be obtained from binding energies and from critical exponents, respectively.

Ground water contamination with (238)U, (234)U, (235)U, (226)Ra and (210)Pb from past uranium mining: cove wash, Arizona.

Science.gov (United States)

Dias da Cunha, Kenya Moore; Henderson, Helenes; Thomson, Bruce M; Hecht, Adam A

2014-06-01

The objectives of the study are to present a critical review of the (238)U, (234)U, (235)U, (226)Ra and (210)Pb levels in water samples from the EPA studies (U.S. EPA in Abandoned uranium mines and the Navajo Nation: Red Valley chapter screening assessment report. Region 9 Superfund Program, San Francisco, 2004, Abandoned uranium mines and the Navajo Nation: Northern aum region screening assessment report. Region 9 Superfund Program, San Francisco, 2006, Health and environmental impacts of uranium contamination, 5-year plan. Region 9 Superfund Program, San Franciso, 2008) and the dose assessment for the population due to ingestion of water containing (238)U and (234)U. The water quality data were taken from Sect. "Data analysis" of the published report, titled Abandoned Uranium Mines Project Arizona, New Mexico, Utah-Navajo Lands 1994-2000, Project Atlas. Total uranium concentration was above the maximum concentration level for drinking water (7.410-1 Bq/L) in 19 % of the water samples, while (238)U and (234)U concentrations were above in 14 and 17 % of the water samples, respectively. (226)Ra and (210)Pb concentrations in water samples were in the range of 3.7 × 10(-1) to 5.55 × 102 Bq/L and 1.11 to 4.33 × 102 Bq/L, respectively. For only two samples, the (226)Ra concentrations exceeded the MCL for total Ra for drinking water (0.185 Bq/L). However, the (210)Pb/(226)Ra ratios varied from 0.11 to 47.00, and ratios above 1.00 were observed in 71 % of the samples. Secular equilibrium of the natural uranium series was not observed in the data record for most of the water samples. Moreover, the (235)U/(total)U mass ratios ranged from 0.06 to 5.9 %, and the natural mass ratio of (235)U to (total)U (0.72 %) was observed in only 16 % of the water samples, ratios above or below the natural ratio could not be explained based on data reported by U.S. EPA. In addition, statistical evaluations showed no correlations among the distribution of the radionuclide concentrations

The structure and magnetic moment distribution in the antiferromagnetic phase of U sub 1 sub 4 Au sub 5 sub 1

CERN Document Server

Brown, P J; Neumann, K U; Smith, J G; Ziebeck, K R A

1997-01-01

The antiferromagnetic structure of the intermetallic compound U sub 1 sub 4 Au sub 5 sub 1 has been determined from neutron polarimetric measurements and refined by combining these data with integrated intensity measurements. The structure was found to be non-collinear with the U moments confined to the a-b plane. The moments of U atoms in each of the two sets of sixfold sites are arranged hexagonally with rotations of 60 deg. between them and the two sets are rotated with respect to one another by 50 deg. The third (twofold) set of U atoms has no ordered moment. These conclusions are in disagreement with a previous determination of the structure from powder data which gave a collinear structure with moments parallel to the c axis. Magnetization measurements made on single crystals in the temperature range 300-2 K can be understood in terms of a transition to a non-collinear easy plane antiferromagnetic structure stable below 22 K. Polarized neutron measurements have been used to determine the contribution of...

Financing U.S. exploration

International Nuclear Information System (INIS)

Dell'Osso, L. Jr.

1990-01-01

This paper discusses the challenges of financing U.S. exploration from the perspective of an independent oil and gas producer. When Burlington Resources was split into a separate company from the Burlington Northern Railroad three years ago, the company owned extensive resources but had little production capability, and had to resolve the problem of raising development capital. According to the author of this paper, three key elements in the company's perception of the business environment drove its strategy: that the role of independent producers would be crucial in new onshore oil and gas development as the majors moved offshore; that energy prices would remain weak; and that financial market sentiment would not favor a move to leverage the company more highly than its starting-point of 19 percent debt-to-total capital ratio

Draft Public Health Statement on the U.S.-Central American Free Trade Agreement (CAFTA).

Science.gov (United States)

2004-01-01

The U.S. is rapidly negotiating a raft of new regional and bilateral trade agreements. The most recent agreement, with Central America, [was to] come before Congress for a vote as soon as late May. There is growing concern that international trade agreements threaten health care and the health of communities. . . . The Draft Public Health Statement on the U.S.-Central American Free Trade Agreement (CAFTA), developed by CPATH which planned a campaign around the issues, analyzes key provisions from the perspective of public health and suggests reframing the trade debate in terms of health.

Exploring the Learning Experiences of Filipino Nurse Immigrants New to the U.S. Healthcare Industry

Science.gov (United States)

Smith, Walter L.

2011-01-01

Precepting, coaching, and mentoring are teaching methods used extensively in nursing education in U.S. healthcare facilities. Filipino nurse immigrants have cultural backgrounds that may influence their experience with and perspectives of these learning interventions. Although Filipino nurse immigrants comprise approximately 0.2% of the population…

Strikingly different penetrance of LHON in two Chinese families with primary mutation G11778A is independent of mtDNA haplogroup background and secondary mutation G13708A

Energy Technology Data Exchange (ETDEWEB)

Wang Huawei [Key Laboratory of Animal Models and Human Disease Mechanisms, Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming 650223 (China)]|[Laboratory for Conservation and Utilization of Bio-resource, Yunnan University, Kunming 650091 (China); Jia Xiaoyun; Ji Yanli [State Key Laboratory of Ophthalmology, Zhongshan Ophthalmic Center, Sun Yat-sen University, Guangzhou 510060 (China); Kong Qingpeng [State Key Laboratory of Genetic Resources and Evolution, Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming, Yunnan 650223 (China); Zhang Qingjiong [State Key Laboratory of Ophthalmology, Zhongshan Ophthalmic Center, Sun Yat-sen University, Guangzhou 510060 (China)], E-mail: qingjiongzhang@yahoo.com; Yao Yonggang [Key Laboratory of Animal Models and Human Disease Mechanisms, Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming 650223 (China)]|[State Key Laboratory of Genetic Resources and Evolution, Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming, Yunnan 650223 (China)], E-mail: ygyaozh@yahoo.com; Zhang Yaping [Laboratory for Conservation and Utilization of Bio-resource, Yunnan University, Kunming 650091 (China)]|[State Key Laboratory of Genetic Resources and Evolution, Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming, Yunnan 650223 (China)

2008-08-25

The penetrance of Leber's hereditary optic neuropathy (LHON) in families with primary mitochondrial DNA (mtDNA) mutations is very complex. Matrilineal and nuclear genetic background, as well as environmental factors, have been reported to be involved in different affected pedigrees. Here we describe two large Chinese families that show a striking difference in the penetrance of LHON, in which 53.3% and 15.0% of members were affected (P < 0.02), respectively. Analysis of the complete mtDNA genome of the two families revealed the presence of the primary mutation G11778A and several other variants suggesting the same haplogroup status G2a. The family with higher penetrance contained a previously described secondary mutation G13708A, which presents a polymorphism in normal Chinese samples and does not affect in vivo mitochondrial oxidative metabolism as described in a previous study. Evolutionary analysis failed to indicate any putatively pathogenic mutation that cosegregated with G11778A in these two pedigrees. Our results suggest that the variable penetrance of LHON in the two Chinese families is independent of both their mtDNA haplotype background and a secondary mutation G13708A. As a result, it is likely that unknown nuclear gene involvement and/or other factors contribute to the strikingly different penetrance of LHON.

Haplotypes in CCR5-CCR2, CCL3 and CCL5 are associated with natural resistance to HIV-1 infection in a Colombian cohort.

Science.gov (United States)

Vega, Jorge A; Villegas-Ospina, Simón; Aguilar-Jiménez, Wbeimar; Rugeles, María T; Bedoya, Gabriel; Zapata, Wildeman

2017-06-01

Variants in genes encoding for HIV-1 co-receptors and their natural ligands have been individually associated to natural resistance to HIV-1 infection. However, the simultaneous presence of these variants has been poorly studied. To evaluate the association of single and multilocus haplotypes in genes coding for the viral co-receptors CCR5 and CCR2, and their ligands CCL3 and CCL5, with resistance or susceptibility to HIV-1 infection. Nine variants in CCR5-CCR2, two SNPs in CCL3 and two in CCL5 were genotyped by PCR-RFLP in 35 seropositive (cases) and 49 HIV-1-exposed seronegative Colombian individuals (controls). Haplotypes were inferred using the Arlequin software, and their frequency in individual or combined loci was compared between cases and controls by the chi-square test. A p' value ;0.05 after Bonferroni correction was considered significant. Homozygosis of the human haplogroup (HH) E was absent in controls and frequent in cases, showing a tendency to susceptibility. The haplotypes C-C and T-T in CCL3 were associated with susceptibility (p'=0.016) and resistance (p';0.0001) to HIV-1 infection, respectively. Finally, in multilocus analysis, the haplotype combinations formed by HHC in CCR5-CCR2, T-T in CCL3 and G-C in CCL5 were associated with resistance (p'=0.006). Our results suggest that specific combinations of variants in genes from the same signaling pathway can define an HIV-1 resistant phenotype. Despite our small sample size, our statistically significant associations suggest strong effects; however, these results should be further validated in larger cohorts.

Analysis list: Stat5b [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Stat5b Blood,Breast + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Sta...t5b.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Stat5b.5.tsv http://dbarchive.biosciencedbc....jp/kyushu-u/mm9/target/Stat5b.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Stat5b.Blood.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/mm9/colo/Stat5b.Breast.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/mm9/colo/Blood.gml,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Breast.gml ...

Dicty_cDB: Contig-U16008-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U16008-1 gap included 1557 5 1711154 1712676 PLUS 5 8 U16008 0 0 0 0 1 1 1 0 1 0 0 0 1 0 Show Contig...-U16008-1 Contig ID Contig-U16008-1 Contig update 2004. 6.11 Contig sequence >Contig-U16008-1 (Contig-U16008-1Q) /CSM_Contig/Contig-U16008... TAAGGTTTATGATTTTTGATTTTAGATTTTATATTTTATTTATTTTAATA AAAAAAAAAAAAAAAAA Gap gap included Contig length 1557 Ch...F LIFVHGSSTIIVLGIAIINFSISRIFERSKMLPAVTWIFNLIILWTCY--- ---PFGGFGARGPPSTIGYSRHTIGGMYGGHSPGPRLHLTGYLGIEPMNGKFLN...SSTIIVLGIAIINFSISRIFERSKMLPAVTWIFNLIILWTCY--- ---PFGGFGARGPPSTIGYSRHTIGGMYGGHSPGPRLHLTGYLGIEPMNGKFLNIGRTFR L

An overview of outside U.S. market opportunities

International Nuclear Information System (INIS)

Barnes, S.B.

1986-01-01

The approach adopted in this paper in analyzing United States market opportunities outside the United States was to: look at the United States worldwide market penetration from an historical perspective, establish whether the United States position is still valid, determine what the future market will be, and offer some opinions on what United States companies must do to avail themselves of this market. Insight into worldwide market opportunities for U.S. companies can be gained by looking at the history of the Nuclear Industry on a worldwide basis

The Study of Business Ethics in the U. S. and Japan : Its Theoretical Framework and Educational Guideline

OpenAIRE

村山, 元理; 村山, 元英

1994-01-01

Business Ethics is now recognized as an essential subject in the business education in the U.S. In this paper we discuss the ethical dimension of business practice and define Business Ethics as reflecting various aspects of management from the perspective

76 FR 2402 - Maritime Security Directive 104-6 (Rev 5); Guidelines for U.S. Vessels Operating in High Risk Waters

Science.gov (United States)

2011-01-13

... Directive 104-6 (Rev 5); Guidelines for U.S. Vessels Operating in High Risk Waters AGENCY: Coast Guard, DHS... designated high risk waters, and provides additional counter-piracy guidance and mandatory measures for these... MARSEC Directives are available at your local Captain of the Port (COTP) office. Phone numbers and...

Web 2.0 Technologies and Parent Involvement of ELL Students: An Ecological Perspective

Science.gov (United States)

Shin, Dong-shin; Seger, Wendy

2016-01-01

This study explores how ELL students' parents participated in a blog-mediated English language arts curriculum in a second grade classroom at a U.S. urban school, and how they supported their children's learning of school-based writing. Adopting ecological perspectives on technological affordances, this study views digital literacy as discursive…

U.S. Public Relations from an International Perspective: Curricular Issues and Objectives.

Science.gov (United States)

Pratt, Cornelius B.; Ogbondah, Chris W.

This paper establishes a rationale for international public relations courses in the curricula of university public relations education in the U.S. and outlines the content of such courses. Disagreements between practitioners and educators on a blueprint for public relations education are documented. Developments pointing to a crucial need for…

Large (g-2)$_{\\mu}$ in SU(5) x U(1) supergravity models

CERN Document Server

López, J L; Wang, X

1994-01-01

We compute the supersymmetric contribution to the anomalous magnetic moment of the muon within the context of $SU(5)\\times U(1)$ supergravity models. The largest possible contributions to $a^{susy}_\\mu$ occur for the largest allowed values of $\\tan\\beta$ and can easily exceed the present experimentally allowed range, even after the LEP lower bounds on the sparticle masses are imposed. Such $\\tan\\beta$ enhancement implies that $a^{susy}_\\mu$ can greatly exceed both the electroweak contribution ($\\approx1.95\\times10^{-9}$) and the present hadronic uncertainty ($\\approx\\pm1.75\\times10^{-9}$). Therefore, the new E821 Brookhaven experiment (with an expected accuracy of $0.4\\times10^{-9}$) should explore a large fraction (if not all) of the parameter space of these models, corresponding to slepton, chargino, and squarks masses as high as 200, 300, and 1000 GeV respectively. Moreover, contrary to popular belief, the $a^{susy}_\\mu$ contribution can have either sign, depending on the sign of the Higgs mixing parameter...

Standard specification for uranium hexafluoride enriched to less than 5 % 235U

CERN Document Server

American Society for Testing and Materials. Philadelphia

2010-01-01

1.1 This specification covers nuclear grade uranium hexafluoride (UF6) that either has been processed through an enrichment plant, or has been produced by the blending of Highly Enriched Uranium with other uranium to obtain uranium of any 235U concentration below 5 % and that is intended for fuel fabrication. The objectives of this specification are twofold: (1) To define the impurity and uranium isotope limits for Enriched Commercial Grade UF6 so that, with respect to fuel design and manufacture, it is essentially equivalent to enriched uranium made from natural UF6; and (2) To define limits for Enriched Reprocessed UF6 to be expected if Reprocessed UF6 is to be enriched without dilution with Commercial Natural UF6. For such UF6, special provisions, not defined herein, may be needed to ensure fuel performance and to protect the work force, process equipment, and the environment. 1.2 This specification is intended to provide the nuclear industry with a standard for enriched UF6 that is to be used in the pro...

Dicty_cDB: Contig-U09569-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09569-1 gap included 1424 5 3658944 3660352 PLUS 8 14 U09569 0 0 8 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09569-1 Contig ID Contig-U09569-1 Contig update 2002. 9.13 Contig sequence >Contig-U09569-1 (Contig-U09569-1Q) /CSM_Contig/Contig-U0956...TTAAAAA TAAAATAAATATAAAATAAAATAAAAATTAACAA Gap gap included Contig length 1424 Chromosome number (1..6, M) 5...NQTFQQKYYVNDQYYNYKNGGPIILYINGEGPVSSPPYSSDDGVVIYAQA LNCMIVTLEHRFYGESSPFSELTIENLQYLSHQQALEDLATFVVDFQSKLVGAGHIVTIG...YLSHQQALEDLATFVVDFQSKLVGAGHIVTIG GSYSGALSAWFRIKYPHITVGSIASLGVVHSILDFTAFDAYVSYA---

The Influence of Uranium Content and PVA/U Ratio on Physical Propertiesof PVA-U Gel and Its Oxide

International Nuclear Information System (INIS)

Damunir; W, Bangun; Indra-Suryawan; Endang-Nawangsih

2000-01-01

The influence of uranium content and PVA/U ratio on physical propertiesof PVA-U gel and its oxide has been investigated. Fifty milliliters of uranylnitrate solution containing 100 g U/l was neutralized using 1M NH 4 0H. Thesolution was converted into PVA-U sol by adding 9.18 % PVA while mixed andheated at 80 o C for 20 minutes. In order to find spherical gel, the solsolution was dropped into a 5 M NH 4 0H solution at room temperature. Theshape formed of the gels small spherical, shape of the formed gels werefiltered, washed and heated at 120 o C. After that the gels were calcined at800 o C for 4 hours. The formed U 3 O 8 particles. Under a similar method, theinfluence of uranium content from 150-400 g/l and the influence of PVA/Uratio of 6.5-12.5 % in 100 g U/l were studied. Characterization of the resultwas obtained from physical properties of the gel and its oxide in the form ofdensity using pycnometer, surface area using surface areameter with N 2 asabsorbent and particle size/ shape using a loop and optical microscope. Theexperimental results showed that both uranium content and PVA/U ratioaffected the physical properties of the kernel properties. The best resultoccurred at uranium content of 100 g/l and PVA/U 9.18 %. The resulted gelwith solid content of 89.17 %, density of 3.36 g/l and size of 124 μm. Theresulted oxide U 3 0 8 had density of 7.98 g U/l, surface area of specific of0.449 m 2 /g and grain size of 810 μm. (author)

U.S. - UK - Canada Trilateral Symposium

Science.gov (United States)

2009-10-02

e . 4. Procedures for intra-community arms transfers simplified. 5 Retransfer controls disco raged b t m st be. u u u complied with. Li d...IRIS – T • Airbus A310 refueller 10 FUTURE OF TRANSATLANTIC ARMAMENTS COOPERATION 1996 VISION – “I believe that national security – ours and that

Noncommutative U(1) gauge theory from a worldline perspective

Energy Technology Data Exchange (ETDEWEB)

Ahmadiniaz, Naser [Facultad de Ciencias en Física y Matemáticas, Universidad Autónoma de Chiapas,Ciudad Universitaria, Tuxtla Gutiérrez 29050 (Mexico); Corradini, Olindo [Facultad de Ciencias en Física y Matemáticas, Universidad Autónoma de Chiapas,Ciudad Universitaria, Tuxtla Gutiérrez 29050 (Mexico); Dipartimento di Scienze Fisiche, Informatiche e Matematiche,Università di Modena e Reggio Emilia,Via Campi 213/A, I-41125 Modena (Italy); D’Ascanio, Daniela [Instituto de Física La Plata - CONICET, Universidad Nacional de La Plata,CC 67 (1900), La Plata (Argentina); Estrada-Jiménez, Sendic [Facultad de Ciencias en Física y Matemáticas, Universidad Autónoma de Chiapas,Ciudad Universitaria, Tuxtla Gutiérrez 29050 (Mexico); Pisani, Pablo [Instituto de Física La Plata - CONICET, Universidad Nacional de La Plata,CC 67 (1900), La Plata (Argentina)

2015-11-10

We study pure noncommutative U(1) gauge theory representing its one-loop effective action in terms of a phase space worldline path integral. We write the quadratic action using the background field method to keep explicit gauge invariance, and then employ the worldline formalism to write the one-loop effective action, singling out UV-divergent parts and finite (planar and non-planar) parts, and study renormalization properties of the theory. This amounts to employ worldline Feynman rules for the phase space path integral, that nicely incorporate the Fadeev-Popov ghost contribution and efficiently separate planar and non-planar contributions. We also show that the effective action calculation is independent of the choice of the worldline Green’s function, that corresponds to a particular way of factoring out a particle zero-mode. This allows to employ homogeneous string-inspired Feynman rules that greatly simplify the computation.

Nuclear reactor for breeding 233U

International Nuclear Information System (INIS)

Bohanan, C.S.; Jones, D.H.; Raab, H.F. Jr.; Radkowsky, A.

1976-01-01

A light-water-cooled nuclear reactor capable of breeding 233 U for use in a light-water breeder reactor includes physically separated regions containing 235 U fissile material and 238 U fertile material and 232 Th fertile material and 239 Pu fissile material, if available. Preferably the 235 U fissile material and 238 U fertile material are contained in longitudinally movable seed regions and the 239 Pu fissile material and 232 Th fertile material are contained in blanket regions surrounding the seed regions. 1 claim, 5 figures

Dicty_cDB: Contig-U13254-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13254-1 no gap 575 5 203798 203233 MINUS 1 1 U13254 0 0 0 0 0 0 0 1 0 0 0 0 0 0 Show Contig...-U13254-1 Contig ID Contig-U13254-1 Contig update 2002.12.18 Contig sequence >Contig-U13254-1 (Contig...-U13254-1Q) /CSM_Contig/Contig-U13254-1Q.Seq.d AAATAATTTATTTAATTTTAAAATTAATAGATAAAAAGATGGAAATGATA A...CATTTTAACATTATTGGATAAT GTCAATGATTGGCCAANNNNNNNNN Gap no gap Contig length 575 Chromosome number (1..6, M) 5 ...2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13254-1 (Contig-U13254-1Q) /CSM_Contig/Contig-U13254-1Q.Seq.d

Phenotypic variation within European carriers of the Y-chromosomal gr/gr deletion is independent of Y-chromosomal background

DEFF Research Database (Denmark)

Krausz, C; Giachini, C; Xue, Y

2008-01-01

of duplications and the Y-chromosomal haplogroup were characterised. Although the study had good power to detect factors that accounted for >or=5.5% of the variation in sperm concentration, no such factor was found. A negative effect of gr/gr deletions followed by b2/b4 duplication was found within...

Global Risk Diversification: An Empirical Investigation From The U. S. Perspective

OpenAIRE

H. Christine Hsu

2011-01-01

The case for global risk diversification has been built on correlations between the U.S. and international stock markets. Now that we witness how tightly the world stock markets are correlated, especially after the global financial crisis of 2008-2009, does it still make sense to diversify globally? Can the investments in global equity portfolios be protected in todays volatile markets? These questions have preoccupied a growing number of portfolio managers in recent years, as well as many of...

Enzymatic U(VI) reduction by Desulfosporosinus species

International Nuclear Information System (INIS)

Suzuki, Y.; Kelly, S.D.; Kemner, K.M.; Banfield, J.F.

2004-01-01

Here we tested U(VI) reduction by a Desulfosporosinus species (sp.) isolate and type strain (DSM 765) in cell suspensions (pH 7) containing 1 mM U(VI) and lactate, under an atmosphere containing N 2 -CO 2 -H 2 (90: 5: 5). Although neither Desulfosporosinus species (spp.) reduced U(VI) in cell suspensions with 0.25% Na-bicarbonate or 0.85% NaCl, U(VI) was reduced in these solutions by a control strain, desulfovibrio desulfuricans (ATCC 642). However, both Desulfosporosinus strains reduced U(VI) in cell suspensions depleted in bicarbonate and NaCl. No U(VI) reduction was observed without lactate and H 2 electron donors or with heat-killed cells, indicating enzymatic U(VI) reduction. Uranium(VI) reduction by both strains was inhibited when 1 mM CuCl 2 was added to the cell suspensions. Because the Desulfosporosinus DSM 765 does not contain cytochrome c 3 used by Desulfovibrio spp. to reduce U(VI), Desulfosporosinus species reduce uranium via a different enzymatic pathway. (orig.)

Theoretical modeling of the uranium 4f XPS for U(VI) and U(IV) oxides

Energy Technology Data Exchange (ETDEWEB)

Bagus, Paul S. [Department of Chemistry, University of North Texas, Denton, Texas 76203-5017 (United States); Nelin, Connie J. [Consulting and Services, 6008 Maury' s Trail, Austin, Texas 78730 (United States); Ilton, Eugene S. [Pacific Northwest National Laboratory, Richland, Washington 99352 (United States)

2013-12-28

A rigorous study is presented of the physical processes related to X-Ray photoelectron spectroscopy, XPS, in the 4f level of U oxides, which, as well as being of physical interest in themselves, are representative of XPS in heavy metal oxides. In particular, we present compelling evidence for a new view of the screening of core-holes that extends prior understandings. Our analysis of the screening focuses on the covalent mixing of high lying U and O orbitals as opposed to the, more common, use of orbitals that are nominally pure U or pure O. It is shown that this covalent mixing is quite different for the initial and final, core-hole, configurations and that this difference is directly related to the XPS satellite intensity. Furthermore, we show that the high-lying U d orbitals as well as the U(5f) orbital may both contribute to the core-hole screening, in contrast with previous work that has only considered screening through the U(5f) shell. The role of modifying the U-O interaction by changing the U-O distance has been investigated and an unexpected correlation between U-O distance and XPS satellite intensity has been discovered. The role of flourite and octahedral crystal structures for U(IV) oxides has been examined and relationships established between XPS features and the covalent interactions in the different structures. The physical views of XPS satellites as arising from shake processes or as arising from ligand to metal charge transfers are contrasted; our analysis provides strong support that shake processes give a more fundamental physical understanding than charge transfer. Our theoretical studies are based on rigorous, strictly ab initio determinations of the electronic structure of embedded cluster models of U oxides with formal U(VI) and U(IV) oxidation states. Our results provide a foundation that makes it possible to establish quantitative relationships between features of the XPS spectra and materials properties.

Theoretical modeling of the uranium 4f XPS for U(VI) and U(IV) oxides

Science.gov (United States)

Bagus, Paul S.; Nelin, Connie J.; Ilton, Eugene S.

2013-12-01

A rigorous study is presented of the physical processes related to X-Ray photoelectron spectroscopy, XPS, in the 4f level of U oxides, which, as well as being of physical interest in themselves, are representative of XPS in heavy metal oxides. In particular, we present compelling evidence for a new view of the screening of core-holes that extends prior understandings. Our analysis of the screening focuses on the covalent mixing of high lying U and O orbitals as opposed to the, more common, use of orbitals that are nominally pure U or pure O. It is shown that this covalent mixing is quite different for the initial and final, core-hole, configurations and that this difference is directly related to the XPS satellite intensity. Furthermore, we show that the high-lying U d orbitals as well as the U(5f) orbital may both contribute to the core-hole screening, in contrast with previous work that has only considered screening through the U(5f) shell. The role of modifying the U-O interaction by changing the U-O distance has been investigated and an unexpected correlation between U-O distance and XPS satellite intensity has been discovered. The role of flourite and octahedral crystal structures for U(IV) oxides has been examined and relationships established between XPS features and the covalent interactions in the different structures. The physical views of XPS satellites as arising from shake processes or as arising from ligand to metal charge transfers are contrasted; our analysis provides strong support that shake processes give a more fundamental physical understanding than charge transfer. Our theoretical studies are based on rigorous, strictly ab initio determinations of the electronic structure of embedded cluster models of U oxides with formal U(VI) and U(IV) oxidation states. Our results provide a foundation that makes it possible to establish quantitative relationships between features of the XPS spectra and materials properties.

Dicty_cDB: Contig-U09480-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09480-1 gap included 705 5 4277527 4276817 MINUS 1 2 U09480 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09480-1 Contig ID Contig-U09480-1 Contig update 2002. 9.13 Contig sequence >Contig-U09480-1 (Contig-U09480-1Q) /CSM_Contig/Contig-U09480...AAAAAAAAAA Gap gap included Contig length 705 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start ...**********imaeinienpfhvntkidvntfvnqirgipngsrcdftnsvvkhf sslgynvfvchpnhavtgpyaklhcefrntkfstig...srcdftnsvvkhf sslgynvfvchpnhavtgpyaklhcefrntkfstigydvyiiargrkvtatnfgdggydn wasggh

Journal of Genetics | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Journal of Genetics; Volume 88; Issue 1 ... mtDNA; macrohaplogroup M; haplogroups; castes and tribes; linguistic families. ... belonging to the same linguistic family but inhabiting different geographical regions (Dravidian and Austro–Asiatic speakers) exhibited differences in their haplogroup diversity.

War in the Era of Declining U.S. Global Hegemony

Directory of Open Access Journals (Sweden)

Francis Shor

2010-01-01

Full Text Available While Clausewitz’s perspective that ‘war is the continuation of politics by other means’ is widely quoted, the full implications of that perspective are rarely explored. What I propose to highlight in this essay is how the imperial political projects of the UnitedStates in the post-Vietnam era unleashed direct and indirect regional war strategies from Latin America to the Middle East. The essay will highlight, in particular, the wide variety of such strategies from covert intervention in Chile to proxy wars in Central America to military intervention in Iraq and Afghanistan. Attempting to re-assert its global hegemony after Vietnam, the U.S. became more committed to perpetrating war as an instrument of its global posture. Of course, relying on war strategies, whether through direct or indirect interventions, complicates, if not confounds, the imposition of global hegemony.

Phenomenology of the hierarchical lepton mass spectrum in the flipped SU(5)xU(1) string model

Energy Technology Data Exchange (ETDEWEB)

Leontaris, G.K.; Nanopoulos, D.V.

1988-09-29

A detailed phenomenological analysis of the lepton mass matrices and their implications in the low energy theory are discussed, within the recently proposed SU(5)xU(1) string model. The unification scale is highly constrained while the Yukawa couplings lie in a natural region. The flavour changing decays ..mu.. -> e..gamma.., ..mu.. -> 3e, ..mu.. -> e are highly suppressed while the depletion in the flux of muon neutrinos reported by the Kamiokande is explained through ..nu../sub ..mu../ reversible ..nu../sub tau/ oscillations.

Deaf and hard of hearing students' perspectives on bullying and school climate.

Science.gov (United States)

Weiner, Mary T; Day, Stefanie J; Galvan, Dennis

2013-01-01

Student perspectives reflect school climate. The study examined perspectives among deaf and hard of hearing students in residential and large day schools regarding bullying, and compared these perspectives with those of a national database of hearing students. The participants were 812 deaf and hard of hearing students in 11 U.S. schools. Data were derived from the Olweus Bullying Questionnaire (Olweus, 2007b), a standardized self-reported survey with multiple-choice questions focusing on different aspects of bullying problems. Significant bullying problems were found in deaf school programs. It appears that deaf and hard of hearing students experience bullying at rates 2-3 times higher than those reported by hearing students. Deaf and hard of hearing students reported that school personnel intervened less often when bullying occurred than was reported in the hearing sample. Results indicate the need for school climate improvement for all students, regardless of hearing status.

Mpn1, Mutated in Poikiloderma with Neutropenia Protein 1, Is a Conserved 3′-to-5′ RNA Exonuclease Processing U6 Small Nuclear RNA

Directory of Open Access Journals (Sweden)

Vadim Shchepachev

2012-10-01

Full Text Available Clericuzio-type poikiloderma with neutropenia (PN is a rare genodermatosis associated with mutations in the C16orf57 gene, which codes for the uncharacterized protein hMpn1. We show here that, in both fission yeasts and humans, Mpn1 processes the spliceosomal U6 small nuclear RNA (snRNA posttranscriptionally. In Mpn1-deficient cells, U6 molecules carry 3′ end polyuridine tails that are longer than those in normal cells and lack a terminal 2′,3′ cyclic phosphate group. In mpn1Δ yeast cells, U6 snRNA and U4/U6 di-small nuclear RNA protein complex levels are diminished, leading to precursor messenger RNA splicing defects, which are reverted by expression of either yeast or human Mpn1 and by overexpression of U6. Recombinant hMpn1 is a 3′-to-5′ RNA exonuclease that removes uridines from U6 3′ ends, generating terminal 2′,3′ cyclic phosphates in vitro. Finally, U6 degradation rates increase in mpn1Δ yeasts and in lymphoblasts established from individuals affected by PN. Our data indicate that Mpn1 promotes U6 stability through 3′ end posttranscriptional processing and implicate altered U6 metabolism as a potential mechanism for PN pathogenesis.

Evaluation of the electrochemical behavior of U{sub 2.5}Zr{sub 7.5}Nb and U{sub 3}Zr{sub 9}Nb uranium alloys in relation to the pH and the solution aeration

Energy Technology Data Exchange (ETDEWEB)

Mansur, Fabio Abud; Santos, Ana Maria Matildes dos; Ferraz, Wilmar Barbosa; Figueiredo, Celia de Araujo, E-mail: ferraz@cdtn.b [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

2011-07-01

The Centro de Desenvolvimento da Tecnologia Nuclear (CDTN) is developing, in cooperation with the Centro Tecnologico da Marinha (CTMSP), the advanced nuclear plate type fuel for the second core of the land-based reactor prototype of the Laboratorio de Geracao Nucleo-Eletrica (LABGENE). Recent investigations have shown that the fuel made of uranium-based niobium and zirconium alloys reaches the best performance relative to other fuels, e.g. UO{sub 2}. Niobium and Zirconium also increase the corrosion resistance and the mechanical strength of the uranium alloys. By means of electrochemical techniques the corrosion behavior of alloys U{sub 2}.{sub 5}Zr{sub 7.5}Nb and U{sub 3}Zr{sub 9}Nb, developed at CDTN and heat treated in the temperature range of 200 deg C to 600 deg C, was assessed. The effect of the parameters pH and solution aeration was studied as well as the influence of zirconium and niobium alloying elements in the corrosion of uranium. The techniques used were open circuit potential, electrochemical impedance and potentiodynamic anodic polarization at room temperature. The tests were performed in a three-electrode electrochemical cell with Ag/AgCl (3M KCl) as the reference electrode and a platinum plate as the auxiliary electrode. The potentiodynamic polarization curves of uranium and its alloys in acidic solutions showed regions with anodic currents limited by a passive film. The presence of niobium and zirconium contributed for the formation of this film. The impedance data showed the presence of two semicircles in the Bode diagram, indicating the occurrence of two distinct electrochemical processes. The data were fitted to an equivalent circuit model in order to obtain parameters of the electrochemical processes and evaluate the effect of the studied variables. (author)

Thermodynamics of La and U and the separation factor of U/La in fused Me(Ga-40 wt.% In)/3LiCl-2KCl system

Science.gov (United States)

Smolenski, Valeri; Novoselova, Alena; Volkovich, Vladimir A.

2017-11-01

Separation of lanthanides and actinides can be achieved in a unique "molten chloride - liquid metal" system. Electrode potentials were recorded vs. Cl-/Cl2 reference electrode and the temperature dependencies of the apparent standard potentials of La-(Ga-In) and U-(Ga-In) alloys were determined. Thermodynamic properties and separation factor of lanthanum and uranium were calculated. The obtained data show the perspective for using this system in future innovation method for recovery of nuclear waste.

Dicty_cDB: Contig-U04729-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U04729-1 no gap 251 5 1037629 1037880 PLUS 1 1 U04729 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U04729-1 Contig ID Contig-U04729-1 Contig update 2001. 8.29 Contig sequence >Contig-U04729-1 (Contig...-U04729-1Q) /CSM_Contig/Contig-U04729-1Q.Seq.d TGGATTTATAACAGAGGTTATTGTAGGTGGTAAAACTTTTAGAGGAATCG ...CATTATCTAATGGG T Gap no gap Contig length 251 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start ...ITEVIVGGKTFRGIVFEDLKSSNQTNNHSQNFSPNQSGTNLNNSNSNIPSSKKIKDKN ISPSSFLPTIGSTTSTSNPLSNG Translated Amino Acid seq