Pexophagy in Hansenula polymorpha
Zutphen, Tim van; Klei, Ida J. van der; Kiel, Jan A.K.W.; Klionsky, D.J.
2009-01-01
In the yeast Hansenula polymorpha the development and turnover of peroxisomes is readily achieved by manipulation of the cultivation conditions. The organelles massively develop when the cells are incubated in the presence of methanol as the sole source of carbon and energy. However, they are
Novel genetic tools for Hansenula polymorpha
Saraya, Ruchi; Krikken, Arjen M; Kiel, Jan A K W; Baerends, Richard J S; Veenhuis, Marten; van der Klei, Ida J
Hansenula polymorpha is an important yeast in industrial biotechnology. In addition, it is extensively used in fundamental research devoted to unravel the principles of peroxisome biology and nitrate assimilation. Here we present an overview of key components of the genetic toolbox for H.
Determining a carbohydrate profile for Hansenula polymorpha
Petersen, G. R.
1985-01-01
The determination of the levels of carbohydrates in the yeast Hansenula polymorpha required the development of new analytical procedures. Existing fractionation and analytical methods were adapted to deal with the problems involved with the lysis of whole cells. Using these new procedures, the complete carbohydrate profiles of H. polymorpha and selected mutant strains were determined and shown to correlate favourably with previously published results.
Hansenula polymorpha Tup1p is important for peroxisome degradation
Leão-Helder, Adriana N; Krikken, Arjen M; Lunenborg, Marcel G J; Kiel, Jan A K W; Veenhuis, Marten; van der Klei, Ida J
2004-01-01
In the yeast Hansenula polymorpha peroxisomes are selectively degraded upon a shift of cells from methanol to glucose-containing media. We identified the H. polymorpha TUP1 gene by functional complementation of the peroxisome degradation deficient mutant pdd2-4. Tup1 proteins function in
Tools for genetic engineering of the yeast Hansenula polymorpha
Saraya, Ruchi; Gidijala, Loknath; Veenhuis, Marten; van der Klei, Ida J; Mapelli, Valeria
2014-01-01
Hansenula polymorpha is a methylotrophic yeast species that has favorable properties for heterologous protein production and metabolic engineering. It provides an attractive expression platform with the capability to secrete high levels of commercially important proteins. Over the past few years
Cloning and sequencing of the peroxisomal amine oxidase gene from Hansenula polymorpha
Bruinenberg, P. G.; Evers, M.; Waterham, H. R.; Kuipers, J.; Arnberg, A. C.; AB, G.
1989-01-01
We have cloned the AMO gene, encoding the microbody matrix enzyme amine oxidase (EC 1.4.3.6) from the yeast Hansenula polymorpha. The gene was isolated by differential screening of a cDNA library, immunoselection, and subsequent screening of a H. polymorpha genomic library. The nucleotide sequence
Adaptation of Hansenula polymorpha to methanol : A transcriptome analysis
van Zutphen, T.; Baerends, R.J S; Susanna, Kim; de Jong, Anne; Kuipers, O.P.; Veenhuis, M; van der Klei, I.J.
2010-01-01
Background: Methylotrophic yeast species (e. g. Hansenula polymorpha, Pichia pastoris) can grow on methanol as sole source of carbon and energy. These organisms are important cell factories for the production of recombinant proteins, but are also used in fundamental research as model organisms to
Stasyk, Oleh V.; Stasyk, Olena G.; Komduur, Janet; Veenhuis, Marten; Cregg, James M.; Sibirny, Andrei A.
2004-01-01
Peroxisome biogenesis and synthesis of peroxisomal enzymes in the methylotrophic yeast Hansenula polymorpha are under the strict control of glucose repression. We identified an H. polymorpha glucose catabolite repression gene (HpGCR1) that encodes a hexose transporter homologue. Deficiency in GCR1
Cytochemical Localization of Catalase Activity in Methanol-Grown Hansenula polymorpha
Dijken, J.P. van; Veenhuis, M.; Vermeulen, C.A.; Harder, W.
1975-01-01
The localization of peroxidase activity in methanol-grown cells of the yeast Hansenula polymorpha has been studied by a method based on cytochemical staining with diaminobenzidine (DAB). The oxidation product of DAB occurred in microbodies, which characteristically develop during growth on methanol,
Klei, I.J. van der; Faber, K.N.; Keizer-Gunnink, I.; Gietl, C.; Harder, W.; Veenhuis, M.
1993-01-01
We have studied the fate of the watermelon (Citrullus vulgaris Schrad.) glyoxysomal enzyme, malate dehydrogenase (gMDH), after synthesis in the methylotrophic yeast, Hansenula polymorpha. The gene encoding the precursor form of gMDH (pre-gMDH) was cloned in an H. polymorpha expression vector
Location of catalase in crystalline peroxisomes of methanol-grown Hansenula polymorpha
Keizer, Ineke; Roggenkamp, Rainer; Harder, Willem; Veenhuis, Marten
1992-01-01
We have studied the intraperoxisomal location of catalase in peroxisomes of methanol-grown Hansenula polymorpha by (immuno)cytochemical means. In completely crystalline peroxisomes, in which the crystalline matrix is composed of octameric alcohol oxidase (AO) molecules, most of the catalase protein
Expression of recombinant staphylokinase in the methylotrophic yeast Hansenula polymorpha
Directory of Open Access Journals (Sweden)
Moussa Manal
2012-12-01
Full Text Available Abstract Background Currently, the two most commonly used fibrinolytic agents in thrombolytic therapy are recombinant tissue plasminogen activator (rt-PA and streptokinase (SK. Whereas SK has the advantage of substantially lower costs when compared to other agents, it is less effective than either rt-PA or related variants, has significant allergenic potential, lacks fibrin selectivity and causes transient hypotensive effects in high dosing schedules. Therefore, development of an alternative fibrinolytic agent having superior efficacy to SK, approaching that of rt-PA, together with a similar or enhanced safety profile and advantageous cost-benefit ratio, would be of substantial importance. Pre-clinical data suggest that the novel fibrinolytic recombinant staphylokinase (rSAK, or related rSAK variants, could be candidates for such development. However, since an efficient expression system for rSAK is still lacking, it has not yet been fully developed or evaluated for clinical purposes. This study’s goal was development of an efficient fermentation process for the production of a modified, non-glycosylated, biologically active rSAK, namely rSAK-2, using the well-established single cell yeast Hansenula polymorpha expression system. Results The development of an efficient large scale (80 L Hansenula polymorpha fermentation process of short duration for rSAK-2 production is described. It evolved from an initial 1mL HTP methodology by successive scale-up over almost 5 orders of magnitude and improvement steps, including the optimization of critical process parameters (e.g. temperature, pH, feeding strategy, medium composition, etc.. Potential glycosylation of rSAK-2 was successfully suppressed through amino acid substitution within its only N-acetyl glycosylation motif. Expression at high yields (≥ 1g rSAK-2/L cell culture broth of biologically active rSAK-2 of expected molecular weight was achieved. Conclusion The optimized production process
van der Heide, M; Hollenberg, CP; van der Klei, IJ; Veenhuis, M
We have cloned the Hansenula polymorpha BIP gene from genomic DNA using a PCR-based strategy. H. polymorpha BIP encodes a protein of 665 amino acids, which shows very high homology to Saccharomyces cerevisiae KAR2p. KAR2p belongs to the Hsp70 family of molecular chaperones and resides in the
Atg21p is essential for macropexophagy and microautophagy in the yeast Hansenula polymorpha
Leão-Helder, Adriana N; Krikken, Arjen M; Gellissen, Gerd; van der Klei, Ida J; Veenhuis, Marten; Kiel, Jan A K W
2004-01-01
ATG genes are required for autophagy-related processes that transport proteins/organelles destined for proteolytic degradation to the vacuole. Here, we describe the identification and characterisation of the Hansenula polymorpha ATG21 gene. Its gene product Hp-Atg21p, fused to eGFP, had a dual
Vargas-Zapata, Rigoberto; Torres-González, Vladimira; Sepúlveda-Saavedra, Julio; Piñeyro-López, Alfredo; Rechinger, Karl B.; Keizer-Gunnink, Ineke; Kiel, Jan A.K.W.; Veenhuis, Marten
Previously we demonstrated that peroxisomicine A1 (T-514), a plant toxin isolated from Karwinskia species, has a deteriorating effect on the integrity of peroxisomes of methylotrophic yeasts. Here we describe two strains of Hansenula polymorpha, affected in the normal utilization of methanol as sole
Titorenko, Vladimir I.; Evers, Melchior E.; Diesel, Andre; Samyn, Bart; Beeumen, Josef van; Roggenkamp, Rainer; Kiel, Jan A.K.W.; Klei, Ida J. van der; Veenhuis, Marten
We have isolated two members of the Hsp70 protein family from the yeast Hansenula polymorpha using affinity chromatography. Both proteins were located in the cytoplasm. One of these, designated Hsp72, was inducible in nature (e.g. by heat shock). The second protein (designated Hsc74) was
Veenhuis, Marten; Douma, Anneke; Harder, Willem; Osumi, Masako
1983-01-01
Inactivation of peroxisomal enzymes in the yeast Hansenula polymorpha was studied following transfer of cells into cultivation media in which their activity was no longer required for growth. After transfer of methanol-grown cells into media containing glucose - a substrate that fully represses
Hiemstra, Harry; Dijkhuizen, Lubbert; Harder, Willem
1983-01-01
In the yeast Hansenula polymorpha an oxygen-requiring enzyme, alcohol oxidase, catalyzes the conversion of methanol into formaldehyde. After growth on methanol cells of the organism were harvested and entrapped in barium-alginate gels. The diffusion of oxygen towards these cells is seriously
Veenhuis, M.; Zwart, K.B.; Harder, W.
1981-01-01
Growth of Hansenula polymorpha in shake flasks and chemostat cultures in the presence of methanol as the sole source of carbon and methylamine as the sole source of nitrogen was associated with the development of peroxisomes in the cells. The organelles were involved in the concurrent oxidation of
Gietl, Christine; Faber, Klaas Nico; Klei, Ida J. van der; Veenhuis, Marten
1994-01-01
We have studied the significance of the N-terminal presequence of watermelon (Citrullus vulgaris) glyoxysomal malate dehydrogenase [gMDH; (S)-malate:NAD+ oxidoreductase; EC 1.1.1.37] in microbody targeting. The yeast Hansenula polymorpha was used as heterologous host for the in vivo expression of
Ishchuk, Olena P; Voronovsky, Andriy Y; Stasyk, Oleh V; Gayda, Galina Z; Gonchar, Mykhailo V; Abbas, Charles A; Sibirny, Andriy A
2008-11-01
Improvement of xylose fermentation is of great importance to the fuel ethanol industry. The nonconventional thermotolerant yeast Hansenula polymorpha naturally ferments xylose to ethanol at high temperatures (48-50 degrees C). Introduction of a mutation that impairs ethanol reutilization in H. polymorpha led to an increase in ethanol yield from xylose. The native and heterologous (Kluyveromyces lactis) PDC1 genes coding for pyruvate decarboxylase were expressed at high levels in H. polymorpha under the control of the strong constitutive promoter of the glyceraldehyde-3-phosphate dehydrogenase gene (GAPDH). This resulted in increased pyruvate decarboxylase activity and improved ethanol production from xylose. The introduction of multiple copies of the H. polymorpha PDC1 gene driven by the strong constitutive promoter led to a 20-fold increase in pyruvate decarboxylase activity and up to a threefold elevation of ethanol production.
Koning, W. de; Weusthuis, R.A.; Harder, W.; Dijkhuizen, L.
Various factors controlling dihydroxyacetone (DHA) and glycerol production from methanol by resting cell suspensions of a mutant of Hansenula polymorpha, blocked in DHA kinase and glycerol kinase, were investigated. The presence of methanol (250 mM) and an additional substrate (0.5%, w/v) to
Smutok, Oleh; Broda, Daniel; Smutok, Halyna; Dmytruk, Kostyantyn; Gonchar, Mykhailo
2011-04-01
In spite of the great interest to studies of the biological roles of chromium, as well as the toxic influence of Cr(VI)-species on living organisms, the molecular mechanisms of chromate bioremediation remain vague. A reductive pathway resulting in formation of less toxic Cr(III)-species is suggested to be the most important among possible mechanisms for chromate biodetoxification. The yeast l-lactate:cytochrome c-oxidoreductase (flavocytochrome b(2), FC b(2)) has absolute specificity for l-lactate, yet is non-selective with respect to its electron acceptor. These properties allow us to consider the enzyme as a potential candidate for chromate reduction by living cells in the presence of l-lactate. A recombinant strain of thermotolerant, methylotrophic yeast Hansenula polymorpha with sixfold increased FC b(2) enzyme activity (up to 3μmolmin(-1)mg(-1) protein in cell-free extract) compared to the parental strain was used for approval our suggestion. The recombinant cells, stored in dried state, as well as living yeast cells were tested for chromate-reducing activity in vitro in the presence of l-lactate (as an electron donor for chromate reduction) and different low molecular weight, redox-active mediators facilitating electron transfer from the reduced form of the enzyme to chromate (as a final electron acceptor): dichlorophenolindophenol (DCPIP), Methylene blue, Meldola blue, and Nile blue. It was shown that the highest chromate-reducing activity of the cells was achieved in the presence of DCPIP. The ability of chromate to catch electrons from the reduced flavocytochrome b(2) was confirmed using purified enzyme immobilized on the surface of a platinum electrode. The increasing concentration of Cr(VI) resulted in a decrease of enzyme-mediated current generated on the electrode during l-lactate oxidation. The shift and drop in amplitude of the peak in the cyclic voltammogram are indicative of Cr(VI)-dependent competition between reaction of chromate with reduced FC
Faber, Klaas Nico; Haima, Pieter; Gietl, Christine; Harder, Willem; Ab, Geert; Veenhuis, Marten
1994-01-01
Two main types of peroxisomal targeting signals have been identified that reside either at the extreme C terminus (PTS1) or the N terminus (PTS2) of the protein. In the methylotrophic yeast Hansenula polymorpha the majority of peroxisomal matrix proteins are of the PTS1 type. Thus far, for H.
Otzen, Marleen; Krikken, Arjen M; Ozimek, Paulina Z; Kurbatova, Elena; Nagotu, Shirisha; Veenhuis, Marten; van der Klei, Ida J
2006-01-01
The peroxin Pex19p is important for the formation of functional peroxisomal membranes. Here we show that Hansenula polymorpha Pex19p is also required for peroxisome inheritance. Peroxisome inheritance is partly defective when Pex19p farnesylation is blocked, whereas deletion of PEX19 resulted in a
International Nuclear Information System (INIS)
Postolache, Carmen; Postolache, Cristian; Dinu, Diana; Dinischiotu, Anca; Sahini, Victor Emanuel
2002-01-01
The post-irradiation repairing mechanisms of two Hansenula Polymorpha yeast enzymes, glucose-6-phosphate dehydrogenase and catalase, were studied. The kinetic parameters of the selected enzymes were investigated over one month since the moment of γ-irradiation with different doses in the presence of oxygen. Dose dependent decrease of initial reaction rates was noticed for both enzymes. Small variation of initial reaction rate was recorded for glucose-6-phosphate dehydrogenase over one month, with a decreasing tendency. No significant electrophoretic changes of molecular forms of this enzyme were observed after irradiation. Continuous strong decrease of catalase activity was evident for the first 20 days after irradiation. Partial recovery process of the catalytic activity was revealed by this study. (authors)
Directory of Open Access Journals (Sweden)
O. V. Blazhenko
2014-02-01
Full Text Available In a previous study we cloned GSH2 gene, encoding γ-glutamylcysteine synthetase (γGCS in the yeast Hansenula рolymorpha. In this study an analysis of molecular organisation of the H. рolymorpha GSH2 gene promoter was conducted and the potential binding sites of Yap1, Skn7, Creb/Atf1, and Cbf1 transcription factors were detected. It was established that full regulation of GSH2 gene expression in the response to cadmium and oxidative stress requires the length of GSH2 promoter to be longer than 450 bp from the start of translation initiation. To study the transcriptional regulation of H. polymorpha GSH2 gene recombinant strain, harbouring a reporter system, in which 1.832 kb regulatory region of GSH2 gene was fused to structural and terminatory regions of alcohol oxidase gene, was constructed. It was shown that maximum increase in H. polymorpha GSH2 gene transcription by 33% occurs in the rich medium under four-hour incubation with 1 μM concentration of cadmium ions. In the minimal medium the GSH2 gene expression does not correlate with the increased total cellular glutathione levels under cadmium ion treatment. We assume that the increased content of total cellular glutathione under cadmium stress in the yeast H. polymorpha probably is not controlled on the level of GSH2 gene transcription.
Directory of Open Access Journals (Sweden)
Schuhmann Wolfgang
2011-05-01
Full Text Available Abstract Background The detection and quantification of uric acid in human physiological fluids is of great importance in the diagnosis and therapy of patients suffering from a range of disorders associated with altered purine metabolism, most notably gout and hyperuricaemia. The fabrication of cheap and reliable urate-selective amperometric biosensors is a challenging task. Results A urate-selective microbial biosensor was developed using cells of the recombinant thermotolerant methylotrophic yeast Hansenula polymorpha as biorecognition element. The construction of uricase (UOX producing yeast by over-expression of the uricase gene of H. polymorpha is described. Following a preliminary screening of the transformants with increased UOX activity in permeabilized yeast cells the optimal cultivation conditions for maximal UOX yield namely a 40-fold increase in UOX activity were determined. The UOX producing cells were coupled to horseradish peroxidase and immobilized on graphite electrodes by physical entrapment behind a dialysis membrane. A high urate selectivity with a detection limit of about 8 μM was found. Conclusion A strain of H. polymorpha overproducing UOX was constructed. A cheap urate selective microbial biosensor was developed.
Directory of Open Access Journals (Sweden)
Sasi Sigawi
2014-01-01
Full Text Available Aliphatic amines, including methylamine, are air-pollutants, due to their intensive use in industry and the natural degradation of proteins, amino acids, and other nitrogen-containing compounds in biological samples. It is necessary to develop systems for removal of methylamine from the air, since airborne methylamine has a negative effect on human health. The primary amine oxidase (primary amine : oxygen oxidoreductase (deaminating or amine oxidase, AMO; EC 1.4.3.21, a copper-containing enzyme from the thermotolerant yeast Hansenula polymorpha which was overexpressed in baker’s yeast Saccharomyces cerevisiae, was tested for its ability to oxidize airborne methylamine. A continuous fluidized bed bioreactor (CFBR was designed to enable bioconversion of airborne methylamine by AMO immobilized in calcium alginate (CA beads. The results demonstrated that the bioreactor with immobilized AMO eliminates nearly 97% of the airborne methylamine. However, the enzymatic activity of AMO causes formation of formaldehyde. A two-step bioconversion process was therefore proposed. In the first step, airborne methylamine was fed into a CFBR which contained immobilized AMO. In the second step, the gas flow was passed through another CFBR, with alcohol oxidase from the yeast H. polymorpha immobilized in CA, in order to decompose the formaldehyde formed in the first step. The proposed system provided almost total elimination of the airborne methylamine and the formaldehyde.
Directory of Open Access Journals (Sweden)
Voronovsky Andriy Y
2008-07-01
Full Text Available Abstract Background The thermotolerant methylotrophic yeast Hansenula polymorpha is capable of alcoholic fermentation of xylose at elevated temperatures (45 – 48°C. Such property of this yeast defines it as a good candidate for the development of an efficient process for simultaneous saccharification and fermentation. However, to be economically viable, the main characteristics of xylose fermentation of H. polymorpha have to be improved. Results Site-specific mutagenesis of H. polymorpha XYL1 gene encoding xylose reductase was carried out to decrease affinity of this enzyme toward NADPH. The modified version of XYL1 gene under control of the strong constitutive HpGAP promoter was overexpressed on a Δxyl1 background. This resulted in significant increase in the KM for NADPH in the mutated xylose reductase (K341 → R N343 → D, while KM for NADH remained nearly unchanged. The recombinant H. polymorpha strain overexpressing the mutated enzyme together with native xylitol dehydrogenase and xylulokinase on Δxyl1 background was constructed. Xylose consumption, ethanol and xylitol production by the constructed strain were determined for high-temperature xylose fermentation at 48°C. A significant increase in ethanol productivity (up to 7.3 times was shown in this recombinant strain as compared with the wild type strain. Moreover, the xylitol production by the recombinant strain was reduced considerably to 0.9 mg × (L × h-1 as compared to 4.2 mg × (L × h-1 for the wild type strain. Conclusion Recombinant strains of H. polymorpha engineered for improved xylose utilization are described in the present work. These strains show a significant increase in ethanol productivity with simultaneous reduction in the production of xylitol during high-temperature xylose fermentation.
Kata, Iwona; Semkiv, Marta V; Ruchala, Justyna; Dmytruk, Kostyantyn V; Sibirny, Andriy A
2016-08-01
Conversion of byproduct from biodiesel production glycerol to high-value compounds is of great importance. Ethanol is considered a promising product of glycerol bioconversion. The methylotrophic thermotolerant yeast Ogataea (Hansenula) polymorpha is of great interest for this purpose as the glycerol byproduct contains methanol and heavy metals as contaminants, and this yeast utilizes methanol and is relatively resistant to heavy metals. Besides, O. polymorpha shows robust growth on glycerol and produces ethanol from various carbon sources. The thermotolerance of this yeast is an additional advantage, allowing increased fermentation temperature to 45-48 °C, leading to increased rate of the fermentation process and a fall in the cost of distillation. The wild-type strain of O. polymorpha produces insignificant amounts of ethanol from glycerol (0.8 g/l). Overexpression of PDC1 coding for pyruvate decarboxylase enhanced ethanol production up to 3.1 g/l, whereas simultaneous overexpression of PDC1 and ADH1 (coding for alcohol dehydrogenase) led to further increase in ethanol production from glycerol. Moreover, the increased temperature of fermentation up to 45 °C stimulated the production of ethanol from glycerol used as the only carbon source up to 5.0 g/l, which exceeds the data obtained by methylotrophic yeast strains reported so far. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.
Borrero, Juan; Kunze, Gotthard; Jiménez, Juan J; Böer, Erik; Gútiez, Loreto; Herranz, Carmen; Cintas, Luis M; Hernández, Pablo E
2012-08-01
The bacteriocin enterocin A (EntA) produced by Enterococcus faecium T136 has been successfully cloned and produced by the yeasts Pichia pastoris X-33EA, Kluyveromyces lactis GG799EA, Hansenula polymorpha KL8-1EA, and Arxula adeninivorans G1212EA. Moreover, P. pastoris X-33EA and K. lactis GG799EA produced EntA in larger amounts and with higher antimicrobial and specific antimicrobial activities than the EntA produced by E. faecium T136.
Directory of Open Access Journals (Sweden)
Schuhmann Wolfgang
2007-06-01
Full Text Available Abstract Background Accurate, rapid, and economic on-line analysis of ethanol is very desirable. However, available biosensors achieve saturation at very low ethanol concentrations and thus demand the time and labour consuming procedure of sample dilution. Results Hansenula polymorpha (Pichia angusta mutant strains resistant to allyl alcohol in methanol medium were selected. Such strains possessed decreased affinity of alcohol oxidase (AOX towards methanol: the KM values for AOX of wild type and mutant strains CA2 and CA4 are shown to be 0.62, 2.48 and 1.10 mM, respectively, whereas Vmax values are increased or remain unaffected. The mutant AOX alleles from H. polymorpha mutants CA2 and CA4 were isolated and sequenced. Several point mutations in the AOX gene, mostly different between the two mutant alleles, have been identified. Mutant AOX forms were isolated and purified, and some of their biochemical properties were studied. An amperometric biosensor based on the mutated form of AOX from the strain CA2 was constructed and revealed an extended linear response to the target analytes, ethanol and formaldehyde, as compared to the sensor based on the native AOX. Conclusion The described selection methodology opens up the possibility of isolating modified forms of AOX with further decreased affinity toward substrates without reduction of the maximal velocity of reaction. It can help in creation of improved ethanol biosensors with a prolonged linear response towards ethanol in real samples of wines, beers or fermentation liquids.
Silvestrini, Lucia; Rossi, Beatrice; Gallmetzer, Andreas; Mathieu, Martine; Scazzocchio, Claudio; Berardi, Enrico; Strauss, Joseph
2015-01-01
A few yeasts, including Hansenula polymorpha are able to assimilate nitrate and use it as nitrogen source. The genes necessary for nitrate assimilation are organised in this organism as a cluster comprising those encoding nitrate reductase (YNR1), nitrite reductase (YNI1), a high affinity transporter (YNT1), as well as the two pathway specific Zn(II)2Cys2 transcriptional activators (YNA1, YNA2). Yna1p and Yna2p mediate induction of the system and here we show that their functions are interdependent. Yna1p activates YNA2 as well as its own (YNA1) transcription thus forming a nitrate-dependent autoactivation loop. Using a split-YFP approach we demonstrate here that Yna1p and Yna2p form a heterodimer independently of the inducer and despite both Yna1p and Yna2p can occupy the target promoter as mono- or homodimer individually, these proteins are transcriptionally incompetent. Subsequently, the transcription factors target genes containing a conserved DNA motif (termed nitrate-UAS) determined in this work by in vitro and in vivo protein-DNA interaction studies. These events lead to a rearrangement of the chromatin landscape on the target promoters and are associated with the onset of transcription of these target genes. In contrast to other fungi and plants, in which nuclear accumulation of the pathway-specific transcription factors only occur in the presence of nitrate, Yna1p and Yna2p are constitutively nuclear in H. polymorpha. Yna2p is needed for this nuclear accumulation and Yna1p is incapable of strictly positioning in the nucleus without Yna2p. In vivo DNA footprinting and ChIP analyses revealed that the permanently nuclear Yna1p/Yna2p heterodimer only binds to the nitrate-UAS when the inducer is present. The nitrate-dependent up-regulation of one partner protein in the heterodimeric complex is functionally similar to the nitrate-dependent activation of nuclear accumulation in other systems.
The N-terminus of amine oxidase of Hansenula polymorpha contains a peroxisomal targeting signal
Faber, Klaas Nico; Keizer-Gunnink, Ineke; Pluim, Dick; Harder, Willem; AB, Geert; Veenhuis, Marten
1995-01-01
Here we describe the identification of the targeting sequence of peroxisomal amine oxidase (AMO) of H. polymorpha. Deletion analysis revealed that essential targeting information is located within the extreme N-terminal 16 amino acids. Moreover, this sequence can direct a reporter protein to the
Maekawa, Hiromi; Kaneko, Yoshinobu
2014-11-01
Yeast mating type is determined by the genotype at the mating type locus (MAT). In homothallic (self-fertile) Saccharomycotina such as Saccharomyces cerevisiae and Kluveromyces lactis, high-efficiency switching between a and α mating types enables mating. Two silent mating type cassettes, in addition to an active MAT locus, are essential components of the mating type switching mechanism. In this study, we investigated the structure and functions of mating type genes in H. polymorpha (also designated as Ogataea polymorpha). The H. polymorpha genome was found to harbor two MAT loci, MAT1 and MAT2, that are ∼18 kb apart on the same chromosome. MAT1-encoded α1 specifies α cell identity, whereas none of the mating type genes were required for a identity and mating. MAT1-encoded α2 and MAT2-encoded a1 were, however, essential for meiosis. When present in the location next to SLA2 and SUI1 genes, MAT1 or MAT2 was transcriptionally active, while the other was repressed. An inversion of the MAT intervening region was induced by nutrient limitation, resulting in the swapping of the chromosomal locations of two MAT loci, and hence switching of mating type identity. Inversion-deficient mutants exhibited severe defects only in mating with each other, suggesting that this inversion is the mechanism of mating type switching and homothallism. This chromosomal inversion-based mechanism represents a novel form of mating type switching that requires only two MAT loci.
HANSENULA WICKERHAMII SP. N., A NEW YEAST FROM FINNISH SOIL
Capriotti, Augusto
1961-01-01
Capriotti, Augusto (l'Università di Perugia, Perugia, Italy). Hansenula wickerhamii sp. n., a new yeast from Finnish soil. J. Bacteriol. 82:259–360. 1961.—Hansenula wickerhamii sp. n. is described; it was isolated from a Finnish soil, and is named in honor of Lynferd J. Wickerham. Images PMID:13690638
DEFF Research Database (Denmark)
Viigand, Katrin; Visnapuu, Triinu; Mardo, Karin
2016-01-01
and mutation of the genes. We studied substrate specificity of the maltase protein MAL1 from an earlier diverged yeast, Ogataea polymorpha (Op), in the light of this hypothesis. MAL1 has extended substrate specificity and its properties are strikingly similar to those of resurrected ancMALS. Moreover, amino......, indicating the power of the method to predict substrate binding. Deletion of either the maltase (MAL1) or α-glucoside permease (MAL2) gene in Op abolished the growth of yeast on MAL1 substrates, confirming the requirement of both proteins for usage of these sugars....
Directory of Open Access Journals (Sweden)
Engelbrecht Christoph
2009-12-01
Full Text Available Abstract Background In the past decade, an enormous number of new bioprocesses have evolved in the biotechnology industry. These bioprocesses have to be developed fast and at a maximum productivity. Up to now, only few microbioreactors were developed to fulfill these demands and to facilitate sample processing. One predominant reaction platform is the shaken microtiter plate (MTP, which provides high-throughput at minimal expenses in time, money and work effort. By taking advantage of this simple and efficient microbioreactor array, a new online monitoring technique for biomass and fluorescence, called BioLector, has been recently developed. The combination of high-throughput and high information content makes the BioLector a very powerful tool in bioprocess development. Nevertheless, the scalabilty of results from the micro-scale to laboratory or even larger scales is very important for short development times. Therefore, engineering parameters regarding the reactor design and its operation conditions play an important role even on a micro-scale. In order to evaluate the scale-up from a microtiter plate scale (200 μL to a stirred tank fermenter scale (1.4 L, two standard microbial expression systems, Escherichia coli and Hansenula polymorpha, were fermented in parallel at both scales and compared with regard to the biomass and protein formation. Results Volumetric mass transfer coefficients (kLa ranging from 100 to 350 1/h were obtained in 96-well microtiter plates. Even with a suboptimal mass transfer condition in the microtiter plate compared to the stirred tank fermenter (kLa = 370-600 1/h, identical growth and protein expression kinetics were attained in bacteria and yeast fermentations. The bioprocess kinetics were evaluated by optical online measurements of biomass and protein concentrations exhibiting the same fermentation times and maximum signal deviations below 10% between the scales. In the experiments, the widely applied green
The moonlighting function of pyruvate carboxylase resides in the non-catalytic end of the TIM barrel
Huberts, Daphne H. E. W.; Venselaar, Hanka; Vriend, Gert; Veenhuis, Marten; van der Klei, Ida J.
Pyruvate carboxylase is a highly conserved enzyme that functions in replenishing the tricarboxylic acid cycle with oxaloacetate. In the yeast Hansenula polymorpha, the pyruvate carboxylase protein is also required for import and assembly of the peroxisomal enzyme alcohol oxidase. This additional
Methanol Metabolism in Yeasts : Regulation of the Synthesis of Catabolic Enzymes
Egli, Th.; Dijken, J.P. van; Veenhuis, M.; Harder, W.; Fiechter, A.
1980-01-01
The regulation of the synthesis of four dissimilatory enzymes involved in methanol metabolism, namely alcohol oxidase, formaldehyde dehydrogenase, formate dehydrogenase and catalase was investigated in the yeasts Hansenula polymorpha and Kloeckera sp. 2201. Enzyme profiles in cell-free extracts of
Peroxisomal catalase deficiency modulates yeast lifespan depending on growth conditions
Kawalek, Adam; Lefevre, Sophie D.; Veenhuis, Marten; van der Klei, Ida J.
We studied the role of peroxisomal catalase in chronological aging of the yeast Hansenula polymorpha in relation to various growth substrates. Catalase-deficient (cat) cells showed a similar chronological life span (CLS) relative to the wild-type control upon growth on carbon and nitrogen sources
Enzymatic halogenation and oxidation using an alcohol oxidase-vanadium chloroperoxidase cascade
But, Andrada; Noord, Van Aster; Poletto, Francesca; Sanders, Johan P.M.; Franssen, Maurice C.R.; Scott, Elinor L.
2017-01-01
The chemo-enzymatic cascade which combines alcohol oxidase from Hansenula polymorpha (AOXHp) with vanadium chloroperoxidase (VCPO), for the production of biobased nitriles from amino acids was investigated. In the first reaction H2O2 (and acetaldehyde) are generated from ethanol and oxygen by AOXHp.
Walker, G.K.; Black, M.G.; Edwards, C.A.
1996-01-01
Adult zebra (Dreissena polymorpha) and quagga (Dreissena bugensis) mussels were induced to release large quantities of live spermatozoa by the administration of 5-hydroxytryptamine (serotonin). Sperm were photographed alive using phase-contrast microscopy and were fixed subsequently with glutaraldehyde followed by osmium tetroxide for eventual examination by transmission or scanning electron microscopy. The sperm of both genera are of the ect-aquasperm type. Their overall dimensions and shape allow for easy discrimination at the light and scanning electron microscopy level. Transmission electron microscopy of the cells reveals a barrel-shaped nucleus in zebra mussel sperm and an elongated nucleus in quagga mussel sperm. In both species, an acrosome is cradled in a nuclear fossa. The ultrastructure of the acrosome and axial body, however, is distinctive for each species. The structures of the midpiece are shown, including a unique mitochondrial "skirt" that includes densely packed parallel cristae and extends in a narrow sheet from the mitochondria.
Molloy, D P; Giambérini, L; Stokes, N A; Burreson, E M; Ovcharenko, M A
2012-04-01
Extensive connective tissue lysis is a common outcome of haplosporidian infection. Although such infections in marine invertebrates are well documented, they are relatively rarely observed in freshwater invertebrates. Herein, we report a field study using a comprehensive series of methodologies (histology, dissection, electron microscopy, gene sequence analysis, and molecular phylogenetics) to investigate the morphology, taxonomy, systematics, geographical distribution, pathogenicity, and seasonal and annual prevalence of a haplosporidian observed in zebra mussels, Dreissena polymorpha. Based on its genetic sequence, morphology, and host, we describe Haplosporidium raabei n. sp. from D. polymorpha - the first haplosporidian species from a freshwater bivalve. Haplosporidium raabei is rare as we observed it in histological sections in only 0·7% of the zebra mussels collected from 43 water bodies across 11 European countries and in none that were collected from 10 water bodies in the United States. In contrast to its low prevalences, disease intensities were quite high with 79·5% of infections advanced to sporogenesis.
Schäfer, S; Hamer, B; Treursić, B; Möhlenkamp, C; Spira, D; Korlević, M; Reifferscheid, G; Claus, E
2012-05-01
The zebra mussel Dreissena polymorpha is widely used as sentinel organism for the assessment of environmental contamination in freshwater environments. However, in the River Rhine (Germany), the D. polymorpha population is declining, whereas the closely related quagga mussel D. bugensis is found in high numbers at some sites. In the present laboratory study, D. polymorpha and D. bugensis were exposed to resuspended native sediments for ≤2 weeks. Wet sediments (quagga mussel can be used as alternative test organism for the zebra mussel.
Directory of Open Access Journals (Sweden)
Xin Wang
2016-03-01
Full Text Available Marchantia polymorpha L. is a representative bryophyte used as a traditional Chinese medicinal herb for scald and pneumonia. The phytochemicals in M. polymorpha L. are terpenoids and flavonoids, among which especially the flavonoids show significant human health benefits. Many researches on the gametophyte of M. polymorpha L. have been reported. However, as the reproductive organ of M. polymorpha L., the bioactivity and flavonoids profile of the archegoniophore have not been reported, so in this work the flavonoid profiles, antioxidant and acetylcholinesterase inhibition activities of the extracts from the archegoniophore and gametophyte of M. polymorpha L. were compared by radical scavenging assay methods (DPPH, ABTS, O2−, reducing power assay, acetylcholinesterase inhibition assay and LC-MS analysis. The results showed that the total flavonoids content in the archegoniophore was about 10-time higher than that of the gametophyte. Differences between the archegoniophore and gametophyte of M. polymorpha L. were observed by LC-MS analysis. The archegoniophore extracts showed stronger bio-activities than those of the gametophyte. The archegoniophore extract showed a significant acetylcholinesterase inhibition, while the gametophyte extract hardly inhibited it.
Viigand, Katrin; Visnapuu, Triinu; Mardo, Karin; Aasamets, Anneli
2016-01-01
Abstract Saccharomyces cerevisiae maltases use maltose, maltulose, turanose and maltotriose as substrates, isomaltases use isomaltose, α‐methylglucoside and palatinose and both use sucrose. These enzymes are hypothesized to have evolved from a promiscuous α‐glucosidase ancMALS through duplication and mutation of the genes. We studied substrate specificity of the maltase protein MAL1 from an earlier diverged yeast, Ogataea polymorpha (Op), in the light of this hypothesis. MAL1 has extended substrate specificity and its properties are strikingly similar to those of resurrected ancMALS. Moreover, amino acids considered to determine selective substrate binding are highly conserved between Op MAL1 and ancMALS. Op MAL1 represents an α‐glucosidase in which both maltase and isomaltase activities are well optimized in a single enzyme. Substitution of Thr200 (corresponds to Val216 in S. cerevisiae isomaltase IMA1) with Val in MAL1 drastically reduced the hydrolysis of maltose‐like substrates (α‐1,4‐glucosides), confirming the requirement of Thr at the respective position for this function. Differential scanning fluorimetry (DSF) of the catalytically inactive mutant Asp199Ala of MAL1 in the presence of its substrates and selected monosaccharides suggested that the substrate‐binding pocket of MAL1 has three subsites (–1, +1 and +2) and that binding is strongest at the –1 subsite. The DSF assay results were in good accordance with affinity (K m) and inhibition (K i) data of the enzyme for tested substrates, indicating the power of the method to predict substrate binding. Deletion of either the maltase (MAL1) or α‐glucoside permease (MAL2) gene in Op abolished the growth of yeast on MAL1 substrates, confirming the requirement of both proteins for usage of these sugars. © 2016 The Authors. Yeast published by John Wiley & Sons, Ltd. PMID:26919272
Biotransformation and Production from Hansenula Anomala to Natural Ethyl Phenylacetate
Directory of Open Access Journals (Sweden)
Tian Xun
2015-01-01
Full Text Available Ethyl phenylacetate can be widely applied in many industries, such as food, medicines, cosmetics and medicinal herbs. At the moment, the production of natural ethyl phenylacetate is very limited. However, the biotransformation production of natural ethyl phenylacetate has an very extensive application prospect. This paper is written by taking the phenylacetic acid tolerance and the esterifying enzyme activity as the two indexes for screening the HA14 strain of hansenula anomala mutagenic which is regarded as the microorganism of ethyl phenylacetate production through biotransformation. By optimizing the production condition of phenylacetic acid and the esterification condition of ethyl phenylacetate, the production of ethyl phenylacetate accomplished through biotransformation within 72 hours can reach 864mg/L which is 171% of that of the initial bacterial strain.
Energy Technology Data Exchange (ETDEWEB)
Jefanova, O.; Marciulioniene, D. [Nature Research Centre, Akademijos str. 2, LT-08412 Vilnius, Lietuva (Lithuania)
2014-07-01
The specific activity of {sup 137}Cs, {sup 60}Co, {sup 54}Mn, {sup 90}Sr was measured in mollusks Dreissena polymorpha samples from lake Drukshiai that is the cooling pond of the Ignalina NPP. Item the accumulation of {sup 137}Cs, {sup 90}Sr, {sup 144}Ce, {sup 106}Ru in the mollusks from water and from phytoplankton which is a part of their diet was evaluated under laboratory conditions. The data of long-term (1991-2009) studies conducted at six monitoring stations of lake Drukshiai show that in 1991 {sup 137}Cs in mollusks Dreissena polymorpha was found only in that lake's area which was influenced by the effluent that got into lake from the industrial drainage channel of Ignalina NPP. In later periods of the investigation the {sup 137}Cs specific activity was detected in mollusks samples which had been collected at other monitoring stations (the aquatory of lake Drukshiai). Meanwhile {sup 60}Co and {sup 54}Mn in Dreissena polymorpha were detected only in that lake's area which was impacted by the industrial drainage channel. The data of long-term investigation show that the major amount of radionuclides has come into lake Drukshiai through the industrial drainage system of Ignalina NPP. Albeit {sup 137}Cs, {sup 90}Sr, {sup 144}Ce, {sup 106}Ru get into the mollusks through a large amount of the water rather than from the food (phytoplankton), therefore the food can also be the main source of radionuclides in the organism of these mollusks in aquatic environment when there are low levels of specific activities of these radionuclides. (authors)
Potet, Marine; Giambérini, Laure; Pain-Devin, Sandrine; Louis, Fanny; Bertrand, Carole; Devin, Simon
2018-01-15
Differential tolerance to stress is partly responsible for the heterogeneity of biomarker responses between populations of a sentinel species. Although currently used for freshwater biomonitoring, studies concerning inter-populational variability in tolerance to contaminants for the zebra mussel (Dreissena polymorpha) are scarce. Moreover, this well-known invader is currently replaced by another, the quagga mussel (Dreissena rostriformis bugensis). To evaluate the differential tolerance between dreissenids, several populations of both species were exposed to a high concentration of nickel. A LT 50 (time when 50% of individuals were dead) was established for each population. Biomarker responses and internal nickel concentration were also measured, to link tolerance with physiological status. Results evidenced that D. polymorpha populations are more heterogeneous and more tolerant than D. r. bugensis ones. For D. polymorpha populations only, LT 50 values were positively correlated with the nickel contamination in situ, with higher anti-oxidative defences and a higher Integrated Biomarker Response value in the field. Such findings may be explained by local adaptation and invasion dynamic within each species. The significance of this differential tolerance when using biomarker responses for biomonitoring purposes is thus discussed.
Schaller, Jörg; Planer-Friedrich, Britta
2017-05-01
Organic sediments in aquatic ecosystems are well known sinks for nutrients, silicon, and metal(loid)s. Organic matter-consuming organisms like invertebrate shredders, grazers, and bioturbators significantly affect element fixation or remobilization by changing redox conditions or binding properties of organic sediments. Little is known about the effect of filter feeders, like the zebra mussel Dreissena polymorpha, an invasive organism in North American and European freshwater ecosystems. A laboratory batch experiment exposing D. polymorpha (∼1200 organisms per m 2 ) to organic sediment from a site contaminated with arsenic, copper, lead, and uranium revealed a significant uptake and accumulation of arsenic, copper, iron, and especially uranium both into the soft body tissues and the seashell. This is in line with previous observations of metal(loid) accumulation from biomonitoring studies. Regarding its environmental impact, D. polymorpha significantly contributed to mobilization of silicon, iron, phosphorus, arsenic, and copper and to immobilization of uranium (p < 0.001), probably driven by redox conditions, microbial activity within the gut system, or active control of element homeostasis. No net mobilization or immobilization was observed for zinc and lead, because of their low mobility at the prevailing pH of 7.5-8.5. The present results suggest that D. polymorpha can both ameliorate (nutrient mobilization, immobilization of toxicants mobile under oxic conditions) or aggravate negative effects (mobilization of toxicants mobile under reducing conditions) in ecosystems. Relating the results of the present study to observed population densities in natural freshwater ecosystems suggests a significant influence of D. polymorpha on element cycling and needs to be considered in future studies. Copyright © 2017 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Françoise Immel
Full Text Available The zebra mussel Dreissena polymorpha is a well-established invasive model organism. Although extensively used in environmental sciences, virtually nothing is known of the molecular process of its shell calcification. By describing the microstructure, geochemistry and biochemistry/proteomics of the shell, the present study aims at promoting this species as a model organism in biomineralization studies, in order to establish a bridge with ecotoxicology, while sketching evolutionary conclusions. The shell of D. polymorpha exhibits the classical crossed-lamellar/complex crossed lamellar combination found in several heterodont bivalves, in addition to an external thin layer, the characteristics of which differ from what was described in earlier publication. We show that the shell selectively concentrates some heavy metals, in particular uranium, which predisposes D. polymorpha to local bioremediation of this pollutant. We establish the biochemical signature of the shell matrix, demonstrating that it interacts with the in vitro precipitation of calcium carbonate and inhibits calcium carbonate crystal formation, but these two properties are not strongly expressed. This matrix, although overall weakly glycosylated, contains a set of putatively calcium-binding proteins and a set of acidic sulphated proteins. 2D-gels reveal more than fifty proteins, twenty of which we identify by MS-MS analysis. We tentatively link the shell protein profile of D. polymorpha and the peculiar recent evolution of this invasive species of Ponto-Caspian origin, which has spread all across Europe in the last three centuries.
Characterization of the plasma membrane H+-ATPase in the liverwort Marchantia polymorpha.
Okumura, Masaki; Inoue, Shin-ichiro; Takahashi, Koji; Ishizaki, Kimitsune; Kohchi, Takayuki; Kinoshita, Toshinori
2012-06-01
The plasma membrane H(+)-ATPase generates an electrochemical gradient of H(+) across the plasma membrane that provides the driving force for solute transport and regulates pH homeostasis and membrane potential in plant cells. Recent studies have demonstrated that phosphorylation of the penultimate threonine in H(+)-ATPase and subsequent binding of a 14-3-3 protein is the major common activation mechanism for H(+)-ATPase in vascular plants. However, there is very little information on the plasma membrane H(+)-ATPase in nonvascular plant bryophytes. Here, we show that the liverwort Marchantia polymorpha, which is the most basal lineage of extant land plants, expresses both the penultimate threonine-containing H(+)-ATPase (pT H(+)-ATPase) and non-penultimate threonine-containing H(+)-ATPase (non-pT H(+)-ATPase) as in the green algae and that pT H(+)-ATPase is regulated by phosphorylation of its penultimate threonine. A search in the expressed sequence tag database of M. polymorpha revealed eight H(+)-ATPase genes, designated MpHA (for M. polymorpha H(+)-ATPase). Four isoforms are the pT H(+)-ATPase; the remaining isoforms are non-pT H(+)-ATPase. An apparent 95-kD protein was recognized by anti-H(+)-ATPase antibodies against an Arabidopsis (Arabidopsis thaliana) isoform and was phosphorylated on the penultimate threonine in response to the fungal toxin fusicoccin in thalli, indicating that the 95-kD protein contains pT H(+)-ATPase. Furthermore, we found that the pT H(+)-ATPase in thalli is phosphorylated in response to light, sucrose, and osmotic shock and that light-induced phosphorylation depends on photosynthesis. Our results define physiological signals for the regulation of pT H(+)-ATPase in the liverwort M. polymorpha, which is one of the earliest plants to acquire pT H(+)-ATPase.
Import of peroxisomal matrix proteins in the yeast Hansenula polymorpha
Gunkel, Katja
2005-01-01
Archaea, prokaryotes and eukaryotes form the three kingdoms of life. The smallest unit of life, which can exist independently, is a cell. Archaea and prokaryotes have a relatively very simple architecture. The cytoplasm (cellulars pace), containing all metabolites, proteins and genetic material
Decline of Ohia (Metrosideros polymorpha) in Hawaii: a review
Charles S. Hodges; Ken T. Adee; John D. Stein; Hulton B. Wood; Robert D. Doty
1986-01-01
Portions of the ohia (Metrosideros polymorpha) forests on the windward slopes of Mauna Loa and Mauna Kea on the island of Hawaii began dying in 1952. Little mortality has occurred since 1972. About 50,000 ha are affected by the decline. Individual trees exhibit several symptoms, from slow progressive dieback to rapid death. Seven types of decline...
Parameters affecting methanol utilization by yeasts
Energy Technology Data Exchange (ETDEWEB)
Foda, M.S.; El-Masry, H.G.
1981-01-01
Screening of 28 yeast cultures, representing 22 species of various yeasts, with respect to their capabilities to assimilate methanol, has shown that this property was mostly found in certain species of the two genera Hansenula and Candida. When methanol was used as a sole carbon source for a methanol-adapted strain of Hansenula polymorpha, a linear yield response could be obtained with increasing alcohol up to 2% concentration. The amount of inoculum proved to be the decisive factor in determining a priori the ability of the organism to grow at 6% methanol as final concentration. The optimum pH values for growth ranged between 4.5-5.5 with no growth at pH 6.5 or higher. A marked growth stimulation was obtained when the medium was supplied with phosphate up to 0.08 M as final concentration. Within the nitrogen sources tested, corn steep liquor concentrate gave the highest yield of cells. The significance of the obtained results are discussed with reference to feasibilities of application.
Rajagopal, S.; Pollux, B.J.A.; Peters, J.L.; Cremers, G.; Moon- van der Staay, S.Y.; Alen, van T.; Eygensteyn, J.; Hoek, van A.H.A.M.; Palau, A.; Vaate, de A.B.; Velde, van der G.
2009-01-01
The zebra mussel, Dreissena polymorpha is an aquatic nuisance invasive species originally native to the Ponto-Caspian region where it is found in lakes and delta areas of large rivers draining into the Black and Caspian seas. The dispersal of D. polymorpha began at the end of the 18th century, at a
Nelson, Jessica M; Hauser, Duncan A; Hinson, Rosemary; Shaw, A Jonathan
2018-05-01
Fungal symbioses are ubiquitous in plants, but their effects have mostly been studied in seed plants. This study aimed to assess the diversity of fungal endophyte effects in a bryophyte and identify factors contributing to the variability of outcomes in these interactions. Fungal endophyte cultures and axenic liverwort clones were isolated from wild populations of the liverwort, Marchantia polymorpha. These collections were combined in a gnotobiotic system to test the effects of fungal isolates on the growth rates of hosts under laboratory conditions. Under the experimental conditions, fungi isolated from M. polymorpha ranged from aggressively pathogenic to strongly growth-promoting, but the majority of isolates caused no detectable change in host growth. Growth promotion by selected fungi depended on nutrient concentrations and was inhibited by coinoculation with multiple fungi. The M. polymorpha endophyte system expands the resources for this model liverwort. The experiments presented here demonstrate a wealth of diversity in fungal interactions even in a host reported to lack standard mycorrhizal symbiosis. In addition, they show that some known pathogens of vascular plants live in M. polymorpha and can confer benefits to this nonvascular host. This highlights the importance of studying endophyte effects across the plant tree of life. © 2018 The Authors. New Phytologist © 2018 New Phytologist Trust.
Decomposition of Metrosideros polymorpha leaf litter along elevational gradients in Hawaii
Paul G. Scowcroft; Douglas R. Turner; Peter M. Vitousek
2000-01-01
We examined interactions between temperature, soil development, and decomposition on three elevational gradients, the upper and lower ends of each being situated on a common lava flow or ash deposit. We used the reciprocal transplant technique to estimate decomposition rates of Metrosideros polymorpha leaf litter during a three-year period at warm...
Assimilation and depuration of microcystin–LR by the zebra mussel, Dreissena polymorpha
Pires, L.M.D.; Karlsson, K.M.; Meriluoto, J.A.O.; Kardinaal, E.A.; Visser, P.M.; Siewertsen, K.; Van Donk, E.; Ibelings, B.W.
2004-01-01
Zebra mussels (Dreissena polymorpha) are an important component of the foodweb of shallow lakes in the Netherlands, amongst others in Lake IJsselmeer, an international important wetland. Large numbers of ducks feed on these mussels in autumn and winter. The mussels are filter feeders and are exposed
Directory of Open Access Journals (Sweden)
Romualda Chuševė
2012-11-01
Full Text Available We report the first results of a parasitological study ofDreissena polymorpha (zebra mussels from the brackishCuronian Lagoon, SE Baltic Sea. Zebra mussels were collected monthlyfrom May to October 2011 from a site near the mouth of the River Nemunas.Three types of endosymbionts were found in the mantle cavity andvisceral mass of the molluscs during dissections, i.e. thecommensal ciliate Conchophthirus acuminatus and parasitic ciliateOphryoglena sp., and rarely encountered, unidentified nematodes.The abundances of C. cuminatus and Ophryoglena sp.were positively associated with host shell length and watertemperature, but no effect of water salinity was detected.As the endosymbionts are either highly host-specific to zebra mussels(C. acuminatus and Ophryoglena sp. or are probablyfree-living organisms that inadvertently infect the molluscs (nematodes,we conclude that the presence of D. polymorpha in theCuronian Lagoon does not pose any serious parasitologicalrisk to native biota. We emphasize, however, that this conclusionshould be treated with caution as it is based on a study conductedonly at a single location. Our work extends the currentlyscarce records of D. polymorpha parasites and commensals frombrackish waters, and adds to a better understanding of the ecologicalimpact this highly invasive mollusc causes in the areas it has invaded.
Tsuboyama, Shoko; Kodama, Yutaka
2014-01-01
The liverwort Marchantia polymorpha L. is being developed as an emerging model plant, and several transformation techniques were recently reported. Examples are biolistic- and Agrobacterium-mediated transformation methods. Here, we report a simplified method for Agrobacterium-mediated transformation of sporelings, and it is termed Agar-utilized Transformation with Pouring Solutions (AgarTrap). The procedure of the AgarTrap was carried out by simply exchanging appropriate solutions in a Petri dish, and completed within a week, successfully yielding sufficient numbers of independent transformants for molecular analysis (e.g. characterization of gene/protein function) in a single experiment. The AgarTrap method will promote future molecular biological study in M. polymorpha.
Kajiwara, Shota; Yamada, Ryosuke; Ogino, Hiroyasu
2018-04-10
Simple and cost-effective lipase expression host microorganisms are highly desirable. A combinatorial library strategy is used to improve the secretory expression of lipase from Bacillus thermocatenulatus (BTL2) in the culture supernatant of Saccharomyces cerevisiae. A plasmid library including expression cassettes composed of sequences encoding one of each 15 promoters, 15 secretion signals, and 15 terminators derived from yeast species, S. cerevisiae, Pichia pastoris, and Hansenula polymorpha, is constructed. The S. cerevisiae transformant YPH499/D4, comprising H. polymorpha GAP promoter, S. cerevisiae SAG1 secretion signal, and P. pastoris AOX1 terminator, is selected by high-throughput screening. This transformant expresses BTL2 extra-cellularly with a 130-fold higher than the control strain, comprising S. cerevisiae PGK1 promoter, S. cerevisiae α-factor secretion signal, and S. cerevisiae PGK1 terminator, after cultivation for 72 h. This combinatorial library strategy holds promising potential for application in the optimization of the secretory expression of proteins in yeast. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Modelling the effects of diving ducks on zebra mussels Dreissena polymorpha in lakes
Nes, van E.H.; Noordhuis, R.; Lammens, E.H.R.R.; Portielje, R.; Reeze, B.; Peeters, E.T.H.M.
2008-01-01
An individual-based model describing the growth of zebra mussels (Dreissena polymorpha) is presented. The model is spatially explicit and predicts length¿frequency distributions of zebra mussels. The parameters and model inputs with the strongest effect on the model outcomes were identified using a
Deans, Bianca J; Tedone, Laura; Bissember, Alex C; Smith, Jason A
2018-06-07
An investigation of the previously unexamined ancient Tasmanian clone Lomatia tasmanica W. M. Curtis (Proteaceae) and two other endemic species Lomatia tinctoria R. Br. and Lomatia polymorpha (Labill.) R. Br. was undertaken. This represents the first extensive natural products study in which individual phytochemical components have been isolated and identified from these three Lomatia species. Extraction of L. tasmanica leaves provided the naphthoquinone juglone (0.34% w/w), and n-alkanes nonacosane and heptacosane (0.30% w/w combined). L. polymorpha afforded the flavonoid glycosides dihydroquercetin 3-O-β-D-xyloside (0.22% w/w) and quercetin 3-O-β-d-glucose (0.14% w/w), as well as the naphthalene glucoside 1,4,8-trihydroxynaphthalene-1-O-β-d-glucose (0.04% w/w) and 4-O-p-coumaroyl-d-glucose (0.03% w/w). In addition, both L. polymorpha and L. tinctoria contained juglone (0.32% w/w and 0.58% w/w, respectively). L. polymorpha provided tetracosan-1-ol, hexacosan-1-ol and octacosan-1-ol (0.07% w/w combined), while L. tinctoria gave nonacosane (0.13% w/w). Analysis of three individual specimens from each of the three species demonstrated consistency in the respective phytochemical profiles of these populations and tentatively suggests limited intraspecific variation. Copyright © 2018 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Luschuetzky, E.F. [Univ. Wien, Inst. fuer Zoologie, Abt. fuer Ultrastrukturforschung und Elektronenmikroskopie, Wien (Austria)
2005-07-01
Goal and scope. This study was undertaken to investigate the differences in heavy metal burden between the organisms and environmental compartments and to evaluate the role of Dreissena polymorpha as a bioindicator organism. Methods. The concentrations of zinc, copper, cadmium and lead in whole soft body and selected tissues of D. polymorpha at two river habitats in Austria were examined using atomic absorption spectroscopy (AAS). Concentrations in organisms were compared to those in sediment and water. Results and conclusion. Zebra mussels of the river Drau showed generally higher heavy metal concentrations as compared to mussels of the river Danube and contained elevated zinc and cadmium levels as compared to metal concentrations found in soft tissues of zebra mussels from uncontaminated sites in Germany and The Netherlands. The essential metals zinc and copper were mainly accumulated in gills, foot and byssal gland tissue of the mussel, in contrast to the non-essential metals cadmium and lead which were found predominantly in the midgut gland. The heavy metal concentrations in both, sediments and mussel tissue, were higher than in water samples. There was no correlation between the concentrations in water and in the organisms except for zinc. In contrast, correlations were found between concentrations in sediments and mussel soft tissue. Recommendation and perspective. Further investigations should include the examination of sediments and consider the mechanism of food uptake to assess the role of D. polymorpha as a bioindicator organism. (orig.)
Low cost production of perdeuterated biomass using methylotrophic yeasts
International Nuclear Information System (INIS)
Haon, S.; Auge, S.; Tropis, M.; Milon, A.; Lindley, N.D.
1993-01-01
Three strains of methylotropic yeasts, Candida boidinii, Pichia angusta (previously Hansenula polymorpha) and Pichia pastoris, were studied for their capacity to grow on methanol in deuterated media. Growth rates, determined relative to the extent of deuteration of water and/or methanol, showed that water deuteration was the major limiting factor. After adaptation to deuterium by progressive transfer through media of increasing deuteration, growth rates were diminished relative to those obtained on hydrogenated media of identical salts composition: the two Pichia species retained the highest growth rates in the full deuterated medium. Perdeuterated biomass (16 g) was obtained in a 1 liter fed-batch fermentation and the extent of deuteration of isolated ergosterol has been shown to be 97.5% by mass spectrometric analysis. (Author)
Del Piero, Stefania; Masiero, Luciano; Casellato, Sandra
2012-11-01
Fluoride toxicity and bioaccumulation tests (short- and long-term) were performed on the nonindigenous freshwater mollusk Dreissena polymorpha at two different temperatures: 17 ± 0.5°C and 22 ± 0.5°C. Concentrations that did not result in toxicity in short-term experiments (96 h) induced effects over a longer period (17 weeks), especially at the warmest temperature, highlighting the role of this parameter. Fluoride bioaccumulation increased linearly with increasing concentration and temperature, reaching 4,202 µg F(-)/g dry weight in soft tissues only after 48 h of exposure at 22°C at a concentration of 640 mg F(-)/L. Comparing tolerance to fluoride and bioaccumulation values of this species with those of other freshwater invertebrates, D. polymorpha was much more resistant and revealed its capacity to accumulate a great quantity of this xenobiotic substance. The results of the present study demonstrated that fluoride accumulation in the soft tissue of this animal was much higher (up to 1,409.6 µg F(-)/g dry wt) than that in its shell (up to 706.4 µg F(-)/g dry wt). If we consider this datum and the fact that D. polymorpha is widespread in many aquatic ecosystems around the world, representing a food source for many birds and other vertebrates, we must acknowledge the possibility that it can represent a serious danger in view of fluoride biomagnification in the aquatic environment. Copyright © 2012 SETAC.
Pires, L.M.D.; Bontes, B.M.; Van Donk, E.; Ibelings, B.W.
2005-01-01
Colony forming and toxic cyanobacteria form a problem in surface waters of shallow lakes, both for recreation and wildlife. Zebra mussels, Dreissena polymorpha, have been employed to help to restore shallow lakes in the Netherlands, dominated by cyanobacteria, to their former clear state. Zebra
International Nuclear Information System (INIS)
Riva, Consuelo; Binelli, Andrea; Provini, Alfredo
2008-01-01
Zebra mussel (Dreissena polymorpha) has been used for the biomonitoring of several POPs (PCBs, DDTs, HCB and HCHs) in the largest Italian subalpine great lakes (Lake Maggiore, Garda, Como, Iseo and Lugano). Samplings were carried out in April 2003 at 15 locations selected according to industrial and anthropic levels of lakes. Results have pointed out high DDT levels in D. polymorpha specimens from Lake Maggiore (700-1400 ng/g lipids, 5-9 times higher than those measured in mussels of other Italian lakes), due to a contamination from a chemical plant located on one of the main lake inlet that occurred in 1996. On the contrary, PCB levels (400-2509 ng/g lipids) highlighted an overall pollution, with some sporadic peaks of contamination. Data showed a moderate increase trend compared to those found in a previous monitoring campaign carried out in 1996. Future monitoring is needed in order to confirm this tendency. - Significant levels of DDTs and PCBs are still present in the Italian subalpine great lakes
Energy Technology Data Exchange (ETDEWEB)
Riva, Consuelo [Department of Biology, Ecology Section, University of Milan, Via Celoria 26, 20133 Milan (Italy)], E-mail: consuelo.riva@unimi.it; Binelli, Andrea; Provini, Alfredo [Department of Biology, Ecology Section, University of Milan, Via Celoria 26, 20133 Milan (Italy)
2008-02-15
Zebra mussel (Dreissena polymorpha) has been used for the biomonitoring of several POPs (PCBs, DDTs, HCB and HCHs) in the largest Italian subalpine great lakes (Lake Maggiore, Garda, Como, Iseo and Lugano). Samplings were carried out in April 2003 at 15 locations selected according to industrial and anthropic levels of lakes. Results have pointed out high DDT levels in D. polymorpha specimens from Lake Maggiore (700-1400 ng/g lipids, 5-9 times higher than those measured in mussels of other Italian lakes), due to a contamination from a chemical plant located on one of the main lake inlet that occurred in 1996. On the contrary, PCB levels (400-2509 ng/g lipids) highlighted an overall pollution, with some sporadic peaks of contamination. Data showed a moderate increase trend compared to those found in a previous monitoring campaign carried out in 1996. Future monitoring is needed in order to confirm this tendency. - Significant levels of DDTs and PCBs are still present in the Italian subalpine great lakes.
Pollux, B.J.A.; Minchin, D.; Van der Velde, G.; Van Alen, T.; Moon-Van der Staay, S.Y.; Hackstein, J.
2003-01-01
The zebra mussel (Dreissena polymorpha) is an aquatic nuisance species that invaded Ireland around 1994. We studied the invasion of the zebra mussel combining field surveys and genetic studies, to determine the origin of invasion and the vector of introduction. Field surveys showed that live zebra
Use of zebra mussel (dreissena polymorpha) to assess trace metals in river water
International Nuclear Information System (INIS)
Anzano, J.; Lasheras, R.J.; Bonilla, A.; Anwar, J.
2007-01-01
Ebro river (Spain) has been fairly contaminated by industrial effluents: The toxicity level of the river due to heavy metals has been monitored by analyzing zebra mussels (Dreissena Polymorpha) samples as bioindicator. To access the level of toxicity ten metals (AI, Cd, Cr, Cu, Fe, Ni, Pb, Se, Sn and Zn) were determined by Voltamperometry. The conditions of determination were optimized for each metal prior to determination. Aqueous solutions of metals concerned were used as standards in detenpinations. (author)
Kageyama, Akito; Ishizaki, Kimitsune; Kohchi, Takayuki; Matsuura, Hideyuki; Takahashi, Kosaku
2015-09-01
Environmental stresses are effective triggers for the biosynthesis of various secondary metabolites in plants, and phytohormones such as jasmonic acid and abscisic acid are known to mediate such responses in flowering plants. However, the detailed mechanism underlying the regulation of secondary metabolism in bryophytes remains unclear. In this study, the induction mechanism of secondary metabolites in the model liverwort Marchantia polymorpha was investigated. Abscisic acid (ABA) and ultraviolet irradiation (UV-C) were found to induce the biosynthesis of isoriccardin C, marchantin C, and riccardin F, which are categorized as bisbibenzyls, characteristic metabolites of liverworts. UV-C led to the significant accumulation of ABA. Overexpression of MpABI1, which encodes protein phosphatase 2C (PP2C) as a negative regulator of ABA signaling, suppressed accumulation of bisbibenzyls in response to ABA and UV-C irradiation and conferred susceptibility to UV-C irradiation. These data show that ABA plays a significant role in the induction of bisbibenzyl biosynthesis, which might confer tolerance against UV-C irradiation in M. polymorpha. Copyright © 2015 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Couleau, Nicolas; Techer, Didier [Universite de Lorraine, Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), CNRS UMR 7146, IUT Thionville-Yutz, Espace Cormontaigne, Yutz, F-57970 (France); Pagnout, Christophe [Universite de Lorraine, Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), UMR 7146, Campus Bridoux, rue du General Delestraint, Metz, F-57070 (France); International Consortium for the Environmental Implications of Nanotechnology, iCEINT, http://www.i-ceint.org (France); Jomini, Stephane [Universite de Lorraine, Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), UMR 7146, Campus Bridoux, rue du General Delestraint, Metz, F-57070 (France); Foucaud, Laurent; Laval-Gilly, Philippe; Falla, Jairo [Universite de Lorraine, Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), CNRS UMR 7146, IUT Thionville-Yutz, Espace Cormontaigne, Yutz, F-57970 (France); Bennasroune, Amar, E-mail: amar.bennasroune@univ-metz.fr [Universite de Lorraine, Laboratoire des Interactions Ecotoxicologie, Biodiversite, Ecosystemes (LIEBE), CNRS UMR 7146, IUT Thionville-Yutz, Espace Cormontaigne, Yutz, F-57970 (France)
2012-11-01
The widespread use of titanium-based nanoparticles and their environmental release may pose a significant risk to aquatic organisms within freshwater ecosystems. Suspension-feeder invertebrates like bivalve molluscs represent a unique target group for nanoparticle toxicology. The aim of this work was to investigate the short-term responses of Dreissena polymorpha hemocytes after in vivo exposure to titanium dioxide nanoparticles (TiO{sub 2} NP). For this purpose, freshwater mussels were exposed to P25 TiO{sub 2} NP at the concentrations of 0.1, 1, 5 and 25 mg/L during 24 h. Viability, phagocytosis activity and mitogen activated protein kinase (MAPK) phosphorylation level of ERK 1/2 and p38 in hemocytes extracted from exposed mussels were compared to those from control specimens. Results demonstrated an inhibition of the phagocytosis activity after exposure to TiO{sub 2} NP at 0.1 and 1 mg/L. Similar trends, albeit less pronounced, were reported for higher concentrations of NP. Transmission electron microscopy showed for the first time the internalization of TiO{sub 2} NP into Dreissena polymorpha hemocytes. Besides, exposure to NP increased the ERK 1/2 phosphorylation levels in all treatments. Concerning the phosphorylation level of p38, only exposures to 5 and 25 mg/L of NP induced significant p38 activation in comparison to that of the control. Finally, these short-term effects observed at environmentally relevant concentrations highlighted the need for further studies concerning ecotoxicological evaluation of nanoparticle release into an aquatic environment. -- Highlights: Black-Right-Pointing-Pointer Phagocytosis inhibition at TiO{sub 2} NP exposure concentrations of 0.1 and 1 mg/L. Black-Right-Pointing-Pointer Internalization of TiO{sub 2} NP in freshwater mussel hemocytes. Black-Right-Pointing-Pointer Increased phosphorylation level of p38 and ERK 1/2 after in vivo exposure to TiO{sub 2} NP.
Dionisio Pires, L.M.; Jonker, R.R.; Donk, E.van; Laanbroek, H.J.
2004-01-01
1. Selective grazing of adults and larvae of the zebra mussel (Dreissena polymorpha) on phytoplankton and detritus from both laboratory cultures and natural seston was quantified using flow cytometry. 2. Mean clearance rate of adult zebra mussels was higher on a mixture of the green
Leeuw, de J.J.
1999-01-01
The foraging skills of Tufted Duck Aythya fuligula and Scaup Aythya marila feeding on Zebra Mussels Dreissena polymorpha were studied in experiments under semi-natural diving conditions with relevance to the IJsselmeer/Markermeer area (large lakes in the centre of The Netherlands, former Zuiderzee
Modelling the Risk Posed by the Zebra Mussel Dreissena polymorpha: Italy as a Case Study.
Bosso, Luciano; De Conno, Carmelina; Russo, Danilo
2017-08-01
We generated a risk map to forecast the potential effects of the spreading of zebra mussels Dreissena polymorpha across the Italian territory. We assessed the invader's potential impact on rivers, lakes, watersheds and dams at a fine-grained scale and detected those more at risk that should be targeted with appropriate monitoring. We developed a MaxEnt model and employed weighted overlay analyses to detect the species' potential distribution and generate risk maps for Italy. D. polymorpha has a greater probability of occurring at low to medium altitudes in areas characterised by fluviatile deposits of major streams. Northern and central Italy appear more at risk. Some hydroelectric power dams are at high risk, while most dams for irrigation, drinkable water reservoirs and other dam types are at medium to low risk. The lakes and rivers reaches (representing likely expansion pathways) at medium-high or high risk mostly occur in northern and central Italy. We highlight the importance of modelling potential invasions on a country scale to achieve the sufficient resolution needed to develop appropriate monitoring plans and prevent the invader's harmful effects. Further high-resolution risk maps are needed for other regions partly or not yet colonised by the zebra mussel.
Modelling the Risk Posed by the Zebra Mussel Dreissena polymorpha: Italy as a Case Study
Bosso, Luciano; De Conno, Carmelina; Russo, Danilo
2017-08-01
We generated a risk map to forecast the potential effects of the spreading of zebra mussels Dreissena polymorpha across the Italian territory. We assessed the invader's potential impact on rivers, lakes, watersheds and dams at a fine-grained scale and detected those more at risk that should be targeted with appropriate monitoring. We developed a MaxEnt model and employed weighted overlay analyses to detect the species' potential distribution and generate risk maps for Italy. D. polymorpha has a greater probability of occurring at low to medium altitudes in areas characterised by fluviatile deposits of major streams. Northern and central Italy appear more at risk. Some hydroelectric power dams are at high risk, while most dams for irrigation, drinkable water reservoirs and other dam types are at medium to low risk. The lakes and rivers reaches (representing likely expansion pathways) at medium-high or high risk mostly occur in northern and central Italy. We highlight the importance of modelling potential invasions on a country scale to achieve the sufficient resolution needed to develop appropriate monitoring plans and prevent the invader's harmful effects. Further high-resolution risk maps are needed for other regions partly or not yet colonised by the zebra mussel.
Pires, L.M.D.; Jonker, R.M.; Van Donk, E.; Laanbroek, H.J.
2004-01-01
1. Selective grazing of adults and larvae of the zebra mussel (Dreissena polymorpha) on phytoplankton and detritus from both laboratory cultures and natural seston was quantified using flow cytometry. 2. Mean clearance rate of adult zebra mussels was higher on a mixture of the green alga Scenedesmus
De Leeuw, JJ
1999-01-01
The foraging skills of Tufted Duck Aythya fuligula and Scaup Aythya marila feeding on Zebra Mussels Dreissena polymorpha were studied in experiments under seminatural diving conditions with relevance to the IJssalmeer/Markermeer area (large lakes in the centre of The Netherlands, former Zuiderzee
International Nuclear Information System (INIS)
Jin Xiang; Mao Peihong; Lu Jie; Ma Yuan
2010-01-01
Glycyrrhizic acid (GA) in Glycyrrhiza uralensis (G. uralensis) is physiologically active. In this study, the total DNA of wild G. uralensis was randomly transformed into Hansenula anomaly by implantation of low-energy Ar + and N + , to produce five recombinant yeast strains relating to biological synthesis of the GA or Glycyrrhetinic acid (GAs). After culturing in liquid medium for 96 h, the resultant GA, 18α-GAs and 18β-Gas were determined by reversed-phase high performance liquid chromatography (RP-HPLC), and the corresponding concentrations were 114.49, 0.56, and 0.81 mg·L -1 . After one hundred primers were analyzed with random amplified polymorphic DNA (RAPD), the seven different DNA fragments were produced by the N7059 strain of recombined yeasts, and, the polymerase chain reaction (PCR) verified that one of them came from the genome of G. uralensis, indicating a successful transfer of genetic information by ion implantation. (authors)
Lewis, K.M.; Feder, J.L.; Horvath, T.G.; Lamberti, G.A.
2000-01-01
A number of studies have found positive associations between allozyme heterozygosity and fitness surrogates (e.g., body size and growth rate) for marine molluscs. We investigated whether similar relationships exist for freshwater populations of the zebra mussel, Dreissena polymorpha. Only one significant correlation between multi-locus heterozygosity and shell length was observed for a total of 22 D. polymorpha populations surveyed from midwestern U.S.A. lakes and streams, and the result was not significant on a table-wide basis. Meta-analysis revealed a significant common correlation coefficient (effect magnitude) between multi-locus heterozygosity and shell length across all 22 sites (rc = 0.052, P = 0.019, 1557 df). However, the variance in shell length explained by multi-locus heterozygosity was small (rc2 = 0.0027), implying a weak causal relationship if any. Also, we saw no relationship between heterozygosity and growth rate in a one-year field enclosure experiment. A significant heterozygosity-shell length correlation previously reported for a zebra mussel population at Put-in-Bay, Lake Erie, Ohio, may have been the product of unique population dynamics, rather than natural selection. Similar demographic considerations may contribute to inconsistencies in heterozygosity-fitness correlations seen for other molluscs.
International Nuclear Information System (INIS)
Frank, Sabrina N.; Singer, Christoph; Sures, Bernd
2008-01-01
The effects of different exposure concentrations of palladium (Pd) on relative metallothionein (MT) response and bioaccumulation were investigated in zebra mussels (Dreissena polymorpha). The mussels were exposed to 0.05, 5, 50, and 500 μg/L Pd 2+ for 10 weeks under controlled temperature and fasting conditions. Relative MT contents were assessed by a modified Ag-saturation method, which allows to discriminate between MT bound to Pd (Pd-MT) and MT bound to unidentified metals (Ag-MT). Determination of metal contents resulted from atomic absorption spectrometry following a microwave digestion. For unexposed mussels and mussels exposed to 0.05 μg/L Pd no metal accumulation could be detected. All other exposure concentrations resulted in detectable Pd accumulation in mussels with final tissue concentrations of 96 μg/g (500 μg/L), 45 μg/g (50 μg/L), and 9 μg/g (5 μg/L). Compared with initial levels Pd-MT concentrations at the end of the exposure period were 600 (500 μg/L), 160 (50 μg/L), and 27 (5 μg/L) times higher. These results show that an increase in MTs in D. polymorpha already occurs at relatively low aqueous Pd concentrations indicating that there is the need for detoxification of Pd in the mussel. Furthermore, correlations between Ag-MT and Pd accumulation indicate that higher exposure concentrations are associated with adverse effects on the mussels. Thus, harmful effects of chronic Pd exposure of organisms even in lowest concentrations cannot be excluded in the environment
Fluorescence analysis of the Hansenula polymorpha peroxisomal targeting signal-1 receptor, Pex5p
Boteva, R.; Koek, A.; Visser, N.V.; Visser, A.J.W.G.; Krieger, E.; Zlateva, T.; Veenhuis, M.; Klei, van der I.
2003-01-01
Correct sorting of newly synthesized peroxisomal matrix proteins is dependent on a peroxisomal targeting signal (PTS). So far two PTSs are known. PTS1 consists of a tripeptide that is located at the extreme C terminus of matrix proteins and is specifically recognized by the PTS1-receptor Pex5p. We
Rossatto,Davi Rodrigo; Kolb,Rosana Marta
2010-01-01
Gochnatia polymorpha (Less.) Cabrera is a widespread Asteraceae species found in different physiognomies of cerrado (Neotropical savanna) and in forest formations of southeast Brazil. This study describes some leaf anatomy characteristics of this species and quantitatively evaluates them in relation to different environments, as well as under different light conditions. We found quantitative differences in all anatomical parameters analyzed. The results demonstrate that high leaf anatomy plas...
Influence of lead tetraethyl on the growth of Funaria hygrometrica L. and Marchantia polymorpha L.
Directory of Open Access Journals (Sweden)
Irena Krupińska
2015-01-01
Full Text Available The influence of various lead tetraethyl concentrations (mixture added to petrol as antiknock agent on the growth and development of Funaria hygrometrica L. spores and of Marchantia polymorpha L. gemmulae was investigated. An inhibitory effect of the concentration applied was noted on germination and growth of spores and gemmulae development. Lead tetraethyl produces disturbances In the development of these plants, gradual degeneration of chloroplasts occurs and inhibition of growth leading to profusely branched "dwarf" forms. The disturbances are largely reversible.
Leeuw, de J.J.; Eerden, van M.R.; Visser, G.H.
1999-01-01
Diving ducks face the strongly cooling properties of aquatic environments. In experiments with Tufted Ducks Aythya fuligula feeding on zebra mussels Dreissena polymorpha in outdoor cages, we measured changes in food consumption and diving behaviour in relation to water temperature (3-22°C). Water
de Leeuw, JJ; van Eerden, MR; Visser, GH
Diving ducks face the strongly cooling properties of aquatic environments. In experiments with Tufted Ducks Aythya fuligula feeding on zebra mussels Dreissena polymorpha in outdoor cages, we measured changes in food consumption and diving behaviour in relation to water temperature (3-22 degrees C).
Conn, D B; Ricciardi, A; Babapulle, M N; Klein, K A; Rosen, D A
1996-01-01
Dreissenid mussels, Dreissena polymorpha and D. bugensis, were found to be infected by the naidid oligochaete Chaetogaster limnaei at four sites in the St. Lawrence River. This is the first report of this species infecting dreissenids anywhere in the world. Most worms inhabited the mantle cavity, where they caused erosion of the mantle and gill epithelia as determined by histopathological examination. Others penetrated various tissues; one had invaded the ovary and was feeding on oocytes and ovarian tissues. Of 606 mussels examined, 166 (27.4%) harbored at least 1 C. limnaei. The prevalence varied between 1% and 80%, depending on the collection site and date. The worms were slightly but significantly more prevalent in D. bugensis than in D. polymorpha. The intensity ranged from 1 to 18 worms per infected host. Variations in prevalence and intensity were not related to the size or sex of the host, but the data did suggest some seasonality.
Energy Technology Data Exchange (ETDEWEB)
Avakyan, Z A
1967-01-01
Polarographic study of Pb/sup 2 +/, Cd/sup 2 +/, Co/sup 2 +/, and Ni/sup 2 +/ concentration in different media has shown that at pH 6.0, Pb/sup 2 +/ is always precipitated by phosphates and cannot be determined polarographically. Cd, Co and Ni content is somewhat lower than that found in water solutions. The effect of Ag, Hg, Co, Ni, Pb, and Cd ions on the growth of 3 strains of Rhodotorula, Hansenula anomala and T. utilis, 6 strains of Serratia, 6 strains of Azotobacter, 12 strains of Pseudomonas and 2 strains of E. coli was studied. According to their toxicity for the microoganisms tested, heavy metals should be arranged in the following order: Ag>Hg>Cogreater than or equal toNi>Cd. Yeasts are the least sensitive to the action of heavy metals, cf. come serratia, Pseudomonas, Azotobacter and E. coli.
Factorial microarray analysis of zebra mussel (Dreissena polymorpha: Dreissenidae, Bivalvia adhesion
Directory of Open Access Journals (Sweden)
Faisal Mohamed
2010-05-01
Full Text Available Abstract Background The zebra mussel (Dreissena polymorpha has been well known for its expertise in attaching to substances under the water. Studies in past decades on this underwater adhesion focused on the adhesive protein isolated from the byssogenesis apparatus of the zebra mussel. However, the mechanism of the initiation, maintenance, and determination of the attachment process remains largely unknown. Results In this study, we used a zebra mussel cDNA microarray previously developed in our lab and a factorial analysis to identify the genes that were involved in response to the changes of four factors: temperature (Factor A, current velocity (Factor B, dissolved oxygen (Factor C, and byssogenesis status (Factor D. Twenty probes in the microarray were found to be modified by one of the factors. The transcription products of four selected genes, DPFP-BG20_A01, EGP-BG97/192_B06, EGP-BG13_G05, and NH-BG17_C09 were unique to the zebra mussel foot based on the results of quantitative reverse transcription PCR (qRT-PCR. The expression profiles of these four genes under the attachment and non-attachment were also confirmed by qRT-PCR and the result is accordant to that from microarray assay. The in situ hybridization with the RNA probes of two identified genes DPFP-BG20_A01 and EGP-BG97/192_B06 indicated that both of them were expressed by a type of exocrine gland cell located in the middle part of the zebra mussel foot. Conclusions The results of this study suggested that the changes of D. polymorpha byssogenesis status and the environmental factors can dramatically affect the expression profiles of the genes unique to the foot. It turns out that the factorial design and analysis of the microarray experiment is a reliable method to identify the influence of multiple factors on the expression profiles of the probesets in the microarray; therein it provides a powerful tool to reveal the mechanism of zebra mussel underwater attachment.
Xu, Wei; Faisal, Mohamed
2010-05-28
The zebra mussel (Dreissena polymorpha) has been well known for its expertise in attaching to substances under the water. Studies in past decades on this underwater adhesion focused on the adhesive protein isolated from the byssogenesis apparatus of the zebra mussel. However, the mechanism of the initiation, maintenance, and determination of the attachment process remains largely unknown. In this study, we used a zebra mussel cDNA microarray previously developed in our lab and a factorial analysis to identify the genes that were involved in response to the changes of four factors: temperature (Factor A), current velocity (Factor B), dissolved oxygen (Factor C), and byssogenesis status (Factor D). Twenty probes in the microarray were found to be modified by one of the factors. The transcription products of four selected genes, DPFP-BG20_A01, EGP-BG97/192_B06, EGP-BG13_G05, and NH-BG17_C09 were unique to the zebra mussel foot based on the results of quantitative reverse transcription PCR (qRT-PCR). The expression profiles of these four genes under the attachment and non-attachment were also confirmed by qRT-PCR and the result is accordant to that from microarray assay. The in situ hybridization with the RNA probes of two identified genes DPFP-BG20_A01 and EGP-BG97/192_B06 indicated that both of them were expressed by a type of exocrine gland cell located in the middle part of the zebra mussel foot. The results of this study suggested that the changes of D. polymorpha byssogenesis status and the environmental factors can dramatically affect the expression profiles of the genes unique to the foot. It turns out that the factorial design and analysis of the microarray experiment is a reliable method to identify the influence of multiple factors on the expression profiles of the probesets in the microarray; therein it provides a powerful tool to reveal the mechanism of zebra mussel underwater attachment.
Directory of Open Access Journals (Sweden)
Davi Rodrigo Rossatto
2010-09-01
Full Text Available Gochnatia polymorpha (Less. Cabrera is a widespread Asteraceae species found in different physiognomies of cerrado (Neotropical savanna and in forest formations of southeast Brazil. This study describes some leaf anatomy characteristics of this species and quantitatively evaluates them in relation to different environments, as well as under different light conditions. We found quantitative differences in all anatomical parameters analyzed. The results demonstrate that high leaf anatomy plasticity is an adaptive advantage that allows this species to occur in diverse cerrado conditions.Gochnatia polymorpha (Less. Cabrera é uma espécie de Asteraceae com ampla distribuição no bioma cerrado, sendo encontrada em diversas fisionomias florestais da região sudeste do Brasil. O presente estudo descreve alguns caracteres anatômicos foliares dessa espécie e os analisa quantitativamente em função de sua ocorrência nas formações florestais e também das diferenças de luminosidade. Foram encontradas diferenças quantitativas em todos os parâmetros anatômicos analisados. Os resultados demonstram que a alta plasticidade anatômica foliar nesta espécie pode ser considerada como uma vantagem adaptativa que a permite ocorrer em diversos ambientes do cerrado.
Stoyanova, Stefka; Nikolov, Galin; Velichkova, Katya; Atanasoff, Alexander; Mumun, Sevdegul
2015-01-01
Zebra mussels (Dreissena polymorpha) are bivalve mollusks approximately 1 to 5 cm long that live in freshwater lakes. They have invaded many Bulgarian freshwater ecosystems in recent decades. Because of their ability to settle on almost any substrate, zebra mussels cause severe damage to closed water systems, RAS and intensive fish farming systems. In order to assess the status of the mussel population in the lake in the area of the Forest group fish farm, the distribution, extent of coloniza...
International Nuclear Information System (INIS)
Sures, Bernd; Zimmermann, Sonja
2007-01-01
Zebra mussels (Dreissena polymorpha) were exposed to different types of water containing PGE salts (PtCl 4 , PdSO 4 , RhCl 3 ) to investigate the influence of humic substances on the aqueous solubility, uptake and bioaccumulation of noble metals. The results showed a time dependent decrease of the aqueous PGE concentrations in tank water for all groups. This could mainly be related to non-biological processes. The aqueous solubility of Pd and Rh was higher in humic water compared with non-chlorinated tap water, whereas Pt showed opposing results. Highest metal uptake rates and highest bioaccumulation plateaus were found for Pd, followed by Pt and Rh. Pd uptake and bioaccumulation was significantly hampered by humic substances, whose presence appear to increase Pt uptake and bioaccumulation. No clear trend emerged for Rh. Differences in effects of humic matter among the PGE may be explained by formation of metal complexes with different fractions of humic substances. - Precious metal accumulation in Dreissena polymorpha is affected by humic substances
Energy Technology Data Exchange (ETDEWEB)
Kraak, M.H.S.; Wijnands, P.; Govers, H.A.J.; Admiraal, W.; Voogt, P. de [Univ. of Amsterdam (Netherlands)
1997-10-01
Effects of four benzoquinoline isomers on the filtration rate of the zebra mussel (Dreissena polymorpha) were analyzed, to study the effect of minor differences in chemical structure on adverse biological effects. Filtration rates were measured after 48 h of exposure to different concentrations of acridine, phenanthridine, benzo[f]quinoline, and benzo[h]quinoline in the water. The 50% effective concentration (EC50) values for filtration rate of the four isomers differed significantly. Effects increased in the order benzo[f], -[h], -[b], and -[c]quinoline, and the difference between the most toxic isomer and the least toxic isomer amounted to a factor of 30. Attempts were made to relate these differences in toxicity to the structure of the isomers. Size- or topology-related molecular descriptors provided insufficient resolution to distinguish between the benzoquinoline isomers, and none of the electronic descriptors separately provided a significant correlation with the observed effects. In an alternative approach, molecular shape, accessibility, and minimum agent-macromolecule distance were used to represent repulsive and attractive forces between the benzoquinoline isomers and biological membranes. This approach could tentatively explain the observed effects and is supported by a high correlation between the EC50 data and the reversed-phase C18-HPLC behavior of the benzoquinolines (k{sub 0}), which is likely to be governed by similar processes.
REYNOLDS J. D.; DONOHOE R.
2001-01-01
The zebra mussel Dreissena polymorpha, native to the Aralo-Caspian region, has spread across Europe in the last 180 years. Although it reached England in 1820, it only arrived in Ireland in around 1995, probably attached to the hull of pleasure boats, and since then has spread through the lowland Shannon and Erne systems, which are linked by canal. While White-clawed crayfish Austropotamobius pallipes (Lereboullet) occur in these systems, Dreissena has not yet colonized sites with large crayf...
Energy Technology Data Exchange (ETDEWEB)
Al-Aasm, I.S.; Clarke, J.D.; Fryer, B.J. [Windsor Univ., ON (Canada). Dept. of Earth Sciences
1998-02-01
Dreissena polymorpha is an exotic freshwater bivalve species which was introduced into the Great Lakes system in the fall of 1985 through the release of ballast water from European freighters. Utilizing individual growth rings of the shells, the stable isotope distribution ({delta}{sup 18}O and {delta}{sup 13}C) was determined for the life history of selected samples which were collected from the western basin of Lake Erie. These bivalves deposit their shell in near equilibrium with the ambient water and thus reflect any annual variation of the system in the isotopic records held within their shells. Observed values for {delta}{sup 18}O range from -6.64 to -9.46 permille with an average value of -7.69 permille PDB, while carbon values ranged from -0.80 to -4.67 permille with an average value of -1.76 permille PDB. Dreissena polymorpha shells incorporate metals into their shells during growth. Individual shell growth increments were analyzed for Pb, Fe, Mg, Mn, Cd, Cu, and V concentrations. The shells show increased uptake of certain metals during periods of isotopic enrichment which correspond with warmer water temperatures. Since metals are incorporated into the shells, the organism may be useful as a biomonitor of metal pollution within aquatic environments. (orig.)
Oganjan, Katarina; Lauringson, Velda; Kotta, Jonne; Rostin, Liis; Martin, Georg
2017-01-01
Species invasions are modifying ecosystems worldwide. Coexistence of invasive species of no common evolutionary history in their new ranges enables the study of ecological rules shaping novel communities at their initial stages. In oligohaline parts of the Baltic Sea, the most dominant and widespread epifaunal suspension feeders are invasive mussels Dreissena polymorpha and cirripeds Amphibalanus improvisus. This study experimentally evaluated recruitment and microhabitat use in response to environmental forcing in these two species in a eutrophic bay. Recruitment was structured by different microhabitat exploitation patterns coupled with both individual and interactive effects of several environmental gradients. Despite functional similarity, the importance of environmental gradients differed between these species: mussel recruitment was best explained by temperature while barnacle recruitment was best explained by wave exposure. Zebra mussels were more fastidious about surface orientation than barnacles. The preferred orientations also differed between species, as mussels strongly preferred horizontal surfaces, while barnacles were more abundant on vertical surfaces. Increase in one species also predicted well the abundance of the other, especially for barnacles, as mussel abundance was the best predictor of barnacle abundance over all the other factors. The extent of microhabitat segregation correlated weakly over the studied range of the most important environmental gradients. The study shows that coexistence of functionally similar non-native D. polymorpha and A. improvisus in their sympatric range is likely determined by complex interactions between these species, their different microhabitat exploitation patterns, environmental limitations and optima.
Wagner, James M; Alper, Hal S
2016-04-01
Coupling the tools of synthetic biology with traditional molecular genetic techniques can enable the rapid prototyping and optimization of yeast strains. While the era of yeast synthetic biology began in the well-characterized model organism Saccharomyces cerevisiae, it is swiftly expanding to include non-conventional yeast production systems such as Hansenula polymorpha, Kluyveromyces lactis, Pichia pastoris, and Yarrowia lipolytica. These yeasts already have roles in the manufacture of vaccines, therapeutic proteins, food additives, and biorenewable chemicals, but recent synthetic biology advances have the potential to greatly expand and diversify their impact on biotechnology. In this review, we summarize the development of synthetic biological tools (including promoters and terminators) and enabling molecular genetics approaches that have been applied in these four promising alternative biomanufacturing platforms. An emphasis is placed on synthetic parts and genome editing tools. Finally, we discuss examples of synthetic tools developed in other organisms that can be adapted or optimized for these hosts in the near future. Copyright © 2015 Elsevier Inc. All rights reserved.
Stokes, B. O.; Petersen, G. R.
1982-01-01
The benefits and deficiencies of various candidates for a controlled ecological life support system (CELSS) for manned spacecraft missions of at least 3-14 yr are discussed. Conventional plants are considered unacceptable due to their inefficient production of foodstuffs and overproduction of stems and leafy matter. The alternate concepts are algae and/or bacteria or chemical synthesis of food. Microorganisms are considered the most promising because of their direct use of CO2 and possible utilization of waste streams. Yeasts are cited as the most viable candidates, since a large data base and experience already exists in the commercial food industry. The addition of hydrogen bactria and solar-grown algae is recommended, together with genetic manipulation experiments to tailor the microorganisms to production of foodstuffs closer to the 70 percent carbohydrate, 20 percent protein, and 10 percent lipid optimal food currently accepted. The yeast strain, Hansenula polymorpha, has been successfully grown in methanol and encouraged to produce a 55 percent carbohydrate content.
Svenningsen, Nanna B.; Heisterkamp, Ines M.; Sigby-Clausen, Maria; Larsen, Lone H.; Nielsen, Lars Peter; Stief, Peter
2012-01-01
Nitrification in shell biofilms and denitrification in the gut of the animal accounted for N2O emission by Dreissena polymorpha (Bivalvia), as shown by gas chromatography and gene expression analysis. The mussel's ammonium excretion was sufficient to sustain N2O production and thus potentially uncouples invertebrate N2O production from environmental N concentrations. PMID:22492461
Bioaccumulation and partitioning of cadmium within the freshwater mussel Dreissena polymorpha Pallas
International Nuclear Information System (INIS)
Bias, R.; Karbe, L.
1985-01-01
Kinetics of uptake, partitioning and elimination of cadmium were investigated in experimental studies with the freshwater mussel, Dreissena polymorpha. 109 Cd and 115 Cd were used as tracers. Shells, soft parts and body fluid of the mussel exhibited considerable differences in accumulation and elimination. Accumulation factors up to more than 70,000 were calculated for the periostracum, whereas accumulation factors for the whole mussels ranging up to 3,000 were calculated. The shells bound a great deal of cadmium, but only loosely, and the metal could be readily eliminated after transfer to uncontaminated water. In contrast, no significant amounts of the cadmium incorporated in the soft parts were eliminated. The results indicate that the major portion of cadmium in the soft parts is strongly bound and cannot be eliminated by exchange processes. (author)
Biomonitoring of Inland and Inshore Waters with Use of Dreissena Polymorpha Mussels
Directory of Open Access Journals (Sweden)
Matuszak Piotr
2015-09-01
Full Text Available The pollution of water that is used for consumption and in agricultural holdings contributes to an increased mortality rate, inhibition of growth and physiological functions, changes in the DNA (genotoxicity, changes within tissues (cytotoxicity and organs of individuals who are exposed to chemical components. One of the most dangerous toxin classes which have effect on animals and humans who come into contact with contaminated water is the class of cyanobacterial toxins released by dying cyanobacteria. They contribute to very serious health conditions and also to fatalities. Toxins of this type are relatively difficult to detect on account of their seasonal changeability in blooming. One of the most effective methods of detecting water contamination automatically and continuously is biomonitoring with the use of Dreissena polymorpha mussels.
Energy Technology Data Exchange (ETDEWEB)
Sures, Bernd [Department of Applied Zoology/Hydrobiology, University of Duisburg-Essen, D-45177 Essen (Germany)]. E-mail: bernd.sures@uni-due.de; Zimmermann, Sonja [Department of Applied Zoology/Hydrobiology, University of Duisburg-Essen, D-45177 Essen (Germany)
2007-03-15
Zebra mussels (Dreissena polymorpha) were exposed to different types of water containing PGE salts (PtCl{sub 4}, PdSO{sub 4}, RhCl{sub 3}) to investigate the influence of humic substances on the aqueous solubility, uptake and bioaccumulation of noble metals. The results showed a time dependent decrease of the aqueous PGE concentrations in tank water for all groups. This could mainly be related to non-biological processes. The aqueous solubility of Pd and Rh was higher in humic water compared with non-chlorinated tap water, whereas Pt showed opposing results. Highest metal uptake rates and highest bioaccumulation plateaus were found for Pd, followed by Pt and Rh. Pd uptake and bioaccumulation was significantly hampered by humic substances, whose presence appear to increase Pt uptake and bioaccumulation. No clear trend emerged for Rh. Differences in effects of humic matter among the PGE may be explained by formation of metal complexes with different fractions of humic substances. - Precious metal accumulation in Dreissena polymorpha is affected by humic substances.
Karkovska, Maria; Smutok, Oleh; Stasyuk, Nataliya; Gonchar, Mykhailo
2015-11-01
In the recent years, nanotechnology is the most developing branch due to a wide variety of potential applications in biomedical, biotechnological and agriculture fields. The binding nanoparticles with various biological molecules makes them attractive candidates for using in sensor technologies. The particularly actual is obtaining the bionanomembranes based on biocatalytic elements with improved sensing characteristics. The aim of this investigation is to study the properties of microbial L-lactate-selective sensor based on using the recombinant Hansenula polymorpha yeast cells overproducing flavocytochrome b2 (FC b2), as well as additionally enriched by the enzyme bound with gold nanoparticles (FC b2-nAu). Although, the high permeability of the living cells to nanoparticles is being intensively studied (mostly for delivery of drugs), the idea of using both recombinant technology and nanotechnology to increase the amount of the target enzyme in the biosensing layer is really novel. The FC b2-nAu-enriched living and permeabilized yeast cells were used for construction of a bioselective membrane of microbial L-lactate-selective amperometric biosensor. Phenazine methosulphate was served as a free defusing electron transfer mediator which provides effective electron transfer from the reduced enzyme to the electrode surface. It was shown that the output to L-lactate of FC b2-nAu-enriched permeabilized yeast cells is 2.5-fold higher when compared to the control cells. The obtained results confirm that additional enrichment of the recombinant yeast cell by the enzyme bound with nanoparticles improves the analytical parameters of microbial sensor. Copyright © 2015 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Waldir Estela Escalante
2012-02-01
Full Text Available The fermentative behaviour of Hansenula anomala RIVE 7-1-5 was studied in order to evaluate the production of chemical compounds of sensory importance. The results demonstrated that the strain ferments very well monosaccharides and also sucrose and maltose. Its fermentative activity was inhibited at concentrations of 100 mg/L of sodium metabisulphite in the medium. Furthermore, it was able to produce 5,81±0,1% (v/v of ethanol. Agitation of the culture medium increases the production of higher alcohols (679,2 mg/L and ethyl acetate (206,0±8,0 mg/L, but on the contrary affects the production of acetic acid (196,0±7,0mg/L. Glycerol production was similar in static (without agitation and shaken cultivation. During batch cultivation carried out in biorreactor under aerated conditions the growth rate (μ reached value of 0,13 h-1 and, it was also observed production of acetic acid at levels of 4,2±0,3 g/L. The oxygen concentration in the medium affects its metabolism, thus insufficient amounts of oxygen would provoke a respirofermentative metabolism with production of ethanol, higher alcohols, esters and acetic acid. The control of aeration during fermentation is a useful tool to control the balance between the respiratory and fermentative activity and thus; synthesis of compounds of sensory importance in the production of non-traditional fermented beverages.Se ha estudiado la actividad fermentativa de Hansenula anomala RIVE 7-1-5 con el objetivo de evaluar la producción de compuestos químicos de importancia sensorial. Los resultados mostraron que fermenta bien monosacáridos y también sucrosa y maltosa. Su actividad fermentativa es inhibida a concentraciones de 100,0mg/L de metabisulfito de sodio en el medio. Además, es capaz de producir 5,81±0,1 % v/v de etanol. La agitación del medio de cultivo incrementa la producción de alcoholes superiores (679,2 mg/L y etil acetato (206,0±8,0 mg/L, por el contrario disminuye la producción de
Farsad, Nikrooz; Sone, Eli D
2012-03-01
The freshwater zebra mussel (Dreissena polymorpha) owes a large part of its success as an invasive species to its ability to attach to a wide variety of substrates. As in marine mussels, this attachment is achieved by a proteinaceous byssus, a series of threads joined at a stem that connect the mussel to adhesive plaques secreted onto the substrate. Although the zebra mussel byssus is superficially similar to marine mussels, significant structural and compositional differences suggest that further investigation of the adhesion mechanisms in this freshwater species is warranted. Here we present an ultrastructural examination of the zebra mussel byssus, with emphasis on interfaces that are critical to its adhesive function. By examining the attached plaques, we show that adhesion is mediated by a uniform electron dense layer on the underside of the plaque. This layer is only 10-20 nm thick and makes direct and continuous contact with the substrate. The plaque itself is fibrous, and curiously can exhibit either a dense or porous morphology. In zebra mussels, a graded interface between the animal and the substrate mussels is achieved by interdigitation of uniform threads with the stem, in contrast to marine mussels, where the threads themselves are non-uniform. Our observations of several novel aspects of zebra mussel byssal ultrastructure may have important implications not only for preventing biofouling by the zebra mussel, but for the development of new bioadhesives as well. Copyright © 2012 Elsevier Inc. All rights reserved.
An engineered yeast efficiently secreting penicillin.
Directory of Open Access Journals (Sweden)
Loknath Gidijala
Full Text Available This study aimed at developing an alternative host for the production of penicillin (PEN. As yet, the industrial production of this beta-lactam antibiotic is confined to the filamentous fungus Penicillium chrysogenum. As such, the yeast Hansenula polymorpha, a recognized producer of pharmaceuticals, represents an attractive alternative. Introduction of the P. chrysogenum gene encoding the non-ribosomal peptide synthetase (NRPS delta-(L-alpha-aminoadipyl-L-cysteinyl-D-valine synthetase (ACVS in H. polymorpha, resulted in the production of active ACVS enzyme, when co-expressed with the Bacillus subtilis sfp gene encoding a phosphopantetheinyl transferase that activated ACVS. This represents the first example of the functional expression of a non-ribosomal peptide synthetase in yeast. Co-expression with the P. chrysogenum genes encoding the cytosolic enzyme isopenicillin N synthase as well as the two peroxisomal enzymes isopenicillin N acyl transferase (IAT and phenylacetyl CoA ligase (PCL resulted in production of biologically active PEN, which was efficiently secreted. The amount of secreted PEN was similar to that produced by the original P. chrysogenum NRRL1951 strain (approx. 1 mg/L. PEN production was decreased over two-fold in a yeast strain lacking peroxisomes, indicating that the peroxisomal localization of IAT and PCL is important for efficient PEN production. The breakthroughs of this work enable exploration of new yeast-based cell factories for the production of (novel beta-lactam antibiotics as well as other natural and semi-synthetic peptides (e.g. immunosuppressive and cytostatic agents, whose production involves NRPS's.
Accumulation of a low pathogenic avian influenza virus in zebra mussels (Dreissena polymorpha).
Stumpf, Petra; Failing, Klaus; Papp, Tibor; Nazir, Jawad; Böhm, Reinhard; Marschang, Rachel E
2010-12-01
In order to investigate the potential role of mussels as a vector of influenza A viruses, we exposed zebra mussels (Dreissena polymorpha) to natural lake water containing a low pathogenic H5N1 avian influenza virus. Mussels were kept in water containing virus for 48 hr, then transferred into fresh water for another 14 days. Virus detection in mussels and water samples was performed by quantitative real-time reverse transcriptase-PCR (qRRT-PCR) and egg culture methods. Virus uptake was detected in all of the mussel groups that were exposed to virus. Even after 14 days in fresh water, virus could still be detected in shellfish material by both qRRT-PCR and egg culture methods. The present study demonstrates that zebra mussels are capable of accumulating influenza A viruses from the surrounding water and that these viruses remain in the mussels over an extended period of time.
Yeast synthetic biology for the production of recombinant therapeutic proteins.
Kim, Hyunah; Yoo, Su Jin; Kang, Hyun Ah
2015-02-01
The production of recombinant therapeutic proteins is one of the fast-growing areas of molecular medicine and currently plays an important role in treatment of several diseases. Yeasts are unicellular eukaryotic microbial host cells that offer unique advantages in producing biopharmaceutical proteins. Yeasts are capable of robust growth on simple media, readily accommodate genetic modifications, and incorporate typical eukaryotic post-translational modifications. Saccharomyces cerevisiae is a traditional baker's yeast that has been used as a major host for the production of biopharmaceuticals; however, several nonconventional yeast species including Hansenula polymorpha, Pichia pastoris, and Yarrowia lipolytica have gained increasing attention as alternative hosts for the industrial production of recombinant proteins. In this review, we address the established and emerging genetic tools and host strains suitable for recombinant protein production in various yeast expression systems, particularly focusing on current efforts toward synthetic biology approaches in developing yeast cell factories for the production of therapeutic recombinant proteins. © FEMS 2015. All rights reserved. For permissions, please e-mail: journals.permission@oup.com.
Hoy, M.S.; Kelly, K.; Rodriguez, R.J.
2010-01-01
A 3-primer PCR system was developed to discriminate invasive zebra (Dreissena polymorpha) and quagga (Dreissena bugensis) mussel. The system is based on: 1) universal primers that amplifies a region of the nuclear 28s rDNA gene from both species and 2) a species-specific primer complementary to either zebra or quagga mussel. The species-specific primers bind to sequences between the binding sites for the universal primers resulting in the amplification of two products from the target species and one product from the nontarget species. Therefore, nontarget products are positive amplification controls. The 3-primer system accurately discriminated zebra and quagga mussels from seven geographically distinct populations.
Mortality of zebra mussel, Dreissena polymorpha, veligers during downstream transport
Horvath, T.G.; Lamberti, G.A.
1999-01-01
1. Streams flowing from lakes which contain zebra mussels, Dreissena polymorpha, provide apparently suitable habitats for mussel colonization and downstream range expansion, yet most such streams contain few adult mussels. We postulated that mussel veligers experience high mortality during dispersal via downstream transport. They tested this hypothesis in Christiana Creek, a lake-outlet stream in south-western Michigan, U.S.A., in which adult mussel density declined exponentially with distance downstream. 2. A staining technique using neutral red was developed and tested to distinguish quickly live and dead veligers. Live and dead veligers were distinguishable after an exposure of fresh samples to 13.3 mg L-1 of neutral red for 3 h. 3. Neutral red was used to determine the proportion of live veligers in samples taken longitudinally along Christiana Creek. The proportion of live veligers (mean ?? SE) declined from 90 ?? 3% at the lake outlet to 40 ?? 8% 18 km downstream. 4. Veligers appear to be highly susceptible to damage by physical forces (e.g. shear), and therefore, mortality in turbulent streams could be an important mechanism limiting zebra mussel dispersal to downstream reaches. Predictions of zebra mussel spread and population growth should consider lake-stream linkages and high mortality in running waters.
McLaughlan, Claire; Rose, Paul; Aldridge, David C.
2014-01-01
Invasive non-native species frequently occur in very high densities. Where such invaders present an economic or ecological nuisance this biomass is typically removed and landfill is the most common destination, which is undesirable from both an economic and ecological perspective. The zebra mussel, Dreissena polymorpha, has invaded large parts of Europe and North America, and is routinely removed from raw water systems where it creates a biofouling nuisance. We investigated the suitability...
Graczyk, Thaddeus K; Conn, David Bruce; Lucy, Frances; Minchin, Dan; Tamang, Leena; Moura, Lacy N S; DaSilva, Alexandre J
2004-08-01
Zebra mussels ( Dreissena polymorpha) from throughout the Shannon River drainage area in Ireland were tested for the anthropozoonotic waterborne parasites Cryptosporidium parvum, Giardia lamblia, Encephalitozoon intestinalis, E. hellem, and Enterocytozoon bieneusi, by the multiplexed combined direct immunofluorescent antibody and fluorescent in situ hybridization method, and PCR. Parasite transmission stages were found at 75% of sites, with the highest mean concentration of 16, nine, and eight C. parvum oocysts, G. lamblia cysts, and Encephalitozoon intestinalis spores/mussel, respectively. On average eight Enterocytozoon bieneusi spores/mussel were recovered at any selected site. Approximately 80% of all parasites were viable and thus capable of initiating human infection. The Shannon River is polluted with serious emerging human waterborne pathogens including C. parvum, against which no therapy exists. Zebra mussels can recover and concentrate environmentally derived pathogens and can be used for the sanitary assessment of water quality.
Hoy, Marshal S; Kelly, Kevin; Rodriguez, Rusty J
2010-01-01
A 3-primer PCR system was developed to discriminate invasive zebra (Dreissena polymorpha) and quagga (Dreissena bugensis) mussel. The system is based on: 1) universal primers that amplifies a region of the nuclear 28s rDNA gene from both species and 2) a species-specific primer complementary to either zebra or quagga mussel. The species-specific primers bind to sequences between the binding sites for the universal primers resulting in the amplification of two products from the target species and one product from the nontarget species. Therefore, nontarget products are positive amplification controls. The 3-primer system accurately discriminated zebra and quagga mussels from seven geographically distinct populations. Published 2009. This article is a US Government work and is the public domain in the USA.
Binelli, A; Guzzella, L; Roscioli, C
2008-06-01
Several congeners of polybrominated diphenyl ethers (PBDEs) were monitored in 14 different sampling stations of Lake Maggiore, the second largest Italian lake in regard to surface, volume and average depth, using the sentinel-organism Zebra mussel (Dreissena polymorpha). Results revealed a moderate contamination with summation operatorPBDE levels (BDE-17, -28, -47, -66, -71, -85, -99, -100, -138, -153, -154, -183, -190 and -209) ranging from 40 to 447ngg(-1) lipid weight which are similar to those found in environments polluted by deposition or atmospheric transport. The general order of decreasing congener contribution to the total load was BDE-47>-99>-100>-209, which closely reflected patterns observed in mussels collected in freshwater ecosystems worldwide.
Bischoff, Paul J; Wetmore, Scott
2009-01-01
In North America, zebra mussels (Dreissena polymorpha) are notoriously known as invasive species. The abundance of naked amoebae sampled from the shells of zebra mussels was compared with abundances from rock scrapings at approximately monthly intervals for 1 year. The sites were 2 km apart along the same shoreline. No significant difference in abundance of naked amoebae (F = 1.44; P
Stasyuk, Nataliya; Smutok, Oleh; Gayda, Galina; Vus, Bohdan; Koval'chuk, Yevgen; Gonchar, Mykhailo
2012-01-01
A novel L-arginine-selective amperometric bi-enzyme biosensor based on recombinant human arginase I isolated from the gene-engineered strain of methylotrophic yeast Hansenula polymorpha and commercial urease is described. The biosensing layer was placed onto a polyaniline-Nafion composite platinum electrode and covered with a calcium alginate gel. The developed sensor revealed a good selectivity to L-arginine. The sensitivity of the biosensor was 110 ± 1.3 nA/(mM mm(2)) with the apparent Michaelis-Menten constant (K(M)(app)) derived from an L-arginine (L-Arg) calibration curve of 1.27 ± 0.29 mM. A linear concentration range was observed from 0.07 to 0.6mM, a limit of detection being 0.038 mM and a response time - 10s. The developed biosensor demonstrated good storage stability. A laboratory prototype of the proposed amperometric biosensor was applied to the samples of three commercial pharmaceuticals ("Tivortin", "Cytrarginine", "Aminoplazmal 10% E") for L-Arg testing. The obtained L-Arg-content values correlated well with those declared by producers. Copyright © 2012 Elsevier B.V. All rights reserved.
Genome and metabolic engineering in non-conventional yeasts: Current advances and applications.
Löbs, Ann-Kathrin; Schwartz, Cory; Wheeldon, Ian
2017-09-01
Microbial production of chemicals and proteins from biomass-derived and waste sugar streams is a rapidly growing area of research and development. While the model yeast Saccharomyces cerevisia e is an excellent host for the conversion of glucose to ethanol, production of other chemicals from alternative substrates often requires extensive strain engineering. To avoid complex and intensive engineering of S. cerevisiae, other yeasts are often selected as hosts for bioprocessing based on their natural capacity to produce a desired product: for example, the efficient production and secretion of proteins, lipids, and primary metabolites that have value as commodity chemicals. Even when using yeasts with beneficial native phenotypes, metabolic engineering to increase yield, titer, and production rate is essential. The non-conventional yeasts Kluyveromyces lactis, K. marxianus, Scheffersomyces stipitis, Yarrowia lipolytica, Hansenula polymorpha and Pichia pastoris have been developed as eukaryotic hosts because of their desirable phenotypes, including thermotolerance, assimilation of diverse carbon sources, and high protein secretion. However, advanced metabolic engineering in these yeasts has been limited. This review outlines the challenges of using non-conventional yeasts for strain and pathway engineering, and discusses the developed solutions to these problems and the resulting applications in industrial biotechnology.
Energy Technology Data Exchange (ETDEWEB)
Madhavan, Aravind [Biotechnology Division, National Institute for Interdisciplinary Science and Technology, Council of Scientific and Industrial Research, Trivandrum (India); Rajiv Gandhi Centre for Biotechnology, Trivandrum (India); Jose, Anju Alphonsa; Binod, Parameswaran; Sindhu, Raveendran, E-mail: sindhurgcb@gmail.com; Sukumaran, Rajeev K. [Biotechnology Division, National Institute for Interdisciplinary Science and Technology, Council of Scientific and Industrial Research, Trivandrum (India); Pandey, Ashok [Biotechnology Division, National Institute for Interdisciplinary Science and Technology, Council of Scientific and Industrial Research, Trivandrum (India); Center for Innovative and Applied Bioprocessing, Mohali, Punjab (India); Castro, Galliano Eulogio [Dpt. Ingeniería Química, Ambiental y de los Materiales Edificio, Universidad de Jaén, Jaén (Spain)
2017-04-25
The increasing fossil fuel scarcity has led to an urgent need to develop alternative fuels. Currently microorganisms have been extensively used for the production of first-generation biofuels from lignocellulosic biomass. Yeast is the efficient producer of bioethanol among all existing biofuels option. Tools of synthetic biology have revolutionized the field of microbial cell factories especially in the case of ethanol and fatty acid production. Most of the synthetic biology tools have been developed for the industrial workhorse Saccharomyces cerevisiae. The non-conventional yeast systems have several beneficial traits like ethanol tolerance, thermotolerance, inhibitor tolerance, genetic diversity, etc., and synthetic biology have the power to expand these traits. Currently, synthetic biology is slowly widening to the non-conventional yeasts like Hansenula polymorpha, Kluyveromyces lactis, Pichia pastoris, and Yarrowia lipolytica. Herein, we review the basic synthetic biology tools that can apply to non-conventional yeasts. Furthermore, we discuss the recent advances employed to develop efficient biofuel-producing non-conventional yeast strains by metabolic engineering and synthetic biology with recent examples. Looking forward, future synthetic engineering tools’ development and application should focus on unexplored non-conventional yeast species.
Directory of Open Access Journals (Sweden)
Smirnov Vladimir N
2002-10-01
Full Text Available Abstract Background Secretion of recombinant proteins in yeast can be affected by their improper folding in the endoplasmic reticulum and subsequent elimination of the misfolded molecules via the endoplasmic reticulum associated protein degradation pathway. Recombinant proteins can also be degraded by the vacuolar protease complex. Human urokinase type plasminogen activator (uPA is poorly secreted by yeast but the mechanisms interfering with its secretion are largely unknown. Results We show that in Hansenula polymorpha overexpression worsens uPA secretion and stimulates its intracellular aggregation. The absence of the Golgi modifications in accumulated uPA suggests that aggregation occurs within the endoplasmic reticulum. Deletion analysis has shown that the N-terminal domains were responsible for poor uPA secretion and propensity to aggregate. Mutation abolishing N-glycosylation decreased the efficiency of uPA secretion and increased its aggregation degree. Retention of uPA in the endoplasmic reticulum stimulates its aggregation. Conclusions The data obtained demonstrate that defect of uPA secretion in yeast is related to its retention in the endoplasmic reticulum. Accumulation of uPA within the endoplasmic reticulum disturbs its proper folding and leads to formation of high molecular weight aggregates.
Directory of Open Access Journals (Sweden)
Raveendran Sindhu
2017-04-01
Full Text Available The increasing fossil fuel scarcity has led to an urgent need to develop alternative fuels. Currently microorganisms have been extensively used for the production of first-generation biofuels from lignocellulosic biomass. Yeast is the efficient producer of bioethanol among all existing biofuels option. Tools of synthetic biology have revolutionized the field of microbial cell factories especially in the case of ethanol and fatty acid production. Most of the synthetic biology tools have been developed for the industrial workhorse Saccharomyces cerevisiae. The non-conventional yeast systems have several beneficial traits like ethanol tolerance, thermotolerance, inhibitor tolerance, genetic diversity, etc., and synthetic biology have the power to expand these traits. Currently, synthetic biology is slowly widening to the non-conventional yeasts like Hansenula polymorpha, Kluyveromyces lactis, Pichia pastoris, and Yarrowia lipolytica. Herein, we review the basic synthetic biology tools that can apply to non-conventional yeasts. Furthermore, we discuss the recent advances employed to develop efficient biofuel-producing non-conventional yeast strains by metabolic engineering and synthetic biology with recent examples. Looking forward, future synthetic engineering tools’ development and application should focus on unexplored non-conventional yeast species.
Directory of Open Access Journals (Sweden)
Sasi Sigawi
2014-02-01
Full Text Available A laboratory prototype of a microcomputer-based analyzer was developed for quantitative determination of formaldehyde in liquid samples, based on catalytic chemosensing elements. It was shown that selectivity for the target analyte could be increased by modulating the working electrode potential. Analytical parameters of three variants of the amperometric analyzer that differed in the chemical structure/configuration of the working electrode were studied. The constructed analyzer was tested on wastewater solutions that contained formaldehyde. A simple low-cost biosensor was developed for semi-quantitative detection of airborne formaldehyde in concentrations exceeding the threshold level. This biosensor is based on a change in the color of a solution that contains a mixture of alcohol oxidase from the yeast Hansenula polymorpha, horseradish peroxidase and a chromogen, following exposure to airborne formaldehyde. The solution is enclosed within a membrane device, which is permeable to formaldehyde vapors. The most efficient and sensitive biosensor for detecting formaldehyde was the one that contained alcohol oxidase with an activity of 1.2 U·mL−1. The biosensor requires no special instrumentation and enables rapid visual detection of airborne formaldehyde at concentrations, which are hazardous to human health.
International Nuclear Information System (INIS)
Madhavan, Aravind; Jose, Anju Alphonsa; Binod, Parameswaran; Sindhu, Raveendran; Sukumaran, Rajeev K.; Pandey, Ashok; Castro, Galliano Eulogio
2017-01-01
The increasing fossil fuel scarcity has led to an urgent need to develop alternative fuels. Currently microorganisms have been extensively used for the production of first-generation biofuels from lignocellulosic biomass. Yeast is the efficient producer of bioethanol among all existing biofuels option. Tools of synthetic biology have revolutionized the field of microbial cell factories especially in the case of ethanol and fatty acid production. Most of the synthetic biology tools have been developed for the industrial workhorse Saccharomyces cerevisiae. The non-conventional yeast systems have several beneficial traits like ethanol tolerance, thermotolerance, inhibitor tolerance, genetic diversity, etc., and synthetic biology have the power to expand these traits. Currently, synthetic biology is slowly widening to the non-conventional yeasts like Hansenula polymorpha, Kluyveromyces lactis, Pichia pastoris, and Yarrowia lipolytica. Herein, we review the basic synthetic biology tools that can apply to non-conventional yeasts. Furthermore, we discuss the recent advances employed to develop efficient biofuel-producing non-conventional yeast strains by metabolic engineering and synthetic biology with recent examples. Looking forward, future synthetic engineering tools’ development and application should focus on unexplored non-conventional yeast species.
Effects of Room-Temperature Ionic Liquids on Zebra Mussels (Dreissena polymorpha)
Costello, D. M.; Bernot, R. J.; Lamberti, G. A.
2005-05-01
Zebra mussels (Dreissena polymorpha) are exotic bivalves that are widely distributed in eastern North America. We propose that this nuisance organism could serve as a model species for studies of aquatic toxicology. We tested zebra mussels response to room-temperature ionic liquids (ILs), which are being synthesized as environmentally friendly alternatives to volatile organic solvents. Volatile organic solvents contribute to atmospheric pollution and ozone depletion, whereas ILs are non-volatile and less harmful to the atmosphere. Although ILs would contribute significantly less to air pollution, little is known about their potential effects on aquatic ecosystems. In 72-hour toxicity tests, we determined the acute effects of three imidazolium-based ILs (1-butyl-3-methylimidazolium bromide (bmimBr), 1-hexyl-3-methylimidazolium bromide (hmimBr), and 1-octyl-3-methylimidazolium bromide (omimBr)) on the survival of zebra mussels. As alkyl chain length decreased, median lethal concentration (LC50) decreased from 1291 mg L-1 for bmimBr, to 105 mg L-1 for hmimBr, and 21.2 mg L-1 for omimBr. For bivalve mussels, the toxicities of these ILs are comparable to the toxicities of commonly used industrial solvents (e.g., toluene, benzene). This study presents a foundation for using zebra mussels in toxicity studies as well as possible models for less common Unionid mussels.
Directory of Open Access Journals (Sweden)
Daniele Franco Martins Machado
2015-02-01
Full Text Available Neste trabalho, o objetivo foi avaliar o efeito de isolados de Trichoderma spp. na emergência de plântulas e no crescimento de mudas de cambará (Gochnatia polymorpha. Utilizou-se, em casa de vegetação, substrato esterilizado e não esterilizado, sendo avaliados os efeitos de quatro isolados de trichoderma: TSM1 e TSM2 de Trichoderma viride, 2B2 e 2B22 de Trichoderma harzianum mais um mix preparado com a mistura desses quatro isolados, além de dois produtos comerciais à base de trichoderma. A análise dos dados permitiu concluir que os isolados de trichoderma testados não interferem na emergência das plântulas, mas os isolados 2B2 e 2B22 de T. harzianum apresentam potenciais como promotores de crescimento de mudas de cambará.
Predation of the zebra mussel (Dreissena polymorpha) by freshwater drum in western Lake Erie
French, John R. P.; Bur, Michael T.; Nalepa, Thomas F.; Schloesser, Donald W.
1992-01-01
Environmental and economic problems associated with the colonization of zebra mussels (Dreissena polymorpha) in western Lake Erie created a need to investigate control mechanisms. Predation by fishes is one potential means of control, but predation on zebra mussels by native fishes in Lake Erie is unknown. The freshwater drum (Aplodinotus grunniens) is the most likely fish predator since it is the only fish with pharyngeal teeth capable of crushing mollusk shells. In 1990, freshwater drum were collected in western Lake Erie from 9 sites near rocky reefs and 13 sites with silt or sand bottoms, and gut contents were examined. Predation on zebra mussels increased as drum size increased. Small drum (200-249 mm in length) fed mainly on dipterans, amphipods, and small fish; small zebra mussels (375 mm in length) fed almost exclusively on zebra mussels (seasons and locations combined). The smallest drum capable of crushing zebra mussel shells was 265 mm. Since freshwater drum over 375 mm feed heavily on zebra mussels, they may become a possible biological control mechanism for mussels in portions of North America.
Nagotu, Shirisha; Krikken, Arjen M; Otzen, Marleen; Kiel, Jan A K W; Veenhuis, Marten; van der Klei, Ida J
We show that Mdv1 and Caf4, two components of the mitochondrial fission machinery in Saccharomyces cerevisiae, also function in peroxisome proliferation. Deletion of MDV1, CAF4 or both, however, had only a minor effect on peroxisome numbers at peroxisome-inducing growth conditions, most likely
Riva, Consuelo; Binelli, Andrea; Rusconi, Francesco; Colombo, Graziano; Pedriali, Alessandra; Zippel, Renata; Provini, Alfredo
2011-07-01
It has recently been established that the use of proteomics can be a useful tool in the field of ecotoxicology. Despite the fact that the mussel Dreissena polymorpha is a valuable bioindicator for freshwater ecosystems, the application of a proteomic approach with this organism has not been deeply investigated. To this end, several zebra mussel specimens were subjected to a 7-day exposure of two different concentrations (0.1 and 2 μg L⁻¹) of the model pollutant benzo[α]pyrene (B[α]P). Changes in protein expression profiles were investigated in gill cytosolic fractions from control/exposed male and female mussels using 2-DE electrophoresis. B[α]P bioaccumulation in mussel soft tissue was also assessed to validate exposure to the selected chemical. We evaluated overall changes in expression profiles for 28 proteins in exposed mussels, 16 and 12 of which were, respectively, over- and under-expressed. Surprisingly, the comparative analysis of protein data sets showed no proteins that varied commonly between the two different B[α]P concentrations. Spots of interest were manually excised and analysed by MALDI-TOF/TOF mass spectrometry. The most significant proteins that were identified as altered were related to oxidative stress, signal transduction, cellular structure and metabolism. This preliminary study indicates the feasibility of a proteomic approach with the freshwater mussel D. polymorpha and provides a starting point for similar investigations. Our results confirm the need to increase the number of invertebrate proteomic studies in order to increase the following: their representation in databases and the successful identification of their most relevant proteins. Finally, additional studies investigating the role of gender and protein modulation are warranted. Copyright © 2011 Elsevier B.V. All rights reserved.
Ivanković, Dusica; Pavicić, Jasenka; Beatović, Vanja; Klobucar, Roberta Sauerborn; Klobucar, Göran Igor Vinko
2010-04-01
Freshwater mussels Dreissena polymorpha (Pallas, 1771) were exposed to the elevated concentrations of Cd (10, 50, 100, and 500 microg/L), Cu (10, 30, 50, and 80 microg/L), and an organochlorinated pesticide, pentachlorophenol (PCP) (1, 10, and 100 microg/L). Induced synthesis of biomarker metallothionein (MT) and changes in concentrations of cytosolic Cd, Cu, and Zn in the whole soft tissue of mussels were monitored after a 7-day laboratory exposure to the contaminants. A clear dose-dependent elevation in the MT concentration was observed after exposure to Cd at doses of 10-100 microg/L, and this increase of MT content was accompanied with a linear increase of cytosolic Cd. Cd concentration of 500 microg/L caused no additional increase of MT and Cd in mussel cytosol, suggesting possible toxic effects due to exceeding cellular inducible/defense capacity. Cu exposure resulted with variable changes in MT concentrations, with no clear linear relationship between MT and Cu concentrations in water, although a progressive dose-dependent accumulation of Cu in the soluble fraction of mussel tissues was recorded. A decrease of cytosolic Zn was evident at higher exposure concentrations of both metals used. PCP in concentrations applied was unable to induce MT synthesis, but the higher concentrations of PCP influenced the cytosolic metal concentrations. In conclusion, the results obtained confirm the specificity of MT induction in D. polymorpha as an biological response on metal stimulation, especially by cadmium, being more closely correlated to MT than copper within the ecologically relevant concentration range. The strong induction potential of cadmium as well as an absence of MT induction following exposure to PCP as an organic chemical contaminant are supporting evidences for usage of zebra mussel MT as a specific biomarker of Cd exposure in biomonitoring programs.
Energy Technology Data Exchange (ETDEWEB)
Binelli, A. [Department of Biology, Via Celoria 26, University of Milan, 20133 Milan (Italy)], E-mail: andrea.binelli@unimi.it; Guzzella, L.; Roscioli, C. [IRSA-CNR, 20047 Brugherio (Milan) (Italy)
2008-06-15
Several congeners of polybrominated diphenyl ethers (PBDEs) were monitored in 14 different sampling stations of Lake Maggiore, the second largest Italian lake in regard to surface, volume and average depth, using the sentinel-organism Zebra mussel (Dreissena polymorpha). Results revealed a moderate contamination with {sigma}PBDE levels (BDE-17, -28, -47, -66, -71, -85, -99, -100, -138, -153, -154, -183, -190 and -209) ranging from 40 to 447 ng g{sup -1} lipid weight which are similar to those found in environments polluted by deposition or atmospheric transport. The general order of decreasing congener contribution to the total load was BDE-47 > -99 > -100 > -209, which closely reflected patterns observed in mussels collected in freshwater ecosystems worldwide. - This study shows the first data of PBDE contamination in freshwater invertebrates from Mediterranean basin.
International Nuclear Information System (INIS)
Binelli, A.; Guzzella, L.; Roscioli, C.
2008-01-01
Several congeners of polybrominated diphenyl ethers (PBDEs) were monitored in 14 different sampling stations of Lake Maggiore, the second largest Italian lake in regard to surface, volume and average depth, using the sentinel-organism Zebra mussel (Dreissena polymorpha). Results revealed a moderate contamination with ΣPBDE levels (BDE-17, -28, -47, -66, -71, -85, -99, -100, -138, -153, -154, -183, -190 and -209) ranging from 40 to 447 ng g -1 lipid weight which are similar to those found in environments polluted by deposition or atmospheric transport. The general order of decreasing congener contribution to the total load was BDE-47 > -99 > -100 > -209, which closely reflected patterns observed in mussels collected in freshwater ecosystems worldwide. - This study shows the first data of PBDE contamination in freshwater invertebrates from Mediterranean basin
International Nuclear Information System (INIS)
Giamberini, Laure; Cajaraville, Miren P.
2005-01-01
In order to examine the possible use of lysosomal response as a biomarker of freshwater quality, structural changes of lysosomes were measured by image analysis in the digestive gland of the zebra mussel, Dreissena polymorpha, exposed in laboratory conditions to cadmium. Mussels were exposed to the metal (10 and 200 μg/L) for 3 weeks and randomly collected after 7 and 21 days. At each treatment day, digestive tissues were excised and β-glucuronidase activity was revealed in cryotome sections. Four stereological parameters were calculated: lysosomal volume density, lysosomal surface density, lysosomal surface to volume ratio, and lysosomal numerical density. The changes observed in this study reflected a general activation of the lysosomal system, including an increase in both the number and the size of lysosomes in the digestive gland cells of mussels exposed to cadmium. The digestive lysosomal response in zebra mussels was related to exposure time and to metal concentration, demonstrating the potential of this biomarker in freshwater biomonitoring
Energy Technology Data Exchange (ETDEWEB)
Garaud, M. [Université de Lorraine, CNRS UMR 7360, Laboratoire Interdisciplinaire des Environnements Continentaux (LIEC), Campus Bridoux, Rue du Général Delestraint, 57070 Metz (France); International Consortium for the Environmental Implications of Nanotechnology (iCEINT), Aix en Provence (France); Trapp, J.; Devin, S.; Cossu-Leguille, C.; Pain-Devin, S.; Felten, V. [Université de Lorraine, CNRS UMR 7360, Laboratoire Interdisciplinaire des Environnements Continentaux (LIEC), Campus Bridoux, Rue du Général Delestraint, 57070 Metz (France); Giamberini, L., E-mail: laure.giamberini@univ-lorraine.fr [Université de Lorraine, CNRS UMR 7360, Laboratoire Interdisciplinaire des Environnements Continentaux (LIEC), Campus Bridoux, Rue du Général Delestraint, 57070 Metz (France); International Consortium for the Environmental Implications of Nanotechnology (iCEINT), Aix en Provence (France)
2015-01-15
Highlights: • Gammarids and mussels both accumulated significant amount of waterborne nCeO{sub 2}. • nCeO{sub 2} decreased catalase, lysosomal system size and lipoperoxidation in mussels. • nCeO{sub 2} could exert antioxidant protecting activity in mussels. • In contrast with mussels, no effects of nCeO{sub 2} were observed on Gammarids. - Abstract: Cerium nanoparticles (nCeO{sub 2}) are widely used in everyday products, as fuel and paint additives. Meanwhile, very few studies on nCeO{sub 2} sublethal effects on aquatic organisms are available. We tried to fill this knowledge gap by investigating short-term effects of nCeO{sub 2} at environmentally realistic concentrations on two freshwater invertebrates; the amphipod Gammarus roeseli and the bivalve Dreissena polymorpha, using an integrated multibiomarker approach to detect early adverse effects of nCeO{sub 2} on organism biology. Differences in the behaviour of the organisms and of nanoparticles in the water column led to differential nCeO{sub 2} bioaccumulations, G. roeseli accumulating more cerium than D. polymorpha. Exposure to nCeO{sub 2} led to decreases in the size of the lysosomal system, catalase activity and lipoperoxidation in mussel digestive glands that could result from nCeO{sub 2} antioxidant properties, but also negatively impacted haemolymph ion concentrations. At the same time, no strong adverse effects of nCeO{sub 2} could be observed on G. roeseli. Further experiments will be necessary to confirm the absence of severe nCeO{sub 2} adverse effects in long-term environmentally realistic conditions.
Efficacy of candidate chemicals for preventing attachment of zebra mussels (Dreissena polymorpha)
Cope, W.G.; Bartsch, M.R.; Marking, L.L.
1997-01-01
Forty-seven chemicals having potential for preventing the attachment of zebra mussels Dreissena polymorpha were identified and tested. For each chemical, 15 zebra mussels (5-8-mm shell length) in each of two replicates and six treatments were exposed for 48 h followed by a 48-h postexposure period in untreated water. Eleven of the chemicals inhibited the reattachment of zebra mussels after the 48-h exposure; eight had EC50 values ranging from 0.4 to 5.4 mg /L, and three had EC50 values ranging from 19.4 to 29.0 mg/L. Based on an analysis of chemical cost, solubility in water, anticipated treatment concentrations, and potential hazards to humans or the environment, three of the most promising chemicals, all antioxidants (butylated hydroxyanisole [BHA], tert-butylhydroquinone, and tannic acid) were tested on nontarget fish (bluegill, Lepomis macrochirus; channel catfish, Ictalurus punctatus; and rainbow trout, Oncorhynchus mykiss). These chemicals were not selectively toxic to zebra mussels; only the tests with bluegill and BHA and with channel catfish and tannic acid had 48-h LC50 values greater than the concentrations effective for preventing the reattachment of zebra mussels. Although the attachment of zebra mussels can be prevented with selected antioxidants, an alternative formulation should be investigated to minimize effects on nontarget organisms, such as fish.
Effects of the exotic zebra mussel (Dreissena polymorpha) on metal cycling in Lake Erie
International Nuclear Information System (INIS)
Klerks, P.L.; Fraleigh, P.C.; Lawniczak, J.E.
1997-01-01
This research demonstrated the impact of high densities of the zebra mussel (Dreissena polymorpha) on the cycling of copper, nickel, and zinc in a lake environment. Experiments with mussels on sedimentation traps in western Lake Erie and with mussels in flow-through tanks receiving Lake Erie water showed that zebra mussels remove metals from the water column, incorporate metals in their tissues, and deposit metals on the lake bottom. Removal of metals from the water column was estimated at 10-17%·day -1 of the amounts present. This material was largely deposited on the lake bottom; zebra mussels more than doubled the rate at which metals were being added to the lake bottom. Metal biodeposition rates were extremely high (e.g., 50 mg Zn·m -2 ·day -1 ) in high-turbidity areas with elevated metal levels. Two factors contributed to metal biodeposition by zebra mussels. First, their production of feces and pseudofeces increased the rate at which suspended matter was being added to the sediment (accounting for 92% of the increased metal biodeposition). Second, the material coming out of suspension had higher metal concentrations when zebra mussels were present (constituting 8% of the increased biodeposition). (author)
Smolders, Roel; Bervoets, Lieven; Blust, Ronny
2002-09-01
For over 20 years, mussels have been recommended as one of the most suitable biomonitoring organisms for aquatic ecosystems. Though the common mussel (Mytilus edulis) is frequently used for biomonitoring estuarine and marine ecosystems, no freshwater species is promoted for similar monitoring networks. Recently, however, the zebra mussel (Dreissena polymorpha) has been proposed as a suitable monitoring organism in freshwater ecosystems. The aim of this study was to explore the usefulness of transplanted zebra mussels as active biomonitors in an effluent-dominated stream. Results showed that for these purposes, an exposure period of at least a few weeks is required to detect any significant changes in condition status or scope for growth. Wet-tissue-weight:dry-tissue-weight ratio was the most sensitive measure to quantify effects of field exposure on physiological fitness. In case of scope for growth (SfG), energy intake was the factor determining the overall energy budget of the mussels. Based on the dilution rates of the two different effluents present, effluent 2 had the most important effect on the condition status of the exposed organisms. Overall, we conclude that the use of transplanted mussels is a sensitive and easily applicable active biomonitor that can be used to assess water quality, pollution, and subsequent recovery through self-purification in field situations.
Evariste, Lauris; David, Elise; Cloutier, Pierre-Luc; Brousseau, Pauline; Auffret, Michel; Desrosiers, Mélanie; Groleau, Paule Emilie; Fournier, Michel; Betoulle, Stéphane
2018-04-02
The zebra mussel, Dreissena polymorpha constitutes an extensively used sentinel species for biomonitoring in European and North American freshwater systems. However, this invasive species is gradually replaced in freshwater ecosystem by Dreissena bugensis, a closely related dreissenid species that shares common morphological characteristics but possess some physiological differences. However, few are known about differences on more integrated physiological processes that are generally used as biomarkers in biological monitoring studies. Declining of zebra mussel populations raises the question of the sustainability of using one or both species indifferently to maintain the quality of environmental pollution monitoring data. In our study, we performed a field comparative study measuring immune-related markers and bioaccumulation of PCBs, PAHs and PBDEs in sympatrically occurring mussel populations from three sites of the St. Lawrence River. For tested organisms, species were identified using RFLP analysis. Measurement of bioaccumulated organic compounds indicated a higher accumulation of PCBs and PBDEs in D. bugensis soft tissues compared to D. polymorpha while no differences were noticed for PAHs. Results of hemocytic parameters highlighted that differences of hemocyte distributions were associated to modulations of phagocytic activities. Moreover, marked differences occurred in measurement of hemocytic oxidative activity, indicating divergences between the two species for ROS regulation strategies. This physiological characteristic may deeply influence species responses facing environmental or pollution related stress and induce bias if the two species are not differentiated in further biomarker or bioaccumulation measurement-based studies. Copyright © 2018 Elsevier Ltd. All rights reserved.
Sarnelle, Orlando; White, Jeffrey D; Horst, Geoffrey P; Hamilton, Stephen K
2012-07-01
We tested the hypothesis that zebra mussels (Dreissena polymorpha) have positive effects on the toxin-producing cyanobacterium, Microcystis aeruginosa, at low phosphorus (P) concentrations, but negative effects on M. aeruginosa at high P, with a large-scale enclosure experiment in an oligotrophic lake. After three weeks, mussels had a significantly positive effect on M. aeruginosa at ambient P (total phosphorus, TP ∼10 μg L⁻¹), and a significantly negative effect at high P (simulating a TP of ∼40 μg L⁻¹ in lakes). Positive and negative effects were strong and very similar in magnitude. Thus, we were able to ameliorate a negative effect of Dreissena invasion on water quality (i.e., promotion of Microcystis) by adding P to water from an oligotrophic lake. Our results are congruent with many field observations of Microcystis response to Dreissena invasion across ecosystems of varying P availability. Copyright © 2012 Elsevier Ltd. All rights reserved.
Zaiko, Anastasija; Daunys, Darius; Olenin, Sergej
2009-03-01
Habitat engineering role of the invasive zebra mussel Dreissena polymorpha (Pallas) was studied in the Curonian lagoon, a shallow water body in the SE Baltic. Impacts of live zebra mussel clumps and its shell deposits on benthic biodiversity were differentiated and referred to unmodified (bare) sediments. Zebra mussel bed was distinguished from other habitat types by higher benthic invertebrate biomass, abundance, and species richness. The impact of live mussels on biodiversity was more pronounced than the effect of shell deposits. The structure of macrofaunal community in the habitats with >103 g/m2 of shell deposits devoid of live mussels was similar to that found within the zebra mussel bed. There was a continuous shift in species composition and abundance along the gradient ‘bare sediments—shell deposits—zebra mussel bed’. The engineering impact of zebra mussel on the benthic community became apparent both in individual patches and landscape-level analyses.
Eggleton, M.A.; Miranda, L.E.; Kirk, J.P.
2004-01-01
Rates of annual food consumption and biomass were modeled for several fish species across representative rivers and lakes in eastern North America. Results were combined to assess the relative potential of fish predation to impact zebra mussels (Dreissena polymorpha). Predicted annual food consumption by fishes in southern waters was over 100% greater than that in northern systems because of warmer annual water temperatures and presumed increases in metabolic demand. Although generally increasing with latitude, biomasses of several key zebra mussel fish predators did not change significantly across latitudes. Biomasses of some less abundant fish predators did increase significantly with latitude, but increases were not of the magnitude to offset predicted decreases in food consumption. Our results generally support the premise that fishes in rivers and lakes of the southern United States (U.S.) have inherently greater potential to impact zebra mussels by predation. Our simulations may provide a partial explanation of why zebra mussel invasions have not been as rapid and widespread in southern U.S. waters compared to the Great Lakes region. ?? Blackwell Munksgaard, 2004.
Genome and metabolic engineering in non-conventional yeasts: Current advances and applications
Directory of Open Access Journals (Sweden)
Ann-Kathrin Löbs
2017-09-01
Full Text Available Microbial production of chemicals and proteins from biomass-derived and waste sugar streams is a rapidly growing area of research and development. While the model yeast Saccharomyces cerevisiae is an excellent host for the conversion of glucose to ethanol, production of other chemicals from alternative substrates often requires extensive strain engineering. To avoid complex and intensive engineering of S. cerevisiae, other yeasts are often selected as hosts for bioprocessing based on their natural capacity to produce a desired product: for example, the efficient production and secretion of proteins, lipids, and primary metabolites that have value as commodity chemicals. Even when using yeasts with beneficial native phenotypes, metabolic engineering to increase yield, titer, and production rate is essential. The non-conventional yeasts Kluyveromyces lactis, K. marxianus, Scheffersomyces stipitis, Yarrowia lipolytica, Hansenula polymorpha and Pichia pastoris have been developed as eukaryotic hosts because of their desirable phenotypes, including thermotolerance, assimilation of diverse carbon sources, and high protein secretion. However, advanced metabolic engineering in these yeasts has been limited. This review outlines the challenges of using non-conventional yeasts for strain and pathway engineering, and discusses the developed solutions to these problems and the resulting applications in industrial biotechnology.
Energy Technology Data Exchange (ETDEWEB)
Contardo-Jara, Valeska, E-mail: contardo@igb-berlin.d [Dpt. Ecophysiology and Aquaculture, Leibniz-Institute of Freshwater Ecology and Inland Fisheries, Mueggelseedamm 301, 12587 Berlin (Germany); Pflugmacher, Stephan, E-mail: pflugmacher@igb-berlin.d [Dpt. Ecophysiology and Aquaculture, Leibniz-Institute of Freshwater Ecology and Inland Fisheries, Mueggelseedamm 301, 12587 Berlin (Germany); Nuetzmann, Gunnar, E-mail: nuetzmann@igb-berlin.d [Dpt. Ecohydrology, Leibniz-Institute of Freshwater Ecology and Inland Fisheries, Mueggelseedamm 301, 12587 Berlin (Germany); Kloas, Werner, E-mail: werner.kloas@igb-berlin.d [Dpt. Ecophysiology and Aquaculture, Leibniz-Institute of Freshwater Ecology and Inland Fisheries, Mueggelseedamm 301, 12587 Berlin (Germany); Wiegand, Claudia, E-mail: wiegand@biology.sdu.d [University of Southern Denmark Institute of Biology, Campusvej 55, 5230 Odense M (Denmark)
2010-06-15
Due to increasing amounts of pharmaceutically active compounds (PhACs) in the aquatic environment, their largely unknown effects to non-target organisms need to be assessed. This study examined physiological changes in the freshwater mussel Dreissena polymorpha exposed to increasing concentrations (0.534, 5.34, 53.4 and 534 mug L{sup -1}) of the beta-blocker metoprolol in a flow-through system for seven days. The two lower concentrations represent the environmentally relevant range. Surprisingly, metallothionein mRNA was immediately up-regulated in all treatments. For the two higher concentrations mRNA up-regulation in gills was found for P-glycoprotein after one day, and after four days for pi class glutathione S-transferase, demonstrating elimination and biotransformation processes, respectively. Additionally, catalase and superoxide dismutase were up-regulated in the digestive gland indicating oxidative stress. In all treated mussels a significant up-regulation of heat shock protein mRNA was observed in gills after four days, which suggests protein damage and the requirement for repair processes. Metoprolol was 20-fold bioaccumulated for environmentally relevant concentrations. - Evidence for significant physiological changes in an aquatic mollusc due to exposure to a pharmaceutically active compound detected by real-time PCR.
Palos Ladeiro, M; Aubert, D; Villena, I; Geffard, A; Bigot, A
2014-01-01
Cryptosporidium parvum, Giardia duodenalis and Toxoplasma gondii are ubiquitous pathogens, which waterborne transmission has been largely demonstrated. Since they can be found in various watercourses, interactions with aquatic organisms are possible. Protozoan detection for watercourses biomonitoring is currently based on large water filtration. The zebra mussel, Dreissena polymorpha, is a choice biological model in ecotoxicological studies which are already in use to detect chemical contaminations in watercourses. In the present study, the zebra mussel was tested as a new tool for detecting water contamination by protozoa. In vivo exposures were conducted in laboratory experiments. Zebra mussel was exposed to various protozoan concentrations for one week. Detection of protozoa was realized by Taqman real time qPCR. Our experiments evidenced C. parvum, G. duodenalis and T. gondii oocyst bioaccumulation by mussels proportionally to ambient contamination, and significant T. gondii prevalence was observed in muscle tissue. To our knowledge, this is the first study that demonstrates T. gondii oocyst accumulation by zebra mussel. The results from this study highlight the capacity of zebra mussels to reveal ambient biological contamination, and thus to be used as a new effective tool in sanitary biomonitoring of water bodies. Copyright © 2013 Elsevier Ltd. All rights reserved.
Effects of the exotic zebra mussel (Dreissena polymorpha) on metal cycling in Lake Erie
Energy Technology Data Exchange (ETDEWEB)
Klerks, P.L. [Univ. of Southwestern Louisiana, Dept. of Biology, Lafayette, Louisiana (United States)]. E-mail: klerks@usl.edu; Fraleigh, P.C.; Lawniczak, J.E. [Univ. of Toledo, Dept. of Biology, Toledo, Ohio (United States)
1997-07-15
This research demonstrated the impact of high densities of the zebra mussel (Dreissena polymorpha) on the cycling of copper, nickel, and zinc in a lake environment. Experiments with mussels on sedimentation traps in western Lake Erie and with mussels in flow-through tanks receiving Lake Erie water showed that zebra mussels remove metals from the water column, incorporate metals in their tissues, and deposit metals on the lake bottom. Removal of metals from the water column was estimated at 10-17%{center_dot}day{sup -1} of the amounts present. This material was largely deposited on the lake bottom; zebra mussels more than doubled the rate at which metals were being added to the lake bottom. Metal biodeposition rates were extremely high (e.g., 50 mg Zn{center_dot}m{sup -2}{center_dot}day{sup -1}) in high-turbidity areas with elevated metal levels. Two factors contributed to metal biodeposition by zebra mussels. First, their production of feces and pseudofeces increased the rate at which suspended matter was being added to the sediment (accounting for 92% of the increased metal biodeposition). Second, the material coming out of suspension had higher metal concentrations when zebra mussels were present (constituting 8% of the increased biodeposition). (author)
International Nuclear Information System (INIS)
Zuykov, M.; Pelletier, E.; Rouleau, C.; Popov, L.; Fowler, S.W.; Orlova, M.
2009-01-01
Autoradiography was used to identify α-track distributions in a series of shell sections from live mussels Dreissena polymorpha Pallas and dissected shells of dead mussels obtained from laboratory experiments using relatively high concentrations of 241 Am in the exposure media, a required condition for successful use of this autoradiographic technique. A comparable distribution of α-tracks was recorded on autoradiographs from both live and dead shells suggesting that metabolism does not lead to any sizable changes in the process of 241 Am adsorption (present in the extrapallial fluid) onto the inner surface of shell. Autoradiographs showed a preferential accumulation of 241 Am in the organic periostracum, whereas the outer and inner shell layers were characterized by a relatively low α-tracks density. No α-tracks were observed in the central part of the shell in any of the samples. These observations will be useful for the development of a general model to explain bioaccumulation and biosorption processes of radionuclides into mollusk shells. (author)
Dieterich, Axel; Mörtl, Martin; Eckmann, Reiner
2004-07-01
Complex habitat structures can influence the foraging success of fish. Competition for food between fish species can therefore depend on the competitors' abilities to cope with structural complexity. In laboratory experiments, we comparatively assessed effects of zebra mussels (Dreissena polymorpha Pall.) on the foraging success of Eurasian perch (Perca fluviatilis L.) and ruffe (Gymnocephalus cernuus (L.)). In single-species and mixed-species experiments, the fish were fed caddisfly larvae (Tinodes waeneri (L.)) over complex (mussel-covered stones) and less-complex (bare stones) substrates. With intraspecific competition, food consumption by perch and ruffe decreased significantly when the complex substrate was used. With interspecific competition, food consumption by perch and ruffe did not change with substrate complexity, but perch clearly out-competed ruffe on both substrates. Zebra mussel beds provide a refuge for macrozoobenthos against predation by ruffe and probably also by perch. (
Fernández-Sanjuan, María; Faria, Melissa; Lacorte, Silvia; Barata, Carlos
2013-04-01
Perfluorinated chemicals (PFCs) have been used for many years in numerous industrial products and are known to accumulate in organisms. A recent survey showed that tissue levels of PFCs in aquatic organisms varied among compounds and species being undetected in freshwater zebra mussels Dreissena polymorpha. Here we studied the bioaccumulation kinetics and effects of two major PFCs, perfluorooctane sulfonic acid compound (PFOS) and perfluorooctanoic acid (PFOA), in multixenobiotic transporter activity (MXR) and filtration and oxygen consumption rates in zebra mussel exposed to a range of concentrations of a PCF mixture (1-1,000 μg/L) during 10 days. Results indicate a low potential of the studied PFCs to bioaccumulate in zebra mussel tissues. PFCs altered mussel MXR transporter activity being inhibited at day 1 but not at day 10. Bioaccumulation kinetics of PFCs were inversely related with MXR transporter activity above 9 ng/g wet weight and unrelated at tissue concentration lower than 2 ng/g wet weight suggesting that at high tissue concentrations, these type of compounds may be effluxed out by MXR transporters and as a result have a low potential to be bioaccumulated in zebra mussels. Oxygen consumption rates but not filtering rates were increased in all exposure levels and periods indicating that at environmental relevant concentrations of 1 μg/L, the studied PFCs enhanced oxidative metabolism of mussels. Overall, the results obtained in this study confirm previous findings in the field indicating that an important fraction of PFC accumulated in mussel tissues is eliminated actively by MXR transporters or other processes that are metabolically costly.
Directory of Open Access Journals (Sweden)
Nataliya Petryk
Full Text Available The transcriptional regulator HAP4, induced by respiratory substrates, is involved in the balance between fermentation and respiration in S. cerevisiae. We identified putative orthologues of the Hap4 protein in all ascomycetes, based only on a conserved sixteen amino acid-long motif. In addition to this motif, some of these proteins contain a DNA-binding motif of the bZIP type, while being nonetheless globally highly divergent. The genome of the yeast Hansenula polymorpha contains two HAP4-like genes encoding the protein HpHap4-A which, like ScHap4, is devoid of a bZIP motif, and HpHap4-B which contains it. This species has been chosen for a detailed examination of their respective properties. Based mostly on global gene expression studies performed in the S. cerevisiae HAP4 disruption mutant (ScΔhap4, we show here that HpHap4-A is functionally equivalent to ScHap4, whereas HpHap4-B is not. Moreover HpHAP4-B is able to complement the H2O2 hypersensitivity of the ScYap1 deletant, YAP1 being, in S. cerevisiae, the main regulator of oxidative stress. Finally, a transcriptomic analysis performed in the ScΔyap1 strain overexpressing HpHAP4-B shows that HpHap4-B acts both on oxidative stress response and carbohydrate metabolism in a manner different from both ScYap1 and ScHap4. Deletion of these two genes in their natural host, H. polymorpha, confirms that HpHAP4-A participates in the control of the fermentation/respiration balance, while HpHAP4-B is involved in oxidative stress since its deletion leads to hypersensitivity to H2O2. These data, placed in an evolutionary context, raise new questions concerning the evolution of the HAP4 transcriptional regulation function and suggest that Yap1 and Hap4 have diverged from a unique regulatory protein in the fungal ancestor.
Thomas, R; Jebin, N; Saha, R; Sarma, D K
2016-01-01
Pork nuggets with 'very good' acceptability was processed by incorporating kordoi (Averrhoa carambola) fruit juice and bamboo (Bambusa polymorpha) shoot extract, and their physical, chemical, microbiological and sensorial characteristics were evaluated during 35 days storage under refrigeration. Addition of kordoi fruit juice (4%) and bamboo shoot extract (6%) had a significant effect on the pH, moisture, protein, fat, fiber, instrumental color values and texture profiles of nuggets. Nuggets with juice and extract had significantly lower TBARS values towards the end of the storage period compared to the control. Microbial and sensory qualities of nuggets were significantly improved by the addition of juice and extract. Incorporation of juice and extract at 4% and 6% levels, respectively, increased the storage life of pork nuggets by at least two weeks, i.e. from 21 days to 35 days at 4 ± 1 °C compared to the control. Copyright © 2015 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Contardo-Jara, Valeska; Lorenz, Claudia; Pflugmacher, Stephan; Nuetzmann, Gunnar; Kloas, Werner; Wiegand, Claudia
2011-01-01
Bioaccumulation and effects of the contraceptive hormone levonorgestrel were examined in the non-target organism Dreissena polymorpha. Molecular biomarkers of biotransformation, elimination, antioxidant defence and protein damage were analyzed after exposure to increasing concentrations of levonorgestrel in a flow-through system. The lowest concentration (0.312 μg L -1 ) was 100-fold bioconcentrated within four days. A decrease of the bioconcentration factor was observed within one week for the highest test concentrations (3.12 and 6.24 μg L -1 ) suggesting enhanced excretory processes. The immediate mRNA up-regulation of pi class glutathione S-transferase proved that phase II biotransformation processes were induced. Disturbance of fundamental cell functions was assumed since the aryl hydrocarbon receptor has been permanently down-regulated. mRNA up-regulation of P-glycoprotein, superoxide dismutase and metallothioneine suggested enhanced elimination processes and ongoing oxidative stress. mRNA up-regulation of heat shock protein 70 in mussels exposed to the two highest concentrations clearly indicated impacts on protein damage. - Fundamental cell processes as biotransformation, elimination and prevention from oxidative stress are influenced by exposure of the contraceptive levonorgestrel in non-target organisms. - Research highlights: → Bioaccumulation of levonorgestrel in mussels is higher than expected based on its lipophilicity. → Exposure to levonorgestrel causes oxidative stress and enhanced elimination processes. → Glutathione S-transferase (pi class) mRNA induction after one day hint on phase II biotransformation. → mRNA induction of heat shock protein 70 after one week prove protein damage.
Energy Technology Data Exchange (ETDEWEB)
Bias, R.; Karbe, L. (Hamburg Univ. (Germany, F.R.))
1985-01-01
Kinetics of uptake, partitioning and elimination of cadmium were investigated in experimental studies with the freshwater mussel, Dreissena polymorpha. /sup 109/Cd and /sup 115/Cd were used as tracers. Shells, soft parts and body fluid of the mussel exhibited considerable differences in accumulation and elimination. Accumulation factors up to more than 70,000 were calculated for the periostracum, whereas accumulation factors for the whole mussels ranging up to 3,000 were calculated. The shells bound a great deal of cadmium, but only loosely, and the metal could be readily eliminated after transfer to uncontaminated water. In contrast, no significant amounts of the cadmium incorporated in the soft parts were eliminated. The results indicate that the major portion of cadmium in the soft parts is strongly bound and cannot be eliminated by exchange processes.
Energy Technology Data Exchange (ETDEWEB)
Cope, W.G.; Bartsch, M.R.; Rada, R.G.; Balogh, S.J.; Rupprecht, J.E.; Young, R.D.; Johnson, D.K.
1999-12-15
Zebra mussels (Dreissena polymorpha) were sampled from artificial substrates deployed from May 30 to October 19, 1995, at 19 locks and dams from Minneapolis, MN, to Muscatine, IA. Analyses of composite tissue samples of zebra mussels revealed accumulation of mercury (Hg), cadmium (Cd), and polychlorinated biphenyls (PCBs) during a 143-d exposure period. Concentrations of total Hg ranged from 2.6 to 6.1 ng/g wet weight and methylmercury (CH{sub 3}Hg) from 1.0 to 3.3 ng/g wet weight. About 50% of the mean total Hg in zebra mussels was CH{sub 3}Hg. Cadmium ranged from 76 to 213 ng/g wet weight. Concentrations of total PCBs in zebra mussels varied longitudinally, but the composition of PCB congeners was similar throughout the river. Chlordane and dieldrin were the only two pesticides detected of the 15 analyzed. Zebra mussels are sentinels of contaminant bioavailability in the Upper Mississippi River and may be an important link in the trophic transfer of contaminants in the river because of their increasing importance in the diets of certain fish and waterfowl.
Cumulative effects of ibuprofen and air emersion in zebra mussels Dreissena polymorpha.
André, C; Gagné, F
2017-10-01
Municipal effluents are major source of pharmaceutical products in the environment. The purpose of this study was to examine the toxicity of a largely used drug, ibuprofen (Ibu), in Dresseina polymorpha mussels and its impact on air survival time. The mussels were exposed to increasing concentration of Ibu (0, 1, 10 and 100μg/L) for 96 at 15°C and a sub-group of mussels was maintain in air for another 96h. Post-exposure mussels (Ibu and Ibu+Air) were analyzed for weight loss, total triglycerides, neutral lipids, lipid peroxidation (LPO), arachidonate-dependent cyclooxygenase (COX) and glutathione S-transferase activity. Lipid extracts of mussel tissues were also analyzed by 1 H-nuclear resonance spectroscopy. The data revealed that mussels exposed to Ibu had increased signs of lipid oxidation, neutral lipids and decreased triglycerides, LPO and GST activity. COX activity was significantly reduced by Ibu in keeping with mode of action of the drug. Following exposure to air, increased weight loss, neutral lipids (lipid degradation), were observed in mussels exposed to Ibu but no changes in COX activity were observed. Air stress limited the decrease in triglycerides and the increase in GST in mussels exposed to 100μg/L Ibu indicating decreased anti-oxidant response/phase II biotransformation and limited lipid metabolism. In conclusion, exposure to Ibu has some anti-inflammatory effects to mussels based on COX activity but resulted in increased oxidative damage and lipid catabolism. Exposure to air stress could enhance some of these responses and contribute to decreased resistance to air exposures. Crown Copyright © 2017. Published by Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Mitchell, M.J.; Mills, E.L.; Idrisi, N.; Michener, R.
1996-01-01
The carbon and nitrogen concentrations and the stable isotopic compositions (δ 13 C and δ 15 N) of major abiotic and biotic constituents were determined in Oneida Lake, New York. This lake was invaded by the zebra mussel (Dreissena polymorpha) in 1990 and there have been concomitant changes in various biotic and abiotic lake properties. The C (46-49%) and N (12%) concentrations and C:N ratios (3.9-4) of zebra mussel flesh were similar to those reported for other lakes. Trophic positions were reflected in the δ 15 N values for which walleye > gizzard shad and yellow perch > Daphnia spp. and zebra mussel flesh > seston and sediment. There was an average increase of 3.6% 0 15 N per trophic transfer. Results from the δ 13 C analysis suggest that Daphnia spp. were using a distinct source of organic carbon whereas zebra mussel were using the entire seston resource. Only yellow perch showed a significant shift in δ 13 C values (1.1% 0 ), possibly reflecting a shift in a food source and diet from 1992 to 1993. (author). 48 refs., 2 tabs., 2 figs
Directory of Open Access Journals (Sweden)
REYNOLDS J. D.
2001-04-01
Full Text Available The zebra mussel Dreissena polymorpha, native to the Aralo-Caspian region, has spread across Europe in the last 180 years. Although it reached England in 1820, it only arrived in Ireland in around 1995, probably attached to the hull of pleasure boats, and since then has spread through the lowland Shannon and Erne systems, which are linked by canal. While White-clawed crayfish Austropotamobius pallipes (Lereboullet occur in these systems, Dreissena has not yet colonized sites with large crayfish populations. In laboratory experiments crayfish of both sexes ranging in size from 32-48 mm carapace length (CL were offered zebra mussels in 7 size classes spanning a range from 3-17 mm total length. Crayfish fed most on small mussels, although there was some correlation between size of crayfish and largest mussels attacked. When eaten mussels were not replaced, crayfish shifted to larger sizes. In the presence of alternative prey, experienced crayfish ate mussels and alternative foods in similar amounts while those who had never encountered zebra mussels nearly always chose the alternative foods first. The possibility of crayfish exerting significant controlling impacts on expanding mussel populations is discussed.
NRT2.4 and NRT2.5 Are Two Half-Size Transporters from the Chlamydomonas NRT2 Family
Directory of Open Access Journals (Sweden)
Jose Javier Higuera
2016-03-01
Full Text Available The NRT2 transporters mediate High Affinity Nitrate/NitriteTransport (HAN/NiT, which are essential for nitrogen acquisition from these inorganic forms. The NRT2 proteins are encoded by a multigene family in plants, and contain 12 transmembrane-spanning domains. Chlamydomonas reinhardtii has six NRT2, two of which (NRT2.5 and NRT2.4 are located in Chromosome III, in tandem head to tail. cDNAs for these genes were isolated and their sequence revealed that they correspond to half-size NRT2 transporters each containing six transmembrane domains. NRT2.5 has long N- and C- termini sequences without known homology. NRT2.4 also contains long termini sequences but smaller than NRT2.5. Expression of both studied genes occurred at a very low level, slightly in darkness, and was not modified by the N or C source. Silencing of NRT2.4 by specific artificial miRNA resulted in the inhibition of nitrite transport in the absence of other HANNiT (NRT2.1/NAR2 in the cell genetic background. Nitrite transport activity in the Hansenula polymorpha Δynt::URA3 Leu2 mutant was restored by expressing CrNRT2.4. These results indicate that half-size NRT2 transporters are present in photosynthetic organisms and that NRT2.4 is a HANiT.
Porter, Stephanie S; Faber-Hammond, Joshua J; Friesen, Maren L
2018-01-01
Exotic, invasive plants and animals can wreak havoc on ecosystems by displacing natives and altering environmental conditions. However, much less is known about the identities or evolutionary dynamics of the symbiotic microbes that accompany invasive species. Most leguminous plants rely upon symbiotic rhizobium bacteria to fix nitrogen and are incapable of colonizing areas devoid of compatible rhizobia. We compare the genomes of symbiotic rhizobia in a portion of the legume's invaded range with those of the rhizobium symbionts from across the legume's native range. We show that in an area of California the legume Medicago polymorpha has invaded, its Ensifer medicae symbionts: (i) exhibit genome-wide patterns of relatedness that together with historical evidence support host-symbiont co-invasion from Europe into California, (ii) exhibit population genomic patterns consistent with the introduction of the majority of deep diversity from the native range, rather than a genetic bottleneck during colonization of California and (iii) harbor a large set of accessory genes uniquely enriched in binding functions, which could play a role in habitat invasion. Examining microbial symbiont genome dynamics during biological invasions is critical for assessing host-symbiont co-invasions whereby microbial symbiont range expansion underlies plant and animal invasions. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Directory of Open Access Journals (Sweden)
Leyli Gholamhosseini
2007-03-01
Full Text Available Zebra mussel (Dreissenidae polymorpha is capable of filtering great volumes of water due to its high population density. In this study, Nitrate and Phosphate removal capability of 3 shell masses (20, 40, and 60 gr in urban wastewater was investigated based on filtering rate measurements (using simultaneous phytoplankton, chlorella, and Scenedesmus cultures and indirect absorption of nitrate and phosphate in open and closed systems with 3 to 10 replications. Open and closed systems showed a positive correlation between shell weights and Nitrate and Phosphate filtration rates (R2 =0.99 but a negative correlation between influent Nitrate and Phosphate concentrations and their filtration rates (R2=0.97. Increasing of shell weights in the open system resulted in absorption rates of 0.08-0.2mg.l-1 of the shell dry weight for Nitrate and 0.02-0.04 mg.l-1 for Phosphate. In the closed system, these rates were 0.03-0.11 mg.l-1 of the shell dry weight for Nitrate absorption and 0.01-0.02 mg.l-1 for Phosphate. These results show that shell masses have a low nitrate and phosphate removal efficiency, especially in the case of phosphate, and they can not be, therefore, recommended for urban wastewater treatment.
Bruesewitz, Denise A.; Tank, Jennifer L.; Bernot, Melody J.; Richardson, William B.; Strauss, Eric A.
2006-01-01
Zebra mussels (Dreissena polymorpha) have altered the structure of invaded ecosystems and exhibit characteristics that suggest they may influence ecosystem processes such as nitrogen (N) cycling. We measured denitrification rates seasonally on sediments underlying zebra mussel beds collected from the impounded zone of Navigation Pool 8 of the Upper Mississippi River. Denitrification assays were amended with nutrients to characterize variation in nutrient limitation of denitrification in the presence or absence of zebra mussels. Denitrification rates at zebra mussel sites were high relative to sites without zebra mussels in February 2004 (repeated measures analysis of variance (RM ANOVA), p = 0.005), potentially because of high NO3-N variability from nitrification of high NH4+ zebra mussel waste. Denitrification rates were highest in June 2003 (RM ANOVA, p 3-N concentrations during the study (linear regression, R2 = 0.72, p p ≤ 0.01). Examining how zebra mussels influence denitrification rates will aid in developing a more complete understanding of the impact of zebra mussels and more effective management strategies of eutrophic waters.
Gatlin, Michael R.; Shoup, Daniel E.; Long, James M.
2013-01-01
The introduction and spread of invasive species is of great concern to natural resource managers in the United States. To effectively control the spread of these species, managers must be aware of the multitude of dispersal methods used by the organisms. We investigated the potential for survival through the gut of a migrating fish (blue catfish, Ictalurus furcatus) as a dispersal mechanism for two invasive bivalves: zebra mussel (Driessena polymorpha) and Asian clam (Corbicula fluminea). Blue catfish (N = 62) were sampled over several months from Sooner Lake, Oklahoma, transported to a laboratory and held in individual tanks for 48 h. All fecal material was collected and inspected for live mussels. Survival was significantly related to water temperature in the lake at the time of collection, with no mussels surviving above 21.1 C°, whereas 12 % of zebra mussels (N = 939) and 39 % of Asian clams (N = 408) consumed in cooler water survived gut passage. This research demonstrates the potential for blue catfish to serve as a dispersal vector for invasive bivalves at low water temperatures.
Shcherbina, G. Kh; Buckler, D.R.
2006-01-01
This paper presents data on contemporary distribution patterns of two species of Dreissenidae, the zebra mussel (Dreissena polymorpha) and the Quagga mussel (Dreissena bugensis), and their role in ecosystem processes in the Ivan'kovo, Uglich, Rybinsk, and Gorky Reservoirs of the Upper Volga River basin. The role of zebra mussel was also studied in experimental mesocosms of 15 m3. Maximum abundance and species diversity of macroinvertebrates, especially of leeches, polychaetes, crustaceans, and heterotopic insects, were attained in the portions of reservoirs where Dreissenidae were present and in experimental mesocosms where zebra mussel biomass was the highest. In the mesocosm studies, the presence of zebra mussel druses (colonies) provided shelter for macroinvertebrates, reducing their vulnerability to predation by perch (Perca fluviatills) larvae and yearlings, thereby increasing macroinvertebrate species diversity. It was shown that in addition to its role in aquatic biocenosis (ecological community) formation and water purification, Dreissenidae are important food objects for benthophagous fishes, especially roach (Rutilus rutilus). Examination of intestines of benthophagous fishes showed that the length of Dreissenidae ranged from 5 to 20 mm in roach; from 4 to 14 mm in silver bream (Blicca bjoerkna), and from 2 to 10 mm in bream (Abramis brama). The largest mussels consumed were Quagga mussels up to 30 mm, noted in the predatory cyprinid, ide (Leuciscus idus). Copyright ?? 2006 by ASTM International.
Directory of Open Access Journals (Sweden)
Silvia Regina de Lima
2010-08-01
Full Text Available In this study, the main chemical components of Moquinia polymorpha (LESS. DC. (candeia or cambará wood were investigated. This wood is native in the Southern region of Minas Gerais - Brazil. The chemical composition was: 47.5% of α-cellulose, 25.4% of A and B hemicelluloses, 24.0% of lignin, 73.2% of holocellulose, 3.82% of ethanol:cyclohexane (1:1, v v-1 extractives, 3.21% of ethanol extractives and 4.04% of hot water extractives. The volatile composition was mainly: α-curcumene, α-dihydroturmerone, β-dihydroturmerone, cedranol, 1-cyclopentyl-3-[2,4-dimethylphenyl]propane. The total phenols analysis was carried out on methanol:water (MW and acetone:water (AW extracts. The last one presented better yield. The total phenols were determined by Folin-Ciocalteau and the modified Prussian blue assays. Folin-Ciocalteau yielded 0.93 mg g-1 of wood for MW extract and 1.56 for AW extract; modified Prussian blue yielded 2.74 mg g-1 of wood for MW extract and 4.42 for AW extract. Proanthocyanidins were determined by n-buthanol-acid and vanillin assays. The n-buthanol acid yielded 0.012 mg g-1 of wood for MW extract and 0.017 for AW extract; vanillin: 0.29 mg g-1 of wood for MW extract and 0.58 for AW extract. 3-deoxy-proanthocyanidins were not detected.
Bervoets, Lieven; Voets, Judith; Chu, Shaogang; Covaci, Adrian; Schepens, Paul; Blust, Ronny
2004-08-01
Zebra mussels (Dreissena polymorpha) were exposed at 12 canals and lakes situated in Flanders (Belgium), in cages for six weeks during the summer of 2002. Accumulation of polychlorinated biphenyls (PCBs), polybrominated diphenyl ethers (PBDEs), hexachlorobenzene, and trace metals were measured in the transplanted mussels and levels compared to levels in indigenous mussels. Additionally, zebra mussels were exposed at a small lake in the vicinity of Antwerp (Belgium), and accumulation of contaminants was followed for an extended period from December 2001 to April 2002. Analysis of the pollutants in the indigenous mussels showed that the selected sites displayed a wide range of pollution from near to background to very high levels of metals and/or organic contaminants when compared to the literature. For organic contaminants and for most metals, comparison of levels between caged and resident mussels revealed no significant differences. Only for cadmium and nickel, significant differences were observed, with levels being either higher (cadmium) or lower (nickel) in caged mussels. For organic contaminants, significant correlations between levels in caged and resident mussels were found with r2 values up to 0.98. For some metals, no or poor correlations were found. At most sites, concentrations of those metals were of the same order of magnitude and comparable to levels in mussels from unpolluted sites. This might explain the absence of significant correlations. When mussels were exposed for an extended period, the concentration of some pollutants increased, whereas others decreased with time. Only in the case of certain metals did levels differ significantly because of the slow depuration of metals already present in the transplanted mussels. This is an additional indication that measured concentrations in transplanted mussels indeed reflected the local situation. With this study, we were able to prove the applicability of transplanted mussels as a biomonitoring tool
Body size-dependent Cd accumulation in the zebra mussel Dreissena polymorpha from different routes.
Tang, Wen-Li; Evans, Douglas; Kraemer, Lisa; Zhong, Huan
2017-02-01
Understanding body size-dependent metal accumulation in aquatic organisms (i.e., metal allometry) is critical in interpreting biomonitoring data. While growth has received the most attention, little is known about controls of metal exposure routes on metal allometry. Here, size-dependent Cd accumulation in zebra mussels (Dreissena polymorpha) from different routes were investigated by exposing mussels to A.( 111 Cd spiked algae+ 113 Cd spiked river water) or B.( 111 Cd spiked sediments+ 113 Cd spiked river water). After exposure, 111 Cd or 113 Cd levels in mussel tissue were found to be negatively correlated with tissue weight, while Cd allometry coefficients (b values) were dependent on Cd exposure routes: -0.664 for algae, -0.241 for sediments and -0.379 for river water, compared to -0.582 in un-exposed mussels. By comparing different Cd exposure routes, we found that size-dependent Cd bioaccumulation from algae or river water could be more responsible for the overall size-dependent Cd accumulation in mussels, and the relative importance of the two sources was dependent on mussel size ranges: Cadmium obtained from algae (algae-Cd) was more important in size-dependent Cd accumulation in smaller mussels (tissue dry weight 5 mg). In contrast, sediment-Cd contributed only a small amount to Cd accumulation in zebra mussels and may have little effect on size-dependent Cd bioaccumulation. Our results suggest that size-dependent Cd accumulation in mussels could be largely affected by exposure routes, which should be considered when trying to interpret Cd biomonitoring data of zebra mussels. Copyright © 2016 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Sures, B.; Steiner, W.; Rydlo, M.; Taraschewski, H.
1999-11-01
Concentrations of the elements Al, Ag, Ba, ca, Cd, Co, Cr, cu, Fe, Ga, Mg, Mn, Ni, Pb, Sr, Tl, and Zn were analyzed by inductively coupled plasma mass spectrometry in the acanthocephalan Acanthocephalus lucii (Mueller); in its host, Perca fluviatilis (L.), and in the soft tissue of the zebra mussel, Dreissena polymorpha (Pallas). All animals were collected from the same sampling site in a subalpine lake, Mondsee, in Austria. Most of the elements were found at significantly higher concentrations in the acanthocephalan than in different tissues (muscle, liver, and intestinal wall) of its perch host. Only Co was concentrated in the liver of perch to a level that was significantly higher than that found in the parasite. Most of the analyzed elements were also present at significantly higher concentrations in A. lucii than in D. polymorpha. Barium and Cr were the only elements recorded at higher concentrations in the mussel compared with the acanthocephalan. Thus, when comparing the accumulation of elements, the acanthocephalans appear to be even more suitable than the zebra mussels in terms of their use in the detection of metal contamination within aquatic biotopes. Spearman correlation analysis revealed that the concentrations of several elements within the parasites decreased with increasing infrapopulation. Furthermore, the levels of some elements in the perch liver were negatively correlated with the weight of A. lucii in the intestine. Thus, it emerged that not only is there competition for elements between acanthocephalans inside the gut but there is also competition for these elements between the host and the parasites. The elevated element concentrations demonstrated here in the parasitic worm A. lucii provide support for further investigations of these common helminthes and of their accumulation properties.
Binelli, A; Ricciardi, F; Riva, C; Provini, A
2006-01-01
One of the useful biological tools for environmental management is the measurement of biomarkers whose changes are related to the exposure to chemicals or environmental stress. Since these responses might vary with different contaminants or depending on the pollutant concentration reached in the organism, the support of bioaccumulation data is needed to prevent false conclusions. In this study, several persistent organic pollutants -- 23 polychlorinated biphenyl (PCB) congeners, 11 polycyclic aromatic hydrocarbons (PAHs), six dichlorodiphenyltricholroethane (DDT) relatives, hexachlorobenzene (HCB), chlorpyrifos and its oxidized metabolite -- and some herbicides (lindane and the isomers alpha, beta, delta; terbutilazine; alachlor; metolachlor) were measured in the soft tissues of the freshwater mollusc Zebra mussel (Dreissena polymorpha) from 25 sampling sites in the Italian portions of the sub-alpine great lakes along with the measure of ethoxyresorufin dealkylation (EROD) and acetylcholinesterase (AChE) activity. The linkage between bioaccumulation and biomarker data allowed us to create site-specific environmental quality indexes towards man-made chemicals. This classification highlighted three different degrees of xenobiotic contamination of the Italian sub-alpine great lakes: a high water quality in Lake Lugano with negligible pollutant levels and no effects on enzyme activities, an homogeneous poor quality for Lakes Garda, Iseo and Como, and the presence of some xenobiotic point-sources in Lake Maggiore, whose ecological status could be jeopardized, also due to the heavy DDT contamination revealed since 1996.
Shoults-Wilson, W Aaron; Elsayed, Norhan; Leckrone, Kristen; Unrine, Jason
2015-02-01
The invasive zebra mussel (Dreissena polymorpha) has become an accepted biomonitor organism for trace elements, but it has yet to be studied along the Lake Michigan shoreline. Likewise, the relationships between tissue concentrations of elements, organism size, and sediment concentrations of elements have not been fully explained. The present study found that a variety of allometric variables such as length, dry tissue mass, shell mass, organism condition indices, and shell thickness index were useful in explaining intrasite variability in elemental concentrations. The flesh condition index (grams of tissue dry mass per gram of shell mass) explained variability at the most sites for most elements. Once allometric intrasite variability was taken into account, additional significant differences were found between sites, although the net effect was small. Significant positive relationships between sediment and tissue concentrations were found for Pb and Zn, with a significant negative relationship for Cd. It was also found that Cu and Zn concentrations in tissues increased significantly along the shoreline in the southeasterly direction, whereas Hg increased in a northwesterly direction. Opportunistic sampling found that zebra mussels accumulate significantly higher concentrations of nearly all elements analyzed compared to Asian clams (Corbicula fluminea) at the same site. The present study demonstrates the need to fully explain natural sources of variability before using biomonitors to explain spatial distributions of trace elements. © 2014 SETAC.
Molloy, Daniel P; Lynn, Denis H; Giamberini, Laure
2005-07-18
Ophryoglena hemophaga n. sp. is described from a freshwater Dreissena polymorpha population in the Rhine delta of the Netherlands. This is the first ophryoglenine species (order Hymenostomatida, suborder Ophryoglenina) recorded as a molluscan parasite. As is typical of ciliates in the suborder Ophryoglenina, O. hemophaga exhibits a polymorphic life history with cystment and reproduction by palintomy. Trophonts were observed within digestive gland lumina, and zebra mussel hemocytes were present in some of their digestive vacuoles. The presence of a single, longitudinal tract of multiple contractile vacuoles represents its most unique feature and distinguishes it from all other described Ophryoglena spp. The number of somatic kineties of O. hemophaga (range 100 to 124) is also distinguishing as it is one of the lowest for [corrected] an Ophryoglena sp. Other characteristics of this species include: ovoid to elongate trophonts 96 to 288 microm in length, with an elongate macronucleus 41 to 65 microm in length; tomonts 50 to 150 microm in diameter producing a clear mucous cyst envelope, whose thickness is approximately half of the tomont diameter; elongated theronts 96 to 131 microm in length which emerge after 1 to 3 cell divisions taking 36 to 48 h at 20 +/- 3 degrees C. Protomonts and theronts are, respectively, negatively and positively phototactic--characteristics that likely aid in maintenance of infection in zebra mussel populations.
Châtel, Amélie; Faucet-Marquis, Virginie; Gourlay-Francé, Catherine; Pfohl-Leszkowicz, Annie; Vincent-Hubert, Françoise
2015-04-01
The aim of the present study was to confirm the relevance of studying DNA adduct formation in a field study. In that context, freshwater mussels Dreissena polymorpha, collected in a reference station, were transplanted in different sites with a pollution gradient. After one and two months, mussels were collected and DNA adduct formation was analyzed using the (32)P post labelling technique on both gills and digestive glands. In addition, the expression of genes involved in the detoxification system (catalase (CAT), superoxide dismutase (SOD), glutathione S-transferase (GST), HSP70, aryl hydrocarbon receptor (AHR), P glycoprotein (PgP), metallothionein (MT)) was assessed by RT-PCR. DNA adducts were observed at amount comparable to data from literature. Increase of DNA adducts after two months of transplantation could be correlated with strong modulation of gene expression implicated in detoxification processes. Indeed, PgP and HSP70 gene expressions were similarly induced in gills and digestive glands while SOD and CAT expressions were down regulated in both tissues. AHR, GST and MT genes were differently regulated depending upon the tissue studied and the level of contamination in the different sites. We demonstrated that mussels transplanted in the different stations with pollution gradient were able to biotransform PAHs, assessed by DNA adduct formation and the high decrease of detoxification genes. Specific DNA adducts pattern obtained after one and two month mussel transplantations demonstrated the relevance of DNA adduct as biomarker of environmental pollution. Copyright © 2014 Elsevier Inc. All rights reserved.
Palais, F; Dedourge-Geffard, O; Beaudon, A; Pain-Devin, S; Trapp, J; Geffard, O; Noury, P; Gourlay-Francé, C; Uher, E; Mouneyrac, C; Biagianti-Risbourg, S; Geffard, A
2012-04-01
A 12-month active biomonitoring study was performed in 2008-2009 on the Vesle river basin (Champagne-Ardenne, France) using the freshwater mussel Dreissena polymorpha as a sentinel species; allochthonous mussels originating from a reference site (Commercy) were exposed at four sites (Bouy, Sept-Saulx, Fismes, Ardre) within the Vesle river basin. Selected core biomarkers (acetylcholinesterase (AChE) activity, glutathione-S transferase (GST) activity, metallothionein concentration), along with digestive enzyme activities (amylase, endocellulase) and energy reserve concentrations (glycogen, lipids), were monitored throughout the study in exposed mussels. At the Fismes and Ardre sites (downstream basin), metallic and organic contamination levels were low but still high enough to elicit AChE and GST activity induction in exposed mussels (chemical stress); besides, chemical pollutants had no apparent deleterious effects on mussel condition. At the Bouy and Sept-Saulx sites (upstream basin), mussels obviously suffered from adverse food conditions which seriously impaired individual physiological state and survival (nutritional stress); food scarcity had however no apparent effects on core biomarker responses. Digestive enzyme activities responded to both chemical and nutritional stresses, the increase in energy outputs (general adaptation syndrome-downstream sites) or the decrease in energy inputs (food scarcity-upstream sites) leading to mid- or long-term induction of digestive carbohydrase activities in exposed mussels (energy optimizing strategy). Complex regulation patterns of these activities require nevertheless the use of a multi-marker approach to allow data interpretation. Besides, their sensitivity to natural confounding environmental factors remains to be precised.
Cope, W.G.; Newton, T.J.; Gatenby, C.M.
2003-01-01
Because of the declines in diversity and abundance of native freshwater mussels (superfamily Unionoidea), and the potential decimation of populations of native mussels resulting from the rapid spread of the exotic zebra mussel Dreissena polymorpha, management options to eliminate or reduce the threat of the zebra mussel are needed. Relocating native mussels to refugia (artificial and natural) has been proposed to mitigate the threat of zebra mussels to native species. Relocation of native mussels to refugia such as fish hatchery facilities or natural habitats within their historic range. Which are unlikely to be infested by zebra mussels, necessitates that protocols be developed to prevent the inadvertent introduction of zebra mussels. Several recent studies have developed Such protocols, and have assessed their effectiveness on the health and survival of native mussels during subsequent relocation to various refugia. The purpose of this project is to synthesize and evaluate the current protocols and to develop a set of procedures that resource managers and researchers should consider before conducting conservation activities in zebra mussel infested waters. We found that the existing protocols have many common points of concern, such as facility modification and suitability, zebra mussel risk assessment and management procedures, and health and disease management procedures. These conservation protocols may have broad applicability to other situations and locations. A summary and evaluation of the information in these main areas, along with recommended guidelines, are presented in this article.
Directory of Open Access Journals (Sweden)
Périne Doyen
2015-04-01
Full Text Available Glutathione S-transferases (GST, glutathione peroxidases (GPx and metallothioneins (MT are essential components of cellular detoxication systems. We studied the expression of pi-GST, Se-GPx, and MT transcripts in the digestive gland of Dreissena polymorpha exposed to organic and metallic pollutants. Mussels from a control site were transplanted during 3, 15 and 30 days into the Moselle River, upstream and downstream to the confluence with the Fensch River, a tributary highly polluted by polycyclic aromatic hydrocarbons and heavy metals. Se-GPx and pi-GST mRNA expression increased in mussels transplanted into the upstream site, Se-GPx response being the earliest. These genes were also induced after 3-days exposure at the downstream site. These inductions suggest an adaptative response to an alteration of the environment. Moreover, at this site, a significant decrease of the expression of MT, pi-GST and Se-GPx transcripts was observed after 30 days which could correspond to an inefficiency of detoxification mecanisms. The results are in correlation with the levels of pollutants in the sediments and their bioaccumulation in mussels, they confirm the environmental deleterious impact of the pollutants carried by the Fensch River.
Directory of Open Access Journals (Sweden)
Luciana Francisco Fleuri
2010-06-01
Full Text Available O presente trabalho visou a aplicação da β-1,3 glucanase lítica, obtida do microrganismo Cellulosimicrobium cellulans 191, na produção de protoplastos e na lise da parede celular de leveduras. A preparação bruta da enzima foi capaz de lisar as leveduras Kluyveromyces lodderi, Saccharomyces cerevisiae (Fleischmann e Itaiquara, S. cerevisiae KL-88, S. diastaticus NCYC 713, S. cerevisiae NCYC 1001, Candida glabrata NCYC 388, Kluyveromyces marxianus NCYC 587 e Hansenula mrakii NCYC 500. A β-1,3 glucanase purificada foi capaz de lisar as leveduras Saccharomyces cerevisiae KL-88, Saccharomyces capensis, Debaromyces vanriji, Pachysolen tannophillus, Kluyveromyces drosophilarum, Candida glabrata, Hansenula mrakii e Pichia membranaefaciens e formar protoplastos de Saccharomyces cerevisiae KL-88.The aim of this work was the application of lytic β-1,3 glucanase obtained from Cellulosimicrobium cellulans strain 191 in the production of protoplasts and lysis of yeast cell walls. The crude extract demonstrated lysis activity against the yeasts Kluyveromyces lodderi, Saccharomyces cerevisiae (Fleischmann and Itaiquara, S. cerevisiae KL-88, S. diastaticus NCYC 713, S. cerevisiae NCYC 1001, Candida glabrata NCYC 388, Kluyveromyces marxianus NCYC 587, and Hansenula mrakii NCYC 500. The purified β-1,3 glucanase demonstrated lysis activity against the yeasts Saccharomyces cerevisiae KL-88, Saccharomyces capensis, Debaromyces vanriji, Pachysolen tannophillus, Kluyveromyces drosophilarum, Candida glabrata, Hansenula mrakii, and Pichia membranaefaciens, and it was able to produce Saccharomyces cerevisiae KL-88 protoplasts.
Regoli, L; Chan, H M; de Lafontaine, Y; Mikaelian, I
2001-07-01
Toxic antifouling agents such as tributyltin (TBT) and triphenyltin (TPT) have been released in aquatic ecosystems through the use of antifouling paint applied to ship hulls, pleasure crafts and fish nets and these compounds can bioaccumulate in aquatic organisms. The purpose of this study was 1) to assess the extent of the distribution of organotins from a contaminated marina to the St. Lawrence River system by measuring organotin concentrations in zebra mussels (Dreissena polymorpha) and in sediments collected from 9 sites along the St. Lawrence River near Quebec City in July 1998, and 2) to examine the histopathological condition of zebra mussel tissues from these sites. TBT concentrations in zebra mussels were between 37 and 1078 ng Sn g(-1) wet weight, with the highest value found in the Bassin Louise marina. Elevated concentrations were also found in two other marinas. The concentrations decreased sharply to background levels just outside the marinas. All butyltins were detected in all sediments analysed, with highest values found in the Bassin Louise marina. Phenyltins were detected in three of the nine sites in low concentrations (zebra mussels. There was a significant correlation between TBT in sediments and mussels. Gonadal development of zebra mussels varied largely between sites, and was negatively associated to TBT levels in mussel tissue. This study shows that TBT contamination remains a problem in localised freshwater sectors of the St. Lawrence River.
Avaliação da atividade antimicrobiana e citotóxica de extratos de Gochnatia polymorpha ssp floccosa
Directory of Open Access Journals (Sweden)
Maria Élida A. Stefanello
Full Text Available Neste estudo procedeu-se a avaliação da atividade antimicrobiana e citotóxica de extratos de Gochnatia polymorpha ssp floccosa, espécie empregada na medicina popular contra doenças respiratórias. Folhas, cascas do tronco e ramos foram extraídos com hexano, diclorometano e etanol, sucessivamente, sendo obtidos os respectivos extratos brutos. A atividade antimicrobiana foi determinada pelo método de difusão em ágar utilizando-se bactérias Gram-positivas, Gram-negativas e fungos. A avaliação da citotoxicidade foi realizada empregando-se o ensaio de letalidade contra Artemia salina. Nenhum dos extratos mostrou atividade citotóxica. Os extratos das folhas apresentaram uma fraca atividade antimicrobiana frente a algumas cepas de Staphylococcus aureus e Streptococcus mutans, enquanto o extrato em diclorometano dos ramos e o extrato em etanol das cascas foram ativos contra Micrococcus luteus, Staphylococcus aureus e S. epidermidis. A maior atividade antimicrobiana foi observada para o extrato em diclorometano das cascas, que inibiu o crescimento de Micrococcus luteus, Staphylococcus aureus, S. epidermidis, Streptococcus mutans, Enterococcus faecalis e Candida albicans. Esta atividade parece estar relacionada à presença de diterpenos no extrato. Nenhum dos extratos estudados (a 5,0 mg/mL mostrou atividade frente a cepas de bactérias Gram-negativas. Esses resultados demonstram o potencial dessa planta como fonte de compostos antibacterianos e justificam, parcialmente, seu uso popular.
Hanson, Sara J; Byrne, Kevin P; Wolfe, Kenneth H
2014-11-11
Saccharomyces cerevisiae has a complex system for switching the mating type of haploid cells, requiring the genome to have three mating-type (MAT)-like loci and a mechanism for silencing two of them. How this system originated is unknown, because the three-locus system is present throughout the family Saccharomycetaceae, whereas species in the sister Candida clade have only one locus and do not switch. Here we show that yeasts in a third clade, the methylotrophs, have a simpler two-locus switching system based on reversible inversion of a section of chromosome with MATa genes at one end and MATalpha genes at the other end. In Hansenula polymorpha the 19-kb invertible region lies beside a centromere so that, depending on the orientation, either MATa or MATalpha is silenced by centromeric chromatin. In Pichia pastoris, the orientation of a 138-kb invertible region puts either MATa or MATalpha beside a telomere and represses transcription of MATa2 or MATalpha2. Both species are homothallic, and inversion of their MAT regions can be induced by crossing two strains of the same mating type. The three-locus system of S. cerevisiae, which uses a nonconservative mechanism to replace DNA at MAT, likely evolved from a conservative two-locus system that swapped genes between expression and nonexpression sites by inversion. The increasing complexity of the switching apparatus, with three loci, donor bias, and cell lineage tracking, can be explained by continuous selection to increase sporulation ability in young colonies. Our results provide an evolutionary context for the diversity of switching and silencing mechanisms.
Jost, Jennifer A; Keshwani, Sarah S; Abou-Hanna, Jacob J
2015-04-01
Global climate change is affecting ectothermic species, and a variety of studies are needed on thermal tolerances, especially from cellular and physiological perspectives. This study utilized AMP-activated protein kinase (AMPK), a key regulator of cellular energy levels, to examine the effects of high water temperatures on zebra mussel (Dreissena polymorpha) physiology. During heating, AMPK activity increased as water temperature increased to a point, and maximum AMPK activity was detected at high, but sublethal, water temperatures. This pattern varied with season, suggesting that cellular mechanisms of seasonal thermal acclimatization affect basic metabolic processes during sublethal heat stress. There was a greater seasonal variation in the water temperature at which maximum AMPK activity was measured than in lethal water temperature. Furthermore, baseline AMPK activity varied significantly across seasons, most likely reflecting altered metabolic states during times of growth and reproduction. In addition, when summer-collected mussels were lab-acclimated to winter and spring water temperatures, patterns of heat stress mirrored those of field-collected animals. These data suggest that water temperature is the main driver of the seasonal variation in physiology. This study concluded that AMPK activity, which reflects changes in energy supply and demand during heat stress, can serve as a sensitive and early indicator of temperature stress in mussels. Copyright © 2014 Elsevier Inc. All rights reserved.
Lepoutre, Alexandra; Milliote, Nadia; Bonnard, Marc; Palos-Ladeiro, Mélissa; Rioult, Damien; Bonnard, Isabelle; Bastien, Fanny; Faassen, Elisabeth; Geffard, Alain; Lance, Emilie
2018-03-01
The environmental neurotoxin β- N -Methylamino-l-alanine (BMAA) has been pointed out to be involved in human neurodegenerative diseases. This molecule is known to be bioaccumulated by bivalves. However, little data about its toxic effects on freshwater mussels is available, particularly on the hemolymphatic compartment and its hemocyte cells involved in various physiological processes such as immune defenses, digestion and excretion, tissue repair, and shell production. Here we exposed Dreissena polymorpha to dissolved BMAA, at the environmental concentration of 7.5 µg of /mussel/3 days, during 21 days followed by 14 days of depuration in clear water, with the objective of assessing the BMAA presence in the hemolymphatic compartment, as well as the impact of the hemocyte cells in terms of potential cytotoxicity, immunotoxicity, and genotoxiciy. Data showed that hemocytes were in contact with BMAA. The presence of BMAA in hemolymph did not induce significant effect on hemocytes phagocytosis activity. However, significant DNA damage on hemocytes occurred during the first week (days 3 and 8) of BMAA exposure, followed by an increase of hemocyte mortality after 2 weeks of exposure. Those effects might be an indirect consequence of the BMAA-induced oxidative stress in cells. However, DNA strand breaks and mortality did not persist during the entire exposure, despite the BMAA persistence in the hemolymph, suggesting potential induction of some DNA-repair mechanisms.
Zhong, Huan; Kraemer, Lisa; Evans, Douglas
2013-10-15
Size of organisms is critical in controlling metal bioavailability and bioaccumulation, while mechanisms of size-related metal bioaccumulation are not fully understood. To investigate the influences of different sources of particle-associated Cu on body size-related Cu bioavailability and bioaccumulation, zebra mussels (Dreissena polymorpha) of different sizes were exposed to stable Cu isotope ((65)Cu) spiked algae (Chlorella vulgaris) or sediments in the laboratory and the Cu tissue concentration-size relationships were compared with that in unexposed mussels. Copper tissue concentrations decreased with mussel size (tissue or shell dry weight) in both unexposed and algal-exposed mussels with similar decreasing patterns, but were independent of size in sediment-exposed mussels. Furthermore, the relative contribution of Cu uptake from algae (65-91%) to Cu bioaccumulation is always higher than that from sediments (9-35%), possibly due to the higher bioavailability of algal-Cu. Therefore, the size-related ingestion of algae could be more important in influencing the size-related variations in Cu bioaccumulation. However, the relative contribution of sediment-Cu to Cu bioaccumulation increased with body size and thus sediment ingestion may also affect the size-related Cu variations in larger mussels (tissue weight >7.5mg). This study highlights the importance of considering exposure pathways in normalization of metal concentration variation when using bivalves as biomonitors. Copyright © 2013 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Alexandra Lepoutre
2018-03-01
Full Text Available The environmental neurotoxin β-N-Methylamino-l-alanine (BMAA has been pointed out to be involved in human neurodegenerative diseases. This molecule is known to be bioaccumulated by bivalves. However, little data about its toxic effects on freshwater mussels is available, particularly on the hemolymphatic compartment and its hemocyte cells involved in various physiological processes such as immune defenses, digestion and excretion, tissue repair, and shell production. Here we exposed Dreissena polymorpha to dissolved BMAA, at the environmental concentration of 7.5 µg of /mussel/3 days, during 21 days followed by 14 days of depuration in clear water, with the objective of assessing the BMAA presence in the hemolymphatic compartment, as well as the impact of the hemocyte cells in terms of potential cytotoxicity, immunotoxicity, and genotoxiciy. Data showed that hemocytes were in contact with BMAA. The presence of BMAA in hemolymph did not induce significant effect on hemocytes phagocytosis activity. However, significant DNA damage on hemocytes occurred during the first week (days 3 and 8 of BMAA exposure, followed by an increase of hemocyte mortality after 2 weeks of exposure. Those effects might be an indirect consequence of the BMAA-induced oxidative stress in cells. However, DNA strand breaks and mortality did not persist during the entire exposure, despite the BMAA persistence in the hemolymph, suggesting potential induction of some DNA-repair mechanisms.
Directory of Open Access Journals (Sweden)
Marc Bonnard
2015-06-01
Full Text Available The measure of DNA integrity by the single cell gel electrophoresis (SCGE or comet assay is especially recommended for its sensitivity and its capacity for detecting different types of damages. Therefore, it has been applied in environmental genotoxicity in a variety of organisms. It appears today necessary to define both reference and threshold levels of DNA damage, for their application in in situ biomonitoring. However, little is known about the influence of both biological (sex, reproduction status or external (temperature… confounding factors on the measure of DNA damage by the comet assay. These variables need to be taken into account if the robustness of the assay is to be established (Jha, 2008. In the zebra mussel Dreissena polymorpha (recommended as a sentinel species in the evaluation of freshwater quality the measure of DNA damage by the comet assay is mainly performed on hemocytes, which are circulating cells involved in key physiological functions such as immunity, homeostasis, detoxication…. This communication will present and discuss results from an innovative study about the variability of the baseline level of DNA damage in hemocytes of mussels encaged for one year in the canal de l’Aisne à la Marne (Reims, according to their sex and their reproductive status. The sensitivity and the suitability of hemocytes in the evaluation of environmental genotoxicity will also be discussed, referring to observations during a 6 month-exposure of mussels in mesocosms to environmentally realistic concentrations of carbamazepine.
Watanabe, Miki; Meyer, Kathryn A; Jackson, Tyler M; Schock, Tracey B; Johnson, W Edward; Bearden, Daniel W
Zebra mussel, Dreissena polymorpha , in the Great Lakes is being monitored as a bio-indicator organism for environmental health effects by the National Oceanic and Atmospheric Administration's Mussel Watch program. In order to monitor the environmental effects of industrial pollution on the ecosystem, invasive zebra mussels were collected from four stations-three inner harbor sites (LMMB4, LMMB1, and LMMB) in Milwaukee Estuary, and one reference site (LMMB5) in Lake Michigan, Wisconsin. Nuclear magnetic resonance (NMR)-based metabolomics was used to evaluate the metabolic profiles of the mussels from these four sites. The objective was to observe whether there were differences in metabolite profiles between impacted sites and the reference site; and if there were metabolic profile differences among the impacted sites. Principal component analyses indicated there was no significant difference between two impacted sites: north Milwaukee harbor (LMMB and LMMB4) and the LMMB5 reference site. However, significant metabolic differences were observed between the impacted site on the south Milwaukee harbor (LMMB1) and the LMMB5 reference site, a finding that correlates with preliminary sediment toxicity results. A total of 26 altered metabolites (including two unidentified peaks) were successfully identified in a comparison of zebra mussels from the LMMB1 site and LMMB5 reference site. The application of both uni- and multivariate analysis not only confirmed the variability of altered metabolites but also ensured that these metabolites were identified via unbiased analysis. This study has demonstrated the feasibility of the NMR-based metabolomics approach to assess whole-body metabolomics of zebra mussels to study the physiological impact of toxicant exposure at field sites.
Nichols, S. Jerrine; Black, M.G.
1994-01-01
There are presently four freshwater bivalves in the United States that produce larvae or veligers commonly found in the water column: two forms of Asian clams and two species of dreissenids. Portions of the geographic range of three of these bivalves, one species of Asian clam (Corbicula fluminea), zebra mussels (Dreissena polymorpha), and quagga mussels (Dreissena rosteriformis bugensis), overlap, causing problems with larval identification. To determine which characteristics can be used to separate larval forms, adult Asian clams, quaggas, and zebra mussels were brought into the laboratory and induced to spawn, and the resulting larvae were reared. Hybrids between quaggas and zebra mussels were also produced, but not reared to maturity. Characteristics allowing for the most rapid and accurate separation of larvae were hinge length, shell length/height, shell shape, shell size, and the presence or absence of a foot and velum. These characteristics were observed in laboratory-reared larvae of known parentage and field-caught larvae of unknown parentage. In most cases, larvae of the Asian clam can be readily separated from those produced by either type of dreissenid on the basis of shell size and presence of a foot. Separating the gametes and embryos of the two types of dreissenids is not possible, but after shell formation, most of the larval stages can be distinguished. Hinge length, shell length/height, and the similarity in size of the shell valves can be used to separate straight-hinged, umbonal, pediveliger, and plantigrade larvae. Quagga × zebra mussel hybrids show characteristics of both parents and are difficult to identify.
Kiel, JAKW; Veenhuis, M
2000-01-01
In the past decade, much progress has been made in understanding the mechanisms that govern sorting of proteins to the peroxisomal lumen. This article summarizes the principal features of how peroxisomal matrix enzymes are thought to reach the peroxisome. In addition, it describes recent data that
Ram, Jeffrey L.; Fong, Peter; Croll, Roger P.; Nichols, Susan J.; Wall, Darcie
1992-01-01
The zebra mussel (Dreissena polymorpha) has spread rapidly in temperate fresh waters of North America since its introduction into the Great Lakes in 1985 or 1986. It attaches to hard substrates, forming layers, occluding water intakes, encrusting and killing native mussels, filtering algae in competition with other planktivores, and possibly interfering with fish spawning. It reproduces prolifically, suggesting that an approach to its control may be by controlling its reproduction. Previous literature suggests that spawning in bivalves is regulated by both environmental and internal chemical cues. A suggested sequence is that phytoplankton chemicals initially trigger spawning; chemicals associated with gametes provide a species-specific pheromonal positive feedback for spawning; and the response to environmental chemicals is mediated internally by serotonin (5-HT). The role of 5-HT in zebra mussels is under investigation. Both males and females can be induced to spawn by either injection or external application of 5-HT. The response can also be activated by 8-hydroxy-2-(di-n-propylamino)-tetralin, an agonist at 5-HT1A receptors. HPLC analysis has detected 5-HT as the major biogenic amine in both male and female gonads. 5-HT immunocytochemistry demonstrates nerves containing serotonergic fibers innervating gonads of both males and females, with prominent varicosities surrounding the follicles in both sexes. A role of 5-HT in mediating spawning responses in zebra mussels is thus strongly supported. These studies have shown that reproductive behavior of zebra mussels can be modified by outside chemicals, a property that may be exploited for purposes of control.
Montanini, Barbara; Viscomi, Arturo R.; Bolchi, Angelo; Martin, Yusé; Siverio, José M.; Balestrini, Raffaella; Bonfante, Paola; Ottonello, Simone
2005-01-01
Nitrogen assimilation by plant symbiotic fungi plays a central role in the mutualistic interaction established by these organisms, as well as in nitrogen flux in a variety of soils. In the present study, we report on the functional properties, structural organization and distinctive mode of regulation of TbNrt2 (Tuber borchii NRT2 family transporter), the nitrate transporter of the mycorrhizal ascomycete T. borchii. As revealed by experiments conducted in a nitrate-uptake-defective mutant of the yeast Hansenula polymorpha, TbNrt2 is a high-affinity transporter (Km=4.7 μM nitrate) that is bispecific for nitrate and nitrite. It is expressed in free-living mycelia and in mycorrhizae, where it preferentially accumulates in the plasma membrane of root-contacting hyphae. The TbNrt2 mRNA, which is transcribed from a single-copy gene clustered with the nitrate reductase gene in the T. borchii genome, was specifically up-regulated following transfer of mycelia to nitrate- (or nitrite)-containing medium. However, at variance with the strict nitrate-dependent induction commonly observed in other organisms, TbNrt2 was also up-regulated (at both the mRNA and the protein level) following transfer to a nitrogen-free medium. This unusual mode of regulation differs from that of the adjacent nitrate reductase gene, which was expressed at basal levels under nitrogen deprivation conditions and required nitrate for induction. The functional and expression properties, described in the present study, delineate TbNrt2 as a versatile transporter that may be especially suited to cope with the fluctuating (and often low) mineral nitrogen concentrations found in most natural, especially forest, soils. PMID:16201972
New approaches for improving the production of the 1st and 2nd generation ethanol by yeast.
Kurylenko, Olena; Semkiv, Marta; Ruchala, Justyna; Hryniv, Orest; Kshanovska, Barbara; Abbas, Charles; Dmytruk, Kostyantyn; Sibirny, Andriy
2016-01-01
Increase in the production of 1st generation ethanol from glucose is possible by the reduction in the production of ethanol co-products, especially biomass. We have developed a method to reduce biomass accumulation of Saccharomyces cerevisiae by the manipulation of the intracellular ATP level due to overexpression of genes of alkaline phosphatase, apyrase or enzymes involved in futile cycles. The strains constructed accumulated up to 10% more ethanol on a cornmeal hydrolysate medium. Similar increase in ethanol accumulation was observed in the mutants resistant to the toxic inhibitors of glycolysis like 3-bromopyruvate and others. Substantial increase in fuel ethanol production will be obtained by the development of new strains of yeasts that ferment sugars of the abundant lignocellulosic feedstocks, especially xylose, a pentose sugar. We have found that xylose can be fermented under elevated temperatures by the thermotolerant yeast, Hansenula polymorpha. We combined protein engineering of the gene coding for xylose reductase (XYL1) along with overexpression of the other two genes responsible for xylose metabolism in yeast (XYL2, XYL3) and the deletion of the global transcriptional activator CAT8, with the selection of mutants defective in utilizing ethanol as a carbon source using the anticancer drug, 3-bromopyruvate. Resulted strains accumulated 20-25 times more ethanol from xylose at the elevated temperature of 45°C with up to 12.5 g L(-1) produced. Increase in ethanol yield and productivity from xylose was also achieved by overexpression of genes coding for the peroxisomal enzymes: transketolase (DAS1) and transaldolase (TAL2), and deletion of the ATG13 gene.
ORF Sequence: NC_003282 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available SSQ-3, hansenula mrakii killer toxin-resistant protein 1 like (22.4 kD) (ssq-3) [Caenorhabditis elegans] MTAVGGAPRGASTM...TAVGGAPVGGSSTMTAVGGAPSGASTMTAIGGAPRGASTMTAVGGAPMGGGSTMTAVGGAPSGASTMTAVGGAPSGASTMTAIGGAPRGASTMTAV...GGAPMGGSSTMTAVGGAPIGGSSTMTAVGGAPRGVSTMTAVGGAPGGASTMTAMGGGPSAFGGAPPPPSGSAMGGGGGGGATSAYFGVGSGAMGGGGAGAQSAYFGVGGGPVGGGGGGAKSGGGGGGIPGQSVYMGAGGGGGGGGGATSAYFAPR
Kerambrun, E; Rioult, D; Delahaut, L; Evariste, L; Pain-Devin, S; Auffret, M; Geffard, A; David, E
2016-12-01
The present study was performed to validate the suitability of using gene expression in zebra mussels, Dreissena polymorpha, for biomonitoring of freshwater environment. Mussels were collected in four French rivers (Meuse, Moselle, Oise and Vilaine) in spring and autumn. Relative gene expression of 9 candidate genes involved in cellular metabolic activities (Cytochrome-c-oxidase - cox, and ATP synthase - atp), detoxification process (Metallothionein - mt and Glutathion-S-Transferase - gst), oxidative stress (Catalase - cat, Superoxyde Dismutase - sod and Glutathion peroxidase - gpx) and digestive functions (Amylase - amy and Cellulase - ghf) were measured in digestive gland. Metal bioaccumulation in tissues and morphometric parameters were also analyzed to interpret molecular responses. All our results are consistent with different physiological reactions to environmental condition between zebra mussel populations. In spring, the levels of mt, sod, gpx, cat, atp, amy and ghf relative expression were significantly higher in mussels with the lowest metal bioaccumulation (the Meuse) compared to at least one of the other sites. In autumn, this higher expression levels in Meuse River were still observed for gpx, cat, atp and amy. This study has also pointed out different sources of variability in gene expression (individual size, season, trophic resources and origin of mussels) which are inevitable in natural fluctuant environment. This underlines the importance to take them into account in field study to propose a correct interpretation of biomarker responses. Copyright © 2016 Elsevier Inc. All rights reserved.
Kraemer, Lisa D; Evans, Douglas; Dillon, Peter J
2013-05-01
Zebra mussels (Dreissena polymorpha) are filter feeders located near the base of the foodweb and these animals are able to utilize a variety of carbon sources that may also vary seasonally. We conducted both a spatial and a temporal study in order to test the hypotheses: (1) dissolved organic carbon (DOC) concentrations influence Hg accumulation in zebra mussels sampled from a series of lakes and (2) seasonal variations in diet influence Hg accumulation. In the spatial study, we found a significant negative relationship between Hg concentrations and DOC concentrations, suggesting an influence of DOC on Hg bioaccumulation. In the temporal study, we used stable isotope ratios of nitrogen (δ(15)N) and carbon (δ(13)C) as ecological tools to provide a temporally integrated description of the feeding ecology of zebra mussels. Both δ(15)N and δ(13)C varied seasonally in a similar manner: more depleted values occurred in the summer and more enriched values occurred in the fall. Mercury concentrations also varied significantly over the year, with highest concentrations occurring in the summer, followed by a progressive decrease in concentrations into the fall. The C/N ratio of zebra mussels also varied significantly over the year with the lowest values occurring mid-summer and then values increased in the fall and winter, suggesting that there was significant variation in lipid stores. These results indicate that in addition to any effect of seasonal dietary changes, seasonal variation in energy stores also appeared to be related to Hg levels in the zebra mussels. Collectively results from this study suggest that DOC concentrations, seasonal variation in diet and seasonal depletion of energy stores are all important variables to consider when understanding Hg accumulation in zebra mussels. Copyright © 2013 Elsevier Inc. All rights reserved.
Magni, Stefano; Gagné, François; André, Chantale; Della Torre, Camilla; Auclair, Joëlle; Hanana, Houda; Parenti, Camilla Carla; Bonasoro, Francesco; Binelli, Andrea
2018-08-01
Microplastics (MPs), plastic debris smaller than 5mm, are widely found in both marine and freshwater ecosystems. However, few studies regarding their hazardous effects on inland water organisms, have been conducted. For this reason, the aim of our research was the evaluation of uptake and chronic toxicity of two mixtures (MIXs) of virgin polystyrene microbeads (PMs) of 10μm and 1μm in size (MIX 1, with 5×10 5 of 1μmsizePMs/L and 5×10 5 of 10μmsizePMs/L, and MIX 2 with 2×10 6 of 1μmsizePMs/L and 2×10 6 of 10μmsizePMs/L) on freshwater zebra mussel Dreissena polymorpha (Mollusca: Bivalvia) during 6 exposure days. The PM uptake in the mussel body and hemolymph was assessed using confocal microscopy, while the chronic toxicity of PMs was evaluated on exposed mussels using a comprehensive battery of biomarkers of cellular stress, oxidative damage and neuro- genotoxicity. Confocal microscopy analyses showed that MPs concentrated in the gut lumen of exposed mussels, absorbed and transferred firstly in the tissues and then in the hemolymph. The results revealed that PMs do not produce oxidative stress and genetic damage, with the exception of a significant modulation of catalase and glutathione peroxidase activities in mussels exposed to MIX 1. Regarding neurotoxicity, we observed only a significant increase of dopamine concentration in mussels exposed to both MIXs, suggesting a possible implication of this neurotransmitter in an elimination process of accumulated PMs. This research represents a first study about the evaluation of virgin MP toxicity in zebra mussel and more research is warranted concerning the long term neurological effects of virgin MPs. Crown Copyright © 2018. Published by Elsevier B.V. All rights reserved.
Le, T T Yen; Leuven, Rob S E W; Hendriks, A Jan
2011-12-01
The metal-specific covalent index and the species-specific size-based filtration rate were integrated into a biokinetic model estimating metal bioaccumulation in mussels from the dissolved phase and phytoplankton. The model was validated for zebra (Dreissena polymorpha) and quagga (Dreissena rostriformis bugensis) mussels in the rivers Rhine and Meuse, the Netherlands. The model performed well in predicting tissue concentrations in different-sized zebra mussels from various sampling sites for (55) Mn, (56) Fe, (59) Co, (60) Ni, (82) Se, (111) Cd, (118) Sn, and (208) Pb (r(2) =0.71-0.99). Performance for (52) Cr, (63) Cu, (66) Zn, (68) Zn, and (112) Cd was moderate (r(2) quagga mussels, approximately 73 to 94% of the variability in concentrations of (82) Se, (111) Cd, (112) Cd, and (208) Pb was explained by the model (r(2) =0.73-0.94), followed by (52) Cr, (55) Mn, (56) Fe, (60) Ni, and (63) Cu (r(2) =0.48-0.61). Additionally, in both zebra and quagga mussels, average modeled concentrations were within approximately one order of magnitude of the measured values. In particular, in zebra mussels, estimations of (60) Ni and (82) Se concentrations were equal to 51 and 76% of the measurements, respectively. Higher deviations were observed for (52) Cr, (59) Co, (55) Mn, (56) Fe, (111) Cd, (63) Cu, and (112) Cd (underestimation), and (66) Zn, (68) Zn, (208) Pb, and (118) Sn (overestimation). For quagga mussels, modeled concentrations of (66) Zn and (68) Zn differed approximately 14% from the measured levels. Differences between predictions and measurements were higher for other metals. Copyright © 2011 SETAC.
Cope, W.G.; Bartsch, M.R.; Hightower, J.E.
2006-01-01
The aim of this study was to document and model the population dynamics of zebra mussels Dreissena polymorpha (Pallas, 1771) in Pool 8 of the Upper Mississippi River (UMR), USA, for five consecutive years (1992-1996) following their initial discovery in September 1991. Artificial substrates (concrete blocks, 0.49 m2 surface area) were deployed on or around the first of May at two sites within each of two habitat types (main channel border and contiguous backwater). Blocks were removed monthly (30 ?? 10 d) from the end of May to the end of October to obtain density and growth information. Some blocks deployed in May 1995 were retrieved in April 1996 to obtain information about overwinter growth and survival. The annual density of zebra mussels in Pool 8 of the UMR increased from 3.5/m2 in 1992 to 14,956/m 2 in 1996. The average May-October growth rate of newly recruited individuals, based on a von Bertalanffy growth model fitted to monthly shell-length composition data, was 0.11 mm/d. Model estimates of the average survival rate varied from 21 to 100% per month. Estimated recruitment varied substantially among months, with highest levels occurring in September-October of 1994 and 1996, and in July of 1995. Recruitment and density in both habitat types increased by two orders of magnitude in 1996. Follow-up studies will be necessary to assess the long-term stability of zebra mussel populations in the UMR; this study provides the critical baseline information needed for those future comparisons. ?? Published by Oxford University Press on behalf of The Malacological Society of London 2006.
Directory of Open Access Journals (Sweden)
Altair A. Zebral
1971-01-01
Full Text Available No presente trabalho, os autores estudaram as propriedades morfo-bioquímicas e a sinsibilidade aos antibióticos de 19 amostras de bactérias dos gêneros Mima e Herellea isoladas de material clínico e identificadas como Mima polymorpha variedade oxidans, Mima polymorpha e Herellea vaginicola. No estudo bioquímico observou-se que Herellea vaginicola foi oxidase negativa e em meio complexo nitrogenado, consistentemente ataca a glicose, galactose, manose, arabinose, xilose, lactose a 10% e irregularmente ataca a ramnose e a celobiose; em base sintética nitrogenada, além das atividades citadas, consistentemente produziu ácido a partir da lactose. Mima polymopha foi oxidase negativa, não apresentando atividade glicidolítica, quer em meio complexo nitrogenado, quer em base sintética nitrogenada. Mima polymorpha var. oxidans, foi oxidase positiva, não revelando nenhuma atividade glicidolítica. Herellea vaginicola e Mima polymorpha mostraram grande sensibilidade à gabromicina, knamicina, neomicina, colistin, sendo que a última também foi muito sensível ao cloranfenicol e rovamicina. Mima polymorpha var. oxidans, apresentou grande sensibilidade à knamicina, neomicina, colistin, cloranfenicol e wintomylon. A sensibilidade das amostras a 1 a 0,1 unidade de penicilina/ml, nas condições ensaiadas no presente trabalho, não foi absoluta, como a observada por Baumann, Doudoroff & Stanier (1968a que permitisse uma separação entre amostras oxidase positiva e negativa ou uma diferenciação dentro do grupo das bactérias oxidase positiva.The authors studied the morpho-biochemical characteristics and antibiotic sensitivity of 19 strains of bacteria isolated from clinical specimens and identifyed as Mima polymorpha var. oxidans, Mima polymorpha and Herellea vaginicola. The biochemical study indicated Herellea vaginicola to be oxidase negative and in complex nitrogenous media effetively utilize glucose, galactose, manose, arabinose, xylose, 10
Nowicki, Carly J; Kashian, Donna R
2018-02-14
Dreissenid mussels Dreissena bugensis (quagga mussel) and Dreissena polymorpha (zebra mussel) are prolific invasive species to the freshwaters of the United States and Western Europe. In the Great Lakes, D. polymorpha has initially dominated the system since its invasion in the mid-1980s; however, recently D. bugensis has displaced D. polymorpha as the dominant species. Dreissena bugensis has several competitive advantages over D. polymorpha, including greater tolerances to deeper and colder waters and lower respiration rates. Nevertheless, physiological differences between the species remain largely unknown. The oxidative stress response is a mechanism used by all organisms to mitigate environmental stress by reducing oxygen radicals in the body, and comparing this mechanism between similar species can be useful for understanding how different species compete in aquatic environments. We compared oxidative stress biomarkers (lipid peroxidation [LPO] and catalase [CAT] activity) in mussels after exposure to 4 stressors (i.e., high densities, temperature, hypoxia, and polychlorinated biphenyls [PCBs]) independently and in combinations of 2 stressors. Overall, D. bugensis had lower LPO and CAT activity than D. polymorpha when exposed to single stressors; however, in multiple stressor treatments D. bugensis had increased LPO, especially with high temperatures and PCBs. The lower lipid damage in D. bugensis compared with D. polymorpha under single stressor conditions may come at the cost of the ability to respond to multiple stressors. Environ Toxicol Chem 2018;9999:1-12. © 2018 SETAC. © 2018 SETAC.
Directory of Open Access Journals (Sweden)
Claudia Fieira
2013-02-01
Full Text Available Penicillium expansum is the causative agent of apple blue mold. The inhibitory effects of the capsaicin derived from Capsicum spp. fruits and yeast Hansenula wingei against P. expansum were evaluated in an in vitro and in in vivo assay using Fuji apples. The minimum inhibitory concentration of capsaicin determined using the broth micro-dilution method was 122.16 µg mL-1. Capsaicin did not reduce blue mold incidence in apples. However, it was able to delay fungal growth in the first 14 days of the in vivo assay. The in vivo effect of the yeast Hansenula wingei AM2(-2, alone and combined with thiabendazole at low dosage (40 µg mL-1, on the incidence of apple diseases caused by P. expansum was also described. H. wingei AM2(-2 combined with a low fungicide dosage (10% of the dosage recommended by the manufacturer showed the best efficacy (100% up to 7 days of storage at 21 ºC, later showing a non-statistically different decrease (p > 0.05 after 14 (80.45% and 21 days (72.13%, respectively. These results contribute providing new options for using antifungal agents against Penicillium expansum.Penicillium expansum é o agente causador da doença em maçã conhecida como mofo azul. O efeito inibitório da capsaicina derivada dos frutos Capsicum spp. e da levedura Hansenula wingei foi avaliado através de ensaios in vitro e in vivo em maçã. A concentração inibitória mínima da capsaicina de 122,16 µg mL-1 foi determinada usando microdiluição. A capsaicina não mostrou capacidade em reduzir a incidência do mofo azul na maçã. Entretanto, um retardo no crescimento do fungo foi observado nos 14 primeiros dias dos ensaios in vivo. Também descrevemos o efeito da levedura Hansenula wingei AM2(-2 isolada e em combinação com tiabendazol em baixa dosagem (40 µg mL-1 no controle da doença de maçãs por P. expansum.Hansenula wingei AM2(-2, em combinação com baixa dosagem de tiabendazol (10% da recomendada pelo fabricante, apresentou 100% de
Energy Technology Data Exchange (ETDEWEB)
Zhong, Huan, E-mail: huanzhong1982@hotmail.com [Environmental and Resource Studies Program, Trent University, Peterborough, Ontario (Canada); Nanjing University, School of Environment, State Key Laboratory of Pollution Control and Resource Reuse, Nanjing, Jiangsu Province (China); Kraemer, Lisa; Evans, Douglas [Environmental and Resource Studies Program, Trent University, Peterborough, Ontario (Canada)
2013-10-15
Highlights: • Mussels exposed to algal/sediment-Cu have different size-related Cu accumulation. • Size-related Cu accumulation in mussels could be more dependant on algal-Cu uptake. • Importance of algal/sediment-Cu to Cu bioaccumulation varies with mussel body size. • Cu sources (algae and sediments) should be considered in “mussel watch” programs. • Cu stable isotope offers many advantages in Cu bioaccumulation studies. -- Abstract: Size of organisms is critical in controlling metal bioavailability and bioaccumulation, while mechanisms of size-related metal bioaccumulation are not fully understood. To investigate the influences of different sources of particle-associated Cu on body size-related Cu bioavailability and bioaccumulation, zebra mussels (Dreissena polymorpha) of different sizes were exposed to stable Cu isotope ({sup 65}Cu) spiked algae (Chlorella vulgaris) or sediments in the laboratory and the Cu tissue concentration-size relationships were compared with that in unexposed mussels. Copper tissue concentrations decreased with mussel size (tissue or shell dry weight) in both unexposed and algal-exposed mussels with similar decreasing patterns, but were independent of size in sediment-exposed mussels. Furthermore, the relative contribution of Cu uptake from algae (65–91%) to Cu bioaccumulation is always higher than that from sediments (9–35%), possibly due to the higher bioavailability of algal-Cu. Therefore, the size-related ingestion of algae could be more important in influencing the size-related variations in Cu bioaccumulation. However, the relative contribution of sediment-Cu to Cu bioaccumulation increased with body size and thus sediment ingestion may also affect the size-related Cu variations in larger mussels (tissue weight >7.5 mg). This study highlights the importance of considering exposure pathways in normalization of metal concentration variation when using bivalves as biomonitors.
Rich nutrition from the poorest - Cereal fermentations in Africa and Asia
Nout, M.J.R.
2009-01-01
Cereal fermentations in Africa and Asia involve mainly the processing of maize, rice, sorghum and the millets. Lactic acid bacteria (Lactobacillus, Pediococcus), Enterobacter spp., yeasts (Candida, Debaryomyces, Endomycopsis, Hansenula, Pichia, Saccharomyces and Trichosporon spp.) and filamentous
McLaughlan, Claire; Rose, Paul; Aldridge, David C.
2014-11-01
Invasive non-native species frequently occur in very high densities. When such invaders present an economic or ecological nuisance, this biomass is typically removed and landfill is the most common destination, which is undesirable from both an economic and ecological perspective. The zebra mussel, Dreissena polymorpha, has invaded large parts of Europe and North America, and is routinely removed from raw water systems where it creates a biofouling nuisance. We investigated the suitability of dried, whole zebra mussels as a supplement to poultry feed, thus providing a more attractive end-use than disposal to landfill. Measurable outcomes were nutrient and energy composition analyses of the feeds and production parameters of the birds over a 14 day period. Zebra mussels were a palatable feed supplement for chickens. The mussel meal contained high levels of calcium (344.9 g kg-1), essential for egg shell formation, which was absorbed and retained easily by the birds. Compared with standard feed, a mussel-supplemented diet caused no significant effects on production parameters such as egg weight and feed conversion ratio during the study period. However, protein and energy levels in the zebra mussel feed were much lower than expected from the literature. In order for zebra mussels to be a viable long-term feed supplement for poultry, flesh would need to be separated from the shells in an economically viable way. If zebra mussels were to be used with the shells remaining, it seems that the resultant mussel meal would be more suitable as a calcium supplement.
Competitive impacts of an invasive nectar thief on plant-pollinator mutualisms
Hanna, Cause; Foote, David; Kremen, Claire
2014-01-01
Plant–pollinator mutualisms are disrupted by a variety of competitive interactions between introduced and native floral visitors. The invasive western yellowjacket wasp, Vespula pensylvanica, is an aggressive nectar thief of the dominant endemic Hawaiian tree species, Metrosideros polymorpha. We conducted a large-scale, multiyear manipulative experiment to investigate the impacts of V. pensylvanica on the structure and behavior of the M. polymorpha pollinator community, including competitive mechanisms related to resource availability. Our results demonstrate that V. pensylvanica, through both superior exploitative and interference competition, influences resource partitioning and displaces native and nonnative M. polymorpha pollinators. Furthermore, the restructuring of the pollinator community due to V. pensylvanica competition and predation results in a significant decrease in the overall pollinator effectiveness and fruit set of M. polymorpha. This research highlights both the competitive mechanisms and contrasting effects of social insect invaders on plant–pollinator mutualisms and the role of competition in pollinator community structure.
McLaughlan, C; Aldridge, D C
2013-09-01
Algal and cyanobacterial blooms in reservoirs are driven by nutrient enrichment and may present economic and conservation challenges for water managers. Current approaches such as suppression of algal growth with barley straw, ferric dosing or manipulation of fish stocks have not yielded long term successes. A possibility that has sparked growing interest is the encouragement and cultivation of natural filter feeders, such as mussels, which remove suspended matter from the water and reduce nutrient levels through biodeposition and assimilation. This review focusses on the zebra mussel (Dreissena polymorpha) as a tool for enhancement of water quality in reservoirs. Native to the Ponto-Caspian region, this species has invaded many lakes and reservoirs across North America and Western Europe, where it occurs in very high densities. While purposeful introduction of a non-native species into new sites is socially unacceptable, we investigate the possible benefits of encouraging increased abundance of zebra mussels in sites where the species is already established. We estimate that the annual nitrogen and phosphorus input into a large UK reservoir (Grafham Water) could be assimilated into zebra mussel biomass by encouraging settlement onto 3075 m and 1400 m of commercial mussel ropes, respectively. While zebra mussel cultivation has an incredible capacity to push eutrophic systems towards a clear water state, there are many risks associated with encouraging an invasive species, even within sites where it has already established. The zebra mussel is a prominent biofouler of native unionid mussels and raw water pipes, it changes the physical characteristics of the places it inhabits, in sites low in phosphorus it can be responsible for toxic cyanobacterial blooms, it alters nutrient cycling and community structure and it can have negative impacts on amenity value. Increased propagule pressure from elevated numbers of veliger larvae in the water column may increase the risk
Rebuilding after collapse: evidence for long-term cohort dynamics in the native Hawaiian rain forest
Boehmer, Hans Juergen; Wagner, Helene H.; Jacobi, James D.; Gerrish, Grant C.; Mueller-Dombois, Dieter
2013-01-01
Questions: Do long-term observations in permanent plots confirm the conceptual model of Metrosideros polymorpha cohort dynamics as postulated in 1987? Do regeneration patterns occur independently of substrate age, i.e. of direct volcanic disturbance impact? Location: The windward mountain slopes of the younger Mauna Loa and the older Mauna Kea volcanoes (island of Hawaii, USA). Methods: After widespread forest decline (dieback), permanent plots were established in 1976 in 13 dieback and 13 non-dieback patches to monitor the population structure of M. polymorpha at ca. 5-yr intervals. Within each plot of 20 × 20 m, all trees with DBH >2.5 cm were individually tagged, measured and tree vigour assessed; regeneration was quantified in 16 systematically placed subplots of 3 × 5 m. Data collected in the subplots included the total number of M. polymorpha seedlings and saplings (five stem height classes). Here we analyse monitoring data from six time steps from 1976 to 2003 using repeated measures ANOVA to test specific predictions derived from the 1987 conceptual model. Results: Regeneration was significantly different between dieback and non-dieback plots. In dieback plots, the collapse in the 1970s was followed by a ‘sapling wave’ that by 2003 led to new cohort stands of M. polymorpha. In non-dieback stands, seedling emergence did not result in sapling waves over the same period. Instead, a ‘sapling gap’ (i.e. very few or no M. polymorpha saplings) prevailed as typical for mature stands. Canopy dieback in 1976, degree of recovery by 2003 and the number of living trees in 2003 were unrelated to substrate age. Conclusions: Population development of M. polymorpha supports the cohort dynamics model, which predicts rebuilding of the forest with the same canopy species after dieback. The lack of association with substrate age suggests that the long-term maintenance of cohort structure in M. polymorpha does not depend on volcanic disturbance but may be related to
Daunys, Darius; Zemlys, Petras; Olenin, Sergej; Zaiko, Anastasija; Ferrarin, Christian
2006-05-01
The role of the zebra mussel Dreissena polymorpha in redistribution of total particulate material (TPM) between the water column and bottom sediment was estimated using the TPM budget for a mussel bed in the Curonian lagoon, the Baltic Sea. Seasonal clearance rates were derived from the TPM budget assuming two resuspension scenarios: no resuspension and full resuspension of biodeposits. Estimated clearance rates for both scenarios were compared with the rates calculated from the population clearance rate model. Seasonal clearance rates estimated using the population model (1.1 and 11.8 l g-1 SFDW day-1) fitted well into the interval of seasonal clearance rates calculated from TPM budgets assuming no resuspension of biodeposits (3.2 and 21.4 l g SFDW-1 day-1). In the scenario with biodeposits resuspension clearance rates were much higher (57.4 and 148.9 g SFDW-1 day-1). The ratio of clearance to residence time was highly dependent on the fate of biodeposits. Therefore its use in interpretation of the species impact on TPM was limited. An alternative measure based on the ratio of the amount of TPM biodeposited to TPM transported into the bed was used. It was found that zebra mussels are able to deposit between 10 and 30% of the incoming TPM, and the amount of biodeposited material was correlated with water residence time. Results indicate that the impact of zebra mussels on TPM in the lagoon is small relative to the high transport rates of TPM over the bed. However, annual biosedimentation rate (~590 g m-2) in the mussel bed was higher than physical deposition rate (~380 g m-2) in accumulation areas devoid of large suspension feeders. We suggest that a local impact due to enhanced availability of organic material to other trophic groups of associated benthic organisms may be more significant than effects on TPM pathways at an ecosystem scale.
Filamentous fungi associated with natural infection of noble rot on withered grapes.
Lorenzini, M; Simonato, B; Favati, F; Bernardi, P; Sbarbati, A; Zapparoli, G
2018-05-02
The effects of noble rot infection of grapes on the characteristics of different types of wine, including Italian passito wine, are well known. Nevertheless, there is still little information on filamentous fungi associated with noble-rotten grapes. In this study, withered Garganega grapes for passito wine production, naturally infected by noble rot, were analyzed and compared to sound grapes. Skin morphology and fungal population on berry surfaces were analyzed. Scanning electron microscopy analysis revealed microcracks, germination conidia and branched hyphae on noble-rotten berries. Penicillium, Aureobasidium and Cladosporium were the most frequent genera present. Analysis of single berries displayed higher heterogeneity of epiphytic fungi in those infected by noble-rot than in sound berries. Penicillium adametzoides, Cladosporium cladospoirioides and Coniochaeta polymorpha were recovered. These, to the best of our knowledge, had never been previously isolated from withered grapes and, for C. polymorpha, from grapevine. This study provided novel data on noble rot mycobiota and suggests that fungi that co-habit with B. cinerea could have an important role on grape and wine quality. Copyright © 2018 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Fernández González, J.
1992-08-01
Full Text Available The paper studies the changes of the physico-chemical and microbiological characteristics of the fermentation in aerobic conditions that occur during the storage stage of Hojiblanca cultivar used to elaborate ripe olives. Assayed treatments include all the conditions used at industrial level (correction of initial pH to 4,0-4,2 units with acetic acid, sodium chloride concentration ranging between 3 and 6%, green to yellow-pink green fruits and bubling of air at a rate of 0,3 liter per hour and liter of the vessel capacity.
The process was characterized by a maintenance of the pH values, a slow sugar consumption, very low content of carbon dioxide and progressive increase of the salt concentration. Gram-negative rods and Bacillus grew at the beginning of the process; however, the most representative germs of these fermentation were the yeasts, whose population grew rapidly from brining (at higher rate as the salt content was slower. They remained throughout the storage, although after 180 days a decrease tendency was observed. The most representative species were: Pichía membranae faciens (51% of frequency, Pichía fementans (6% and Hansenula polymorpha (6%. No gas-pocket or shrivelling was appreciated in any treatment.
El trabajo estudia la evolución de las características físico-químicas y microbiológicas de la fermentación en medio aeróbico durante la conservación de aceitunas de la variedad Hojiblanca, en las diversas condiciones de los actuales procesos industriales (pH corregido inicialmente con acético a 4,0-4,2 unidades, concentración de sal entre 3 y 6%, frutos verdes o con una mayor madurez y aireación a razón de 0,3 litros de aire por hora y litro de capacidad del recipiente.
La misma se caracteriza por un mantenimiento del pH, lenta utilización de los azúcares, bajos niveles de anhídrido carbónico disuelto y progresiva subida de la concentración de sal. Asimismo, se desarrollan bacilos
Grutters, Bart M C; Verhofstad, Michiel J J M; van der Velde, Gerard; Rajagopal, Sanjeevi; Leuven, Rob S E W
2012-01-01
The quagga mussel (Dreissena rostriformis bugensis) and zebra mussel (Dreissena polymorpha) are invasive freshwater bivalves in Europe and North America. The distribution range of both Dreissena species is still expanding and both species cause major biofouling and ecological effects, in particular when they invade new areas. In order to assess the effect of temperature, salinity and light on the initial byssogenesis of both species, 24 h re-attachment experiments in standing water were conducted. At a water temperature of 25°C and a salinity of 0.2 psu, the rate of byssogenesis of D. polymorpha was significantly higher than that of D. rostriformis bugensis. In addition, byssal thread production by the latter levelled out between 15°C and 25°C. The rate of byssogenesis at temperatures<25°C was similar for both species. Neither species produced any byssal threads at salinities of 4 psu or higher. At a salinity of 1 psu and a water temperature of 15°C, D. polymorpha produced significantly more byssal threads than D. rostriformis bugensis. There was no significant effect of the length of illumination on the byssogenesis of either species. Overall, D. polymorpha produced slightly more byssal threads than D. rostriformis bugensis at almost all experimental conditions in 24 h re-attachment experiments, but both species had essentially similar initial re-attachment abilities. The data imply that D. rostriformis bugensis causes biofouling problems identical to those of D. polymorpha.
Rohde, Cláudia; Silva, Diva Maria Izabel O; Oliveira, Geórgia F; Monteiro, Liv S; Montes, Martín A; Garcia, Ana Cristina L
2014-12-01
Brazil has a high diversity of flies of the genus Drosophila, and part of this richness is represented by the cardini group. We analyzed the fluctuations in the richness and abundance of this group, in environments that had never previously been studied in the northeastern region of Brazil. Among the 28,204 drosophilids sampled, 1,294 belonged to the cardini group and were represented by D. polymorpha, D. cardini, D. neocardini and D. cardinoides. Occurrences of D. neocardini and D. cardinoides were registered for the first time in the Caatinga. In this biome, D. cardini stood out as having the highest abundance, and D. polymorpha was not observed. In the coastal Atlantic Forest, D. cardini was not registered, but D. polymorpha was found in all the localities investigated. Mangrove swamps were the environment with the lowest abundance and richness of the cardini group. The High-altitude Forest presented the highest richness of this group. We suggest that the high abundance of D. polymorpha in the High-altitude Forest and in the coastal Atlantic Forest may be a reflection of the historical relationship between these two environments.
Invasive species management restores a plant-pollinator mutualism in Hawaii
Hanna, Cause; Foote, David; Kremen, Claire
2013-01-01
1.The management and removal of invasive species may give rise to unanticipated changes in plant–pollinator mutualisms because they can alter the composition and functioning of plant–pollinator interactions in a variety of ways. To utilize a functional approach for invasive species management, we examined the restoration of plant–pollinator mutualisms following the large-scale removal of an invasive nectar thief and arthropod predator, Vespula pensylvanica. 2.We reduced V. pensylvanica populations in large plots managed over multiple years to examine the response of plant–pollinator mutualisms and the fruit production of a functionally important endemic Hawaiian tree species, Metrosideros polymorpha. To integrate knowledge of the invader's behaviour and the plant's mating system, we determined the efficacy of V. pensylvanica as a pollinator of M. polymorpha and quantified the dependence of M. polymorpha on animal pollination (e.g. level of self-compatibility and pollen limitation). 3.The reduction of V. pensylvanica in managed sites, when compared to unmanaged sites, resulted in a significant increase in the visitation rates of effective bee pollinators (e.g. introduced Apis mellifera and native Hylaeus spp.) and in the fruit production of M. polymorpha. 4.Apis mellifera, following the management of V. pensylvanica, appears to be acting as a substitute pollinator for M. polymorpha, replacing extinct or threatened bird and bee species in our study system. 5.Synthesis and applications. Fruit production of the native M. polymorpha was increased after management of the invasive pollinator predator V. pensylvanica; however, the main pollinators were no longer native but introduced. This research thus demonstrates the diverse impacts of introduced species on ecological function and the ambiguous role they play in restoration. We recommend incorporating ecological function and context into invasive species management as this approach may enable conservation
Takemura, Miho; Maoka, Takashi; Misawa, Norihiko
2015-03-01
MpBHY codes for a carotene β-ring 3(,3')-hydroxylase responsible for both zeaxanthin and lutein biosynthesis in liverwort. MpCYP97C functions as an ε-ring hydroxylase (zeinoxanthin 3'-hydroxylase) to produce lutein in liverwort. Xanthophylls are oxygenated or hydroxylated carotenes that are most abundant in the light-harvesting complexes of plants. The plant-type xanthophylls consist of α-xanthophyll (lutein) and β-xanthophylls (zeaxanthin, antheraxanthin, violaxanthin and neoxanthin). The α-xanthophyll and β-xanthophylls are derived from α-carotene and β-carotene by carotene hydroxylase activities, respectively. β-Ring 3,3'-hydroxylase that mediates the route of zeaxanthin from β-carotene via β-cryptoxanthin is present in higher plants and is encoded by the BHY (BCH) gene. On the other hand, CYP97A (or BHY) and CYP97C genes are responsible for β-ring 3-hydroxylation and ε-ring 3'-hydroxylation, respectively, in routes from α-carotene to lutein. To elucidate the evolution of the biosynthetic routes of such hydroxylated carotenoids from carotenes in land plants, we identified and functionally analyzed carotenoid hydroxylase genes of liverwort Marchantia polymorpha L. Three genes homologous to higher plants, BHY, CYP97A, and CYP97C, were isolated and named MpBHY, MpCYP97A, and MpCYP97C, respectively. MpBHY was found to code for β-ring hydroxylase, which is responsible for both routes starting from β-carotene and α-carotene. MpCYP97C functioned as an ε-ring hydroxylase not for α-carotene but for zeinoxanthin, while MpCYP97A showed no hydroxylation activity for β-carotene or α-carotene. These findings suggest the original functions of the hydroxylation enzymes of carotenes in land plants, which are thought to diversify in higher plants. In addition, we generated recombinant Escherichia coli cells, which produced rare and novel carotenoids such as α-echinenone and 4-ketozeinoxanthin, through pathway engineering using bacterial carotenogenic genes
Directory of Open Access Journals (Sweden)
Homero Sáenz
2003-12-01
Full Text Available La terapia de remplazo enzimático (TRE, consiste en suministrarle a un paciente una proteína exógena, que en su organismo está siendo sintetizada anormalmente. La proteína puede provenir de tejidos y fluidos humanos, ser sintetizada en bacterias, células de mamífero o levaduras, a las cuales se les ha introducido el gen correspondiente. Actualmente son tratadas con TRE las enfermedades de Gaucher, Fabry y la inmunodeficiencia humana combinada. Además existen avanzados estudios en las enfermedades de Hurler, Hunter, Pompe, Niemann-Pick tipo B, Morquio A, angioderma hereditario y pénfigo vulgar. Una de las limitantes de la TRE ha sido sus altos costos, debido al relativamente pequeño número de pacientes que se tratan a nivel mundial y a que el sistema usado hasta ahora, es decir, la expresión en células de mamífero, requiere procedimientos muy costosos. La expresión en bacterias o levaduras sería mucho más barato, pero las primeras no expresan proteínas glicosiladas que constituyen el 91% del total de proteínas y la mayoría de las levaduras tienen sistemas de glicosilación, distintos a los de mamíferos.Sin embargo, Pichia pastoris y Hansenula polymorpha parecen producir proteínas muy similares a las humanas, con lo cual se evitan los problemas de rechazo por parte del organismo humano. En el Instituto de Errores Innatos del Metabolismo (IEIM de la Pontificia Universidad Javeriana se adelantan estudios conducentes a la implementación de un sistema de expresión de proteínas recombinantes en levaduras para uso clínico en enfermedades lisosomales como los síndromes de Hunter y Morquio A. Este modelo, si funciona a cabalidad, podría emplearse para la mayoría de las enfermedades lisosomales (42 en total y para otros errores innatos del metabolismo.
Directory of Open Access Journals (Sweden)
Kensy Frank
2009-06-01
Full Text Available Abstract Background An advanced version of a recently reported high-throughput fermentation system with online measurement, called BioLector, and its validation is presented. The technology combines high-throughput screening and high-information content by applying online monitoring of scattered light and fluorescence intensities in continuously shaken microtiter plates. Various examples in calibration of the optical measurements, clone and media screening and promoter characterization are given. Results Bacterial and yeast biomass concentrations of up to 50 g/L cell dry weight could be linearly correlated to scattered light intensities. In media screening, the BioLector could clearly demonstrate its potential for detecting different biomass and product yields and deducing specific growth rates for quantitatively evaluating media and nutrients. Growth inhibition due to inappropriate buffer conditions could be detected by reduced growth rates and a temporary increase in NADH fluorescence. GFP served very well as reporter protein for investigating the promoter regulation under different carbon sources in yeast strains. A clone screening of 90 different GFP-expressing Hansenula polymorpha clones depicted the broad distribution of growth behavior and an even stronger distribution in GFP expression. The importance of mass transfer conditions could be demonstrated by varying filling volumes of an E. coli culture in 96 well MTP. The different filling volumes cause a deviation in the culture growth and acidification both monitored via scattered light intensities and the fluorescence of a pH indicator, respectively. Conclusion The BioLector technology is a very useful tool to perform quantitative microfermentations under engineered reaction conditions. With this technique, specific yields and rates can be directly deduced from online biomass and product concentrations, which is superior to existing technologies such as microplate readers or optode
Studies on yeasts and yeast-like microorganisms in the denitrification unit biocenosis
Directory of Open Access Journals (Sweden)
Elena Sláviková
2014-08-01
Full Text Available It was found that Candida famata, Hansenula californica and Rhodotorula rubra occurred in reactor UASB-type biocenosis in the course of denitrification carried out in the presence of lactic acid as a carbon source. The role of those species in nitrogen removal process was discussed with respect to their physiology.
Energy Technology Data Exchange (ETDEWEB)
Akaki, M.; Takahashi, T.; Ishiguro, K.
1981-01-01
Cane molasses distillation slops were used as substrate for the cultivation of 203 strains of yeast. Most yeast strains, especially Hansenula, Debaryomyces, and Rhodotorula, assimilated the molasses distillation wastes. Yeast cell dry weight reached 0.9 grams/100 mL, and yeasts removed greater than 30% of the COD of the waste material.
THE PREVALENCE OF LERNAEID ECTOPARASITES IN GRASS CARP (CTENOPHARYNGODON IDELLA
Directory of Open Access Journals (Sweden)
Z. TASAWAR, S. ZAFAR, M. H. LASHARI AND C. S. HAYAT1
2009-05-01
Full Text Available The present study was conducted to investigate the prevalence of lernaeid ectoparasites in grass carp (Ctenopharyngodon idella. For this purpose, 597 fishes (Ctenopharyngodon idella were examined for lernaeid ectoparasites at a private fish farm located in Multan, Pakistan. Four species of the genus Lernaea i.e. L. cyprinacea, L. polymorpha, L. oryzophila, and L. lophiara were recorded. It was observed that L. polymorpha had the highest (P20 cm.
Energy Technology Data Exchange (ETDEWEB)
Lazzara, Raimondo; Fernandes, Denise, E-mail: deniseferna@gmail.com; Faria, Melissa; Lopez, Jordi F.; Tauler, Roma; Porte, Cinta, E-mail: cinta.porte@cid.csic.es
2012-08-15
Total lipids and fatty acid profiles were determined along the reproductive cycle of the zebra mussel (Dreissena polymorpha). A total of 33 fatty acids with carbon atoms from 14 to 22 were identified: palmitic acid (16:0) was the most abundant fatty acid (13-24%) followed by docosahexaenoic acid (DHA; 22:6n-3), eicosapentaenoic acid (EPA; 20:5n-3) and palmitoleic acid (16:1n-7). Some individual fatty acids (16:0, 16:2n-4, 18:1n-7, 18:2n-6, 18:3n-4, 18:4n-3, 20:4n-3, 20:5n-3) were strongly related to reproductive events, while others having structural-type functions (18:0 and 22:6n-3) were rather stable during the study period. Multivariate analysis of the whole data set using the multivariate curve resolution alternating least squares method confirmed the strong relationship of fatty acid profiles with the reproductive cycle of zebra mussel. Additionally, the effects of the pharmaceutical clofibrate on lipid composition and fatty acid profiles were assessed following 7-day exposure of zebra mussels to a wide range of concentrations (20 ng/L to 2 mg/L). A significant reduction in total triglycerides (38%-48%) together with an increase in the amount of fatty acids per gram wet weight (1.5- to 2.2-fold) was observed in the exposed mussels. This work highlights the ability of clofibrate to induce changes on the lipidome of zebra mussels at concentrations as low as 200 ng/L. -- Highlights: Black-Right-Pointing-Pointer Clofibrate exposure leads to a reduction of total triglycerides in zebra mussel. Black-Right-Pointing-Pointer The amount of fatty acids per gram wet weight increased in exposed mussels. Black-Right-Pointing-Pointer The effects were evidenced at concentrations of clofibrate as low as 200 ng/L. Black-Right-Pointing-Pointer Fatty acid profiles were closely related to reproductive events.
International Nuclear Information System (INIS)
Lazzara, Raimondo; Fernandes, Denise; Faria, Melissa; López, Jordi F.; Tauler, Romà; Porte, Cinta
2012-01-01
Total lipids and fatty acid profiles were determined along the reproductive cycle of the zebra mussel (Dreissena polymorpha). A total of 33 fatty acids with carbon atoms from 14 to 22 were identified: palmitic acid (16:0) was the most abundant fatty acid (13–24%) followed by docosahexaenoic acid (DHA; 22:6n−3), eicosapentaenoic acid (EPA; 20:5n−3) and palmitoleic acid (16:1n−7). Some individual fatty acids (16:0, 16:2n−4, 18:1n−7, 18:2n−6, 18:3n−4, 18:4n−3, 20:4n−3, 20:5n−3) were strongly related to reproductive events, while others having structural-type functions (18:0 and 22:6n−3) were rather stable during the study period. Multivariate analysis of the whole data set using the multivariate curve resolution alternating least squares method confirmed the strong relationship of fatty acid profiles with the reproductive cycle of zebra mussel. Additionally, the effects of the pharmaceutical clofibrate on lipid composition and fatty acid profiles were assessed following 7-day exposure of zebra mussels to a wide range of concentrations (20 ng/L to 2 mg/L). A significant reduction in total triglycerides (38%–48%) together with an increase in the amount of fatty acids per gram wet weight (1.5- to 2.2-fold) was observed in the exposed mussels. This work highlights the ability of clofibrate to induce changes on the lipidome of zebra mussels at concentrations as low as 200 ng/L. -- Highlights: ► Clofibrate exposure leads to a reduction of total triglycerides in zebra mussel. ► The amount of fatty acids per gram wet weight increased in exposed mussels. ► The effects were evidenced at concentrations of clofibrate as low as 200 ng/L. ► Fatty acid profiles were closely related to reproductive events.
In vitro and in vivo antifungal activity of natural inhibitors against Penicillium expansum
Directory of Open Access Journals (Sweden)
Claudia Fieira
2013-02-01
Full Text Available Penicillium expansum is the causative agent of apple blue mold. The inhibitory effects of the capsaicin derived from Capsicum spp. fruits and yeast Hansenula wingei against P. expansum were evaluated in an in vitro and in in vivo assay using Fuji apples. The minimum inhibitory concentration of capsaicin determined using the broth micro-dilution method was 122.16 µg mL-1. Capsaicin did not reduce blue mold incidence in apples. However, it was able to delay fungal growth in the first 14 days of the in vivo assay. The in vivo effect of the yeast Hansenula wingei AM2(-2, alone and combined with thiabendazole at low dosage (40 µg mL-1, on the incidence of apple diseases caused by P. expansum was also described. H. wingei AM2(-2 combined with a low fungicide dosage (10% of the dosage recommended by the manufacturer showed the best efficacy (100% up to 7 days of storage at 21 ºC, later showing a non-statistically different decrease (p > 0.05 after 14 (80.45% and 21 days (72.13%, respectively. These results contribute providing new options for using antifungal agents against Penicillium expansum.
Comparative study of different alcohol sensors based on Screen-Printed Carbon Electrodes.
Costa Rama, Estefanía; Biscay, Julien; González García, María Begoña; Julio Reviejo, A; Pingarrón Carrazón, José Manuel; Costa García, Agustín
2012-05-30
Different very simple single-use alcohol enzyme sensors were developed using alcohol oxidase (AOX) from three different yeast, Hansenula sp., Pichia pastoris and Candida boidinii, and employing three different commercial mediator-based Screen-Printed Carbon Electrodes as transducers. The mediators tested, Prussian Blue, Ferrocyanide and Co-phthalocyanine were included into the ink of the working electrode. The procedure to obtain these sensors consists of the immobilization of the enzyme on the electrode surface by adsorption. For the immobilization, an AOX solution is deposited on the working electrode and left until dried (1h) at room temperature. The best results were obtained with the biosensor using Screen-Printed Co-phthalocyanine/Carbon Electrode and AOX from Hansenula sp. The reduced cobalt-phthalocyanine form is amperometrically detected at +0.4V (vs. Ag pseudo reference electrode). This sensor shows good sensitivity (1211 nA mM(-1)), high precision (2.1% RSD value for the slope value of the calibration plot) and wide linear response (0.05-1.00 mM) for ethanol determination. The sensor provides also accurate results for ethanol quantification in alcoholic drinks. Copyright © 2012 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Dominik Marchowski
Full Text Available The European population of Greater Scaup Aythya marila has experienced an alarming, ~60% decline in numbers over the last two decades. The brackish lagoons of the Odra River Estuary (ORE in the south-western Baltic Sea, represent an important area for the species during the non-breeding season in Europe. The lagoons regularly support over 20 000 Scaup, with peaks exceeding 100 000 (38%-70% of the population wintering in NW Europe and the highest number recorded in April 2011-105 700. In the ORE, Scaup feed almost exclusively on the non-native Zebra Mussel Dreissena polymorpha. This mussel was present in the ORE already in the 19th century and continues to be superabundant. Using the results of 22 Scaup censuses (November to April 2002/2003 to 2013/2014 from the whole ORE (523 km2 of water, we show that Scaup flocks follow areas with the greatest area of occurrence and biomass of the Zebra Mussel, while areas with low mussel densities are ignored. The numbers of Scaup in the ORE are primarily related to the area of Zebra Mussel occurrence on the lagoon's bottom (km2 in a non-linear fashion. Zebra Mussels were absolutely prevalent (97% of biomass in the digestive tracts of birds unintentionally by-caught in fishing nets (n = 32. We estimate that Scaup alone consume an average of 5 400 tons of Zebra Mussels annually, which represents 5.6% of the total resources of the mussel in the ORE. Our results provide a clear picture of the strong dependence of the declining, migratory duck species on the non-native mussel, its primary food in the ORE. Our findings are particularly important as they can form the basis for the conservation action plan aimed at saving the north-western European populations of Scaup.
Marchowski, Dominik; Neubauer, Grzegorz; Ławicki, Łukasz; Woźniczka, Adam; Wysocki, Dariusz; Guentzel, Sebastian; Jarzemski, Maciej
2015-01-01
The European population of Greater Scaup Aythya marila has experienced an alarming, ~60% decline in numbers over the last two decades. The brackish lagoons of the Odra River Estuary (ORE) in the south-western Baltic Sea, represent an important area for the species during the non-breeding season in Europe. The lagoons regularly support over 20 000 Scaup, with peaks exceeding 100 000 (38%-70% of the population wintering in NW Europe and the highest number recorded in April 2011-105 700). In the ORE, Scaup feed almost exclusively on the non-native Zebra Mussel Dreissena polymorpha. This mussel was present in the ORE already in the 19th century and continues to be superabundant. Using the results of 22 Scaup censuses (November to April 2002/2003 to 2013/2014) from the whole ORE (523 km2 of water), we show that Scaup flocks follow areas with the greatest area of occurrence and biomass of the Zebra Mussel, while areas with low mussel densities are ignored. The numbers of Scaup in the ORE are primarily related to the area of Zebra Mussel occurrence on the lagoon's bottom (km2) in a non-linear fashion. Zebra Mussels were absolutely prevalent (97% of biomass) in the digestive tracts of birds unintentionally by-caught in fishing nets (n = 32). We estimate that Scaup alone consume an average of 5 400 tons of Zebra Mussels annually, which represents 5.6% of the total resources of the mussel in the ORE. Our results provide a clear picture of the strong dependence of the declining, migratory duck species on the non-native mussel, its primary food in the ORE. Our findings are particularly important as they can form the basis for the conservation action plan aimed at saving the north-western European populations of Scaup.
Feldheim, Kevin A; Brown, Joshua E; Murphy, Douglas J; Stepien, Carol A
2011-07-01
We developed and tested 14 new polymorphic microsatellite loci for dreissenid mussels, including the two species that have invaded many freshwater habitats in Eurasia and North America, where they cause serious industrial fouling damage and ecological alterations. These new loci will aid our understanding of their genetic patterns in invasive populations as well as throughout their native Ponto-Caspian distributions. Eight new loci for the zebra mussel Dreissena polymorpha polymorpha and six for the quagga mussel D. rostriformis bugensis were compared with new results from six previously published loci to generate a robust molecular toolkit for dreissenid mussels and their relatives. Taxa tested include D. p. polymorpha, D. r. bugensis, D. r. grimmi, D. presbensis, the 'living fossil'Congeria kusceri, and the dark false mussel Mytilopsis leucophaeata (the latter also is invasive). Overall, most of the 24 zebra mussel (N = 583) and 13 quagga mussel (N = 269) population samples conformed to Hardy-Weinberg equilibrium expectations for the new loci following sequential Bonferroni correction. The 11 loci (eight new, three previously published) evaluated for D. p. polymorpha averaged 35.1 alleles and 0.72 mean observed heterozygosity per locus, and 25.3 and 0.75 for the nine loci (six new, three previously published) developed for D. r. bugensis. All but three of these loci successfully amplified the other species of Dreissena, and all but one also amplified Congeria and Mytilopsis. All species and populations tested were significantly divergent using the microsatellite data, with neighbour-joining trees reflecting their evolutionary relationships; our results reveal broad utility for resolving their biogeographic, evolutionary, population and ecological patterns. © 2011 Blackwell Publishing Ltd.
Uptake of dissolved organic carbon and trace elements by zebra mussels
Roditi, Hudson A.; Fisher, Nicholas S.; Sañudo-Wilhelmy, Sergio A.
2000-09-01
Zebra mussels (Dreissena polymorpha) are widespread and abundant in major freshwater ecosystems in North America, even though the phytoplankton food resources in some of these systems seem to be too low to sustain them. Because phytoplankton biomass is greatly depleted in ecosystems with large D. polymorpha populations and bacteria do not seem to be an important food source for this species, exploitation of alternative carbon sources may explain the unexpected success of D. polymorpha in such environments. Here we examine the possibility that absorption of dissolved organic carbon (DOC) from water could provide a nutritional supplement to zebra mussels. We find that mussels absorb 14C-labelled DOC produced by cultured diatoms with an efficiency of 0.23%; this indicates that DOC in natural waters could contribute up to 50% of the carbon demand of zebra mussels. We also find that zebra mussels absorb some dissolved metals that have been complexed by the DOM; although absorption of dissolved selenium was unaffected by DOC, absorption of dissolved cadmium, silver and mercury by the mussels increased 32-, 8.7- and 3.6-fold, respectively, in the presence of high-molecular-weight DOC.
Energy Technology Data Exchange (ETDEWEB)
Singer, Christoph [Zoologisches Institut I-Oekologie, Universitaet Karlsruhe, Geb. 07.01, Kornblumenstrasse 13, D-76131 Karlsruhe (Germany); Zimmermann, Sonja [Zoologisches Institut I-Oekologie, Universitaet Karlsruhe, Geb. 07.01, Kornblumenstrasse 13, D-76131 Karlsruhe (Germany); Sures, Bernd [Zoologisches Institut I-Oekologie, Universitaet Karlsruhe, Geb. 07.01, Kornblumenstrasse 13, D-76131 Karlsruhe (Germany)]. E-mail: dc11@rz.uni-karlsruhe.de
2005-10-05
An increasing number of papers concentrate on the availability and uptake of platinum group elements (PGE) by different organisms. These metals are discharged into the environment from different anthropogenic sources, such as automobile catalytic converters, hospitals and other medical institutions. As the effects of these precious metals on organisms remain unclear, the induction of heat shock proteins (hsp70) in zebra mussels (Dreissena polymorpha) following exposure to soluble salts of platinum, palladium and rhodium was compared with the hsp70 induction in mussels following exposure to cadmium and lead. Mussels were sampled weekly during a period of 10 weeks and analyzed for their metal concentration and their hsp70 level. Highest metal uptake was found for Cd, followed by Pt, Pb and Pd. Rh demonstrated the lowest uptake rate. A clear time-dependent increase of hsp70 levels occurred in all exposed mussels. Concentrations of hsp70 started to rise between days 18 and 25, except for the Pt-exposed group, where the initial increase was between days 25 and 32. All groups reached maximal hsp70 concentrations at day 39. Subsequently, hsp70 levels decreased to initial levels for the remaining exposure period. Threshold metal levels for the hsp70 induction varied among the metals and increased in the order: Rh < Pd {<=} Pb < Pt < Cd. Highest hsp70 values were found for mussels exposed to Pd, with a 25-fold higher level than in the controls, followed by Pt- and Rh-exposed mussels, which showed a 19-fold increase. The hsp70 levels of the mussels exposed to Cd and Pb were much lower, showing 6- and 12-fold higher values than the control, respectively. The clear induction of hsp70 due to exposure to Pt, Pd and Rh gives evidence for strong cellular effects of these metals, especially, when compared with lead and cadmium. Among the metals tested, Pd seems to have the highest potential as inducer for hsp70 production due to its low threshold level in combination with the
International Nuclear Information System (INIS)
Singer, Christoph; Zimmermann, Sonja; Sures, Bernd
2005-01-01
An increasing number of papers concentrate on the availability and uptake of platinum group elements (PGE) by different organisms. These metals are discharged into the environment from different anthropogenic sources, such as automobile catalytic converters, hospitals and other medical institutions. As the effects of these precious metals on organisms remain unclear, the induction of heat shock proteins (hsp70) in zebra mussels (Dreissena polymorpha) following exposure to soluble salts of platinum, palladium and rhodium was compared with the hsp70 induction in mussels following exposure to cadmium and lead. Mussels were sampled weekly during a period of 10 weeks and analyzed for their metal concentration and their hsp70 level. Highest metal uptake was found for Cd, followed by Pt, Pb and Pd. Rh demonstrated the lowest uptake rate. A clear time-dependent increase of hsp70 levels occurred in all exposed mussels. Concentrations of hsp70 started to rise between days 18 and 25, except for the Pt-exposed group, where the initial increase was between days 25 and 32. All groups reached maximal hsp70 concentrations at day 39. Subsequently, hsp70 levels decreased to initial levels for the remaining exposure period. Threshold metal levels for the hsp70 induction varied among the metals and increased in the order: Rh < Pd ≤ Pb < Pt < Cd. Highest hsp70 values were found for mussels exposed to Pd, with a 25-fold higher level than in the controls, followed by Pt- and Rh-exposed mussels, which showed a 19-fold increase. The hsp70 levels of the mussels exposed to Cd and Pb were much lower, showing 6- and 12-fold higher values than the control, respectively. The clear induction of hsp70 due to exposure to Pt, Pd and Rh gives evidence for strong cellular effects of these metals, especially, when compared with lead and cadmium. Among the metals tested, Pd seems to have the highest potential as inducer for hsp70 production due to its low threshold level in combination with the
Electron/electron acoustic instability
International Nuclear Information System (INIS)
Gary, S.P.
1987-01-01
The electron acoustic wave becomes a normal mode of an unmagnetized collisionless plasma in the presence of two electron components with similar densities, but strongly disparate temperatures. The characteristic frequency of this mode is the plasma frequency of the cooler electron component. If these two electron components have a relative drift speed several times the thermal speed of the cooler component, the electron/electron acoustic instability may arise. This paper describes the parametric dependences of the threshold drift speed and maximum growth rate of this instability, and compares these with the same properties of the electron/ion acoustic instability. Under the condition of zero current, the electron/ion acoustic instability typically has the lower threshold drift speed, so that observation of the electron/electron acoustic instability is a strong indication of the presence of an electrical current in the plasma
Electronics and electronic systems
Olsen, George H
1987-01-01
Electronics and Electronic Systems explores the significant developments in the field of electronics and electronic devices. This book is organized into three parts encompassing 11 chapters that discuss the fundamental circuit theory and the principles of analog and digital electronics. This book deals first with the passive components of electronic systems, such as resistors, capacitors, and inductors. These topics are followed by a discussion on the analysis of electronic circuits, which involves three ways, namely, the actual circuit, graphical techniques, and rule of thumb. The remaining p
Electrons, Electronic Publishing, and Electronic Display.
Brownrigg, Edwin B.; Lynch, Clifford A.
1985-01-01
Provides a perspective on electronic publishing by distinguishing between "Newtonian" publishing and "quantum-mechanical" publishing. Highlights include media and publishing, works delivered through electronic media, electronic publishing and the printed word, management of intellectual property, and recent copyright-law issues…
Zoochorous dispersal of freshwater bivalves: an overlooked vector in biological invasions?
Directory of Open Access Journals (Sweden)
Coughlan Neil E.
2017-01-01
Full Text Available Vectors that underpin the natural dispersal of invasive alien species are frequently unknown. In particular, the passive dispersal (zoochory of one organism (or propagule by another, usually more mobile animal, remains poorly understood. Field observations of the adherence of invasive freshwater bivalves to other organisms have prompted us to assess the importance of zoochory in the spread of three prolific invaders: zebra mussel Dreissena polymorpha; quagga mussel Dreissena bugensis; and Asian clam Corbicula fluminea. An extensive, systematic search of the literature was conducted across multiple on-line scientific databases using various search terms and associated synonyms. In total, only five publications fully satisfied the search criteria. It appears that some fish species can internally transport viable adult D. polymorpha and C. fluminea specimens. Additionally, literature indicates that veligers and juvenile D. polymorpha can adhere to the external surfaces of waterbirds. Overall, literature suggests that zoochorous dispersal of invasive bivalves is possible, but likely a rare occurrence. However, even the establishment of a few individuals (or a single self-fertilising C. fluminea specimen can, over-time, result in a substantial population. Here, we highlight knowledge gaps, identify realistic opportunities for data collection, and suggest management protocols to mitigate the spread of invasive alien species.
Electron-electron Bremsstrahlung for bound target electrons
International Nuclear Information System (INIS)
Haug, E.
2008-01-01
For the process of electron-electron (e-e) Bremsstrahlung the momentum and energy distributions of the recoiling electrons are calculated in the laboratory frame. In order to get the differential cross section and the photon spectrum for target electrons which are bound to an atom, these formulae are multiplied by the incoherent scattering function and numerically integrated over the recoil energy. The effect of atomic binding is most pronounced at low energies of the incident electrons and for target atoms of high atomic numbers. The results are compared to those of previous calculations. (authors)
A Survey of Freshwater Mussels in the West Pearl River, Mississippi and Louisiana, 1995
National Research Council Canada - National Science Library
Miller, Andrew
1997-01-01
.... The nonindigenous zebra mussel, Dreissena polymorpha, introduced into the Great Lakes in the late 1980s, and the threatened mussel, Potamilus inflatus, listed as endangered, were not found although...
Interplay between electron-phonon and electron-electron interactions
International Nuclear Information System (INIS)
Roesch, O.; Gunnarsson, O.; Han, J.E.; Crespi, V.H.
2005-01-01
We discuss the interplay between electron-electron and electron-phonon interactions for alkali-doped fullerides and high temperature superconductors. Due to the similarity of the electron and phonon energy scales, retardation effects are small for fullerides. This raises questions about the origin of superconductivity, since retardation effects are believed to be crucial for reducing effects of the Coulomb repulsion in conventional superconductors. We demonstrate that by treating the electron-electron and electron-phonon interactions on an equal footing, superconductivity can be understood in terms of a local pairing. The Jahn-Teller character of the important phonons in fullerides plays a crucial role for this result. To describe effects of phonons in cuprates, we derive a t-J model with phonons from the three-band model. Using exact diagonalization for small clusters, we find that the anomalous softening of the half-breathing phonon as well as its doping dependence can be explained. By comparing the solution of the t-J model with the Hartree-Fock approximation for the three-band model, we address results obtained in the local-density approximation for cuprates. We find that genuine many-body results, due to the interplay between the electron-electron and electron-phonon interactions, play an important role for the the results in the t-J model. (copyright 2005 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
Electronic emission and electron guns
International Nuclear Information System (INIS)
Roy, Amitava
2010-01-01
This paper reviews the process of electron emission from metal surface. Although electrons move freely in conductors like metals, they normally do not leave the metal without some manipulation. In fact, heating and bombardment are the two primary ways in which electrons are emitted through the use of a heating element behind the cathode (termed thermionic emission) or as a result of bombardment with a beam of electrons, ions, or metastable atoms (termed secondary emission). Another important emission mechanism called Explosive Electron Emission (EEE) is also often used in various High Voltage Pulse Power Systems to generate very high current (few hundreds of kA) pulsed electron beams. The electron gun is the device in that it shoots off a continuous (or pulsed) stream of electrons. A brief idea about the evolution of the electron gun components and their basis of functioning are also discussed. (author)
Impact of Inter-Row Spacing on Yield and Yield Components of several Annual Medics Species
Directory of Open Access Journals (Sweden)
Mahnaz BAGHERI
2010-12-01
Full Text Available A field study was conducted in Faculty of Agriculture, Tarbiat Modares University, Tehran, Iran to evaluate the effects of three within-row spacing treatments (20, 30 and 40 cm on forage and seed production of five species of annual medics (Medicago scutellata cv. Sava; M. littoralis cv. Herald; M. polymorpha cv. Santiago; M. minima cv. Orion and M. truncatula cv. Mogul. The experiment was carried out in Faculty of Agriculture, Tarbiat Modares University, Tehran, Iran. The results of the experiment indicated that M. polymorpha had the highest forage yield out of the highest plant population. Latter with average 443.09 Kg ha-1 and M. scutellata with average 409.99 Kg ha-1 produced the highest seed yield. Also, the last species with 1306.78 Kg ha-1 had the highest pod yields. The highest seed yield and pod yield were produced at 20 cm within-row spacing because there were not adequate plants for maximum seed and pod yields in 30 and 40 cm within-row spacing. The tested plant densities did not affect on seeds number per pod, 1000 seeds weight and seeds to burr pod weight ratio. The M. truncatula and M. minima have the highest seeds number per pod. In addition, M. scutellata had the highest 1000 seeds weight with an average of 12.57 g. The highest seeds to burr pod ratio was observed in M. polymorpha. The most pod numbers were obtained in 20 and 30 cm within-row spacing and M. polymorpha while, the least pod numbers was observed in M. scutellata. Plant densities did not affect on pod numbers of the mentioned species. The highest dry forage yield was produced in 20 cm within-row spacing. Among the tested tested species, M. truncatula had the highest forage yield with average 870.07 Kg ha-1. This experiment indicated that there is possibility for seed and forage production of tested annual medics in the mentioned zone with the considering suitable plant densities.
National Research Council Canada - National Science Library
Sauer, Jennifer
2004-01-01
...) were added to the sampling design in 1993 and zebra mussels (Dreissena Polymorpha) were added in 1995. Sampling was based on a stratified random design and conducted at approximately 125 sites per study area...
Born-Oppenheimer Dynamics, Electronic Friction, and the Inclusion of Electron-Electron Interactions
Dou, Wenjie; Miao, Gaohan; Subotnik, Joseph E.
2017-07-01
We present a universal expression for the electronic friction as felt by a set of classical nuclear degrees of freedom (DOFs) coupled to a manifold of quantum electronic DOFs; no assumptions are made regarding the nature of the electronic Hamiltonian and electron-electron repulsions are allowed. Our derivation is based on a quantum-classical Liouville equation for the coupled electronic-nuclear motion, followed by an adiabatic approximation whereby electronic transitions are assumed to equilibrate faster than nuclear movement. The resulting form of friction is completely general, but does reduce to previously published expressions for the quadratic Hamiltonian (i.e., Hamiltonians without electronic correlation). At equilibrium, the second fluctuation-dissipation theorem is satisfied and the frictional matrix is symmetric. To demonstrate the importance of electron-electron correlation, we study electronic friction within the Anderson-Holstein model, where a proper treatment of electron-electron interactions shows signatures of a Kondo resonance and a mean-field treatment is completely inadequate.
Digestive physiology comparisons of aquatic invertebrates in the Upper Mississippi River Basin
Sauey, Blake W.; Amberg, Jon J.; Cooper, Scott T.; Grunwald, Sandra K.; Haro, Roger J.; Gaikowski, Mark
2016-01-01
Limited information is available on the composition of digestive enzymes present in unionid mussels and the zebra mussel, Dreissena polymorpha. Available information is nearly exclusive to species used for culture purposes. A commercially available enzyme assay kit was used to examine the effect of habitat within an ecosystem, season, and species on the activities of several digestive enzymes. We used Amblema plicata to represent native unionids, D. polymorpha, and also Hydropsyche orris as an outgroup to compare differences between mussels and other macroinvertebrates. The data indicated that neither location nor time affect the activities of the digestive enzymes tested; species was the only factor to affect the activity. Differences were found mostly between four enzymes: naphthol-AS-BI-phosphohydrolase, acid phosphatase, alkaline phosphatase, and β-galactosidase.
Cordeiro, Juliana; De Toni, Daniela Cristina; da Silva, Gisele de Souza; Valente, Vera Lucia da Silva
2014-10-01
Detailed chromosome photomaps are the first step to develop further chromosomal analysis to study the evolution of the genetic architecture in any set of species, considering that chromosomal rearrangements, such as inversions, are common features of genome evolution. In this report, we analyzed inversion polymorphisms in 25 different populations belonging to six neotropical species in the cardini group: Drosophila cardini, D. cardinoides, D. neocardini, D. neomorpha, D. parthenogenetica and D. polymorpha. Furthermore, we present the first reference photomaps for the Neotropical D. cardini and D. parthenogenetica and improved photomaps for D. cardinoides, D. neocardini and D. polymorpha. We found 19 new inversions for these species. An exhaustive pairwise comparison of the polytene chromosomes was conducted for the six species in order to understand evolutionary patterns of their chromosomes.
Effective electron-electron and electron-phonon interactions in the Hubbard-Holstein model
International Nuclear Information System (INIS)
Aprea, G.; Di Castro, C.; Grilli, M. . E-mail marco.grilli@roma1.infn.it; Lorenzana, J.
2006-01-01
We investigate the interplay between the electron-electron and the electron-phonon interaction in the Hubbard-Holstein model. We implement the flow-equation method to investigate within this model the effect of correlation on the electron-phonon effective coupling and, conversely, the effect of phonons in the effective electron-electron interaction. Using this technique we obtain analytical momentum-dependent expressions for the effective couplings and we study their behavior for different physical regimes. In agreement with other works on this subject, we find that the electron-electron attraction mediated by phonons in the presence of Hubbard repulsion is peaked at low transferred momenta. The role of the characteristic energies involved is also analyzed
Directory of Open Access Journals (Sweden)
E. V. Sukharenko
2017-05-01
Full Text Available Processed by-products of oil are the most common pollutants in all river and sea water. The increase in oxidative stress in bivalve molluscs was studied in both tissues of the hepatopancreas and the gill. The model for artificial treatment with processed by-products of oil was performed in a laboratory experiment with the river mollusc Dreissena polymorpha Pallas, 1771. The exposure of the molluscs over 28 days to mazut 50 mg/l induced significant increase of both final product of lipid peroxidation (LPO and antioxidant enzime activity. A significant increase in LPO was observed in the hepatopancreas and gill of D. polymorpha treated with mazut compared to the control group. Antioxidant enzyme activity of cartalase, supeoxide dismutase, glutathione reductase and glutathione-S-transferase showed a greater increase (by almost 1.5 times in the hepatopancreas than in the gill of D. polymorpha. A similar LPO growth and modulation of antioxidant enzyme activity were determined in the hepatopancreas and gill of the mussel Mytilus galloprovincialis Lamarck, 1879 collected in an area polluted with resins, hydrocarbons and asphaltenes, Donuzlav lake in the Kerch gulf. Varied cellular reactivation of the antioxidant enzyme system in the hepatopancreas rather than the gill was observed in both kinds of mollusc Dreissena and Mytilus. The obtained results are evidence of the higher sensitivity of the hepatopancreas cells of bivalve molluscs to organic pollutants compared to the gill cells.
Electron-electron coincidence spectroscopies at surfaces
International Nuclear Information System (INIS)
Stefani, G.; Iacobucci, S.; Ruocco, A.; Gotter, R.
2002-01-01
In the past 20 years, a steadily increasing number of electron-electron coincidence experiments on atoms and molecules have contributed to a deeper understanding of electron-electron correlation effects. In more recent years this technique has been extended to the study of solid surfaces. This class of one photon IN two electrons OUT experiments will be discussed with an emphasis on grazing incidence geometry, that is expected to be particularly suited for studying surfaces. The crucial question of which is the dominant mechanism that leads to ejection of pairs of electron from the surface will be addressed. It will be shown that, depending on the kinematics chosen, the correlated behaviour of the pairs of electrons detected might be singled out from independent particle one
Electron distribution function in electron-beam-excited plasmas
International Nuclear Information System (INIS)
Brau, C.A.
1976-01-01
In monatomic plasmas excited by high-intensity relativistic electron beams, the electron secondary distribution function is dominated by elastic electron-electron collisions at low electron energies and by inelastic electron-atom collisions at high electron energies (above the excitation threshold). Under these conditions, the total rate of excitation by inelastic collisions is limited by the rate at which electron-electron collisions relax the distribution function in the neighborhood of the excitation threshold. To describe this effect quantitatively, an approximate analytic solution of the electron Boltzmann equation is obtained, including both electron-electron and inelastic collisions. The result provides a simple formula for the total rate of excitation
Energy Technology Data Exchange (ETDEWEB)
Krieg, H.J. [Hydrobiologische Untersuchungen und Gutachten - HUuG, Tangstedt (Germany); Gaumert, T. [comps.] [Wasserguetestelle Elbe, Hamburg (Germany)
1998-04-01
The pollutant burden of the Elbe river can now be assessed more accurately with the aid of a new classification system based on pollutant accumulation in the soft tissue of the zebra mussel (Dreissena polymorpha), which provided the basis for a 7-stage pollution scale for individual substances. This closes a gap in pollution analysis of the Elbe river and makes statements on pollutant levels more efficient. [Deutsch] Die Schadstoffbelastung der Elbe kann mit Hilfe eines neuen und hier erstmalig vorgestellten Klassifizierungssystems besser als bisher bewertet werden. Die Auswertung angereicherter Schadstoffgehalte im Weichkoerper der in den Elbe-Messstationen gehaelterten Dreikantmuschel Dreissena polymorpha fuehrte zur Entwicklung einer siebenstufigen Belastungs-Skala fuer einzelne Substanzen. Mit diesem Verfahren kann somit ein offener Bereich bei der Bewertung der Schadstoffbelastung der Elbe geschlossen und die Gewaesserueberwachung mit einer hoeheren Aussagekraft betrieben werden. (orig.)
Hard electronics; Hard electronics
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-03-01
Hard material technologies were surveyed to establish the hard electronic technology which offers superior characteristics under hard operational or environmental conditions as compared with conventional Si devices. The following technologies were separately surveyed: (1) The device and integration technologies of wide gap hard semiconductors such as SiC, diamond and nitride, (2) The technology of hard semiconductor devices for vacuum micro- electronics technology, and (3) The technology of hard new material devices for oxides. The formation technology of oxide thin films made remarkable progress after discovery of oxide superconductor materials, resulting in development of an atomic layer growth method and mist deposition method. This leading research is expected to solve such issues difficult to be easily realized by current Si technology as high-power, high-frequency and low-loss devices in power electronics, high temperature-proof and radiation-proof devices in ultimate electronics, and high-speed and dense- integrated devices in information electronics. 432 refs., 136 figs., 15 tabs.
Morpho-phenological diversity among natural populations of ...
African Journals Online (AJOL)
sunny t
populations (Badri et al., 2007, 2010; Arraouadi et al.,. 2009; Lazrek et al., 2009) were measured for the lines of. M. polymorpha. ..... an organism (Holderegger et al., 2006). Adaptation .... Mouradov A, Cremer F, Coupland G (2002). Control of ...
Merrill, Frank E.; Morris, Christopher
2005-05-17
A system capable of performing radiography using a beam of electrons. Diffuser means receive a beam of electrons and diffuse the electrons before they enter first matching quadrupoles where the diffused electrons are focused prior to the diffused electrons entering an object. First imaging quadrupoles receive the focused diffused electrons after the focused diffused electrons have been scattered by the object for focusing the scattered electrons. Collimator means receive the scattered electrons and remove scattered electrons that have scattered to large angles. Second imaging quadrupoles receive the collimated scattered electrons and refocus the collimated scattered electrons and map the focused collimated scattered electrons to transverse locations on an image plane representative of the electrons' positions in the object.
The Quagga mussel invades the Lake Superior basin - journal article
Prior studies recognized the presence of a single dreissenid species in Lake Superior--the zebra mussel Dreissena polymorpha. However, taxonomic keys based on traditional shell morphology are not always able to differentiate dreissenid species with confidence. We thus employed ge...
Lammens, E.H.R.R.; Nes, van E.H.; Mooij, W.M.
2002-01-01
1. The development of bream populations, water transparency, chlorophyll-a concentration, extent of submerged vegetation and densities of the zebra mussel, Dreissena polymorpha, were analysed in three shallow eutrophic lake systems subject to different fish management. 2. In Lake Veluwemeer, the
Lammens, E.H.R.R.; Van Nes, E.H.; Mooij, W.M.
2002-01-01
SUMMARY1. The development of bream populations, water transparency, chlorophyll-a concentration, extent of submerged vegetation and densities of the zebra mussel, Dreissena polymorpha, were analysed in three shallow eutrophic lake systems subject to different fish management. 2. In Lake Veluwemeer,
International Nuclear Information System (INIS)
Borcherding, J.; Volpers, M.
1994-01-01
The Dreissena-Monitor is a biological early warning system using the native freshwater mussel Dreissena polymorpha. A computer analyzed the opening status and the number of valve movements of 42 mussels exposed in each of two experimental channels. (orig.) [de
Electron transfer from electronic excited states to sub-vacuum electron traps in amorphous ice
International Nuclear Information System (INIS)
Vichnevetski, E.; Bass, A.D.; Sanche, L.
2000-01-01
We investigate the electron stimulated yield of electronically excited argon atoms (Ar * ) from monolayer quantities of Ar deposited onto thin films of amorphous ice. Two peaks of narrow width ( - electron-exciton complex into exciton states, by the transfer of an electron into a sub-vacuum electron state within the ice film. However, the 10.7 eV feature is shifted to lower energy since electron attachment to Ar occurs within small pores of amorphous ice. In this case, the excess electron is transferred into an electron trap below the conduction band of the ice layer
Borowik, Piotr; Thobel, Jean-Luc; Adamowicz, Leszek
2017-12-01
The Monte Carlo simulation method is applied to study the relaxation of excited electrons in monolayer graphene. The presence of spin polarized background electrons population, with density corresponding to highly degenerate conditions is assumed. Formulas of electron-electron scattering rates, which properly account for electrons presence in two energetically degenerate, inequivalent valleys in this material are presented. The electron relaxation process can be divided into two phases: thermalization and cooling, which can be clearly distinguished when examining the standard deviation of electron energy distribution. The influence of the exchange effect in interactions between electrons with parallel spins is shown to be important only in transient conditions, especially during the thermalization phase.
Electron attachment cross sections obtained from electron attachment spectroscopy
International Nuclear Information System (INIS)
Popp, P.; Baumbach, J.I.; Leonhardt, J.W.; Mothes, S.
1988-01-01
Electron capture detectors have a high sensitivity for substances with high thermal electron attachment cross sections. The electron attachment spectroscopy makes it possible to change the mean electron energy in such a way that the maximum for dissociative electron attachment is reached. Thus, best operation modes of the detection system as well as significant dependencies of electron attachment coefficients are available. Cross sections for electron attachment as a function of the electron energy are obtained with the knowledge of electron energy distribution functions from Boltzmann equation analysis by a special computer code. A disadvantage of this electron attachment spectroscopy is the superposition of space charge effects due to the decrease of the electron drift velocity with increasing mean electron energy. These influences are discussed. (author)
Electron beam effects in auger electron spectroscopy and scanning electron microscopy
International Nuclear Information System (INIS)
Fontaine, J.M.; Duraud, J.P.; Le Gressus, C.
1979-01-01
Electron beam effects on Si(100) and 5% Fe/Cr alloy samples have been studied by measurements of the secondary electron yield delta, determination of the surface composition by Auger electron spectroscopy and imaging with scanning electron microscopy. Variations of delta as a function of the accelerating voltage Esub(p) (0.5 -9 Torr has no effect on technological samples covered with their reaction layers; the sensitivities to the beam depend rather on the earlier mechanical, thermal and chemical treatment of the surfaces. (author)
Energy Technology Data Exchange (ETDEWEB)
Kahnoj, Sina Soleimani; Touski, Shoeib Babaee [School of Electrical and Computer Engineering, University of Tehran, P.O. Box 14395-515, Tehran (Iran, Islamic Republic of); Pourfath, Mahdi, E-mail: pourfath@ut.ac.ir, E-mail: pourfath@iue.tuwien.ac.at [School of Electrical and Computer Engineering, University of Tehran, P.O. Box 14395-515, Tehran (Iran, Islamic Republic of); Institute for Microelectronics, TU Wien, Gusshausstrasse 27–29/E360, 1040 Vienna (Austria)
2014-09-08
The effect of dephasing induced by electron-electron interaction on electronic transport in graphene nanoribbons is theoretically investigated. In the presence of disorder in graphene nanoribbons, wavefunction of electrons can set up standing waves along the channel and the conductance exponentially decreases with the ribbon's length. Employing the non-equilibrium Green's function formalism along with an accurate model for describing the dephasing induced by electron-electron interaction, we show that this kind of interaction prevents localization and transport of electrons remains in the diffusive regime where the conductance is inversely proportional to the ribbon's length.
Electron Beam Generation in Tevatron Electron Lenses
International Nuclear Information System (INIS)
Kamerdzhiev, V.; Kuznetsov, G.; Shiltsev, V.; Solyak, N.; Tiunov, M.
2006-01-01
New type of high perveance electron guns with convex cathode has been developed. Three guns described in this article are built to provide transverse electron current density distributions needed for Electron Lenses for beam-beam compensation in the Tevatron collider. The current distribution can be controlled either by the gun geometry or by voltage on a special control electrode located near cathode. We present the designs of the guns and report results of beam measurements on the test bench. Because of their high current density and low transverse temperature of electrons, electron guns of this type can be used in electron cooling and beam-beam compensation devices
Electron beam generation in Tevatron electron lenses
International Nuclear Information System (INIS)
Kamerdzhiev, V.; Kuznetsov, G.; Shiltsev, V.; Solyak, N.; Tiunov, M.
2006-01-01
New type of high perveance electron guns with convex cathode has been developed. Three guns described in this article are built to provide transverse electron current density distributions needed for Electron Lenses for beam-beam compensation in the Tevatron collider. The current distribution can be controlled either by the gun geometry or by voltage on a special control electrode located near cathode. We present the designs of the guns and report results of beam measurements on the test bench. Because of their high current density and low transverse temperature of electrons, electron guns of this type can be used in electron cooling and beam-beam compensation devices
International Nuclear Information System (INIS)
Kim, Jin Su
2010-07-01
This book is composed of five chapters, which introduces electronic technology about understanding of electronic, electronic component, radio, electronic application, communication technology, semiconductor on its basic, free electron and hole, intrinsic semiconductor and semiconductor element, Diode such as PN junction diode, characteristic of junction diode, rectifier circuit and smoothing circuit, transistor on structure of transistor, characteristic of transistor and common emitter circuit, electronic application about electronic equipment, communication technology and education, robot technology and high electronic technology.
Therriault, Thomas W; Docker, Margaret F; Orlova, Marina I; Heath, Daniel D; MacIsaac, Hugh J
2004-03-01
Considerable uncertainty exists in determination of the phylogeny among extant members of the Dreissenidae, especially those inhabiting the Ponto-Caspian basin, as multiple systematic revisions based on morphological characteristics have failed to resolve relationships within this group of bivalves. In this study we use DNA sequence analyses of two mitochondrial gene fragments, 16S rRNA and cytochrome c oxidase subunit I (COI), to determine phylogenetic relationships among Dreissena rostriformis, D. bugensis, D. polymorpha, D. stankovici, Congeria kusceri, and Mytilopsis leucophaeata. Dreissena stankovici was determined to represent a sister taxa to D. polymorpha and both are more closely related to other extant Dreissena species than Congeria or Mytilopsis. Sequence divergence between D. rostriformis and D. bugensis was relatively low (0.3-0.4%), suggesting that these two taxa constitute a single species. However, environmental differences suggest two races of D. rostriformis, a brackish water race (rostriformis) and a freshwater race (bugensis). Spread of bugensis-type individuals into habitats in the Caspian Sea that are occupied by rostriformis-type individuals may create novel hybridization opportunities. Species-specific molecular markers also were developed in this study since significant intraspecific variation in morphological features complicates dreissenid identification. Using two gene fragments (nuclear 28S and 16S), we identified restriction fragment length polymorphisms (RFLPs) that distinguish among D. rostriformis/bugensis, D. polymorpha, and D. stankovici and revealed the presence of a cryptic invader to the Black Sea basin, Mytilopsis leucophaeata. This is the first report of this North American native in southern Europe.
Energy Technology Data Exchange (ETDEWEB)
Thomson, George
1972-01-01
Electrons are elementary particles of atoms that revolve around and outside the nucleus and have a negative charge. This booklet discusses how electrons relate to electricity, some applications of electrons, electrons as waves, electrons in atoms and solids, the electron microscope, among other things.
International Nuclear Information System (INIS)
Kolokolov, N.B.; Kudryavtsev, A.A.; Romanenko, V.A.
1989-01-01
Methods of controlling fast part of electron distribution function (DF) in nonlocal regime of current-free plasma are suggested and realized. Artificially created step in DF fast part has a simple link with frequencies of electron-electron and elastic electron-atom collisions that may be defined in the corresponding experiments
Danehkar, A.
2018-06-01
Suprathermal electrons and inertial drifting electrons, so called electron beam, are crucial to the nonlinear dynamics of electrostatic solitary waves observed in several astrophysical plasmas. In this paper, the propagation of electron-acoustic solitary waves (EAWs) is investigated in a collisionless, unmagnetized plasma consisting of cool inertial background electrons, hot suprathermal electrons (modeled by a κ-type distribution), and stationary ions. The plasma is penetrated by a cool electron beam component. A linear dispersion relation is derived to describe small-amplitude wave structures that shows a weak dependence of the phase speed on the electron beam velocity and density. A (Sagdeev-type) pseudopotential approach is employed to obtain the existence domain of large-amplitude solitary waves, and investigate how their nonlinear structures depend on the kinematic and physical properties of the electron beam and the suprathermality (described by κ) of the hot electrons. The results indicate that the electron beam can largely alter the EAWs, but can only produce negative polarity solitary waves in this model. While the electron beam co-propagates with the solitary waves, the soliton existence domain (Mach number range) becomes narrower (nearly down to nil) with increasing the beam speed and the beam-to-hot electron temperature ratio, and decreasing the beam-to-cool electron density ratio in high suprathermality (low κ). It is found that the electric potential amplitude largely declines with increasing the beam speed and the beam-to-cool electron density ratio for co-propagating solitary waves, but is slightly decreased by raising the beam-to-hot electron temperature ratio.
Uromyces ciceris-arietini, the cause of chickpea rust: new hosts in the Trifolieae, Fabaceae
Plants of Medicago polymorpha in Riverside and San Diego, California were collected with severe rust caused by Uromyces ciceris-arietini. Reported hosts of U. ciceris-arietini are Cicer arietinum (chickpea) and Medicago polyceratia. To confirm the potential new host range, a monouredinial isolate RM...
Effect of rice hull mulch on nutrient concentration of fertilized irrigation water
Parboiled rice hulls are an effective mulch for controlling weeds in nursery containers. A layer of rice hulls between 1.25 and 2.5 cm deep has been shown to provide effective control of liverwort (Marchantia polymorpha), bittercress (Cardamine flexuosa), and creeping woodsorrel (Oxalis corniculata...
Short Communication: Significance for pasture production in the ...
African Journals Online (AJOL)
Short Communication: Significance for pasture production in the southern Cape coastal region of naturalized rhizobia nodulating the strain specific Medicago ... The significance of naturalized strains of M. polymorpha in the production of medic pastures in some soils of the southern Cape coastal region is discussed.
Effects of suspended sediments on food uptake for zebra mussels in Lake Markermeer, The Netherlands
Penning, W.E.; Pozzato, L.; Vijverberg, T.; Noordhuis, R.; bij de Vaate, A.; Van Donk, E.; Dionisio Pires, L.M.
2013-01-01
Until 1992, zebra mussels (Dreissena polymorpha) were an important food source for diving ducks in Lake Markermeer (The Netherlands). After 1993, the mussel biomass sharply declined, and the current population is in poor condition (maximum shell length <15 mm) compared to populations from adjacent
Quagga mussels Dreissena rostriformis burgensis (Andrusov, 1897) in the Main River (Germany)
Velde, G. van der; Platvoet, D.
2007-01-01
The first record of the quagga mussel Dreissena rostriformis bugensis (Andrusov, 1897) in Germany is described. This species has expanded its distribution area in Europe at a slower rate than the zebra mussel Dreissena polymorpha (Pallas, 1771). Recent records from the Danube in Romania and from an
Morpho-phenological diversity among natural populations of ...
African Journals Online (AJOL)
... the high levels of within population variation and the lack of correlation between population differentiation and geographical distances suggest a potentially important rate of long-distance seed dispersal and confirm the role played by natural selection in the population structure of Tunisian populations of M. polymorpha.
Electronic Government and Electronic Participation
Tambouris, E; Scholl, H.J.; Janssen, M.F.W.H.A.; Wimmer, M.A.; Tarabanis, K; Gascó, M; Klievink, A.J.; Lindgren, I; Milano, M; Panagiotopoulos, P; Pardo, T.A.; Parycek, P; Sæbø, Ø
2016-01-01
Electronic government and electronic participation continue to transform the public sector and society worldwide and are constantly being transformed themselves by emerging information and communication technologies.This book presents papers from the 14th International Federation for Information
Electronic Government and Electronic Participation
Tambouris, E.; Scholl, H.J.; Janssen, M.F.W.H.A.; Wimmer, M.A.; Tarabanis, K.; Gascó, M.; Klievink, A.J.; Lindgren, I.; Milano, M.; Panagiotopoulos, P.; Pardo, T.A.; Parycek, P.; Sæbø, O.
2015-01-01
Electronic government and electronic participation continue to transform the public sector and society worldwide and are constantly being transformed themselves by emerging information and communication technologies. This book presents papers from the 14th International Federation for Information
International Nuclear Information System (INIS)
Hashimoto, H.; Mogami, A.
1975-01-01
A device for measuring electron densities at a given energy level in an electron beam or the like having strong background noise, for example, in the detection of Auger electric energy spectrums is described. An electron analyzer passes electrons at the given energy level and at the same time electrons of at least one adjacent energy level. Detecting means associated therewith produce signals indicative of the densities of the electrons at each energy level and combine these signals to produce a signal indicative of the density of the electrons of the given energy level absent background noise
Electron-electron interactions in artificial graphene
Rasanen, Esa
2013-03-01
Recent advances in the creation and modulation of graphenelike systems are introducing a science of ``designer Dirac materials.'' In its original definition, artificial graphene is a man-made nanostructure that consists of identical potential wells (quantum dots) arranged in an adjustable honeycomb lattice in the two-dimensional electron gas. As our ability to control the quality of artificial graphene samples improves, so grows the need for an accurate theory of its electronic properties, including the effects of electron-electron interactions. Here we determine those effects on the band structure and on the emergence of Dirac points, and discuss future investigations and challenges in this field.
The Mechanism Forming the Cell Surface of Tip-Growing Rooting Cells Is Conserved among Land Plants.
Honkanen, Suvi; Jones, Victor A S; Morieri, Giulia; Champion, Clement; Hetherington, Alexander J; Kelly, Steve; Proust, Hélène; Saint-Marcoux, Denis; Prescott, Helen; Dolan, Liam
2016-12-05
To discover mechanisms that controlled the growth of the rooting system in the earliest land plants, we identified genes that control the development of rhizoids in the liverwort Marchantia polymorpha. 336,000 T-DNA transformed lines were screened for mutants with defects in rhizoid growth, and a de novo genome assembly was generated to identify the mutant genes. We report the identification of 33 genes required for rhizoid growth, of which 6 had not previously been functionally characterized in green plants. We demonstrate that members of the same orthogroup are active in cell wall synthesis, cell wall integrity sensing, and vesicle trafficking during M. polymorpha rhizoid and Arabidopsis thaliana root hair growth. This indicates that the mechanism for constructing the cell surface of tip-growing rooting cells is conserved among land plants and was active in the earliest land plants that existed sometime more than 470 million years ago [1, 2]. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.
De Jonge, M; Belpaire, C; Geeraerts, C; De Cooman, W; Blust, R; Bervoets, L
2012-12-01
The present study investigated to what extent accumulated metal levels in aquatic invertebrates can reflect environmental contamination and how these tissue levels can be related to alterations in macroinvertebrate communities in the dredged River Dommel. Metal accumulation was measured in translocated zebra mussels (Dreissena polymorpha) and resident Chironomidae. Furthermore, macroinvertebrate community composition was assessed. Our results indicated that trends of total metal concentrations in surface water of the Dommel in time are reflected well by metal levels in tissue of D. polymorpha. In contrast, sediment-bound metals were the most dominant exposure route for Chironomidae. Alterations in macroinvertebrate community composition were observed during dredging and significant relations between metal levels in invertebrate tissues and ecological responses were found. Our results demonstrated that metal accumulation in both zebra mussels and Chironomidae can be used as an integrated measure of metal bioavailability and to predict ecological effects of metal toxicity on macroinvertebrate communities. Copyright © 2012 Elsevier Ltd. All rights reserved.
Decal electronics for printed high performance cmos electronic systems
Hussain, Muhammad Mustafa
2017-11-23
High performance complementary metal oxide semiconductor (CMOS) electronics are critical for any full-fledged electronic system. However, state-of-the-art CMOS electronics are rigid and bulky making them unusable for flexible electronic applications. While there exist bulk material reduction methods to flex them, such thinned CMOS electronics are fragile and vulnerable to handling for high throughput manufacturing. Here, we show a fusion of a CMOS technology compatible fabrication process for flexible CMOS electronics, with inkjet and conductive cellulose based interconnects, followed by additive manufacturing (i.e. 3D printing based packaging) and finally roll-to-roll printing of packaged decal electronics (thin film transistors based circuit components and sensors) focusing on printed high performance flexible electronic systems. This work provides the most pragmatic route for packaged flexible electronic systems for wide ranging applications.
Energy Technology Data Exchange (ETDEWEB)
Han, Myung-Geun, E-mail: mghan@bnl.gov [Condensed Matter Physics & Materials Science, Brookhaven National Laboratory, Upton, NY 11973 (United States); Garlow, Joseph A. [Condensed Matter Physics & Materials Science, Brookhaven National Laboratory, Upton, NY 11973 (United States); Materials Science and Engineering Department, Stony Brook University, Stony Brook, NY 11794 (United States); Marshall, Matthew S.J.; Tiano, Amanda L. [Department of Chemistry, Stony Brook University, Stony Brook, NY 11974 (United States); Wong, Stanislaus S. [Condensed Matter Physics & Materials Science, Brookhaven National Laboratory, Upton, NY 11973 (United States); Department of Chemistry, Stony Brook University, Stony Brook, NY 11974 (United States); Cheong, Sang-Wook [Department of Physics and Astronomy, Rutgers Center for Emergent Materials, Rutgers University, Piscataway, NJ 08854 (United States); Walker, Frederick J.; Ahn, Charles H. [Department of Applied Physics and Center for Research on Interface Structures and Phenomena, Yale University, New Haven, CT 06520 (United States); Department of Mechanical Engineering and Materials Science, Yale University, New Haven, CT 06520 (United States); Zhu, Yimei [Condensed Matter Physics & Materials Science, Brookhaven National Laboratory, Upton, NY 11973 (United States)
2017-05-15
Highlights: • Electron-beam-induced-current (EBIC) and active secondary-electron voltage-contrast (SE-VC) are demonstrated in STEM mode combined with in situ electrical biasing in a TEM. • Electrostatic potential maps in ferroelectric thin films, multiferroic nanowires, and single crystals obtained by off-axis electron holography were compared with EBIC and SE-VC data. • Simultaneous EBIC and active SE-VC performed with atomic resolution STEM are demonstrated. - Abstract: The ability to map out electrostatic potentials in materials is critical for the development and the design of nanoscale electronic and spintronic devices in modern industry. Electron holography has been an important tool for revealing electric and magnetic field distributions in microelectronics and magnetic-based memory devices, however, its utility is hindered by several practical constraints, such as charging artifacts and limitations in sensitivity and in field of view. In this article, we report electron-beam-induced-current (EBIC) and secondary-electron voltage-contrast (SE-VC) with an aberration-corrected electron probe in a transmission electron microscope (TEM), as complementary techniques to electron holography, to measure electric fields and surface potentials, respectively. These two techniques were applied to ferroelectric thin films, multiferroic nanowires, and single crystals. Electrostatic potential maps obtained by off-axis electron holography were compared with EBIC and SE-VC to show that these techniques can be used as a complementary approach to validate quantitative results obtained from electron holography analysis.
Electronic Commerce and Electronic Business
Indian Academy of Sciences (India)
R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22
This special issue is motivated by the recent upsurge of research activity in the areas of electronic commerce and electronic business both in India and all over the world. The current ... Monte Carlo methods for pricing financial options are then.
International Nuclear Information System (INIS)
Hamarat, R.T.; Witzani, J.; Hoerl, E.M.
1984-08-01
Numerical computer calculations are used to explore the design characteristics of a concave electrostatic electron mirror for a mirror attachment for a conventional scanning electron microscope or an instrument designed totally as a scanning electron mirror microscope. The electron paths of a number of set-ups are calculated and drawn graphically in order to find the optimum shape and dimensions of the mirror geometry. This optimum configuration turns out to be the transition configuration between two cases of electron path deflection, towards the optical axis of the system and away from it. (Author)
Kudo, Kazuhiro; Nakayama, Takashi; Ueno, Nobuo
2015-01-01
The book covers a variety of studies of organic semiconductors, from fundamental electronic states to device applications, including theoretical studies. Furthermore, innovative experimental techniques, e.g., ultrahigh sensitivity photoelectron spectroscopy, photoelectron yield spectroscopy, spin-resolved scanning tunneling microscopy (STM), and a material processing method with optical-vortex and polarization-vortex lasers, are introduced. As this book is intended to serve as a textbook for a graduate level course or as reference material for researchers in organic electronics and nanoscience from electronic states, fundamental science that is necessary to understand the research is described. It does not duplicate the books already written on organic electronics, but focuses mainly on electronic properties that arise from the nature of organic semiconductors (molecular solids). The new experimental methods introduced in this book are applicable to various materials (e.g., metals, inorganic and organic mater...
The Status of Benthos in Lake Ontario
The benthic community of Lake Ontario was dominated by an amphipod (Diporeia spp.) prior to the 1990’s. Two dreissenid mussel species D. polymorpha (zebra) and D. bugensis (quagga) were introduced in 1989 and 1991 via ballast water exchange. D. bugensis was observed as deep as 85...
Decal electronics for printed high performance cmos electronic systems
Hussain, Muhammad Mustafa; Sevilla, Galo Torres; Cordero, Marlon Diaz; Kutbee, Arwa T.
2017-01-01
High performance complementary metal oxide semiconductor (CMOS) electronics are critical for any full-fledged electronic system. However, state-of-the-art CMOS electronics are rigid and bulky making them unusable for flexible electronic applications
Precession mechanism of spin relaxation at frequent electron-electron collisions
Glazov, M M
2002-01-01
It is shown that the spin relaxation mechanism in the two-dimensional electron gas, is controlled not only through the electron pulse relaxation processes, determining the mobility, but through the electron-electron collisions as well. It is decided to use the kinetic equation, describing the electron spin mixing in the k-space, for determining the spin relaxation time tau sub s at frequent electron-electron collisions. The tau sub s time is calculated for the nondegenerated electron gas both with an account and with no account of the exchange interaction
Practical electronics handbook
Sinclair, Ian R
2013-01-01
Practical Electronics Handbook, Third Edition provides the frequently used and highly applicable principles of electronics and electronic circuits.The book contains relevant information in electronics. The topics discussed in the text include passive and active discrete components; linear and digital I.C.s; microprocessors and microprocessor systems; digital-analogue conversions; computer aids in electronics design; and electronic hardware components.Electronic circuit constructors, service engineers, electronic design engineers, and anyone with an interest in electronics will find the book ve
Energy Technology Data Exchange (ETDEWEB)
Müller, E., E-mail: erich.mueller@kit.edu; Gerthsen, D.
2017-02-15
The contrast of backscattered electron (BSE) images in scanning electron microscopy (SEM) depends on material parameters which can be exploited for composition quantification if some information on the material system is available. As an example, the In-concentration in thin In{sub x}Ga{sub 1−x}As layers embedded in a GaAs matrix is analyzed in this work. The spatial resolution of the technique is improved by using thin electron-transparent specimens instead of bulk samples. Although the BSEs are detected in a comparably small angular range by an annular semiconductor detector, the image intensity can be evaluated to determine the composition and local thickness of the specimen. The measured intensities are calibrated within one single image to eliminate the influence of the detection and amplification system. Quantification is performed by comparison of experimental and calculated data. Instead of using time-consuming Monte-Carlo simulations, an analytical model is applied for BSE-intensity calculations which considers single electron scattering and electron diffusion. - Highlights: • Sample thickness and composition are quantified by backscattered electron imaging. • A thin sample is used to achieve spatial resolution of few nanometers. • Calculations are carried out with a time-saving electron diffusion model. • Small differences in atomic number and density detected at low electron energies.
Elwakil, S. A.; El-hanbaly, A. M.; Elgarayh, A.; El-Shewy, E. K.; Kassem, A. I.
2014-11-01
The properties of nonlinear electron-acoustic rogue waves have been investigated in an unmagnetized collisionless four-component plasma system consisting of a cold electron fluid, non-thermal hot electrons obeying a non-thermal distribution, an electron beam and stationary ions. It is found that the basic set of fluid equations is reduced to a nonlinear Schrodinger equation. The dependence of rogue wave profiles on the electron beam and energetic population parameter are discussed. The results of the present investigation may be applicable in auroral zone plasma.
Electron-cyclotron-resonant-heated electron distribution functions
International Nuclear Information System (INIS)
Matsuda, Y.; Nevins, W.M.; Cohen, R.H.
1981-01-01
Recent studies at Lawrence Livermore National Laboratory (LLNL) with a bounce-averaged Fokker-Planck code indicate that the energetic electron tail formed by electron-cyclotron resonant heating (ECRH) at the second harmonic is not Maxwellian. We present the results of our bounce-averaged Fokker-Planck code along with some simple analytic models of hot-electron distribution functions
Attainment of Electron Beam Suitable for Medium Energy Electron Cooling
International Nuclear Information System (INIS)
Seletskiy, Sergey M.; Rochester U.
2005-01-01
Electron cooling of charged particle beams is a well-established technique at electron energies of up to 300 keV. However, up to the present time the advance of electron cooling to the MeV-range energies has remained a purely theoretical possibility. The electron cooling project at Fermilab has recently demonstrated the first cooling of 8.9 GeV/c antiprotons in the Recycler ring, and therefore, has proved the validity of the idea of relativistic electron cooling. The Recycler Electron Cooler (REC) is the key component of the Tevatron Run II luminosity upgrade project. Its performance depends critically on the quality of electron beam. A stable electron beam of 4.3 MeV carrying 0.5 A of DC current is required. The beam suitable for the Recycler Electron Cooler must have an angular spread not exceeding 200 (micro)rad. The full-scale prototype of the REC was designed, built and tested at Fermilab in the Wideband laboratory to study the feasibility of attaining the high-quality electron beam. In this thesis I describe various aspects of development of the Fermilab electron cooling system, and the techniques used to obtain the electron beam suitable for the cooling process. In particular I emphasize those aspects of the work for which I was principally responsible. Chapter 1 is an introduction where I describe briefly the theory and the history of electron cooling, and derive the requirements to the quality of electron beam and requirements to the basic parameters of the Recycler Electron Cooler. Chapter 2 is devoted to the theoretical consideration of the motion of electrons in the cooling section, description of the cooling section and of the measurement of the magnetic fields. In Chapter 3 I consider different factors that increase the effective electron angle in the cooling section and suggest certain algorithms for the suppression of parasitic angles. Chapter 4 is devoted to the measurements of the energy of the electron beam. In the concluding Chapter 5 I review
International Nuclear Information System (INIS)
Misra, Deepankar; Thulasiram, K.V.; Fernandes, W.; Kelkar, Aditya H.; Kadhane, U.; Kumar, Ajay; Singh, Yeshpal; Gulyas, L.; Tribedi, Lokesh C.
2009-01-01
We study electron emission from atoms and molecules in collisions with fast electrons and heavy ions (C 6+ ). The soft collision electrons (SE), two center electron emission (TCEE), the binary encounter (BE) events and the KLL Auger lines along with the elastically scattered peaks (in electron collisions) are studied using a hemispherical electrostatic electron analyzer. The details of the measurements along with description of the spectrometer and data acquisition system are given. The angular distributions of the low energy (few eV) electrons in soft collisions and the binary encounter electrons at keV energies are compared with quantum mechanical models based on the first Born (B1) and the continuum distorted wave-Eikonal initial state approximation (CDW-EIS).
VIRTUAL ELECTRONIC COMPONENTS OF THE ELECTRONIC EQUIPMENT
Directory of Open Access Journals (Sweden)
E. Lazarevich
2013-01-01
Full Text Available The article is present new idea of the creation, developments and improvements of the electronic equipment of complex systems by means of the virtual electronic components. The idea of the virtual electronic components is a presentation and perception of the creation and developments of the equipment on two forming: real – in the manner of standard marketed block of the intellectual property and image – in the manner of virtual component. The real component in most cases slows the development of the electronic equipment. The imaginary component is the «locomotive» of development of the electronic equipment. The Imaginary component contains the scientific has brushed against developer. The scientific has brushed against developer reveals of itself in the manner of virtual component on the modern level of the design rates of microelectronics.
A new stage of nuclear electronics-particle electronics
International Nuclear Information System (INIS)
Xi Deming
1987-01-01
The rapid development of high energy physics experiments has pushed the nuclear electronics to a new stage, i.e. the particle electronics. In this paper the background, main features and recent trends of the particle electronics are expounded
Electron transport effects in ion induced electron emission
Energy Technology Data Exchange (ETDEWEB)
Dubus, A. [Universite Libre de Bruxelles, Service de Metrologie Nucleaire (CP 165/84), 50 av. FD Roosevelt, B-1050 Brussels (Belgium)]. E-mail: adubus@ulb.ac.be; Pauly, N. [Universite Libre de Bruxelles, Service de Metrologie Nucleaire (CP 165/84), 50 av. FD Roosevelt, B-1050 Brussels (Belgium); Roesler, M. [Karl-Pokern-Str. 12, D-12587 Berlin (Germany)
2007-03-15
Ion induced electron emission (IIEE) is usually described as a three-step process, i.e. electron excitation by the incident projectile, electron transport (and multiplication) and electron escape through the potential barrier at the surface. In many cases, the first step of the process has been carefully described. The second step of the process, i.e. electron transport and multiplication, has often been treated in a very rough way, a simple decreasing exponential law being sometimes used. It is precisely the aim of the present work to show the importance of a correct description of electron transport and multiplication in a theoretical calculation of IIEE. A short overview of the electron transport models developed for IIEE is given in this work. The so-called 'Infinite medium slowing-down model' often used in recent works is evaluated by means of Monte Carlo simulations. In particular, the importance of considering correctly the semi-infinite character of the medium and the boundary condition at the vacuum-medium interface is discussed. Quantities like the electron escape depth are also briefly discussed. This evaluation has been performed in the particular case of protons (25keV
Studying electron-PAG interactions using electron-induced fluorescence
Narasimhan, Amrit; Grzeskowiak, Steven; Ostrander, Jonathan; Schad, Jonathon; Rebeyev, Eliran; Neisser, Mark; Ocola, Leonidas E.; Denbeaux, Gregory; Brainard, Robert L.
2016-03-01
In extreme ultraviolet (EUV) lithography, 92 eV photons are used to expose photoresists. Typical EUV resists are organic-based and chemically amplified using photoacid generators (PAGs). Upon exposure, PAGs produce acids which catalyze reactions that result in changes in solubility. In EUV lithography, photo- and secondary electrons (energies of 10- 80 eV) play a large role in PAG acid-production. Several mechanisms for electron-PAG interactions (e.g. electron trapping, and hole-initiated chemistry) have been proposed. The aim of this study is to explore another mechanism - internal excitation - in which a bound PAG electron can be excited by receiving energy from another energetic electron, causing a reaction that produces acid. This paper explores the mechanism of internal excitation through the analogous process of electron-induced fluorescence, in which an electron loses energy by transferring that energy to a molecule and that molecule emits a photon rather than decomposing. We will show and quantify electron-induced fluorescence of several fluorophores in polymer films to mimic resist materials, and use this information to refine our proposed mechanism. Relationships between the molecular structure of fluorophores and fluorescent quantum yield may aid in the development of novel PAGs for EUV lithography.
Electron-electron Thomas peak in fast transfer ionization
International Nuclear Information System (INIS)
Tolmanov, S. G.; McGuire, J. H.
2000-01-01
''Thomas process'' is a name used for a family of singular two-step processes that can lead to electron transfer. The Thomas process of the ''second kind,'' occurring in reactions with both transfer and ionization, utilizes the e-e scattering in the second step, so this Thomas process requires the dynamics of the electron-electron interaction. We calculate numerically the second order element of an S matrix and corresponding cross sections for the transfer ionization process. We find that the position and shape of the Thomas peak depend on both electron-electron and the electron-nucleus interaction. Also the direct and exchange amplitudes are equal at the peak position. We test the peaking approximation used for transfer ionization. Our results can be compared to experimental results for p + +He→H+He 2+ +e - . (c) 2000 The American Physical Society
DEFF Research Database (Denmark)
Appelt, Ane L; Rønde, Heidi S
2013-01-01
The photo shows a close-up of a Lichtenberg figure – popularly called an “electron tree” – produced in a cylinder of polymethyl methacrylate (PMMA). Electron trees are created by irradiating a suitable insulating material, in this case PMMA, with an intense high energy electron beam. Upon discharge......, during dielectric breakdown in the material, the electrons generate branching chains of fractures on leaving the PMMA, producing the tree pattern seen. To be able to create electron trees with a clinical linear accelerator, one needs to access the primary electron beam used for photon treatments. We...... appropriated a linac that was being decommissioned in our department and dismantled the head to circumvent the target and ion chambers. This is one of 24 electron trees produced before we had to stop the fun and allow the rest of the accelerator to be disassembled....
Electronic Raman response in electron-doped cuprate superconductors
International Nuclear Information System (INIS)
Geng Zhihao; Feng Shiping
2012-01-01
The electronic Raman response in the electron-doped cuprate superconductors is studied based on the t-t'-J model. It is shown that although the domelike shape of the doping dependent peak energy in the B 2g symmetry is a common feature for both electron-doped and hole-doped cuprate superconductors, there are pronounced deviations from a cubic response in the B 2g channel and a linear response in the B 2g channel for the electron-doped case in the low energy limit. It is also shown that these pronounced deviations are mainly caused by a nonmonotonic d-wave gap in the electron-doped cuprate superconductors.
Spectroscopy of electron irradiated polymers in electron microscope
International Nuclear Information System (INIS)
Faraj, S.H.; Salih, S.M.
1981-01-01
The damage induced by energetic electrons in the course of irradiation of polymers in a transmission electron microscope was investigated spectroscopically. Damage on the molecular level has been detected at very low exposure doses. These effects have been induced by electron doses less than that received by the specimen when it is situated at its usual place of the specimen stage in the electron microscope by a factor of 1,000. (author)
Micro opropa agation ( n of Ph (Endod hytolac d var. cca dod E-44 ...
African Journals Online (AJOL)
SAM
dodecandra) to control the zebra mussel (Dreissena polymorpha). Lewis, USA. Legesse W, (1993). Endod, a potential natural pesticide for use in developing countries http://collections.infocollections.org/ukedu/en/d/Jid22ie/6.4.html#Jid2. 2ie.6.4 Institute of Pathobiology, Addis Ababa University, Addis. Ababa, Ethiopia.
Electron spectroscopy in the fundamental process of electron-nucleus bremsstrahlung
International Nuclear Information System (INIS)
Hillenbrand, Pierre-Michel
2013-07-01
Within the scope of this thesis the fundamental process of electron-nucleus bremsstrahlung was studied in inverse kinematics at the Experimental Storage Ring ESR at GSI. For the system U 88+ + N 2 at 90 MeV/u it was shown, that by using inverse kinematics coincidence measurements between the scattered electron and the emitted photon can be performed for the case, in which the incoming electron transfers almost all of its kinetic energy onto the emitted photon. The sensitivity to the fundamental process could be achieved by measuring triple differential cross sections as a function of the emission angle of the photon and the scattered electron as well as the energy of the scattered electron. The optics of the magnetic electron spectrometer used were thoroughly revised and optimized to the experimental requirements. Analyzing different coincidences in this collision system, it was possible to determine the contributions to the electron distribution arising from radiative electron capture to the projectile continuum, nonradiative electron capture to the projectile continuum, and electron loss to the projectile continuum. The experimental results of each of these processes were compared to theoretical calculations. The electron spectra for the radiative and the nonradiative electron capture to continuum clearly reproduce the opposite asymmetry predicted by theory. Furthermore electron spectra for collisions of U 28+ with different gases were measured.
Larocque, Hugo; Kaminer, Ido; Grillo, Vincenzo; Leuchs, Gerd; Padgett, Miles J.; Boyd, Robert W.; Segev, Mordechai; Karimi, Ebrahim
2018-04-01
Electrons have played a significant role in the development of many fields of physics during the last century. The interest surrounding them mostly involved their wave-like features prescribed by the quantum theory. In particular, these features correctly predict the behaviour of electrons in various physical systems including atoms, molecules, solid-state materials, and even in free space. Ten years ago, new breakthroughs were made, arising from the new ability to bestow orbital angular momentum (OAM) to the wave function of electrons. This quantity, in conjunction with the electron's charge, results in an additional magnetic property. Owing to these features, OAM-carrying, or twisted, electrons can effectively interact with magnetic fields in unprecedented ways and have motivated materials scientists to find new methods for generating twisted electrons and measuring their OAM content. Here, we provide an overview of such techniques along with an introduction to the exciting dynamics of twisted electrons.
International Nuclear Information System (INIS)
Hestenes, David; Weingartshofer, Antonio
1991-01-01
The stupendous successes of the Dirac equation and quantum electro-dynamics have established the electron as the best understood of the fundamental constituents of matter. Nevertheless, physicists agree that the electron still has secrets to reveal. Moreover, powerful new theoretical and experimental tools for probing those secrets have been sharpened during the last decade. This workshop was organized to bring theorists and experimentalists together to discuss their common goal of knowing the electron. Present state and future prospects for progress toward that goal are here described. The theoretical papers encompass a wide range of views on the electron. Several argue that the 'Zitter-bewegung' is more than a mathematical peculiarity of the Dirac equation, that it may well be a real physical phenomenon and worthy of serious study, theoretically and experimentally. Besides generating the electron spin and magnetic moment, the 'Zitterbewegung' may be a vital clue to electron structure and self-interaction. Some of the papers employ a radical new formulation of the Dirac theory which reveals a hidden geo-metric structure in the theory that supports a 'Zitterbewegung' inter-pretation. For the last half century the properties of electrons have been probed primarily by scattering experiments at ever higher energies. Recently, however, two powerful new experimental techniques have emerged capable of giving alternative experimental views of the electron. First, techniques for confining single electrons for long term study have led to the most accurate measurements of the electron magnetic moment. Second, the interaction of high intensity laser fields with atoms and electrons have revealed striking new phenomena such as multiphoton ionization. refs.; figs.; tabs
Holbrook, Harold D
1971-01-01
Basic Electronics is an elementary text designed for basic instruction in electricity and electronics. It gives emphasis on electronic emission and the vacuum tube and shows transistor circuits in parallel with electron tube circuits. This book also demonstrates how the transistor merely replaces the tube, with proper change of circuit constants as required. Many problems are presented at the end of each chapter. This book is comprised of 17 chapters and opens with an overview of electron theory, followed by a discussion on resistance, inductance, and capacitance, along with their effects on t
Electron-electron scattering and mobilities in semiconductors and quantum wells
International Nuclear Information System (INIS)
Lyo, S.K.
1986-01-01
The effect of electron-electron scattering on the mobility in semiconductors and semiconductor quantum wells is examined. A general exact formula is derived for the mobility, when the electron-electron collision rate is much faster than other scattering rates such as those by ionized impurities and phonons. In this limit, the transport relaxation rate is independent of the carrier's energy and contributions to the inverse mobility from individual scattering mechanism add up. The mobility becomes significantly reduced from its value in the absence of electron-electron scattering. When the collision rates are not necessarily dominated by electron-electron scattering, the mobility is calculated by the Kohler-Sondheimer variational method in the presence of ionized-impurity scattering and acoustic-phonon scattering in a nondegenerate two-dimensional quantum well
Borowik, Piotr; Thobel, Jean-Luc; Adamowicz, Leszek
2017-07-01
Standard computational methods used to take account of the Pauli Exclusion Principle into Monte Carlo (MC) simulations of electron transport in semiconductors may give unphysical results in low field regime, where obtained electron distribution function takes values exceeding unity. Modified algorithms were already proposed and allow to correctly account for electron scattering on phonons or impurities. Present paper extends this approach and proposes improved simulation scheme allowing including Pauli exclusion principle for electron-electron (e-e) scattering into MC simulations. Simulations with significantly reduced computational cost recreate correct values of the electron distribution function. Proposed algorithm is applied to study transport properties of degenerate electrons in graphene with e-e interactions. This required adapting the treatment of e-e scattering in the case of linear band dispersion relation. Hence, this part of the simulation algorithm is described in details.
Attainment of Electron Beam Suitable for Medium Energy Electron Cooling
Energy Technology Data Exchange (ETDEWEB)
Seletskiy, Sergei M. [Univ. of Rochester, NY (United States)
2005-01-01
Electron cooling of charged particle beams is a well-established technique at electron energies of up to 300 keV. However, up to the present time the advance of electron cooling to the MeV-range energies has remained a purely theoretical possibility. The electron cooling project at Fermilab has recently demonstrated the ¯rst cooling of 8.9 GeV/c antiprotons in the Recycler ring, and therefore, has proved the validity of the idea of relativistic electron cool- ing. The Recycler Electron Cooler (REC) is the key component of the Teva- tron Run II luminosity upgrade project. Its performance depends critically on the quality of electron beam. A stable electron beam of 4.3 MeV car- rying 0.5 A of DC current is required. The beam suitable for the Recycler Electron Cooler must have an angular spread not exceeding 200 ¹rad. The full-scale prototype of the REC was designed, built and tested at Fermilab in the Wideband laboratory to study the feasibility of attaining the high-quality electron beam. In this thesis I describe various aspects of development of the Fermilab electron cooling system, and the techniques used to obtain the electron beam suitable for the cooling process. In particular I emphasize those aspects of the work for which I was principally responsible.
Cheng, Shi; Wu, Zhigang
2012-08-21
Microfluidics, a field that has been well-established for several decades, has seen extensive applications in the areas of biology, chemistry, and medicine. However, it might be very hard to imagine how such soft microfluidic devices would be used in other areas, such as electronics, in which stiff, solid metals, insulators, and semiconductors have previously dominated. Very recently, things have radically changed. Taking advantage of native properties of microfluidics, advances in microfluidics-based electronics have shown great potential in numerous new appealing applications, e.g. bio-inspired devices, body-worn healthcare and medical sensing systems, and ergonomic units, in which conventional rigid, bulky electronics are facing insurmountable obstacles to fulfil the demand on comfortable user experience. Not only would the birth of microfluidic electronics contribute to both the microfluidics and electronics fields, but it may also shape the future of our daily life. Nevertheless, microfluidic electronics are still at a very early stage, and significant efforts in research and development are needed to advance this emerging field. The intention of this article is to review recent research outcomes in the field of microfluidic electronics, and address current technical challenges and issues. The outlook of future development in microfluidic electronic devices and systems, as well as new fabrication techniques, is also discussed. Moreover, the authors would like to inspire both the microfluidics and electronics communities to further exploit this newly-established field.
Electron-electron collision effects on the bremsstrahlung emission in Lorentzian plasmas
International Nuclear Information System (INIS)
Jung, Young-Dae; Kato, Daiji
2009-01-01
Electron-electron collision effects on the electron-ion bremsstrahlung process are investigated in Lorentzian plasmas. The effective electron-ion interaction potential is obtained by including the far-field terms caused by electron-electron collisions with an effective Debye length in Lorentzian plasmas. The bremsstrahlung radiation cross section is obtained as a function of the electron energy, photon energy, collision frequency, spectral index and Debye length using the Born approximation for the initial and final states of the projectile electron. It is shown that the non-Maxwellian character suppresses the bremsstrahlung radiation cross section. It is also shown that the electron-electron collision effect enhances the bremsstrahlung emission spectrum. In addition, the bremsstrahlung radiation cross section decreases with an increase in the plasma temperature.
Electron-photon and electron-electron interactions in the presence of strong electromagnetic fields
International Nuclear Information System (INIS)
Surzhykov, A.; Fritzsche, S.; Stoehlker, Th.
2010-01-01
During the last decade, photon emission from highly-charged, heavy ions has been in the focus of intense studies at the GSI accelerator and storage ring facility in Darmstadt. These studies have revealed unique information about the electron-electron and electron-photon interactions in the presence of extremely strong nuclear fields. Apart from the radiative electron capture processes, characteristic photon emission following collisional excitation of projectile ions has also attracted much interest. In this contribution, we summarize the recent theoretical studies on the production of excited ionic states and their subsequent radiative decay. We will pay special attention to the angular and polarization properties of Kα emission from helium-like ions produced by means of dielectronic recombination. The results obtained for this (resonant) capture process will be compared with the theoretical predictions for the characteristic X-rays following Coulomb excitation and radiative recombination of few-electron, heavy ions. Work is supported by Helmholtz Association and GSl under the project VH-NG--421. (author)
Hussain, Muhammad Mustafa
2017-09-08
Electronic stickers may be manufactured on flexible substrates (110, 120, 130) as layers and packaged together. The package may then have an adhesive applied to one side to provide capability for sticking the electronic devices to surfaces. The stickers can be wrappable, placed on surfaces, glued on walls or mirrors or wood or stone, and have electronics (112, 122, 132) which may or may not be ultrathin. Packaging for the electronic sticker can use polymer on cellulose manufacturing and/or three dimensional (3-D) printing. The electronic stickers may provide lighting capability, sensing capability, and/or recharging capabilities.
Directory of Open Access Journals (Sweden)
Slavko Đerić
2016-12-01
Full Text Available Electronic commerce can be defined in different ways. Any definition helps to understand and explain that concept as better as possible.. Electronic commerce is a set of procedures and technologies that automate the tasks of financial transactions using electronic means. Also, according to some authors, electronic commerce is defined as a new concept, which is being developed and which includes process of buying and selling or exchanging products, services or information via computer networks, including the Internet. Electronic commerce is not limited just to buying and selling, but it also includes all pre-sales and after-sales ongoing activities along the supply chain. Introducing electronic commerce, using the Internet and Web services in business, realizes the way to a completely new type of economy - internet economy.
International Nuclear Information System (INIS)
Sarkadi, L.; Orban, A.
2007-01-01
Complete text of publication follows. In this report we present experimental data for a process when two electrons with velocity vectors equal to that of the projectile are emitted from collisions. By observing the two electron cusp the study of the threshold phenomenon for two-electron break-up is possible. It is a particularly interesting question whether the outgoing charged projectile can attract the two repulsing electrons so strongly that the two-electron cusp is formed. If it is so, a further question arises: Are the two electrons correlated in the final state as it is predicted by the Wannier theory? The experiments have been done at the 1 MeV VdG accelerator of ATOMKI using our TOF spectrometer. The first measurements clearly showed the formation of the two-electron cusp and signature of the electron correlation in 200 keV He 0 +He collisions. These promising results motivated us to carry out the experiment at 100 keV beam energy where the coincidence count rate is still reasonable but the energy resolution is better. For an acceptable data acquisition time we improved our data acquisition and data processing system for triple coincidence measurements. In Fig. 1a we present our measured relative fourfold differential cross section (FDCS) that shows strong electron correlation. For a comparison, in Fig. 1b we displayed the contour plot for uncorrelated electron pair emission. These latter data were synthesized artificially, generating the energies of the electron pairs from two independent double coincidence experiments. In both figures the distributions are characterized by two ridges. In Fig. 1b the ridges are perpendicular straight lines (E 1 = E 2 .13.6 eV). As a result of the correlation, the ridges in Fig. 1a are distorted in such a way that they have a joint straight-line section following the line E 1 + E 2 = 27.2 eV. This means that the electron pairs in the vicinity of the cusp maximum are emitted with a center of- mass velocity equal to that of
International Nuclear Information System (INIS)
Molloy, Daniel P.
2001-01-01
These experiments indicated that bacterial strain CL0145A of Pseudomonas fluorescens is equally lethal to the 2 zebra mussel species present in North America, Dreissena polymorpha and Dreissena bugensis. Thus, this bacterial strain should be equally effective at killing zebra mussels in power plant pipes, irrespective of which species is present
Energy Technology Data Exchange (ETDEWEB)
Daniel P. Molloy
2001-10-28
These experiments indicated that bacterial strain CL0145A of Pseudomonas fluorescens is equally lethal to the 2 zebra mussel species present in North America, Dreissena polymorpha and Dreissena bugensis. Thus, this bacterial strain should be equally effective at killing zebra mussels in power plant pipes, irrespective of which species is present.
Institute of Scientific and Technical Information of China (English)
无
2008-01-01
@@ Previously founded as CCPITMachinery and Electronics Sub-council and CCOIC Machinery and Electronics Chamber of Corn-merce in June, 1988, CCPIT Electronics Sub-Council and CCOIC Electronics Chamber of Commerce were established in May, 1993, and then renamed as CCPIT Electronics and Information Industry Sub-council and CCOIC Electronics and Infor-mation Industry Chamber of Commerce (CCPITECC) in September 1999.
International Nuclear Information System (INIS)
Kuzelev, M V; Rukhadze, A A
2008-01-01
Two fundamental mechanisms - the Cherenkov effect and anomalous Doppler effect - underlying the emission by an electron during its superluminal motion in medium are considered. Cherenkov emission induced by a single electron and a small electron bunch is spontaneous. In the course of spontaneous Cherenkov emission, the translational motion of an electron is slowed down and the radiation energy grows linearly with time. As the number of radiating electrons increases, Cherenkov emission becomes stimulated. Stimulated Cherenkov emission represents a resonance beam instability. This emission process is accompanied by longitudinal electron bunching in the beam or by the breaking of an electron bunch into smaller bunches, in which case the radiation energy grows exponentially with time. In terms of the longitudinal size L e of the electron bunch there is a transition region λ e 0 -1 between the spontaneous and stimulated Cherenkov effects, where λ is the average radiation wavelength, and δ 0 is the dimensionless (in units of the radiation frequency) growth rate of the Cherenkov beam instability. The range to the left of this region is dominated by spontaneous emission, whereas the range to the right of this region is dominated by stimulated emission. In contrast to the Vavilov-Cherenkov effect, the anomalous Doppler effect should always (even for a single electron) be considered as stimulated, because it can only be explained by accounting for the reverse action of the radiation field on the moving electron. During stimulated emission in conditions where anomalous Doppler effect shows itself, an electron is slowed down and spins up; in this case, the radiation energy grows exponentially with time. (reviews of topical problems)
High perveance electron gun for the electron cooling system
International Nuclear Information System (INIS)
Korotaev, Yu.; Meshkov, I.; Petrov, A.; Sidorin, A.; Smirnov, A.; Syresin, E.; Titkova, I.
2000-01-01
The cooling time in the electron cooling system is inversely proportional to the beam current. To obtain high current of the electron beam the control electrode of the gun is provided with a positive potential and an electrostatic trap for secondary electrons appears inside the electron gun. This leads to a decrease in the gun perveance. To avoid this problem, the adiabatic high perveance electron gun with the clearing control electrode is designed in JINR (J. Bosser, Y. Korotaev, I. Meshkov, E. Syresin et al., Nucl. Instr. and Meth. A 391 (1996) 103. Yu. Korotaev, I. Meshkov, A. Sidorin, A. Smirnov, E. Syresin, The generation of electron beams with perveance of 3-6 μA/V 3/2 , Proceedings of SCHEF'99). The clearing control electrode has a transverse electric field, which clears secondary electrons. Computer simulations of the potential map were made with RELAX3D computer code (C.J. Kost, F.W. Jones, RELAX3D User's Guide and References Manual)
High perveance electron gun for the electron cooling system
Korotaev, Yu V; Petrov, A; Sidorin, A; Smirnov, A; Syresin, E M; Titkova, I
2000-01-01
The cooling time in the electron cooling system is inversely proportional to the beam current. To obtain high current of the electron beam the control electrode of the gun is provided with a positive potential and an electrostatic trap for secondary electrons appears inside the electron gun. This leads to a decrease in the gun perveance. To avoid this problem, the adiabatic high perveance electron gun with the clearing control electrode is designed in JINR (J. Bosser, Y. Korotaev, I. Meshkov, E. Syresin et al., Nucl. Instr. and Meth. A 391 (1996) 103. Yu. Korotaev, I. Meshkov, A. Sidorin, A. Smirnov, E. Syresin, The generation of electron beams with perveance of 3-6 mu A/V sup 3 sup / sup 2 , Proceedings of SCHEF'99). The clearing control electrode has a transverse electric field, which clears secondary electrons. Computer simulations of the potential map were made with RELAX3D computer code (C.J. Kost, F.W. Jones, RELAX3D User's Guide and References Manual).
Study of single-electron excitations by electron microscopy
International Nuclear Information System (INIS)
Craven, A.J.; Gibson, J.M.; Howie, A.; Spalding, D.R.
1978-01-01
The inelastic scattering of fast electrons by the excitation of L-shell electrons at a stacking fault in silicon has been studied with a scanning transmission electron microscope. It was found that the bright-field stacking fault contrast is preserved in the filtered L-shell-loss signal at 100 eV. This result is discussed in terms of the delocalization of the excitation mechanism. It is concluded that localization effects will typically become significant only for energy transfers greater than 1 keV from a fast electron of energy 80 keV. (author)
Syringe injectable electronics
Hong, Guosong; Zhou, Tao; Jin, Lihua; Duvvuri, Madhavi; Jiang, Zhe; Kruskal, Peter; Xie, Chong; Suo, Zhigang; Fang, Ying; Lieber, Charles M.
2015-01-01
Seamless and minimally-invasive three-dimensional (3D) interpenetration of electronics within artificial or natural structures could allow for continuous monitoring and manipulation of their properties. Flexible electronics provide a means for conforming electronics to non-planar surfaces, yet targeted delivery of flexible electronics to internal regions remains difficult. Here, we overcome this challenge by demonstrating syringe injection and subsequent unfolding of submicrometer-thick, centimeter-scale macroporous mesh electronics through needles with a diameter as small as 100 micrometers. Our results show that electronic components can be injected into man-made and biological cavities, as well as dense gels and tissue, with > 90% device yield. We demonstrate several applications of syringe injectable electronics as a general approach for interpenetrating flexible electronics with 3D structures, including (i) monitoring of internal mechanical strains in polymer cavities, (ii) tight integration and low chronic immunoreactivity with several distinct regions of the brain, and (iii) in vivo multiplexed neural recording. Moreover, syringe injection enables delivery of flexible electronics through a rigid shell, delivery of large volume flexible electronics that can fill internal cavities and co-injection of electronics with other materials into host structures, opening up unique applications for flexible electronics. PMID:26053995
Electronic Nose and Electronic Tongue
Bhattacharyya, Nabarun; Bandhopadhyay, Rajib
Human beings have five senses, namely, vision, hearing, touch, smell and taste. The sensors for vision, hearing and touch have been developed for several years. The need for sensors capable of mimicking the senses of smell and taste have been felt only recently in food industry, environmental monitoring and several industrial applications. In the ever-widening horizon of frontier research in the field of electronics and advanced computing, emergence of electronic nose (E-Nose) and electronic tongue (E-Tongue) have been drawing attention of scientists and technologists for more than a decade. By intelligent integration of multitudes of technologies like chemometrics, microelectronics and advanced soft computing, human olfaction has been successfully mimicked by such new techniques called machine olfaction (Pearce et al. 2002). But the very essence of such research and development efforts has centered on development of customized electronic nose and electronic tongue solutions specific to individual applications. In fact, research trends as of date clearly points to the fact that a machine olfaction system as versatile, universal and broadband as human nose and human tongue may not be feasible in the decades to come. But application specific solutions may definitely be demonstrated and commercialized by modulation in sensor design and fine-tuning the soft computing solutions. This chapter deals with theory, developments of E-Nose and E-Tongue technology and their applications. Also a succinct account of future trends of R&D efforts in this field with an objective of establishing co-relation between machine olfaction and human perception has been included.
A theory of electron baths: One-electron system dynamics
International Nuclear Information System (INIS)
McDowell, H.K.
1992-01-01
The second-quantized, many-electron, atomic, and molecular Hamiltonian is partitioned both by the identity or labeling of the spin orbitals and by the dynamics of the spin orbitals into a system coupled to a bath. The electron bath is treated by a molecular time scale generalized Langevin equation approach designed to include one-electron dynamics in the system dynamics. The bath is formulated as an equivalent chain of spin orbitals through the introduction of equivalent-chain annihilation and creation operators. Both the dynamics and the quantum grand canonical statistical properties of the electron bath are examined. Two versions for the statistical properties of the bath are pursued. Using a weak bath assumption, a bath statistical average is defined which allows one to achieve a reduced dynamics description of the electron system which is coupled to the electron bath. In a strong bath assumption effective Hamiltonians are obtained which reproduce the dynamics of the bath and which lead to the same results as found in the weak bath assumption. The effective (but exact) Hamiltonian is found to be a one-electron Hamiltonian. A reduced dynamics equation of motion for the system population matrix is derived and found to agree with a previous version. This equation of motion is useful for studying electron transfer in the system when coupled to an electron bath
Treatment of foods with 'soft-electrons' (low-energy electrons)
International Nuclear Information System (INIS)
Hayashi, Toru; Todoriki, Setsuko
2003-01-01
Electrons with energies of 300 keV or lower were defined as soft-electrons'. Soft-electrons can eradicate microorganisms residing on the surface of grains, pulses, spices, dehydrated vegetables, tea leaves and seeds, and reduce their microbial loads to levels lower than 10 CFU/g with little quality deterioration. Soft-electrons can inactivate insect pests infesting grains and pulses and inhibit sprouting of potatoes. (author)
International Nuclear Information System (INIS)
Waldecker, Lutz; Bertoni, Roman; Ernstorfer, Ralph
2015-01-01
We present the design and implementation of a highly compact femtosecond electron diffractometer working at electron energies up to 100 keV. We use a multi-body particle tracing code to simulate electron bunch propagation through the setup and to calculate pulse durations at the sample position. Our simulations show that electron bunches containing few thousands of electrons per bunch are only weakly broadened by space-charge effects and their pulse duration is thus close to the one of a single-electron wavepacket. With our compact setup, we can create electron bunches containing up to 5000 electrons with a pulse duration below 100 fs on the sample. We use the diffractometer to track the energy transfer from photoexcited electrons to the lattice in a thin film of titanium. This process takes place on the timescale of few-hundred femtoseconds and a fully equilibrated state is reached within 1 ps
Electron backscattering for process control in electron beam welding
International Nuclear Information System (INIS)
Ardenne, T. von; Panzer, S.
1983-01-01
A number of solutions to the automation of electron beam welding is presented. On the basis of electron backscattering a complex system of process control has been developed. It allows an enlarged imaging of the material's surface, improved adjustment of the beam focusing and definite focus positioning. Furthermore, both manual and automated positioning of the electron beam before and during the welding process has become possible. Monitoring of the welding process for meeting standard welding requirements can be achieved with the aid of a control quantity derived from the results of electronic evaluation of the high-frequency electron backscattering
Cannon, R D
2013-01-01
Electron Transfer Reactions deals with the mechanisms of electron transfer reactions between metal ions in solution, as well as the electron exchange between atoms or molecules in either the gaseous or solid state. The book is divided into three parts. Part 1 covers the electron transfer between atoms and molecules in the gas state. Part 2 tackles the reaction paths of oxidation states and binuclear intermediates, as well as the mechanisms of electron transfer. Part 3 discusses the theories and models of the electron transfer process; theories and experiments involving bridged electron transfe
Bishop, Owen
2013-01-01
Understand Electronics provides a readable introduction to the exciting world of electronics for the student or enthusiast with little previous knowledge. The subject is treated with the minimum of mathematics and the book is extensively illustrated.This is an essential guide for the newcomer to electronics, and replaces the author's best-selling Beginner's Guide to Electronics.The step-by-step approach makes this book ideal for introductory courses such as the Intermediate GNVQ.
Slavko Đerić
2016-01-01
Electronic commerce can be defined in different ways. Any definition helps to understand and explain that concept as better as possible.. Electronic commerce is a set of procedures and technologies that automate the tasks of financial transactions using electronic means. Also, according to some authors, electronic commerce is defined as a new concept, which is being developed and which includes process of buying and selling or exchanging products, services or information via computer networks...
International Nuclear Information System (INIS)
Olofsson, Lennart; Karlsson, Magnus G.; Karlsson, Mikael
2005-01-01
In energy modulated electron therapy a large fraction of the segments will be arranged as abutting segments where inhomogeneities in segment matching regions must be kept as small as possible. Furthermore, the output variation between different segments should be minimized and must in all cases be well predicted. For electron therapy with add-on collimators, both the electron MLC (eMLC) and the photon MLC (xMLC) contribute to these effects when an xMLC tracking technique is utilized to reduce the x-ray induced leakage. Two add-on electron collimator geometries have been analyzed using Monte Carlo simulations: One isocentric eMLC geometry with an isocentric clearance of 35 cm and air or helium in the treatment head, and one conventional proximity geometry with a clearance of 5 cm and air in the treatment head. The electron fluence output for 22.5 MeV electrons is not significantly affected by the xMLC if the shielding margins are larger than 2-3 cm. For small field sizes and 9.6 MeV electrons, the isocentric design with helium in the treatment head or shielding margins larger than 3 cm is needed to avoid a reduced electron output. Dose inhomogeneity in the matching region of electron segments is, in general, small when collimator positions are adjusted to account for divergence in the field. The effect of xMLC tracking on the electron output can be made negligible while still obtaining a substantially reduced x-ray leakage contribution. Collimator scattering effects do not interfere significantly when abutting beam techniques are properly applied
Equation satisfied by electron-electron mutual Coulomb repulsion energy density functional
Joubert, Daniel P.
2011-01-01
The electron-electron mutual Coulomb repulsion energy density functional satisfies an equation that links functionals and functional derivatives at N-electron and (N-1)-electron densities for densities determined from the same adiabatic scaled external potential for the N-electron system.
Lancaster, F. W.
1989-01-01
Describes various stages involved in the applications of electronic media to the publishing industry. Highlights include computer typesetting, or photocomposition; machine-readable databases; the distribution of publications in electronic form; computer conferencing and electronic mail; collaborative authorship; hypertext; hypermedia publications;…
Syringe-injectable electronics.
Liu, Jia; Fu, Tian-Ming; Cheng, Zengguang; Hong, Guosong; Zhou, Tao; Jin, Lihua; Duvvuri, Madhavi; Jiang, Zhe; Kruskal, Peter; Xie, Chong; Suo, Zhigang; Fang, Ying; Lieber, Charles M
2015-07-01
Seamless and minimally invasive three-dimensional interpenetration of electronics within artificial or natural structures could allow for continuous monitoring and manipulation of their properties. Flexible electronics provide a means for conforming electronics to non-planar surfaces, yet targeted delivery of flexible electronics to internal regions remains difficult. Here, we overcome this challenge by demonstrating the syringe injection (and subsequent unfolding) of sub-micrometre-thick, centimetre-scale macroporous mesh electronics through needles with a diameter as small as 100 μm. Our results show that electronic components can be injected into man-made and biological cavities, as well as dense gels and tissue, with >90% device yield. We demonstrate several applications of syringe-injectable electronics as a general approach for interpenetrating flexible electronics with three-dimensional structures, including (1) monitoring internal mechanical strains in polymer cavities, (2) tight integration and low chronic immunoreactivity with several distinct regions of the brain, and (3) in vivo multiplexed neural recording. Moreover, syringe injection enables the delivery of flexible electronics through a rigid shell, the delivery of large-volume flexible electronics that can fill internal cavities, and co-injection of electronics with other materials into host structures, opening up unique applications for flexible electronics.
Electronic excitation of Na atom by electron impact
International Nuclear Information System (INIS)
Bielschowsky, C.E.; Souza, G.G.B. de; Lucas, C.A.; Nogueira, J.C.
1988-01-01
Electronic excitation of the 3s-3p transition in the Na atom was studied by intermediate energy electron impact spectroscopy. Differential Cross Sections (DCS) and Generalized Oscillator Strenghts (GOS) were determined experimentally for 1 KeV electrons. Theoretical results within the First Born Approximation as well as Glauber theory, were also performed. (A.C.A.S.) [pt
Highly efficient electron gun with a single-atom electron source
International Nuclear Information System (INIS)
Ishikawa, Tsuyoshi; Urata, Tomohiro; Cho, Boklae; Rokuta, Eiji; Oshima, Chuhei; Terui, Yoshinori; Saito, Hidekazu; Yonezawa, Akira; Tsong, Tien T.
2007-01-01
The authors have demonstrated highly collimated electron-beam emission from a practical electron gun with a single-atom electron source; ∼80% of the total emission current entered the electron optics. This ratio was two or three orders of magnitude higher than those of the conventional electron sources such as a cold field emission gun and a Zr/O/W Schottky gun. At the pressure of less than 1x10 -9 Pa, the authors observed stable emission of 20 nA, which generates the specimen current of 5 pA required for scanning electron microscopes
Electron-electron interaction in p-SiGe/Ge quantum wells
International Nuclear Information System (INIS)
Roessner, Benjamin; Kaenel, Hans von; Chrastina, Daniel; Isella, Giovanni; Batlogg, Bertram
2005-01-01
The temperature dependent magnetoresistance of high mobility p-SiGe/Ge quantum wells is studied with hole densities ranging from 1.7 to 5.9 x 10 11 cm -2 . At magnetic fields below the onset of quantum oscillations that reflect the high mobility values (up to 75000 cm 2 /Vs), we observe the clear signatures of electron-electron interaction. We compare our experiment with the theory of electron-electron interaction including the Zeeman band splitting. The observed magnetoresistance is well explained as a superposition of band structure induced positive magnetoresistance and the negative magntoresistance due to the electron-electron interaction effect
Electron-electron interactions in disordered systems
Efros, AL
1985-01-01
``Electron-Electron Interactions in Disordered Systems'' deals with the interplay of disorder and the Coulomb interaction. Prominent experts give state-of-the-art reviews of the theoretical and experimental work in this field and make it clear that the interplay of the two effects is essential, especially in low-dimensional systems.
Narrow electron injector for ballistic electron spectroscopy
International Nuclear Information System (INIS)
Kast, M.; Pacher, C.; Strasser, G.; Gornik, E.
2001-01-01
A three-terminal hot electron transistor is used to measure the normal energy distribution of ballistic electrons generated by an electron injector utilizing an improved injector design. A triple barrier resonant tunneling diode with a rectangular transmission function acts as a narrow (1 meV) energy filter. An asymmetric energy distribution with its maximum on the high-energy side with a full width at half maximum of ΔE inj =10 meV is derived. [copyright] 2001 American Institute of Physics
Yavari, H.; Mokhtari, M.; Bayervand, A.
2015-03-01
Based on Kubo's linear response formalism, temperature dependence of the spin-Hall conductivity of a two-dimensional impure (magnetic and nonmagnetic impurities) Rashba electron gas in the presence of electron-electron and electron-phonon interactions is analyzed theoretically. We will show that the temperature dependence of the spin-Hall conductivity is determined by the relaxation rates due to these interactions. At low temperature, the elastic lifetimes ( and are determined by magnetic and nonmagnetic impurity concentrations which are independent of the temperature, while the inelastic lifetimes ( and related to the electron-electron and electron-phonon interactions, decrease when the temperature increases. We will also show that since the spin-Hall conductivity is sensitive to temperature, we can distinguish the intrinsic and extrinsic contributions.
Analytical local electron-electron interaction model potentials for atoms
International Nuclear Information System (INIS)
Neugebauer, Johannes; Reiher, Markus; Hinze, Juergen
2002-01-01
Analytical local potentials for modeling the electron-electron interaction in an atom reduce significantly the computational effort in electronic structure calculations. The development of such potentials has a long history, but some promising ideas have not yet been taken into account for further improvements. We determine a local electron-electron interaction potential akin to those suggested by Green et al. [Phys. Rev. 184, 1 (1969)], which are widely used in atom-ion scattering calculations, electron-capture processes, and electronic structure calculations. Generalized Yukawa-type model potentials are introduced. This leads, however, to shell-dependent local potentials, because the origin behavior of such potentials is different for different shells as has been explicated analytically [J. Neugebauer, M. Reiher, and J. Hinze, Phys. Rev. A 65, 032518 (2002)]. It is found that the parameters that characterize these local potentials can be interpolated and extrapolated reliably for different nuclear charges and different numbers of electrons. The analytical behavior of the corresponding localized Hartree-Fock potentials at the origin and at long distances is utilized in order to reduce the number of fit parameters. It turns out that the shell-dependent form of Green's potential, which we also derive, yields results of comparable accuracy using only one shell-dependent parameter
Extracting electron backscattering coefficients from backscattered electron micrographs
International Nuclear Information System (INIS)
Zupanic, F.
2010-01-01
Electron backscattering micrographs possess the so-called Z-contrast, carrying information about the chemical compositions of phases present in microstructures. The intensity at a particular point in the backscattered electron micrograph is proportional to the signal detected at a corresponding point in the scan raster, which is, in turn, proportional to the electron backscattering coefficient of a phase at that point. This article introduces a simple method for extracting the electron backscattering coefficients of phases present in the microstructure, from the backscattered electron micrographs. This method is able to convert the micrograph's greyscale to the backscattering-coefficient-scale. The prerequisite involves the known backscattering coefficients for two phases in the micrograph. In this way, backscattering coefficients of other phases can be determined. The method is unable to determine the chemical compositions of phases or the presence of an element only from analysing the backscattered electron micrograph. Nevertheless, this method was found to be very powerful when combined with energy dispersive spectroscopy, and the calculations of backscattering coefficients. - Research Highlights: →A simple method for extracting the electron backscattering coefficients →The prerequisite is known backscattering coefficients for two phases →The information is complementary to the EDS-results. →This method is especially useful when a phase contains a light element (H, Li, Be, and B)
PIC simulation of the electron-ion collision effects on suprathermal electrons
International Nuclear Information System (INIS)
Wu Yanqing; Han Shensheng
2000-01-01
The generation and transportation of suprathermal electrons are important to both traditional ICF scheme and 'Fast Ignition' scheme. The author discusses the effects of electron-ion collision on the generation and transportation of the suprathermal electrons by parametric instability. It indicates that the weak electron-ion term in the PIC simulation results in the enhancement of the collisional absorption and increase of the hot electron temperature and reduction in the maximum electrostatic field amplitude while wave breaking. Therefore the energy and distribution of the suprathermal electrons are changed. They are distributed more close to the phase velocity of the electrostatic wave than the case without electron-ion collision term. The electron-ion collision enhances the self-consistent field and impedes the suprathermal electron transportation. These factors also reduce the suprathermal electron energy. In addition, the authors discuss the effect of initial condition on PIC simulation to ensure that the results are correct
Spin Relaxation in GaAs: Importance of Electron-Electron Interactions
Directory of Open Access Journals (Sweden)
Gionni Marchetti
2014-04-01
Full Text Available We study spin relaxation in n-type bulk GaAs, due to the Dyakonov–Perel mechanism, using ensemble Monte Carlo methods. Our results confirm that spin relaxation time increases with the electronic density in the regime of moderate electronic concentrations and high temperature. We show that the electron-electron scattering in the non-degenerate regime significantly slows down spin relaxation. This result supports predictions by Glazov and Ivchenko. Most importantly, our findings highlight the importance of many-body interactions for spin dynamics: we show that only by properly taking into account electron-electron interactions within the simulations, results for the spin relaxation time—with respect to both electron density and temperature—will reach good quantitative agreement with corresponding experimental data. Our calculations contain no fitting parameters.
Energy Technology Data Exchange (ETDEWEB)
Ogiwara, H [Tokyo Dental Coll. (Japan)
1975-02-01
Dentinal carious lesions having a remineralized surface layer were studied by means electron-probe microanalysis, electron microscopy, electron diffraction. As the results of electron-probe study, F, Mg, and Na were found to be distributed mainly in the remineralized surface layer and S in the decalcified region where decreases in Ca, P, and Mg concentration were usually observed. The decrease in Mg concentration always started earlier than that of Ca and P concentration. Electron microscope and electron diffraction studies revealed that apatic crystals in the remineralized surface layer were much larger than those in the intact dentin. Although they were less conspicuous, crystals in the decalcified region also were larger than those in the intact region. Dentinal tubules, occluded by many crystals, were frequently seen during the observations. Crystals in the tubules varied in morphology, showing granular, needle, rhomboid, and tabular shapes. By means of electron diffraction, the granular- or needle-shaped crystals were identified as apatite and the rhomboid-shaped crystals as whitlockite. Some of the tabular-shaped crystals appeared to be cotacalcium phosphate.
Tüütu tegelane helvik / Eva Luigas
Luigas, Eva
2015-01-01
Sageli võib aiakeskustes näha taimepotte, kus mullapinda katab kummaline roheline sammal - nagu plaaditaoline, korrapäraselt harunenud leht oleks tihedalt vastu mulda surutud. Tegemist on hariliku helvikuga (Marchantia polymorpha), rahvas nimetab teda ka maksasamblaks. Koduaeda sattudes võib helvik ruttu levima hakata ja siis on temast lahti saada üsna vaevarikas
R. N. Graca; A. C. Alfenas; A. L. Ross-Davis; Ned Klopfenstein; M. -S. Kim; T. L. Peever; P. G. Cannon; J. Y. Uchida; C. Y. Kadooka; R. D. Hauff
2011-01-01
Puccinia psidii is the cause of rust disease of many host species in the Myrtaceae family, including guava (Psidium spp.), eucalypt (Eucalyptus spp.), rose apple (Syzygium jambos), and 'ohi'a (Metrosideros polymorpha). First reported in 1884 on guava in Brazil, the rust has since been detected in South America (Argentina, Brazil, Colombia, Paraguay, Uruguay,...
Colwell, Morris A
1976-01-01
Electronic Components provides a basic grounding in the practical aspects of using and selecting electronics components. The book describes the basic requirements needed to start practical work on electronic equipment, resistors and potentiometers, capacitance, and inductors and transformers. The text discusses semiconductor devices such as diodes, thyristors and triacs, transistors and heat sinks, logic and linear integrated circuits (I.C.s) and electromechanical devices. Common abbreviations applied to components are provided. Constructors and electronics engineers will find the book useful
Ion- and electron-acoustic solitons in two-electron temperature space plasmas
International Nuclear Information System (INIS)
Lakhina, G. S.; Kakad, A. P.; Singh, S. V.; Verheest, F.
2008-01-01
Properties of ion- and electron-acoustic solitons are investigated in an unmagnetized multicomponent plasma system consisting of cold and hot electrons and hot ions using the Sagdeev pseudopotential technique. The analysis is based on fluid equations and the Poisson equation. Solitary wave solutions are found when the Mach numbers exceed some critical values. The critical Mach numbers for the ion-acoustic solitons are found to be smaller than those for electron-acoustic solitons for a given set of plasma parameters. The critical Mach numbers of ion-acoustic solitons increase with the increase of hot electron temperature and the decrease of cold electron density. On the other hand, the critical Mach numbers of electron-acoustic solitons increase with the increase of the cold electron density as well as the hot electron temperature. The ion-acoustic solitons have positive potentials for the parameters considered. However, the electron-acoustic solitons have positive or negative potentials depending whether the fractional cold electron density with respect to the ion density is greater or less than a certain critical value. Further, the amplitudes of both the ion- and electron-acoustic solitons increase with the increase of the hot electron temperature. Possible application of this model to electrostatic solitary waves observed on the auroral field lines by the Viking spacecraft is discussed
Diffusive scattering of electrons by electron holes around injection fronts
Vasko, I. Y.; Agapitov, O. V.; Mozer, F. S.; Artemyev, A. V.; Krasnoselskikh, V. V.; Bonnell, J. W.
2017-03-01
Van Allen Probes have detected nonlinear electrostatic spikes around injection fronts in the outer radiation belt. These spikes include electron holes (EH), double layers, and more complicated solitary waves. We show that EHs can efficiently scatter electrons due to their substantial transverse electric fields. Although the electron scattering driven by EHs is diffusive, it cannot be evaluated via the standard quasi-linear theory. We derive analytical formulas describing local electron scattering by a single EH and verify them via test particle simulations. We show that the most efficiently scattered are gyroresonant electrons (crossing EH on a time scale comparable to the local electron gyroperiod). We compute bounce-averaged diffusion coefficients and demonstrate their dependence on the EH spatial distribution (latitudinal extent and spatial filling factor) and individual EH parameters (amplitude of electrostatic potential, velocity, and spatial scales). We show that EHs can drive pitch angle scattering of ≲5 keV electrons at rates 10-2-10-4 s-1 and, hence, can contribute to electron losses and conjugated diffuse aurora brightenings. The momentum and pitch angle scattering rates can be comparable, so that EHs can also provide efficient electron heating. The scattering rates driven by EHs at L shells L ˜ 5-8 are comparable to those due to chorus waves and may exceed those due to electron cyclotron harmonics.
Energy Technology Data Exchange (ETDEWEB)
Szczesniak, R. [Institute of Physics, Czestochowa University of Technology (Poland); Institute of Physics, Jan Dlugosz University in Czestochowa (Poland); Durajski, A.P.; Duda, A.M. [Institute of Physics, Czestochowa University of Technology (Poland)
2017-04-15
The properties of the superconducting and the anomalous normal state were described by using the Eliashberg method. The pairing mechanism was reproduced with the help of the Hamiltonian, which models the electron-phonon and the electron-electron-phonon interaction (EEPh). The set of the Eliashberg equations, which determines the order parameter function (φ), the wave function renormalization factor (Z), and the energy shift function (χ), was derived. It was proven that for the sufficiently large values of the EEPh potential, the doping dependence of the order parameter (φ/Z) has the analogous course to that observed experimentally in cuprates. The energy gap in the electron density of states is induced by Z and χ - the contribution from φ is negligible. The electron density of states possesses the characteristic asymmetric form and the pseudogap is observed above the critical temperature. (copyright 2017 by WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Nguyen, Cattien V. (Inventor); Ribaya, Bryan P. (Inventor)
2013-01-01
An electron gun, an electron source for an electron gun, an extractor for an electron gun, and a respective method for producing the electron gun, the electron source and the extractor are disclosed. Embodiments provide an electron source utilizing a carbon nanotube (CNT) bonded to a substrate for increased stability, reliability, and durability. An extractor with an aperture in a conductive material is used to extract electrons from the electron source, where the aperture may substantially align with the CNT of the electron source when the extractor and electron source are mated to form the electron gun. The electron source and extractor may have alignment features for aligning the electron source and the extractor, thereby bringing the aperture and CNT into substantial alignment when assembled. The alignment features may provide and maintain this alignment during operation to improve the field emission characteristics and overall system stability of the electron gun.
International Nuclear Information System (INIS)
Fukuda, E.K.
1983-01-01
Molecular electron affinities have historically been difficult quantities to measure accurately. These difficulties arise from differences in structure between the ion and neutral as well as the existence of excited negative ion states. To circumvent these problems, relative electron affinities were determined in this dissertation by studying equilibrium electron transfer reactions using a pulsed ion cyclotron resonance (ICR) spectrometer. Direct measurement of ion and neutral concentrations for reactions of the general type, A - + B = B - + A, allow calculation of the equilibrium constant and, therefore, the free energy change. The free energy difference is related to the difference in electron affinities between A and B. A relative electron affinity scale covering a range of about 45 kcal/mol was constructed with various substituted p-benzoquinones, nitrobenzenes, anhydrides, and benzophenones. To assign absolute electron affinities, various species with accurately known electron affinities are tied to the scale via ion-cyclotron double resonance bracketing techniques. After the relative scale is anchored to these species with well-known electron affinities, the scale is then used as a check on other electron affinity values as well as generating new electron affinity values. Many discrepancies were found between the electron affinities measured using the ICR technique and previous literature determinations
International Nuclear Information System (INIS)
Longmier, B.; Baalrud, S.; Hershkowitz, N.
2006-01-01
A radio frequency (rf) plasma-based electron source that does not rely on electron emission at a cathode surface has been constructed. All of the random electron flux incident on an exit aperture is extracted through an electron sheath resulting in total nonambipolar flow within the device when the ratio of the ion loss area to the electron loss area is approximately equal to the square root of the ratio of the ion mass to the electron mass, and the ion sheath potential drop at the chamber walls is much larger than T e /e. The nonambipolar electron source (NES) has an axisymmetric magnetic field of 100 G at the extraction aperture that results in a uniform plasma potential across the aperture, allowing the extraction of all the incident electron flux without the use of grids. A prototype NES has produced 15 A of continuous electron current, using 15 SCCM (SCCM denotes cubic centimeter per minute at STP) Ar, 1200 W rf power at 13.56 MHz, and 6 times gas utilization. Alternatively 8 A of electron current can be produced, using 3 SCCM Ar at 1200 W rf and 20 times gas utilization. NES could replace hollow cathode electron sources in a wide variety of applications
Electron-plasmon model in the electron liquid theory
Directory of Open Access Journals (Sweden)
M.V.Vavrukh
2005-01-01
Full Text Available Here we propose an accurate approach to the description of the electron liquid model in the electron and plasmon terms. Our ideas in the present paper are close to the conception of the collective variables which was developed in the papers of Bohm and Pines. However we use another body of mathematics in the transition to the expanded space of variable particles and plasmons realized by the transition operator. It is evident that in the Random Phase Approximation (RPA, the model which consists of two interactive subsystems of electrons and plasmons is equivalent to the electron liquid model with Coulomb interaction.
Hsin-Fei, Meng
2013-01-01
Polymer semiconductor is the only semiconductor that can be processed in solution. Electronics made by these flexible materials have many advantages such as large-area solution process, low cost, and high performance. Researchers and companies are increasingly dedicating time and money in polymer electronics. This book focuses on the fundamental materials and device physics of polymer electronics. It describes polymer light-emitting diodes, polymer field-effect transistors, organic vertical transistors, polymer solar cells, and many applications based on polymer electronics. The book also disc
A direct electron detector for time-resolved MeV electron microscopy
Energy Technology Data Exchange (ETDEWEB)
Vecchione, T.; Denes, P.; Jobe, R. K.; Johnson, I. J.; Joseph, J. M.; Li, R. K.; Perazzo, A.; Shen, X.; Wang, X. J.; Weathersby, S. P.; Yang, J.; Zhang, D.
2017-03-01
The introduction of direct electron detectors enabled the structural biology revolution of cryogenic electron microscopy. Direct electron detectors are now expected to have a similarly dramatic impact on time-resolved MeV electron microscopy, particularly by enabling both spatial and temporal jitter correction. Here we report on the commissioning of a direct electron detector for time-resolved MeV electron microscopy. The direct electron detector demonstrated MeV single electron sensitivity and is capable of recording megapixel images at 180 Hz. The detector has a 15-bit dynamic range, better than 30-μmμm spatial resolution and less than 20 analogue-to-digital converter count RMS pixel noise. The unique capabilities of the direct electron detector and the data analysis required to take advantage of these capabilities are presented. The technical challenges associated with generating and processing large amounts of data are also discussed.
Coherent Electron Focussing in a Two-Dimensional Electron Gas.
Houten, H. van; Wees, B.J. van; Mooij, J.E.; Beenakker, C.W.J.; Williamson, J.G.; Foxon, C.T.
1988-01-01
The first experimental realization of ballistic point contacts in a two-dimensional electron gas for the study of transverse electron focussing by a magnetic field is reported. Multiple peaks associated with skipping orbits of electrons reflected specularly by the channel boundary are observed. At
A study on the secondary electrons in a clinical electron beam
International Nuclear Information System (INIS)
Krithivas, G.; Rao, S.N.
1989-01-01
The central axis dose of a 12 MeV clinical electron beam is investigated in terms of an axial component due to primary electrons in the central ray and a lateral component due to secondary electrons originating from multiple scattering of electrons in the off-axis rays. To this effect secondary electron fluence measurements in a polystyrene medium irradiated with a collimated beam are made with a sensitive diode detector. This leads to a construction of secondary electron depth-dose profiles for beam sizes of diameters ranging from 1.7 to 17.4 cm. The results indicate that the lateral electrons account for 25% of the dose in the therapeutic region. For these electrons, the depth of dose maximum is correlated with diffusion depth and maximum lateral excursion in the medium. Dose component due to backscatter electrons at depths is also investigated using a thin-window parallel-plate ion chamber. The role of lateral and backscatter electrons in characterising central axis per cent depth-dose is discussed. (author)
Shamieh
2015-01-01
Explore the basic concepts of electronics, build your electronics workbench, and begin creating fun electronics projects right away! Electronics For Dummies, 3rd Edition is your guide to the world of electronics. Spanning circuitry, wiring, robotics, transmitters, amplifiers, and more, this book demystifies electricity basics and beyond. The third edition offers new content revised to reflect the latest advancements in the electronics field, and it offers full color project examples to spark your creativity and inspire you to put your new skills to use! Packed with projects that can be comple
Tonomura, Akira
1993-01-01
Holography was devised for breaking through the resolution limit of electron microscopes The advent of a "coherent" field emission electron beam has enabled the use of Electron Holography in various areas of magnetic domain structures observation, fluxon observation in superconductors, and fundamental experiments in physics which have been inaccessible using other techniques After examining the fundamentals of electron holography and its applications to the afore mentioned fields, a detailed discussion of the Aharonov-Bohm effect and the related experiments is presented Many photographs and illustrations are included to elucidate the text
Comprehensive analysis of electron correlations in three-electron atoms
International Nuclear Information System (INIS)
Morishita, T.; Lin, C.D.
1999-01-01
We study the electron correlations in singly, doubly, and triply excited states of a three-electron atom. While electron correlation in general is weak for singly excited states, correlation plays major roles in determining the characteristics of doubly and triply excited states. Using the adiabatic approximation in hyperspherical coordinates, we show that the distinction between singly, doubly, and triply excited states is determined by the radial correlations, while finer distinctions within doubly or triply excited states lie in the angular correlations. Partial projections of the body-fixed frame wave functions are used to demonstrate the characteristic nodal surfaces which provide clues to the energy ordering of the states. We show that doubly excited states of a three-electron atom exhibit correlations that are similar to the doubly excited states of a two-electron atom. For the triply excited states, we show that the motion of the three electrons resemble approximately that of a symmetric top. copyright 1999 The American Physical Society
Advanced electron beam techniques
International Nuclear Information System (INIS)
Hirotsu, Yoshihiko; Yoshida, Yoichi
2007-01-01
After 100 years from the time of discovery of electron, we now have many applications of electron beam in science and technology. In this report, we review two important applications of electron beam: electron microscopy and pulsed-electron beam. Advanced electron microscopy techniques to investigate atomic and electronic structures, and pulsed-electron beam for investigating time-resolved structural change are described. (author)
Effects of electron-electron interactions on electronic transport in disordered systems
International Nuclear Information System (INIS)
Foley, Simon Timothy
2002-01-01
This thesis is concerned with the role of electron-electron interactions on electronic transport in disordered systems. We first consider a novel non-linear sigma model in order to microscopically treat the effects of disorder and electronic interaction. We successfully reproduce the perturbative results for the zero-bias anomaly and the interaction correction to the conductivity in a weakly disordered system, and discuss possible directions for future work. Secondly we consider the fluctuations of the dephasing rate for a closed diffusive and quantum dot system. Using the Keldysh technique we derive an expression for the inelastic scattering rate with which we self-consistently obtain the fluctuations in the dephasing rate. For the diffusive regime we find the relative fluctuations is given by F ∼ (L φ /L) 2 /g 2 , where g is the dimensionless conductance, L φ is the dephasing length and L is the sample size. For the quantum dot regime we find a perturbative divergence due to the presence of the zero mode. By mapping divergent diagrams to those for the two-level correlation function, we conjecture the existence of an exact relation between the two. Finally we discuss the consequences of this relation. (author)
Characteristics of trapped electrons and electron traps in single crystals
International Nuclear Information System (INIS)
Budzinski, E.E.; Potter, W.R.; Potienko, G.; Box, H.C.
1979-01-01
Two additional carbohydrates are reported whose crystal structures trap electrons intermolecularly in single crystals x irradiated at low temperature, namely sucrose and rhamnose. Five carbohydrate and polyhydroxy compounds are now known which exhibit this phenomenon. The following characteristics of the phenomenon were investigated: (1) the hyperfine couplings of the electron with protons of the polarized hydroxy groups forming the trap; (2) the distances between these protons and the trapped electron; (3) the spin density of the electron at the protons and (4) the relative stabilities of the electron trapped in various crystal structures
Electron-electron scattering in linear transport in two-dimensional systems
DEFF Research Database (Denmark)
Hu, Ben Yu-Kuang; Flensberg, Karsten
1996-01-01
We describe a method for numerically incorporating electron-electron scattering in quantum wells for small deviations of the distribution function from equilibrium, within the framework of the Boltzmann equation. For a given temperature T and density n, a symmetric matrix needs to be evaluated only...... once, and henceforth it can be used to describe electron-electron scattering in any Boltzmann equation linear-response calculation for that particular T and n. Using this method, we calculate the distribution function and mobility for electrons in a quantum well, including full finite...
Terahertz Plasma Waves in Two Dimensional Quantum Electron Gas with Electron Scattering
International Nuclear Information System (INIS)
Zhang Liping
2015-01-01
We investigate the Terahertz (THz) plasma waves in a two-dimensional (2D) electron gas in a nanometer field effect transistor (FET) with quantum effects, the electron scattering, the thermal motion of electrons and electron exchange-correlation. We find that, while the electron scattering, the wave number along y direction and the electron exchange-correlation suppress the radiation power, but the thermal motion of electrons and the quantum effects can amplify the radiation power. The radiation frequency decreases with electron exchange-correlation contributions, but increases with quantum effects, the wave number along y direction and thermal motion of electrons. It is worth mentioning that the electron scattering has scarce influence on the radiation frequency. These properties could be of great help to the realization of practical THz plasma oscillations in nanometer FET. (paper)
Oblique electron cyclotron emission for electron distribution studies (invited)
International Nuclear Information System (INIS)
Preische, S.; Efthimion, P.C.; Kaye, S.M.
1997-01-01
Electron cyclotron emission (ECE) at an oblique angle to the magnetic field provides a means of probing the electron distribution function both in energy and physical space through changes in and constraints on the relativistic electron cyclotron resonance condition. Diagnostics based on this Doppler shifted resonance are able to study a variety of electron distributions through changes in the location of the resonance in physical or energy space accomplished by changes in the viewing angle and frequency, and the magnetic field. For the case of observation across a changing magnetic field, such as across the tokamak midplane, the constraint on the resonance condition for real solutions to the dispersion relation can constrain the physical location of optically thin emission. A new Oblique ECE diagnostic was installed and operated on the PBX-M tokamak for the study of energetic electrons during lower hybrid current drive. It has a view 33 degree with respect to perpendicular in the tokamak midplane, receives second harmonic X-mode emission, and is constrained to receive single pass emission by SiC viewing dumps on the tokamak walls. Spatial localization of optically thin emission from superthermal electrons (50 endash 100 keV) was obtained by observation of emission upshifted from a thermal cyclotron harmonic. The localized measurements of the electron energy distribution and the superthermal density profile made by this diagnostic demonstrate its potential to study the spatial transport of energetic electrons on fast magnetohydrodynamic time scales or anomalous diffusion time scales. Oblique ECE can also be used to study electron distributions that may have a slight deviation from a Maxwellian by localizing the emission in energy space. (Abstract Truncated)
Electron microscopy of boron carbide before and after electron irradiation
International Nuclear Information System (INIS)
Stoto, T.; Zuppiroli, L.; Beauvy, M.; Athanassiadis, T.
1984-06-01
The microstructure of boron carbide has been studied by electron microscopy and related to the composition of the material. After electron irradiations in an usual transmission electron microscope and in a high voltage electron microscope at different temperatures and fluxes no change of these microstructures have been observed but a sputtering of the surface of the samples, which has been studied quantitatively [fr
Electron Cyclotron Resonances in Electron Cloud Dynamics
International Nuclear Information System (INIS)
Celata, Christine; Celata, C.M.; Furman, Miguel A.; Vay, J.-L.; Yu, Jennifer W.
2008-01-01
We report a previously unknown resonance for electron cloud dynamics. The 2D simulation code 'POSINST' was used to study the electron cloud buildup at different z positions in the International Linear Collider positron damping ring wiggler. An electron equilibrium density enhancement of up to a factor of 3 was found at magnetic field values for which the bunch frequency is an integral multiple of the electron cyclotron frequency. At low magnetic fields the effects of the resonance are prominent, but when B exceeds ∼(2 pi mec/(elb)), with lb = bunch length, effects of the resonance disappear. Thus short bunches and low B fields are required for observing the effect. The reason for the B field dependence, an explanation of the dynamics, and the results of the 2D simulations and of a single-particle tracking code used to elucidate details of the dynamics are discussed
Role of electron-electron interactions in the RKKY theory of magnetism
International Nuclear Information System (INIS)
Cooke, J.F.
1978-10-01
The theory of magnetism in heavy rare earth metals is based on the RKKY theory. In this formalism the indirect exchange interaction between the local 4f spins is mediated by the conduction electrons. When carried to second order in the 4f-conduction electron interaction, traditional perturbation theory leads to a Heisenberg-like interaction between the local spins which depends on the electronic energy bands and 4f-conduction electron exchange matrix elements. This derivation neglects the detailed behavior of electron-electron interaction within the conduction band, which is known to be important in metallic systems. By using an equation of motion method, an expression for the inelastic neutron scattering cross-section has been derived which includes, in an approximate way, this electron-electron interaction. The results of this calculation indicate that spin-wave peaks can be broadened and shifted if the spin-wave band lies near the conduction electron Stoner continuum. The origin of this effect is similar to that found in itinerant electron systems where the spin-wave band actually intersects the Stoner continuum, resulting in the disappearance of the spin-wave mode
Role of electron-electron interactions in the RKKY theory of magnetism
International Nuclear Information System (INIS)
Cooke, J.F.
1979-01-01
The theory of magnetism in heavy rare earth metals is based on the RKKY theory. In this formalism the indirect exchange interaction between the local 4f spins is mediated by the conduction electrons. When carried to second order in the 4f-conduction electron interaction, traditional pertubation theory leads to a Heisenberg-like interaction between the local spins which depends on the electronic energy bands and 4f-conduction electron exchange matrix elements. This derivation neglects the detailed behavior of electron-electron interaction within the conduction band, which is known to be important in metallic systems. By using an equation of motion method, an expression for the inelastic neutron scattering cross-section has been derived which includes, in an approximate way, this electron-electron interaction. The results of this calculation indicate that spin-wave peaks can be broadened and shifted if the spin-wave band lies near the conduction electron Stoner continuum. The origin of this effect is similar to that found in itinerant electron systems where the spin-wave band actually intersects the Stoner continuum, resulting in the disappearance of the spin-wave mode
Electron acoustic solitary waves in unmagnetized two electron population dense plasmas
International Nuclear Information System (INIS)
Mahmood, S.; Masood, W.
2008-01-01
The electron acoustic solitary waves are studied in unmagnetized two population electron quantum plasmas. The quantum hydrodynamic model is employed with the Sagdeev potential approach to describe the arbitrary amplitude electron acoustic waves in a two electron population dense Fermi plasma. It is found that hot electron density hump structures are formed in the subsonic region in such type of quantum plasmas. The wave amplitude as well as the width of the soliton are increased with the increase of percentage presence of cold (thinly populated) electrons in a multicomponent quantum plasma. It is found that an increase in quantum diffraction parameter broadens the nonlinear structure. Furthermore, the amplitude of the nonlinear electron acoustic wave is found to increase with the decrease in Mach number. The numerical results are also presented to understand the formation of solitons in two electron population Fermi plasmas.
Advances in imaging and electron physics the scanning transmission electron microscope
Hawkes, Peter W
2009-01-01
Advances in Imaging and Electron Physics merges two long-running serials--Advances in Electronics and Electron Physics and Advances in Optical and Electron Microscopy. This series features extended articles on the physics of electron devices (especially semiconductor devices), particle optics at high and low energies, microlithography, image science and digital image processing, electromagnetic wave propagation, electron microscopy, and the computing methods used in all these domains. This particular volume presents several timely articles on the scanning transmission electron microscope. Updated with contributions from leading international scholars and industry experts Discusses hot topic areas and presents current and future research trends Provides an invaluable reference and guide for physicists, engineers and mathematicians.
Tracking down worldwide Puccinia psidii dispersal
Rodrigo Neves Graca; Amy Ross-Davis; Ned Klopfenstein; Mee Sook Kim; Tobin Peever; Phil Cannon; Janice Uchida; Acelino Couto Alfenas
2011-01-01
Puccinia psidii causes rust disease on many host species in the Myrtaceae [1]. First reported in 1884 on guava in Southern Brazil [2], the rust has since been detected on several myrtaceous in South America, Central America, Caribbean, Mexico, USA: in Florida, California, and Hawaii. More recently, P. psidii was reported in Japan infecting M. polymorpha[3]. Of special...
N. B. Klopfenstein; J. W. Hanna; R. N. Graca; A. L. Ross-Davis; P. G. Cannon; A. C. Alfenas; M. -S. Kim
2011-01-01
Puccinia psidii is the cause of Eucalyptus/guava/myrtle rust disease of many host species in the Myrtaceae family, including guava (Psidium spp.), eucalypt (Eucalyptus spp.), rose apple (Syzygium jambos), and ohia (Metrosideros polymorpha) (Farr and Rossman 2010). First reported in 1884 on guava in Brazil (Maclachlan 1938), the rust has since been detected in other...
Attractive electron correlation in wide band gap semiconductors by electron-photon interaction
International Nuclear Information System (INIS)
Takeda, Hiroyuki; Yoshino, Katsumi
2004-01-01
We theoretically demonstrate attractive electron correlation in wide band gap semiconductors by electron-photon interaction. At low temperature, wavevectors of electromagnetic waves absorbed in wide band gap semiconductors cannot be neglected for wavevectors of electron waves; that is, electromagnetic waves affect the movements of electrons. In particular, attractive interaction occurs between two electrons when one electron changes from a valence band to a conduction band and the other electron changes from a conduction band to a valence band
Electronic Publishing or Electronic Information Handling?
Heck, A.
The current dramatic evolution in information technology is bringing major modifications in the way scientists communicate. The concept of 'electronic publishing' is too restrictive and has often different, sometimes conflicting, interpretations. It is thus giving way to the broader notion of 'electronic information handling' encompassing the diverse types of information, the different media, as well as the various communication methodologies and technologies. New problems and challenges result also from this new information culture, especially on legal, ethical, and educational grounds. The procedures for validating 'published material' and for evaluating scientific activities will have to be adjusted too. 'Fluid' information is becoming a common concept. Electronic publishing cannot be conceived without link to knowledge bases nor without intelligent information retrieval tools.
Theoretical study of the interplay of electron-electron interaction and disorder
International Nuclear Information System (INIS)
Brezini, A.; Behilil, S.
1988-10-01
A disordered Hubbard model with diagonal disorder is used to investigate the electron localization effects associated with both disorder and electron-electron interaction. Extensive results are reported on the ground state properties and compared to other theories. Two regimes have been found: when the electron-electron interaction u is greater than the disorder parameter w and when u < w. (author). 18 refs, 4 figs
Defining Electron Bifurcation in the Electron-Transferring Flavoprotein Family.
Garcia Costas, Amaya M; Poudel, Saroj; Miller, Anne-Frances; Schut, Gerrit J; Ledbetter, Rhesa N; Fixen, Kathryn R; Seefeldt, Lance C; Adams, Michael W W; Harwood, Caroline S; Boyd, Eric S; Peters, John W
2017-11-01
Electron bifurcation is the coupling of exergonic and endergonic redox reactions to simultaneously generate (or utilize) low- and high-potential electrons. It is the third recognized form of energy conservation in biology and was recently described for select electron-transferring flavoproteins (Etfs). Etfs are flavin-containing heterodimers best known for donating electrons derived from fatty acid and amino acid oxidation to an electron transfer respiratory chain via Etf-quinone oxidoreductase. Canonical examples contain a flavin adenine dinucleotide (FAD) that is involved in electron transfer, as well as a non-redox-active AMP. However, Etfs demonstrated to bifurcate electrons contain a second FAD in place of the AMP. To expand our understanding of the functional variety and metabolic significance of Etfs and to identify amino acid sequence motifs that potentially enable electron bifurcation, we compiled 1,314 Etf protein sequences from genome sequence databases and subjected them to informatic and structural analyses. Etfs were identified in diverse archaea and bacteria, and they clustered into five distinct well-supported groups, based on their amino acid sequences. Gene neighborhood analyses indicated that these Etf group designations largely correspond to putative differences in functionality. Etfs with the demonstrated ability to bifurcate were found to form one group, suggesting that distinct conserved amino acid sequence motifs enable this capability. Indeed, structural modeling and sequence alignments revealed that identifying residues occur in the NADH- and FAD-binding regions of bifurcating Etfs. Collectively, a new classification scheme for Etf proteins that delineates putative bifurcating versus nonbifurcating members is presented and suggests that Etf-mediated bifurcation is associated with surprisingly diverse enzymes. IMPORTANCE Electron bifurcation has recently been recognized as an electron transfer mechanism used by microorganisms to maximize
International Nuclear Information System (INIS)
Molinari, V.G.; Pizzio, F.; Spiga, G.
1979-01-01
The electron distribution function, the electron temperature and some transport parameters (electrical conductivity and energy flow coefficient) are obtained starting from the nonlinear Boltzmann equation for a plasma under the action of an external electric field. The Fokker-Planck approximation is used for electron-electron and electron-ion interactions. The effects of electron-electron collisions are studied for different values of collision frequencies and electric field. (author)
Electron-excited molecule interactions
International Nuclear Information System (INIS)
Christophorou, L.G.; Tennessee Univ., Knoxville, TN
1991-01-01
In this paper the limited but significant knowledge to date on electron scattering from vibrationally/rotationally excited molecules and electron scattering from and electron impact ionization of electronically excited molecules is briefly summarized and discussed. The profound effects of the internal energy content of a molecule on its electron attachment properties are highlighted focusing in particular on electron attachment to vibrationally/rotationally and to electronically excited molecules. The limited knowledge to date on electron-excited molecule interactions clearly shows that the cross sections for certain electron-molecule collision processes can be very different from those involving ground state molecules. For example, optically enhanced electron attachment studies have shown that electron attachment to electronically excited molecules can occur with cross sections 10 6 to 10 7 times larger compared to ground state molecules. The study of electron-excited molecule interactions offers many experimental and theoretical challenges and opportunities and is both of fundamental and technological significance. 54 refs., 15 figs
International Nuclear Information System (INIS)
Nellist, P.
2006-01-01
Commercially available lens correctors are extending the reach of electron microscopes to unprecedented atomic scales, as Peter Nellist describes. The electron microscope was invented in 1933 and is based on the principle that electrons have a wavelength that is inversely proportional to their momentum. There are two basic types: transmission electron microscopes and scanning electron microscopes, plus a hybrid of the two. The lenses in an electron microscope are provided by electromagnetic fields, but they suffer from spherical aberration. The addition of octupole and quadrupole corrector fields has improved the resolution of the electron microscope to better than 0.1 nm in the last decade. The next step is to correct for chromatic aberration, after which the resolution of the microscope will probably be limited by the size of the atom itself. (U.K.)
CERN. Geneva
2005-01-01
Electronics in HEP experiments: specificities and evolution The Art of Electronics: is there something beyond Ohm's law? Basic building blocks of Analog electronics: quickly understanding a schematic Charge preamps, current preamps and future preamps, shaping and the rest Electronics noise: fundamental and practical Evolution of technology: ASICs, FPGAs...
Multiple electron generation in a sea of electronic states
Witzel, Wayne; Shabaev, Andrew; Efros, Alexander; Hellberg, Carl; Verne, Jacobs
2009-03-01
In traditional bulk semiconductor photovoltaics (PVs), each photon may excite a single electron-hole, wasting excess energy beyond the band-gap as heat. In nanocrystals, multiple excitons can be generated from a single photon, enhancing the PV current. Multiple electron generation (MEG) may result from Coulombic interactions of the confined electrons. Previous investigations have been based on incomplete or over-simplified electronic-state representations. We present results of quantum simulations that include hundreds of thousands of configuration states and show how the complex dynamics, even in a closed electronic system, yields a saturated MEG effect on a femtosecond timescale. Sandia is a multiprogram laboratory operated by Sandia Corporation, a Lockheed Martin Company, for the United States Department of Energy's National Nuclear Security Administration under contract DE-AC04-94AL85000.
Electron collision cross sections and electron swarm parameters for gas molecules
International Nuclear Information System (INIS)
Hayashi, Makoto
1986-01-01
Elastic and inelastic electron collision cross sections for molecules which interest in radiation research have been determined from available electron beam and electron swarm data by utilizing the Boltzmann equation and Monte Carlo simulation method. Electron drift velocity data which interest in radiation Pysics have been discussed and some calculated results of electron drift velocity data for CF 4 and CF 4 -inert gases mixtures will be presented. (author)
Mláka, Michal
2010-01-01
This bachelor thesis analysis issue of electronic payment systems. It discusses their use for payments on the internet and sending funds via e-mail. The first part is devoted to the theoretical definition and legislation of the issuance of electronic money and activities of electronic money institutions. The main part of the work clearly focuses on the use of e-wallets, which is an integral part of electronic payment systems. E-wallet of electronic payment system Moneybookers is considered as...
Wigner-like crystallization of Anderson-localized electron systems with low electron densities
Slutskin, A A; Pepper, M
2002-01-01
We consider an electron system under conditions of strong Anderson localization, taking into account interelectron long-range Coulomb repulsion. We establish that at sufficiently low electron densities and sufficiently low temperatures the Coulomb electron interaction brings about ordering of the Anderson-localized electrons into a structure that is close to an ideal (Wigner) crystal lattice, provided the dimension of the system is > 1. This Anderson-Wigner glass (AWG) is a new macroscopic electron state that, on the one hand, is beyond the conventional Fermi glass concept, and on the other hand, qualitatively differs from the known 'plain' Wigner glass (inherent in self-localized electron systems) in that the random slight electron displacements from the ideal crystal sites essentially depend on the electron density. With increasing electron density the AWG is found to turn into the plain Wigner glass or Fermi glass, depending on the width of the random spread of the electron levels. It is shown that the res...
Excess electrons in methanol clusters: Beyond the one-electron picture
Pohl, Gábor; Mones, Letif; Turi, László
2016-10-01
We performed a series of comparative quantum chemical calculations on various size negatively charged methanol clusters, ("separators=" CH 3 OH ) n - . The clusters are examined in their optimized geometries (n = 2-4), and in geometries taken from mixed quantum-classical molecular dynamics simulations at finite temperature (n = 2-128). These latter structures model potential electron binding sites in methanol clusters and in bulk methanol. In particular, we compute the vertical detachment energy (VDE) of an excess electron from increasing size methanol cluster anions using quantum chemical computations at various levels of theory including a one-electron pseudopotential model, several density functional theory (DFT) based methods, MP2 and coupled-cluster CCSD(T) calculations. The results suggest that at least four methanol molecules are needed to bind an excess electron on a hydrogen bonded methanol chain in a dipole bound state. Larger methanol clusters are able to form stronger interactions with an excess electron. The two simulated excess electron binding motifs in methanol clusters, interior and surface states, correlate well with distinct, experimentally found VDE tendencies with size. Interior states in a solvent cavity are stabilized significantly stronger than electron states on cluster surfaces. Although we find that all the examined quantum chemistry methods more or less overestimate the strength of the experimental excess electron stabilization, MP2, LC-BLYP, and BHandHLYP methods with diffuse basis sets provide a significantly better estimate of the VDE than traditional DFT methods (BLYP, B3LYP, X3LYP, PBE0). A comparison to the better performing many electron methods indicates that the examined one-electron pseudopotential can be reasonably used in simulations for systems of larger size.
Electron dose rate and photon contamination in electron arc therapy
International Nuclear Information System (INIS)
Pla, M.; Podgorsak, E.B.; Pla, C.
1989-01-01
The electron dose rate at the depth of dose maximum dmax and the photon contamination are discussed as a function of several parameters of the rotational electron beam. A pseudoarc technique with an angular increment of 10 degrees and a constant number of monitor units per each stationary electron field was used in our experiments. The electron dose rate is defined as the electron dose at a given point in phantom divided by the number of monitor units given for any one stationary electron beam. For a given depth of isocenter di the electron dose rates at dmax are linearly dependent on the nominal field width w, while for a given w the dose rates are inversely proportional to di. The dose rates for rotational electron beams with different di are related through the inverse square law provided that the two beams have (di,w) combinations which give the same characteristic angle beta. The photon dose at the isocenter depends on the arc angle alpha, field width w, and isocenter depth di. For constant w and di the photon dose at isocenter is proportional to alpha, for constant alpha and w it is proportional to di, and for constant alpha and di it is inversely proportional to w. The w and di dependence implies that for the same alpha the photon dose at the isocenter is inversely proportional to the electron dose rate at dmax
DEFF Research Database (Denmark)
Iov, Florin; Ciobotaru, Mihai; Blaabjerg, Frede
2008-01-01
is to change the electrical power production sources from the conventional, fossil (and short term) based energy sources to renewable energy resources. The other is to use high efficient power electronics in power generation, power transmission/distribution and end-user application. This paper discuss the most...... emerging renewable energy sources, wind energy, which by means of power electronics are changing from being a minor energy source to be acting as an important power source in the energy system. Power electronics is the enabling technology and the presentation will cover the development in wind turbine...... technology from kW to MW, discuss which power electronic solutions are most feasible and used today....
Electron Emission from Ultra-Large Area MOS Electron Emitters
DEFF Research Database (Denmark)
Thomsen, Lasse Bjørchmar; Nielsen, Gunver; Vendelbo, Søren Bastholm
2009-01-01
Ultralarge metal-oxide-semiconductor (MOS) devices with an active oxide area of 1 cm2 have been fabricated for use as electron emitters. The MOS structures consist of a Si substrate, a SiO2 tunnel barrier (~5 nm), a Ti wetting layer (3–10 Å), and a Au top layer (5–60 nm). Electron emission from...... layer is varied from 3 to 10 Å which changes the emission efficiency by more than one order of magnitude. The apparent mean free path of ~5 eV electrons in Au is found to be 52 Å. Deposition of Cs on the Au film increased the electron emission efficiency to 4.3% at 4 V by lowering the work function....... Electron emission under high pressures (up to 2 bars) of Ar was observed. ©2009 American Vacuum Society...
Comparative analysis of the terms "electronic commerce" and "electronic business"
Kavaliauskienė, Virginija; Šarapovas, Tadas
2002-01-01
Establishing the terms that clearly and consistently describe growing and dynamic networked economy is a critical first step toward further analysis and evaluation of electronic commerce and electronic business processes. Electronic commerce is making an impact on the ways that purchasing activities are being conducted. Much of the early literature on this subject was very speculative. However, the growth of e-commerce has enabled more observations to be made of the use of electronic business...
Directory of Open Access Journals (Sweden)
J.G. Alvarez-Moctezuma
1999-09-01
Full Text Available El objetivo de este trabajo fue describir el hábitat de las especies del subgénero Lepidobalanus en la Meseta Central de Chiapas e identificar las principales variables que condicionan su distribución. En 258 parcelas se utilizó un índice de dominancia, basado en la abundancia y cobertura de las especies, para conocer la distribución de Quercus peduncularis, Q. polymorpha, Q. rugosa, Q. sebifera y Q. segoviensis. Además se midieron las variables ambientales: altitud, precipitación de noviembre a abril (PPNA, exposición, pendiente, intensidad de extracción de leña y pastoreo. Se utilizó el Detrended Canonical Correspondence Analysis para la evaluación estadística de los datos. Se encontró una relación negativa entre el índice de dominancia de Q. peduncularis y Q. segoviensis con la altitud y la PPNA. El índice de dominancia de Q. rugosa y Q. segoviensis mostró correlación con la exposición y la intensidad de extracción de leña. La altitud fue la variable ambiental que condiciona la distribución diferencial de las especies, seguida por la PPNA. El resultado de este estudio sugiere que hay hábitat diferenciados para Q. peduncularis, Q. polymorpha, Q. rugosa, Q. sebifera y Q. segoviensis determinados por variables naturales (altitud y PPNA, aunque también las variables culturales (pastoreo y extracción de leña pueden condicionar la distribución y abundancia de estas especies.We describe the habitat of species within the Fagaceae subgenus Lepidobalanus (genus Quercus and identify environmental variables related to their distribution in the Meseta Central of Chiapas, Southern Mexico. In 258 plots a dominance index was used, combining tree density and crown cover, for Quercus peduncularis, Q. polymorpha, Q. rugosa, Q. sebifera and Q. segoviensis. The following variables were measured: altitude, precipitation from November through April (PPNA, exposure, slope, fuel-wood harvesting and grazing. Detrended Canonical
Electron-electron interaction and transfer ionization in fast ion-atom collisions
International Nuclear Information System (INIS)
Voitkiv, A B
2008-01-01
Recently it was pointed out that electron capture occurring in fast ion-atom collisions can proceed via a mechanism which earlier was not considered. In the present paper we study this mechanism in more detail. Similarly as in radiative capture, where the electron transfer occurs due to the interaction with the radiation field and proceeds via emission of a photon, within this mechanism the electron capture is caused by the interaction with another atomic electron leading mainly to the emission of the latter. In contrast to the electron-electron Thomas capture, this electron-electron (E-E) mechanism is basically a first-order one having similarities to the kinematic and radiative capture channels. It also possesses important differences with the latter two. Leading to transfer ionization, this first-order capture mechanism results in the electron emission mainly in the direction opposite to the motion of the projectile ion. The same, although less pronounced, feature is also characteristic for the momenta of the target recoil ions produced via this mechanism. It is also shown that the action of the E-E mechanism is clearly seen in recent experimental data on the transfer ionization in fast proton-helium collisions.
Determination of electron temperature and electron density in ...
African Journals Online (AJOL)
It is seen that the electron temperature increases from 5.8 × 102 oK to 7.83 × 104 oK as the pd is reduced from 130mm Hg × mm to 60 mm Hg × mm for argon. The electron densities increases from 2.8 × 1011/cm3 to 3.2 × 1011 /cm3 for the same variation of pds. For air the electron temperature increases from 3.6 × 104 oK to ...
Optimising electron microscopy experiment through electron optics simulation
Energy Technology Data Exchange (ETDEWEB)
Kubo, Y. [CEMES-CNRS, 29 Rue Jeanne Marvig, 31055 Toulouse France (France); Hitachi High-Technologies Corporation, 882, Ichige, Hitachinaka, Ibaraki 312-8504 (Japan); Gatel, C.; Snoeck, E. [CEMES-CNRS, 29 Rue Jeanne Marvig, 31055 Toulouse France (France); Houdellier, F., E-mail: florent.houdellier@cemes.fr [CEMES-CNRS, 29 Rue Jeanne Marvig, 31055 Toulouse France (France)
2017-04-15
We developed a new type of electron trajectories simulation inside a complete model of a modern transmission electron microscope (TEM). Our model incorporates the precise and real design of each element constituting a TEM, i.e. the field emission (FE) cathode, the extraction optic and acceleration stages of a 300 kV cold field emission gun, the illumination lenses, the objective lens, the intermediate and projection lenses. Full trajectories can be computed using magnetically saturated or non-saturated round lenses, magnetic deflectors and even non-cylindrical symmetry elements like electrostatic biprism. This multi-scale model gathers nanometer size components (FE tip) with parts of meter length (illumination and projection systems). We demonstrate that non-trivial TEM experiments requiring specific and complex optical configurations can be simulated and optimized prior to any experiment using such model. We show that all the currents set in all optical elements of the simulated column can be implemented in the real column (I2TEM in CEMES) and used as starting alignment for the requested experiment. We argue that the combination of such complete electron trajectory simulations in the whole TEM column with automatic optimization of the microscope parameters for optimal experimental data (images, diffraction, spectra) allows drastically simplifying the implementation of complex experiments in TEM and will facilitate the development of advanced use of the electron microscope in the near future. - Highlights: • Using dedicated electron optics software, we calculate full electrons trajectories inside a modern transmission electron microscope. • We have determined how to deal with multi-scale electron optics elements like high voltage cold field emission source. • W • e have succeed to model both weak and strong magnetic lenses whether in saturated or unsaturated conditions as well as electrostatic biprism and magnetic deflectors. • We have applied this model
Optimising electron microscopy experiment through electron optics simulation
International Nuclear Information System (INIS)
Kubo, Y.; Gatel, C.; Snoeck, E.; Houdellier, F.
2017-01-01
We developed a new type of electron trajectories simulation inside a complete model of a modern transmission electron microscope (TEM). Our model incorporates the precise and real design of each element constituting a TEM, i.e. the field emission (FE) cathode, the extraction optic and acceleration stages of a 300 kV cold field emission gun, the illumination lenses, the objective lens, the intermediate and projection lenses. Full trajectories can be computed using magnetically saturated or non-saturated round lenses, magnetic deflectors and even non-cylindrical symmetry elements like electrostatic biprism. This multi-scale model gathers nanometer size components (FE tip) with parts of meter length (illumination and projection systems). We demonstrate that non-trivial TEM experiments requiring specific and complex optical configurations can be simulated and optimized prior to any experiment using such model. We show that all the currents set in all optical elements of the simulated column can be implemented in the real column (I2TEM in CEMES) and used as starting alignment for the requested experiment. We argue that the combination of such complete electron trajectory simulations in the whole TEM column with automatic optimization of the microscope parameters for optimal experimental data (images, diffraction, spectra) allows drastically simplifying the implementation of complex experiments in TEM and will facilitate the development of advanced use of the electron microscope in the near future. - Highlights: • Using dedicated electron optics software, we calculate full electrons trajectories inside a modern transmission electron microscope. • We have determined how to deal with multi-scale electron optics elements like high voltage cold field emission source. • W • e have succeed to model both weak and strong magnetic lenses whether in saturated or unsaturated conditions as well as electrostatic biprism and magnetic deflectors. • We have applied this model
Lead-Free Electronics: Impact for Space Electronics
Sampson, Michael J.
2010-01-01
Pb is used as a constituent in solder alloys used to connect and attach electronic parts to printed wiring boards (PWBs). Similar Pbbearing alloys are electroplated or hot dipped onto the terminations of electronic parts to protect the terminations and make them solderable. Changing to Pb-free solders and termination finishes has introduced significant technical challenges into the supply chain. Tin/lead (Sn/Pb) alloys have been the solders of choice for electronics for more than 50 years. Pb-free solder alloys are available but there is not a plug-in replacement for 60/40 or 63/37 (Sn/Pb) alloys, which have been the industry workhorses.
Observation of electron plasma waves in plasma of two-temperature electrons
International Nuclear Information System (INIS)
Ikezawa, Shunjiro; Nakamura, Yoshiharu.
1981-01-01
Propagation of electron plasma waves in a large and unmagnetized plasma containing two Maxwellian distributions of electrons is studied experimentally. Two kinds of plasma sources which supply electrons of different temperature are used. The temperature ratio is about 3 and the density ratio of hot to cool electrons is varied from 0 to 0.5. A small contamination of hot electrons enhances the Landau damping of the principal mode known as the Bohm-Gross mode. When the density of hot electrons is larger than about 0.2, two modes are observed. The results agree with theoretical dispersion relations when excitation efficiencies of the modes are considered. (author)
Nikrah, M.; Jafari, S.
2016-06-01
We expand here a theory of a high-gradient laser-excited electron accelerator based on an inverse free-electron laser (inverse-FEL), but with innovations in the structure and design. The electrostatic wiggler used in our scheme, namely termed the Paul wiggler, is generated by segmented cylindrical electrodes with applied oscillatory voltages {{V}\\text{osc}}(t) over {{90}\\circ} segments. The inverse-FEL interaction can be described by the equations that govern the electron motion in the combined fields of both the laser pulse and Paul wiggler field. A numerical study of electron energy and electron trajectories has been made using the fourth-order Runge-Kutta method. The results indicate that the electron attains a considerable energy at short distances in this device. It is found that if the electron has got sufficient suitable wiggler amplitude intensities, it can not only gain higher energy in longer distances, but also can retain it even after the passing of the laser pulse. In addition, the results reveal that the electron energy gains different peaks for different initial axial velocities, so that a suitable small initial axial velocity of e-beam produces substantially high energy gain. With regard to the transverse confinement of the electron beam in a Paul wiggler, there is no applied axial guide magnetic field in this device.
Plasmaspheric electron content
International Nuclear Information System (INIS)
Hartmann, G.K.
1978-01-01
Measurements of the plasmaspheric electron content are reviewed with particular reference to the ATS-6 radio beacon experiment. From the review, it appears likely that measurement of the plasmaspheric electron content is the only one capable of monitoring electron fluxes continuously between L 1 and L 2. Some recent important results deduced from plasmaspheric electron content measurements are discussed
A 20 keV electron gun system for the electron irradiation experiments
International Nuclear Information System (INIS)
Mahapatra, S.K.; Dhole, S.D.; Bhoraskar, V.N.
2005-01-01
An electron gun consisting of cathode, focusing electrode, control electrode and anode has been designed and fabricated for the electron irradiation experiments. This electron gun can provide electrons of any energy over the range 1-20 keV, with current upto 50 μA. This electron gun and a Faraday cup are mounted in the cylindrical chamber. The samples are fixed on the Faraday cup and irradiated with electrons at a pressure ∼10 -7 mbar. The special features of this electron gun system are that, at any electron energy above 1 keV, the electron beam diameter can be varied from 5 to 120 mm on the Faraday cup mounted at a distance of 200 mm from the anode in the chamber. The variation in the electron current over the beam spot of 120 mm diameter is less than 15% and the beam current stability is better than 5%. This system is being used for studying the irradiation effects of 1-20 keV energy electrons on the space quality materials in which the irradiation time may vary from a few tens of seconds to hours
A 20 keV electron gun system for the electron irradiation experiments
Energy Technology Data Exchange (ETDEWEB)
Mahapatra, S.K. [Department of Physics, University of Pune, Pune 411007 (India); Dhole, S.D. [Department of Physics, University of Pune, Pune 411007 (India); Bhoraskar, V.N. [Department of Physics, University of Pune, Pune 411007 (India)]. E-mail: vnb@physics.unipune.ernet.in
2005-01-01
An electron gun consisting of cathode, focusing electrode, control electrode and anode has been designed and fabricated for the electron irradiation experiments. This electron gun can provide electrons of any energy over the range 1-20 keV, with current upto 50 {mu}A. This electron gun and a Faraday cup are mounted in the cylindrical chamber. The samples are fixed on the Faraday cup and irradiated with electrons at a pressure {approx}10{sup -7} mbar. The special features of this electron gun system are that, at any electron energy above 1 keV, the electron beam diameter can be varied from 5 to 120 mm on the Faraday cup mounted at a distance of 200 mm from the anode in the chamber. The variation in the electron current over the beam spot of 120 mm diameter is less than 15% and the beam current stability is better than 5%. This system is being used for studying the irradiation effects of 1-20 keV energy electrons on the space quality materials in which the irradiation time may vary from a few tens of seconds to hours.
Effect of electron beam on the properties of electron-acoustic rogue waves
El-Shewy, E. K.; Elwakil, S. A.; El-Hanbaly, A. M.; Kassem, A. I.
2015-04-01
The properties of nonlinear electron-acoustic rogue waves have been investigated in an unmagnetized collisionless four-component plasma system consisting of a cold electron fluid, Maxwellian hot electrons, an electron beam and stationary ions. It is found that the basic set of fluid equations is reduced to a nonlinear Schrodinger equation. The dependence of rogue wave profiles and the associated electric field on the carrier wave number, normalized density of hot electron and electron beam, relative cold electron temperature and relative beam temperature are discussed. The results of the present investigation may be applicable in auroral zone plasma.
Electron cooling and recombination experiments with an adiabatically expanded electron beam
International Nuclear Information System (INIS)
Pastuszka, S.; Heidelberg Univ.; Schramm, U.; Heidelberg Univ.; Grieser, M.; Heidelberg Univ.; Broude, C.; Heidelberg Univ.; Grimm, R.; Heidelberg Univ.; Habs, D.; Heidelberg Univ.; Kenntner, J.; Heidelberg Univ.; Miesner, H.J.; Heidelberg Univ.; Schuessler, T.; Heidelberg Univ.; Schwalm, D.; Heidelberg Univ.; Wolf, A.; Heidelberg Univ.
1996-01-01
Magnetically guided electron beams with transverse temperatures reduced with respect to the cathode temperature by a factor of more than 7 were realized in the electron cooling device of the heavy-ion storage ring TSR and the effect of the reduced transverse temperature in recombination and electron cooling experiments was studied. Measured dielectronic recombination resonances at low relative energy and spectra of laser-stimulated recombination indicate that transverse electron temperatures of about 17 meV have been obtained at cathode temperatures of about 110 meV. The temperature dependence of the spontaneous electron-ion recombination rate during electron cooling was investigated and found to follow the inverse square-root law expected from the theory of radiative recombination, although the measured absolute rates are higher than predicted. A new method based on analyzing the intensity of the fluorescence light emitted during simultaneous laser and electron cooling is used to measure the longitudinal electron cooling force in a range of relative velocities extending over two orders of magnitude (10 5 -10 7 cm/s). The results confirm the occurrence of 'magnetized electron cooling' also at the reduced transverse temperature and show that, compared to earlier measurements at the high transverse temperature, the cooling force increases by about a factor of 2; a considerably larger increase by a factor of ∼5 would be expected if 'magnetized electron cooling' would not exist. (orig.)
Electronic structure of elements and compounds and electronic phases of solids
International Nuclear Information System (INIS)
Nadykto, B.A.
2000-01-01
The paper reviews technique and computed energies for various electronic states of many-electron multiply charged ions, molecular ions, and electronic phases of solids. The model used allows computation of the state energy for free many-electron multiply charged ions with relative accuracy ∼10 -4 suitable for analysis of spectroscopy data
International Nuclear Information System (INIS)
Liu, Z.Q.; Mitsuishi, K.; Furuya, K.
2005-01-01
Attempts were made to fabricate three-dimensional nanostructures on and out of a substrate by electron-beam-induced deposition in a 200-kV scanning transmission electron microscope. Structures with parallel wires over the substrate surface were difficult to fabricate due to the direct deposition of wires on both top and bottom surfaces of the substrate. Within the penetration depth of the incident electron beam, nanotweezers were fabricated by moving the electron beam beyond different substrate layers. Combining the deposition of self-supporting wires and self-standing tips, complicated three-dimensional doll-like, flag-like, and gate-like nanostructures that extend out of the substrate were successfully fabricated with one-step or multi-step scans of the electron beam. Effects of coarsening, nucleation, and distortion during electron-beam-induced deposition are discussed. (orig.)
Secondary electron emission yield in the limit of low electron energy
Andronov, A.N.; Kaganovich, I.D.; Startsev, E.A.; Raitses, Y.; Demidov, V.I.
2013-04-22
Secondary electron emission (SEE) from solids plays an important role in many areas of science and technology.1 In recent years, there has been renewed interest in the experimental and theoretical studies of SEE. A recent study proposed that the reflectivity of very low energy electrons from solid surface approaches unity in the limit of zero electron energy2,3,4, If this was indeed the case, this effect would have profound implications on the formation of electron clouds in particle accelerators,2-4 plasma measurements with electrostatic Langmuir probes, and operation of Hall plasma thrusters for spacecraft propulsion5,6. It appears that, the proposed high electron reflectivity at low electron energies contradicts to numerous previous experimental studies of the secondary electron emission7. The goal of this note is to discuss possible causes of these contradictions.
International Nuclear Information System (INIS)
Hegde, M.S.
1979-01-01
An introduction to the various techniques in electron spectroscopy is presented. These techniques include: (1) UV Photoelectron spectroscopy, (2) X-ray Photoelectron spectroscopy, (3) Auger electron spectroscopy, (4) Electron energy loss spectroscopy, (5) Penning ionization spectroscopy and (6) Ion neutralization spectroscopy. The radiations used in each technique, the basis of the technique and the special information obtained in structure determination in atoms and molecules by each technique are summarised. (A.K.)
Perpendicular electron cyclotron emission from hot electrons in TMX-U
International Nuclear Information System (INIS)
James, R.A.; Ellis, R.F.; Lasnier, C.J.; Casper, T.A.; Celata, C.M.
1984-01-01
Perpendicular electron cyclotron emission (PECE) from the electron cyclotron resonant heating of hot electrons in TMX-U is measured at 30 to 40 and 50 to 75 GHz. This emission is optically thin and is measured at the midplane, f/sub ce/ approx. = 14 GHz, in either end cell. In the west end cell, the emission can be measured at different axial positions thus yielding the temporal history of the hot electron axial profile. These profiles are in excellent agreement with the axial diamagnetic signals. In addition, the PECE signal level correlates well with the diamagnetic signal over a wide range of hot electron densities. Preliminary results from theoretical modeling and comparisons with other diagnostics are also presented
A ferroelectric electron gun in a free-electron maser experiment
International Nuclear Information System (INIS)
Einat, M.; Jerby, E.; Rosenman, G.
2002-01-01
An electron-gun based on a ferroelectric cathode is studied in a free-electron maser (FEM) experiment. In this gun, the electrons are separated from the cathode surface plasma, and are accelerated in two stages. The electron energy-spread is reduced sufficiently for an FEM operation in the microwave regime. A 14 keV, 1-2 A e-beam is obtained in a 0.1-2.1 μs pulse width. The pulse repetition frequency attains 3.1 MHz in ∼50% duty-cycle. This gun is implemented in an FEM oscillator experiment operating around 3 GHz. The paper presents experimental results and discusses the applicability of ferroelectric guns in free-electron laser devices
A ferroelectric electron gun in a free-electron maser experiment
Einat, M; Rosenman, G
2002-01-01
An electron-gun based on a ferroelectric cathode is studied in a free-electron maser (FEM) experiment. In this gun, the electrons are separated from the cathode surface plasma, and are accelerated in two stages. The electron energy-spread is reduced sufficiently for an FEM operation in the microwave regime. A 14 keV, 1-2 A e-beam is obtained in a 0.1-2.1 mu s pulse width. The pulse repetition frequency attains 3.1 MHz in approx 50% duty-cycle. This gun is implemented in an FEM oscillator experiment operating around 3 GHz. The paper presents experimental results and discusses the applicability of ferroelectric guns in free-electron laser devices.
Tobjörk, Daniel; Österbacka, Ronald
2011-05-03
Paper is ubiquitous in everyday life and a truly low-cost substrate. The use of paper substrates could be extended even further, if electronic applications would be applied next to or below the printed graphics. However, applying electronics on paper is challenging. The paper surface is not only very rough compared to plastics, but is also porous. While this is detrimental for most electronic devices manufactured directly onto paper substrates, there are also approaches that are compatible with the rough and absorptive paper surface. In this review, recent advances and possibilities of these approaches are evaluated and the limitations of paper electronics are discussed. Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Destabilization of the electron Bernstein modes by runaway electrons
International Nuclear Information System (INIS)
Hitchcock, D.A.; Mahajan, S.M.
1982-01-01
It is shown that the electromagnetic finite k/sub parallel/ electron Bernstein mode can be destabilized by the runaway electron distribution which results from the quasilinear action of the magnetized plasma oscillation. This mechanism is shown to yield growth rates of the order of 10 8 sec -1 and is suggested as a mechanism for the enchanced cyclotron harmonic emission in the presence of runaway electrons
Surface-electronic-state effects in electron emission from the Be(0001) surface
International Nuclear Information System (INIS)
Archubi, C. D.; Gravielle, M. S.; Silkin, V. M.
2011-01-01
We study the electron emission produced by swift protons impinging grazingly on a Be(0001) surface. The process is described within a collisional formalism using the band-structure-based (BSB) approximation to represent the electron-surface interaction. The BSB model provides an accurate description of the electronic band structure of the solid and the surface-induced potential. Within this approach we derive both bulk and surface electronic states, with these latter characterized by a strong localization at the crystal surface. We found that such surface electronic states play an important role in double-differential energy- and angle-resolved electron emission probabilities, producing noticeable structures in the electron emission spectra.
Surface-electronic-state effects in electron emission from the Be(0001) surface
Energy Technology Data Exchange (ETDEWEB)
Archubi, C. D. [Instituto de Astronomia y Fisica del Espacio, casilla de correo 67, sucursal 28, C1428EGA, Buenos Aires (Argentina); Gravielle, M. S. [Instituto de Astronomia y Fisica del Espacio, casilla de correo 67, sucursal 28, C1428EGA, Buenos Aires (Argentina); Departamento de Fisica, Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires, Buenos Aires (Argentina); Silkin, V. M. [Donostia International Physics Center, E-20018 San Sebastian (Spain); Departamento de Fisica de Materiales, Facultad de Ciencias Quimicas, Universidad del Pais Vasco, Apartado 1072, E-20080 San Sebastian (Spain); IKERBASQUE, Basque Foundation for Science, E-48011 Bilbao (Spain)
2011-07-15
We study the electron emission produced by swift protons impinging grazingly on a Be(0001) surface. The process is described within a collisional formalism using the band-structure-based (BSB) approximation to represent the electron-surface interaction. The BSB model provides an accurate description of the electronic band structure of the solid and the surface-induced potential. Within this approach we derive both bulk and surface electronic states, with these latter characterized by a strong localization at the crystal surface. We found that such surface electronic states play an important role in double-differential energy- and angle-resolved electron emission probabilities, producing noticeable structures in the electron emission spectra.
Simulation of the electron acoustic instability for a finite-size electron beam system
International Nuclear Information System (INIS)
Lin, C.S.; Winske, D.
1987-01-01
Satellite observations at midlatitudes (≅20,000 km) near the earth's dayside polar cusp boundary layer indicate that the upward electron beams have a narrow latitudinal width up to 0.1 0 . In the cusp boundary layer where the electron population consists of a finite-size electron beam in a background of uniform cold and hot electrons, the electron acoustic mode is unstable inside the electron beam but damped outside the electron beam. Simulations of the electron acoustic instability for a finite-size beam system are carried out with a particle-in-cell code to investigate the heating phenomena associated with the instability and the width of the heating region. The simulations show that the finite-size electron beam radiates electrostatic electron acoustic waves. The decay length of the electron acoustic waves outside the beam in the simulation agrees with the spatial decay length derived from the linear dispersion equation
Arbitrary amplitude slow electron-acoustic solitons in three-electron temperature space plasmas
International Nuclear Information System (INIS)
Mbuli, L. N.; Maharaj, S. K.; Bharuthram, R.; Singh, S. V.; Lakhina, G. S.
2015-01-01
We examine the characteristics of large amplitude slow electron-acoustic solitons supported in a four-component unmagnetised plasma composed of cool, warm, hot electrons, and cool ions. The inertia and pressure for all the species in this plasma system are retained by assuming that they are adiabatic fluids. Our findings reveal that both positive and negative potential slow electron-acoustic solitons are supported in the four-component plasma system. The polarity switch of the slow electron-acoustic solitons is determined by the number densities of the cool and warm electrons. Negative potential solitons, which are limited by the cool and warm electron number densities becoming unreal and the occurrence of negative potential double layers, are found for low values of the cool electron density, while the positive potential solitons occurring for large values of the cool electron density are only limited by positive potential double layers. Both the lower and upper Mach numbers for the slow electron-acoustic solitons are computed and discussed
Electron cloud dynamics in the Cornell Electron Storage Ring Test Accelerator wiggler
Directory of Open Access Journals (Sweden)
C. M. Celata
2011-04-01
Full Text Available The interference of stray electrons (also called “electron clouds” with accelerator beams is important in modern intense-beam accelerators, especially those with beams of positive charge. In magnetic wigglers, used, for instance, for transverse emittance damping, the intense synchrotron radiation produced by the beam can generate an electron cloud of relatively high density. In this paper the complicated dynamics of electron clouds in wigglers is examined using the example of a wiggler in the Cornell Electron Storage Ring Test Accelerator experiment at the Cornell Electron Storage Ring. Three-dimensional particle-in-cell simulations with the WARP-POSINST computer code show different density and dynamics for the electron cloud at locations near the maxima of the vertical wiggler field when compared to locations near the minima. Dynamics in these regions, the electron cloud distribution vs longitudinal position, and the beam coherent tune shift caused by the wiggler electron cloud will be discussed.
Arbitrary amplitude fast electron-acoustic solitons in three-electron component space plasmas
Energy Technology Data Exchange (ETDEWEB)
Mbuli, L. N.; Maharaj, S. K. [South African National Space Agency (SANSA) Space Science, P.O. Box 32, Hermanus 7200, Republic of South Africa (South Africa); Department of Physics, University of the Western Cape (UWC), Robert Sobukwe Road, Bellville 7535, Republic of South Africa (South Africa); Bharuthram, R. [Department of Physics, University of the Western Cape (UWC), Robert Sobukwe Road, Bellville 7535, Republic of South Africa (South Africa); Singh, S. V.; Lakhina, G. S. [Indian Institute of Geomagnetism, New Panvel (West), Navi Mumbai 410218 (India); Department of Physics, University of the Western Cape (UWC), Robert Sobukwe Road, Bellville 7535, Republic of South Africa (South Africa)
2016-06-15
We examine the characteristics of fast electron-acoustic solitons in a four-component unmagnetised plasma model consisting of cool, warm, and hot electrons, and cool ions. We retain the inertia and pressure for all the plasma species by assuming adiabatic fluid behaviour for all the species. By using the Sagdeev pseudo-potential technique, the allowable Mach number ranges for fast electron-acoustic solitary waves are explored and discussed. It is found that the cool and warm electron number densities determine the polarity switch of the fast electron-acoustic solitons which are limited by either the occurrence of fast electron-acoustic double layers or warm and hot electron number density becoming unreal. For the first time in the study of solitons, we report on the coexistence of fast electron-acoustic solitons, in addition to the regular fast electron-acoustic solitons and double layers in our multi-species plasma model. Our results are applied to the generation of broadband electrostatic noise in the dayside auroral region.
Electronic Market and Business: Cyberspace vs. Electronic Environment
Directory of Open Access Journals (Sweden)
Deniss Ščeulovs
2013-12-01
Full Text Available The authors of the article analyze the concept "electronic environment". Having studied a range of academic literature sources and other sources, the authors of the article have drawn a conclusion that the academic writings do not provide a definition of "electronic environment". Furthermore, the various opinions among specialists regarding this concept often differ. Meanwhile, there are several explanations of the term "cyberspace" overlapping the concept of "electronic environment", and these terms are often believed to be synonyms. To understand what the term "electronic environment" means and to properly and correctly employ this concept in entrepreneurship, the authors have performed a lexicographic analysis of this concept by comparing reciprocal concepts. As a result of the research, the authors propose their view on what, in their opinion, "electronic environment" is and what its connection to the concept "cyberspace" is. The topicality of the article lies in the fact that often entrepreneurs and specialists of public and other institutions, when using these terms, imply completely different concepts. It can lead to misunderstanding and misinterpreting the information, as well as to encumbering the understanding of tasks, problems, etc.
International Nuclear Information System (INIS)
Urata, Tomohiro; Ishikawa, Tsuyoshi; Cho, Boklae; Oshima, Chuhei
2008-01-01
We have developed practical XHV chambers of a electron gun, of which the operating pressures are 1x10 -9 Pa in a stainless-steel one and 4x10 -9 Pa in a permalloy one. By mounting a noble single-atom electron source with high brightness and high spatial coherence on the electron gun including electron optics, we demonstrated highly collimated electron-beam emission: ∼80% of the total emission current entered the electron optics. This ratio was two or three orders of magnitude higher than those of the conventional electron sources. In XHV, in addition, we confirmed stable electron emission up to 20 nA, which results in the specimen current high enough for scanning electron microscopes. (author)
Two-Electron Transfer Pathways.
Lin, Jiaxing; Balamurugan, D; Zhang, Peng; Skourtis, Spiros S; Beratan, David N
2015-06-18
The frontiers of electron-transfer chemistry demand that we develop theoretical frameworks to describe the delivery of multiple electrons, atoms, and ions in molecular systems. When electrons move over long distances through high barriers, where the probability for thermal population of oxidized or reduced bridge-localized states is very small, the electrons will tunnel from the donor (D) to acceptor (A), facilitated by bridge-mediated superexchange interactions. If the stable donor and acceptor redox states on D and A differ by two electrons, it is possible that the electrons will propagate coherently from D to A. While structure-function relations for single-electron superexchange in molecules are well established, strategies to manipulate the coherent flow of multiple electrons are largely unknown. In contrast to one-electron superexchange, two-electron superexchange involves both one- and two-electron virtual intermediate states, the number of virtual intermediates increases very rapidly with system size, and multiple classes of pathways interfere with one another. In the study described here, we developed simple superexchange models for two-electron transfer. We explored how the bridge structure and energetics influence multielectron superexchange, and we compared two-electron superexchange interactions to single-electron superexchange. Multielectron superexchange introduces interference between singly and doubly oxidized (or reduced) bridge virtual states, so that even simple linear donor-bridge-acceptor systems have pathway topologies that resemble those seen for one-electron superexchange through bridges with multiple parallel pathways. The simple model systems studied here exhibit a richness that is amenable to experimental exploration by manipulating the multiple pathways, pathway crosstalk, and changes in the number of donor and acceptor species. The features that emerge from these studies may assist in developing new strategies to deliver multiple
Wang, Hongyue; Lhuillier, Emmanuel; Yu, Qian; Mottaghizadeh, Alireza; Ulysse, Christian; Zimmers, Alexandre; Dubertret, Benoit; Aubin, Herve
2015-03-01
We present a tunnel spectroscopy study of the electronic spectrum of single PbS Quantum Dots (QDs) trapped between nanometer-spaced electrodes, measured at low temperature T=5 K. The carrier filling of the QD can be controlled either by the drain voltage in the shell filling regime or by a gate voltage. In the empty QD, the tunnel spectrum presents the expected signature of the 8x degenerated excited levels. In the drain controlled shell filling regime, the levels degeneracies are lifted by the global electrostatic Coulomb energy of the QD; in the gate controlled shell filling regime, the levels degeneracies are lifted by the intra-Coulomb interactions. In the charged quantum dot, electron-phonons interactions lead to the apparition of Franck-Condon side bands on the single excited levels and possibly Franck Condon blockade at low energy. The sharpening of excited levels at higher gate voltage suggests that the magnitude of electron-phonon interactions is decreased upon increasing the electron filling in the quantum dot. This work was supported by the French ANR Grants 10-BLAN-0409-01, 09-BLAN-0388-01, by the Region Ile-de-France in the framework of DIM Nano-K and by China Scholarship Council.
Electron emitting filaments for electron discharge devices
International Nuclear Information System (INIS)
Leung, K.N.; Pincosy, P.A.; Ehlers, K.W.
1988-01-01
This patent describes an electron emitting device for use in an electron discharge system. It comprises: a filament having a pair of terminal ends, electrical supply means for supplying electrical power to the terminal ends of the filament for directly heating the filament by the passage of an electrical current along the filament between the terminal ends, the filament being substantially tapered in cross section continuously in one direction from one of its pair of terminal ends to another of its pair of terminal ends to achieve uniform heating of the filament along the length thereof by compensating for the nonuniform current along the filament due to the emission of electrons therefrom
Electron irradiation-induced destruction of carbon nanotubes in electron microscopes
International Nuclear Information System (INIS)
Molhave, Kristian; Gudnason, Sven Bjarke; Pedersen, Anders Tegtmeier; Clausen, Casper Hyttel; Horsewell, Andy; Boggild, Peter
2007-01-01
Observations of carbon nanotubes under exposure to electron beam irradiation in standard transmission electron microscope (TEM) and scanning electron microscope (SEM) systems show that such treatment in some cases can cause severe damage of the nanotube structure, even at electron energies far below the approximate 100 keV threshold for knock-on damage displacing carbon atoms in the graphene structure. We find that the damage we observe in one TEM can be avoided by use of a cold finger. This and the morphology of the damage imply that water vapour, which is present as a background gas in many vacuum chambers, can damage the nanotube structure through electron beam-induced chemical reactions. Though, the dependence on the background gas makes these observations specific for the presently used systems, the results demonstrate the importance of careful assessment of the level of subtle structural damage that the individual electron microscope system can do to nanostructures during standard use
International Nuclear Information System (INIS)
Christophorou, L.G.; McCorkle, D.L.; Christodoulides, A.A.
1982-01-01
Topics covered include: (1) modes of production of negative ions, (2) techniques for the study of electron attachment processes, (3) dissociative electron attachment to ground-state molecules, (4) dissociative electron attachment to hot molecules (effects of temperature on dissociative electron attachment), (5) molecular parent negative ions, and (6) negative ions formed by ion-pair processes and by collisions of molecules with ground state and Rydberg atoms
Acceleration of electrons using an inverse free electron laser auto- accelerator
International Nuclear Information System (INIS)
Wernick, I.K.; Marshall, T.C.
1992-07-01
We present data from our study of a device known as the inverse free electron laser. First, numerical simulations were performed to optimize the design parameters for an experiment that accelerates electrons in the presence of an undulator by stimulated absorption of radiation. The Columbia free electron laser (FEL) was configured as an auto-accelerator (IFELA) system; high power (MW's) FEL radiation at ∼1.65 mm is developed along the first section of an undulator inside a quasi-optical resonator. The electron beam then traverses a second section of undulator where a fraction of the electrons is accelerated by stimulated absorption of the 1.65 mm wavelength power developed in the first undulator section. The second undulator section has very low gain and does not generate power on its own. We have found that as much as 60% of the power generated in the first section can be absorbed in the second section, providing that the initial electron energy is chosen correctly with respect to the parameters chosen for the first and second undulators. An electron momentum spectrometer is used to monitor the distribution of electron energies as the electrons exit the IFELA. We have found; using our experimental parameters, that roughly 10% of the electrons are accelerated to energies as high as 1100 keV, in accordance with predictions from the numerical model. The appearance of high energy electrons is correlated with the abrupt absorption of millimeter power. The autoaccelerator configuration is used because there is no intense source of coherent power at the 1.65 mm design wavelength other than the FEL
2017-07-21
AFRL-RV-PS- AFRL-RV-PS- TR-2017-0114 TR-2017-0114 ADVANCED ELECTRONICS Ashwani Sharma 21 Jul 2017 Interim Report APPROVED FOR PUBLIC RELEASE...NUMBER Advanced Electronics 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 62601F 6. AUTHOR(S) 5d. PROJECT NUMBER 4846 Ashwani Sharma 5e. TASK NUMBER...Approved for public release; distribution is unlimited. (RDMX-17-14919 dtd 20 Mar 2018) 13. SUPPLEMENTARY NOTES 14. ABSTRACT The Space Electronics
The Downshift of Electron Plasma Oscillations in the Electron Foreshock Region.
1984-10-10
Ii D-Ai50 52 THE DOWNSHIFT OF ELECTRON PLASMA OSCILLATIONS IN THE i/1. ELECTRON FORESHOCK R.. (U) I0MM UNIV 10MM CITY DEPT OF PHYSICS AND ASTRONOMY 5...OSCILLATIONS 0 IN THE ELECTRON FORESHOCK REGION In by S. A. Fuselierl, D. A. Gurnett 1 , Ace NTI 0. and R. J. Fitzenreiter 2 DTI I ,3WERSflY o. 06UNDED ISAI...geleasel Ditibto Unlimited 02 1 16 U. of Iowa 84-21 THE DOWNSHIFT OF ELECTRON PLASMA OSCILLATIONSJ / IN THE ELECTRON FORESHOCK REGION t - by Z I S. A
Electronics engineer's reference book
Mazda, F F
1989-01-01
Electronics Engineer's Reference Book, Sixth Edition is a five-part book that begins with a synopsis of mathematical and electrical techniques used in the analysis of electronic systems. Part II covers physical phenomena, such as electricity, light, and radiation, often met with in electronic systems. Part III contains chapters on basic electronic components and materials, the building blocks of any electronic design. Part IV highlights electronic circuit design and instrumentation. The last part shows the application areas of electronics such as radar and computers.
Angular distribution of scattered electron and medium energy electron spectroscopy for metals
International Nuclear Information System (INIS)
Oguri, Takeo; Ishioka, Hisamichi; Fukuda, Hisashi; Irako, Mitsuhiro
1986-01-01
The angular distribution (AD) of scattered electrons produced by medium energy incident electrons (E P = 50 ∼ 300 eV) from polycrystalline Ti, Fe, Ni, Cu and Au were obtained by the angle-resolved medium energy electron spectrometer. The AD of the energy loss peaks are similar figures to AD of the elastically reflected electron peaks. Therefore, the exchanged electrons produced by the knock-on collision between the incident electrons and those of metals without momentum transfer are observed as the energy loss spectra (ELS). This interpretation differs from the inconsequent interpretation by the dielectric theory or the interband transition. The information depth and penetration length are obtained from AD of the Auger electron peaks. The contribution of the surface to spectra is 3 % at the maximum for E P = 50 eV. The true secondary peaks representing the secondary electron emission spectroscopy (SES) are caused by the emissions of the energetic electrons (kT e ≥ 4 eV), and SES is the inversion of ELS. The established fundamental view is that the medium energy electron spectra represent the total bulk density of states. (author)
Wigner-like crystallization of Anderson-localized electron systems with low electron densities
International Nuclear Information System (INIS)
Slutskin, A.A.; Kovtun, H.A.; Pepper, M.
2002-01-01
We consider an electron system under conditions of strong Anderson localization, taking into account interelectron long-range Coulomb repulsion. We establish that at sufficiently low electron densities and sufficiently low temperatures the Coulomb electron interaction brings about ordering of the Anderson-localized electrons into a structure that is close to an ideal (Wigner) crystal lattice, provided the dimension of the system is > 1. This Anderson-Wigner glass (AWG) is a new macroscopic electron state that, on the one hand, is beyond the conventional Fermi glass concept, and on the other hand, qualitatively differs from the known 'plain' Wigner glass (inherent in self-localized electron systems) in that the random slight electron displacements from the ideal crystal sites essentially depend on the electron density. With increasing electron density the AWG is found to turn into the plain Wigner glass or Fermi glass, depending on the width of the random spread of the electron levels. It is shown that the residual disorder of the AWG is characterized by a multi-valley ground-state degeneracy akin to that in a spin glass. Some general features of the AWG are discussed, and a new conduction mechanism of a creep type is predicted
Maalderink, H.H.H.; Bruning, F.B.J.; Schipper, M.M.R. de; Werff, J.J.J. van der; Germs, W.W.C.; Remmers, J.J.C.; Meinders, E.R.
2018-01-01
The need for personalised and smart products drives the development of structural electronics with mass-customisation capability. A number of challenges need to be overcome in order to address the potential of complete free form manufacturing of electronic devices. One key challenge is the
Maalderink, H.H.; Bruning, F.B.J.; de Schipper, M.R.; van der Werff, J.J.; Germs, W.C.; Remmers, J.J.C.; Meinders, E.R.
2018-01-01
The need for personalised and smart products drives the development of structural electronics with mass-customisation capability. A number of challenges need to be overcome in order to address the potential of complete free form manufacturing of electronic devices. One key challenge is the
27 CFR 73.32 - May I electronically sign forms I submit electronically to TTB?
2010-04-01
... AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY (CONTINUED) PROCEDURES AND PRACTICES ELECTRONIC SIGNATURES; ELECTRONIC SUBMISSION OF FORMS Electronic Filing of Documents with TTB § 73.32 May I electronically sign forms I submit electronically to TTB? You may electronically sign the electronic form you...
Zhang, Peng; Yuly, Jonathon L; Lubner, Carolyn E; Mulder, David W; King, Paul W; Peters, John W; Beratan, David N
2017-09-19
How can proteins drive two electrons from a redox active donor onto two acceptors at very different potentials and distances? And how can this transaction be conducted without dissipating very much energy or violating the laws of thermodynamics? Nature appears to have addressed these challenges by coupling thermodynamically uphill and downhill electron transfer reactions, using two-electron donor cofactors that have very different potentials for the removal of the first and second electron. Although electron bifurcation is carried out with near perfection from the standpoint of energy conservation and electron delivery yields, it is a biological energy transduction paradigm that has only come into focus recently. This Account provides an exegesis of the biophysical principles that underpin electron bifurcation. Remarkably, bifurcating electron transfer (ET) proteins typically send one electron uphill and one electron downhill by similar energies, such that the overall reaction is spontaneous, but not profligate. Electron bifurcation in the NADH-dependent reduced ferredoxin: NADP + oxidoreductase I (Nfn) is explored in detail here. Recent experimental progress in understanding the structure and function of Nfn allows us to dissect its workings in the framework of modern ET theory. The first electron that leaves the two-electron donor flavin (L-FAD) executes a positive free energy "uphill" reaction, and the departure of this electron switches on a second thermodynamically spontaneous ET reaction from the flavin along a second pathway that moves electrons in the opposite direction and at a very different potential. The singly reduced ET products formed from the bifurcating flavin are more than two nanometers distant from each other. In Nfn, the second electron to leave the flavin is much more reducing than the first: the potentials are said to be "crossed." The eventually reduced cofactors, NADH and ferredoxin in the case of Nfn, perform crucial downstream redox
DEFF Research Database (Denmark)
Schürmann, Carsten
2009-01-01
Electronic voting technology is a two edged sword. It comes with many risks but brings also many benefits. Instead of flat out rejecting the technology as uncontrollably dangerous, we advocate in this paper a different technological angle that renders electronic elections trustworthy beyond...... the usual levels of doubt. We exploit the trust that voters currently have into the democratic process and model our techniques around that observation accordingly. In particular, we propose a technique of trace emitting computations to record the individual steps of an electronic voting machine...... for a posteriori validation on an acceptably small trusted computing base. Our technology enables us to prove that an electronic elections preserves the voter’s intent, assuming that the voting machine and the trace verifier are independent....
Low-dose electron energy-loss spectroscopy using electron counting direct detectors.
Maigné, Alan; Wolf, Matthias
2018-03-01
Since the development of parallel electron energy loss spectroscopy (EELS), charge-coupled devices (CCDs) have been the default detectors for EELS. With the recent development of electron-counting direct-detection cameras, micrographs can be acquired under very low electron doses at significantly improved signal-to-noise ratio. In spectroscopy, in particular in combination with a monochromator, the signal can be extremely weak and the detection limit is principally defined by noise introduced by the detector. Here we report the use of an electron-counting direct-detection camera for EEL spectroscopy. We studied the oxygen K edge of amorphous ice and obtained a signal noise ratio up to 10 times higher than with a conventional CCD.We report the application of electron counting to record time-resolved EEL spectra of a biological protein embedded in amorphous ice, revealing chemical changes observed in situ while exposed by the electron beam. A change in the fine structure of nitrogen K and the carbon K edges were recorded during irradiation. A concentration of 3 at% nitrogen was detected with a total electron dose of only 1.7 e-/Å2, extending the boundaries of EELS signal detection at low electron doses.
How do electron localization functions describe π-electron delocalization?
Steinmann, Stephan N; Mo, Yirong; Corminboeuf, Clemence
2011-12-14
Scalar fields provide an intuitive picture of chemical bonding. In particular, the electron localization function (ELF) has proven to be highly valuable in interpreting a broad range of bonding patterns. The discrimination between enhanced or reduced electron (de)localization within cyclic π-conjugated systems remains, however, challenging for ELF. In order to clearly distinguish between the local properties of ten highly and weakly π-(de)localized prototype systems, we compare the ELFs of both the canonical wave functions and electron-localized states (diabatic) with those of two closely related scalar fields: the electron localizability indicator (ELI-D) and the localized orbital locator (LOL). The simplest LOL function distinguishes enhanced from weak π-(de)localization in an insightful and reliable manner. LOL offers the finest contrast between annulenes with 4n/4n + 2 π electrons and their inorganic analogues as well as between hyperconjugated cyclopentadiene derivatives. LOL(π) also gives an appealing and intuitive picture of the π-bond. In contrast, the most popular ELF fails to capture subtle contrasting local electronic properties and suffers from the arbitrariness of the σ/π dissection. The orbital separation of the most recent ELI-D is clear-cut but the interpretations sometime less straightforward in the present context.
Electron shuttles in biotechnology.
Watanabe, Kazuya; Manefield, Mike; Lee, Matthew; Kouzuma, Atsushi
2009-12-01
Electron-shuttling compounds (electron shuttles [ESs], or redox mediators) are essential components in intracellular electron transfer, while microbes also utilize self-produced and naturally present ESs for extracellular electron transfer. These compounds assist in microbial energy metabolism by facilitating electron transfer between microbes, from electron-donating substances to microbes, and/or from microbes to electron-accepting substances. Artificially supplemented ESs can create new routes of electron flow in the microbial energy metabolism, thereby opening up new possibilities for the application of microbes to biotechnology processes. Typical examples of such processes include halogenated-organics bioremediation, azo-dye decolorization, and microbial fuel cells. Herein we suggest that ESs can be applied widely to create new microbial biotechnology processes.
Treatment of foods with 'soft-electrons' (low-energy electrons)
Energy Technology Data Exchange (ETDEWEB)
Hayashi, Toru [Japan International Research Center for Agricultural Sciences (JIRCAS), Tsukuba, Ibaraki (Japan); Todoriki, Setsuko [National Food Research Institute (NFRI), Tsukuba, Ibaraki (Japan)
2003-02-01
Electrons with energies of 300 keV or lower were defined as soft-electrons'. Soft-electrons can eradicate microorganisms residing on the surface of grains, pulses, spices, dehydrated vegetables, tea leaves and seeds, and reduce their microbial loads to levels lower than 10 CFU/g with little quality deterioration. Soft-electrons can inactivate insect pests infesting grains and pulses and inhibit sprouting of potatoes. (author)
Electron beam collimation with a photon MLC for standard electron treatments
Mueller, S.; Fix, M. K.; Henzen, D.; Frei, D.; Frauchiger, D.; Loessl, K.; Stampanoni, M. F. M.; Manser, P.
2018-01-01
Standard electron treatments are currently still performed using standard or molded patient-specific cut-outs placed in the electron applicator. Replacing cut-outs and electron applicators with a photon multileaf collimator (pMLC) for electron beam collimation would make standard electron treatments more efficient and would facilitate advanced treatment techniques like modulated electron radiotherapy (MERT) and mixed beam radiotherapy (MBRT). In this work, a multiple source Monte Carlo beam model for pMLC shaped electron beams commissioned at a source-to-surface distance (SSD) of 70 cm is extended for SSDs of up to 100 cm and validated for several Varian treatment units with field sizes typically used for standard electron treatments. Measurements and dose calculations agree generally within 3% of the maximal dose or 2 mm distance to agreement. To evaluate the dosimetric consequences of using pMLC collimated electron beams for standard electron treatments, pMLC-based and cut-out-based treatment plans are created for a left and a right breast boost, a sternum, a testis and a parotid gland case. The treatment plans consist of a single electron field, either alone (1E) or in combination with two 3D conformal tangential photon fields (1E2X). For each case, a pMLC plan with similar treatment plan quality in terms of dose homogeneity to the target and absolute mean dose values to the organs at risk (OARs) compared to a cut-out plan is found. The absolute mean dose to an OAR is slightly increased for pMLC-based compared to cut-out-based 1E plans if the OAR is located laterally close to the target with respect to beam direction, or if a 6 MeV electron beam is used at an extended SSD. In conclusion, treatment plans using cut-out collimation can be replaced by plans of similar treatment plan quality using pMLC collimation with accurately calculated dose distributions.
Technical report of electronics shop characteristics of high speed electronics component, (1)
International Nuclear Information System (INIS)
Watanabe, Shin-ichi; Shiino, Kazuo.
1975-01-01
We must develop electronics circuits for high speed signals. The electronics components of the circuits make use of the special components. This report treats a pulse response of the electronics components (i.e. coaxial cable, connector, resistor, capacitor, diode, transistor) for high speed electronics. The results of this report was already applied constructions of high speed electronics circuits and experimental equipments of the High Energy Physics Division. (auth.)
Fully printable, strain-engineered electronic wrap for customizable soft electronics.
Byun, Junghwan; Lee, Byeongmoon; Oh, Eunho; Kim, Hyunjong; Kim, Sangwoo; Lee, Seunghwan; Hong, Yongtaek
2017-03-24
Rapid growth of stretchable electronics stimulates broad uses in multidisciplinary fields as well as industrial applications. However, existing technologies are unsuitable for implementing versatile applications involving adaptable system design and functions in a cost/time-effective way because of vacuum-conditioned, lithographically-predefined processes. Here, we present a methodology for a fully printable, strain-engineered electronic wrap as a universal strategy which makes it more feasible to implement various stretchable electronic systems with customizable layouts and functions. The key aspects involve inkjet-printed rigid island (PRI)-based stretchable platform technology and corresponding printing-based automated electronic functionalization methodology, the combination of which provides fully printed, customized layouts of stretchable electronic systems with simplified process. Specifically, well-controlled contact line pinning effect of printed polymer solution enables the formation of PRIs with tunable thickness; and surface strain analysis on those PRIs leads to the optimized stability and device-to-island fill factor of strain-engineered electronic wraps. Moreover, core techniques of image-based automated pinpointing, surface-mountable device based electronic functionalizing, and one-step interconnection networking of PRIs enable customized circuit design and adaptable functionalities. To exhibit the universality of our approach, multiple types of practical applications ranging from self-computable digital logics to display and sensor system are demonstrated on skin in a customized form.
Fully printable, strain-engineered electronic wrap for customizable soft electronics
Byun, Junghwan; Lee, Byeongmoon; Oh, Eunho; Kim, Hyunjong; Kim, Sangwoo; Lee, Seunghwan; Hong, Yongtaek
2017-03-01
Rapid growth of stretchable electronics stimulates broad uses in multidisciplinary fields as well as industrial applications. However, existing technologies are unsuitable for implementing versatile applications involving adaptable system design and functions in a cost/time-effective way because of vacuum-conditioned, lithographically-predefined processes. Here, we present a methodology for a fully printable, strain-engineered electronic wrap as a universal strategy which makes it more feasible to implement various stretchable electronic systems with customizable layouts and functions. The key aspects involve inkjet-printed rigid island (PRI)-based stretchable platform technology and corresponding printing-based automated electronic functionalization methodology, the combination of which provides fully printed, customized layouts of stretchable electronic systems with simplified process. Specifically, well-controlled contact line pinning effect of printed polymer solution enables the formation of PRIs with tunable thickness; and surface strain analysis on those PRIs leads to the optimized stability and device-to-island fill factor of strain-engineered electronic wraps. Moreover, core techniques of image-based automated pinpointing, surface-mountable device based electronic functionalizing, and one-step interconnection networking of PRIs enable customized circuit design and adaptable functionalities. To exhibit the universality of our approach, multiple types of practical applications ranging from self-computable digital logics to display and sensor system are demonstrated on skin in a customized form.
DEFF Research Database (Denmark)
Flindt, Christian
2007-01-01
in the possibilities o®ered by the quantum mechanical behavior of electrons when it comes to informa- tion processing. This branch of research is also concerned with fundamental questions in physics. Besides an introduction to the above-mentioned subjects, the thesis con- tains a number of contributions to the ¯elds...... of coherent electron manip- ulation and the statistical description of electron transport through nano- devices. The physics of the electrons are described with a combination of numerical methods, developed and applied in the thesis, and more analytical approaches, which are also discussed. The thesis......-based communication. The statistical description of electron transport through nanostructures is based on rate equations, and the primary contribution of the thesis in that respect is the development of a method that allows for the calculation of the distribution of electrons passing through a device. The method...
Identification of electrons in the ZEUS hadron-electron separator with neural networks
International Nuclear Information System (INIS)
Carstens, J.O.
1994-10-01
An electron finder for the ZEUS experiment was constructed, which is specialized to electrons in the momentum range 0.5 to 3.0 GeV/c. For the first time this electron finder connects the informations of the calorimeter with those of the hadron-electron separator (HES). For this purpose the electron finder was equipped with a neural network. The electron finder reached on a data set of photoproduction events with conversion electrons an efficiency and discriminance of E=(62.9±2.2±0.6)% and D=(91.4±0.8±1.1)%. From these two quantities it can be calculated that the electron finder the ratio electrons to background increases by the factoe E/(1-D)=7.4 (Signal amplification). For the comparison: A neural net, to which only calorimeter informations have been made available, reached at the same efficiency a signal amplification of 2.4. A simple cut in the variable HES-signal reaches a signal amplification of 6.3. Hints were given, how training data sets with electrons and hadrons of higher energies can be obtained. With such data sets the working range of the electron finder can be without problems extended to higher momenta. As preparation for the construction of the electron finder an introduction to the foundations of the mathematics and the application of neural networks was given. By means of examples different methods for the convergence improvement have been tested. Numerous representations mediate illustrative imaginations on the mathematical process of the training of neural networks
Mega-electron-volt ultrafast electron diffraction at SLAC National Accelerator Laboratory
Energy Technology Data Exchange (ETDEWEB)
Weathersby, S. P.; Brown, G.; Chase, T. F.; Coffee, R.; Corbett, J.; Eichner, J. P.; Frisch, J. C.; Fry, A. R.; Gühr, M.; Hartmann, N.; Hast, C.; Hettel, R.; Jobe, R. K.; Jongewaard, E. N.; Lewandowski, J. R.; Li, R. K., E-mail: lrk@slac.stanford.edu; Lindenberg, A. M.; Makasyuk, I.; May, J. E.; McCormick, D. [SLAC National Accelerator Laboratory, 2575 Sand Hill Road, Menlo Park, California 94025 (United States); and others
2015-07-15
Ultrafast electron probes are powerful tools, complementary to x-ray free-electron lasers, used to study structural dynamics in material, chemical, and biological sciences. High brightness, relativistic electron beams with femtosecond pulse duration can resolve details of the dynamic processes on atomic time and length scales. SLAC National Accelerator Laboratory recently launched the Ultrafast Electron Diffraction (UED) and microscopy Initiative aiming at developing the next generation ultrafast electron scattering instruments. As the first stage of the Initiative, a mega-electron-volt (MeV) UED system has been constructed and commissioned to serve ultrafast science experiments and instrumentation development. The system operates at 120-Hz repetition rate with outstanding performance. In this paper, we report on the SLAC MeV UED system and its performance, including the reciprocal space resolution, temporal resolution, and machine stability.
Secondary electron emission anisotropy in oblique incidence of electrons on the (100) Mo
International Nuclear Information System (INIS)
Gomoyunova, M.V.; Zaslavskij, S.L.; Pronin, I.I.
1978-01-01
Studied was the influence of azimuthal plane of incidence of primary particles with energies of 0.5-1.5 keV on the secondary electron emission of the (100) Mo face at the constant polar angle of 45 deg. The measurements were carried out in vacuum of (2-4)x10 -10 torr by modulation technique. It is shown that anisotropy is peculiar to the secondary electron emission of all energies. The anisotropy of emission has two maxima; the high-energy maximum connected with reflected primary electrons and situated near the elastically reflected electrons and weaker pronounced the low-energy one which is found at energies of 100-200 eV and is conditioned by truly secondary electrons. It is shown that the anisotropy, characterizing secondary electrons responsible for the appearance of structure in spectrum, particularly the Auger electrons and the electrons suffering ionizing energy losses, exceeds the anisotropy of continuous spectrum electrons possessing the same energy. The electron diffraction dynamic theory, based on the conception of the united wave field of electrons, has been used to explain the regularities stated
Energy Technology Data Exchange (ETDEWEB)
Levy, Mel, E-mail: ayers@mcmaster.ca, E-mail: mlevy@tulane.edu [Department of Chemistry, Duke University, Durham, North Carolina 27708 (United States); Department of Physics, North Carolina A and T State University, Greensboro, North Carolina 27411 (United States); Department of Chemistry, Tulane University, New Orleans, Louisiana 70118 (United States); Anderson, James S. M.; Zadeh, Farnaz Heidar; Ayers, Paul W., E-mail: ayers@mcmaster.ca, E-mail: mlevy@tulane.edu [Department of Chemistry and Chemical Biology, McMaster University, Hamilton, Ontario (Canada)
2014-05-14
Properties of exact density functionals provide useful constraints for the development of new approximate functionals. This paper focuses on convex sums of ground-level densities. It is observed that the electronic kinetic energy of a convex sum of degenerate ground-level densities is equal to the convex sum of the kinetic energies of the individual degenerate densities. (The same type of relationship holds also for the electron-electron repulsion energy.) This extends a known property of the Levy-Valone Ensemble Constrained-Search and the Lieb Legendre-Transform refomulations of the Hohenberg-Kohn functional to the individual components of the functional. Moreover, we observe that the kinetic and electron-repulsion results also apply to densities with fractional electron number (even if there are no degeneracies), and we close with an analogous point-wise property involving the external potential. Examples where different degenerate states have different kinetic energy and electron-nuclear attraction energy are given; consequently, individual components of the ground state electronic energy can change abruptly when the molecular geometry changes. These discontinuities are predicted to be ubiquitous at conical intersections, complicating the development of universally applicable density-functional approximations.
Embracing Electronic Publishing.
Wills, Gordon
1996-01-01
Electronic publishing is the grandest revolution in the capture and dissemination of academic and professional knowledge since Caxton developed the printing press. This article examines electronic publishing, describes different electronic publishing scenarios (authors' cooperative, consolidator/retailer/agent oligopsony, publisher oligopoly), and…
Peptide π-Electron Conjugates: Organic Electronics for Biology?
Ardoña, Herdeline Ann M; Tovar, John D
2015-12-16
Highly ordered arrays of π-conjugated molecules are often viewed as a prerequisite for effective charge-transporting materials. Studies involving these materials have traditionally focused on organic electronic devices, with more recent emphasis on biological systems. In order to facilitate the transition to biological environments, biomolecules that can promote hierarchical ordering and water solubility are often covalently appended to the π-electron unit. This review highlights recent work on π-conjugated systems bound to peptide moieties that exhibit self-assembly and aims to provide an overview on the development and emerging applications of peptide-based supramolecular π-electron systems.
Modified Sternglass theory for the emission of secondary electrons by fast-electron impact
International Nuclear Information System (INIS)
Suszcynsky, D.M.; Borovsky, J.E.
1992-01-01
The Sternglass theory [Sternglass, Phys. Rev. 108, 1 (1957)] for fast-ion-induced secondary-electron emission from metals has been modified to predict the secondary-electron yield from metals impacted by energetic (several keV to about 200 keV) electrons. The primary modification of the theory accounts for the contribution of the backscattered electrons to the production of secondary electrons based on a knowledge of the backscattered-electron energy distribution. The modified theory is in reasonable agreement with recent experimental data from gold targets in the 6--30-keV electron energy range
Calculation of the electron trajectory for 200 kV self-shielded electron accelerator
International Nuclear Information System (INIS)
Wang Shuiqing
2000-01-01
In order to calculate the electron trajectory of 200 kV self-shielded electron accelerator, the electric field is calculated with a TRAJ program. In this program, following electron track mash points one by one, the electron beam trajectories are calculated. Knowing the effect of grid voltage on electron optics and gaining grid voltage focusing effect in the various energy grades, the authors have gained scientific basis for adjusting grid voltage, and also accumulated a wealth of experience for designing self-shielded electron accelerator or electron curtain in future
Electronic inventions and discoveries electronics from its earliest beginnings to the present day
Dummer, G W A
1983-01-01
Electronic Inventions and Discoveries: Electronics from Its Earliest Beginnings to the Present Day provides a summary of the development of the whole field of electronics. Organized into 13 chapters, the book covers and reviews the history of electronics as a whole and its aspects. The opening chapter covers the beginnings of electronics, while the next chapter discusses the development of components, transistors, and integrated circuits. The third chapter tackles the expansion of electronics and its effects on industry. The succeeding chapters discuss the history of the aspects of electronics
Priebe, Katharina E.; Rathje, Christopher; Yalunin, Sergey V.; Hohage, Thorsten; Feist, Armin; Schäfer, Sascha; Ropers, Claus
2017-12-01
Ultrafast electron and X-ray imaging and spectroscopy are the basis for an ongoing revolution in the understanding of dynamical atomic-scale processes in matter. The underlying technology relies heavily on laser science for the generation and characterization of ever shorter pulses. Recent findings suggest that ultrafast electron microscopy with attosecond-structured wavefunctions may be feasible. However, such future technologies call for means to both prepare and fully analyse the corresponding free-electron quantum states. Here, we introduce a framework for the preparation, coherent manipulation and characterization of free-electron quantum states, experimentally demonstrating attosecond electron pulse trains. Phase-locked optical fields coherently control the electron wavefunction along the beam direction. We establish a new variant of quantum state tomography—`SQUIRRELS'—for free-electron ensembles. The ability to tailor and quantitatively map electron quantum states will promote the nanoscale study of electron-matter entanglement and new forms of ultrafast electron microscopy down to the attosecond regime.
Morris, John
2013-01-01
An essential companion to John C Morris's 'Analogue Electronics', this clear and accessible text is designed for electronics students, teachers and enthusiasts who already have a basic understanding of electronics, and who wish to develop their knowledge of digital techniques and applications. Employing a discovery-based approach, the author covers fundamental theory before going on to develop an appreciation of logic networks, integrated circuit applications and analogue-digital conversion. A section on digital fault finding and useful ic data sheets completes th
The magnetized electron-acoustic instability driven by a warm, field-aligned electron beam
International Nuclear Information System (INIS)
Sooklal, A.; Mace, R.L.
2004-01-01
The electron-acoustic instability in a magnetized plasma having three electron components, one of which is a field-aligned beam of intermediate temperature, is investigated. When the plasma frequency of the cool electrons exceeds the electron gyrofrequency, the electron-acoustic instability 'bifurcates' at sufficiently large propagation angles with respect to the magnetic field to yield an obliquely propagating, low-frequency electron-acoustic instability and a higher frequency cyclotron-sound instability. Each of these instabilities retains certain wave features of its progenitor, the quasiparallel electron-acoustic instability, but displays also new magnetic qualities through its dependence on the electron gyrofrequency. The obliquely propagating electron-acoustic instability requires a lower threshold beam speed for its excitation than does the cyclotron-sound instability, and for low to intermediate beam speeds has the higher maximum growth rate. When the plasma is sufficiently strongly magnetized that the plasma frequency of the cool electrons is less than the electron gyrofrequency, the only instability in the electron-acoustic frequency range is the strongly magnetized electron-acoustic instability. Its growth rate and real frequency exhibit a monotonic decrease with wave propagation angle and it grows at small to intermediate wave numbers where its parallel phase speed is approximately constant. The relevance of the results to the interpretation of cusp auroral hiss and auroral broadband electrostatic noise is briefly discussed
Starting electronics all you need to get a grounding in practical electronics
Brindley, Keith
2013-01-01
Starting Electronics is a nine-chapter introductory text to electronics based on feature articles previously published as magazine articles. The opening chapter provides an overview of the fundamentals of electronics. The succeeding chapters present details of some easy-to-do experiments and the current and voltage measurement. The remaining chapters cover some basic components of electronics, including capacitor, integrated circuit, oscillator, filter, diodes, and transistors. This book will prove useful to electronic constructors and students.
International Nuclear Information System (INIS)
Ruggiero, Steven T.
2005-01-01
Financial support for this project has led to advances in the science of single-electron phenomena. Our group reported the first observation of the so-called ''Coulomb Staircase'', which was produced by tunneling into ultra-small metal particles. This work showed well-defined tunneling voltage steps of width e/C and height e/RC, demonstrating tunneling quantized on the single-electron level. This work was published in a now well-cited Physical Review Letter. Single-electron physics is now a major sub-field of condensed-matter physics, and fundamental work in the area continues to be conducted by tunneling in ultra-small metal particles. In addition, there are now single-electron transistors that add a controlling gate to modulate the charge on ultra-small photolithographically defined capacitive elements. Single-electron transistors are now at the heart of at least one experimental quantum-computer element, and single-electron transistor pumps may soon be used to define fundamental quantities such as the farad (capacitance) and the ampere (current). Novel computer technology based on single-electron quantum dots is also being developed. In related work, our group played the leading role in the explanation of experimental results observed during the initial phases of tunneling experiments with the high-temperature superconductors. When so-called ''multiple-gap'' tunneling was reported, the phenomenon was correctly identified by our group as single-electron tunneling in small grains in the material. The main focus throughout this project has been to explore single electron phenomena both in traditional tunneling formats of the type metal/insulator/particles/insulator/metal and using scanning tunneling microscopy to probe few-particle systems. This has been done under varying conditions of temperature, applied magnetic field, and with different materials systems. These have included metals, semi-metals, and superconductors. Amongst a number of results, we have
International Nuclear Information System (INIS)
Nese, C.; Yuan, Z.; Schuchmann, M.N.; Sonntag, C. von
1992-01-01
Electron transfer to 5-bromouracil (5-BrU) from nucleobase (N) electron adducts (and their protonated forms) has been studied by product analysis and pulse radiolysis. When an electron is transferred to 5-BrU, the ensuing 5-BrU radical anion rapidly loses a bromide ion; the uracilyl radical thus formed reacts with added t-butanol, yielding uracil. From the uracil yields measured as the function of [N]/[5-BrU] after γ-radiolysis of Ar-saturated solutions it is concluded that thymine and adenine electron adducts and their heteroatom-protonated forms transfer electrons quantitatively to 5-BrU. The data raise the question whether in DNA the guanine moiety may act as the ultimate sink of the electron in competition with other processes such as protonation at C(6) of the thymine electron adduct. (Author)
Extreme environment electronics
Cressler, John D
2012-01-01
Unfriendly to conventional electronic devices, circuits, and systems, extreme environments represent a serious challenge to designers and mission architects. The first truly comprehensive guide to this specialized field, Extreme Environment Electronics explains the essential aspects of designing and using devices, circuits, and electronic systems intended to operate in extreme environments, including across wide temperature ranges and in radiation-intense scenarios such as space. The Definitive Guide to Extreme Environment Electronics Featuring contributions by some of the world's foremost exp
Electron-vibrational transitions under molecular ions collisions with slow electrons
International Nuclear Information System (INIS)
Andreev, E.A.
1993-01-01
A concept of a multichannel quantum defect is considered and basic theoretic ratios of inelastic collisional processes with the participation of molecular positive ions and slow electrons playing an important role both in atmospheric and laboratory plasma, are presented. The problem of scattering channel number limitation with the provision of S-matrix unique character is considered. Different models of electron rotation-vibrational connection under collision of two-atom molecular ions with slow electrons are analysed. Taking N 2 + as an example, a high efficiency of transitions between different electron states of a molecular ion is shown. 73 refs., 9 figs., 1 tab
Electron: Cluster interactions
International Nuclear Information System (INIS)
Scheidemann, A.A.; Knight, W.D.
1994-02-01
Beam depletion spectroscopy has been used to measure absolute total inelastic electron-sodium cluster collision cross sections in the energy range from E ∼ 0.1 to E ∼ 6 eV. The investigation focused on the closed shell clusters Na 8 , Na 20 , Na 40 . The measured cross sections show an increase for the lowest collision energies where electron attachment is the primary scattering channel. The electron attachment cross section can be understood in terms of Langevin scattering, connecting this measurement with the polarizability of the cluster. For energies above the dissociation energy the measured electron-cluster cross section is energy independent, thus defining an electron-cluster interaction range. This interaction range increases with the cluster size
Role of electron-electron scattering on spin transport in single layer graphene
Directory of Open Access Journals (Sweden)
Bahniman Ghosh
2014-01-01
Full Text Available In this work, the effect of electron-electron scattering on spin transport in single layer graphene is studied using semi-classical Monte Carlo simulation. The D’yakonov-P’erel mechanism is considered for spin relaxation. It is found that electron-electron scattering causes spin relaxation length to decrease by 35% at 300 K. The reason for this decrease in spin relaxation length is that the ensemble spin is modified upon an e-e collision and also e-e scattering rate is greater than phonon scattering rate at room temperature, which causes change in spin relaxation profile due to electron-electron scattering.
African Journals Online (AJOL)
10332324
"[to] promote the understanding and, acceptance of and growth in the number of electronic transactions .... Chapter III of the ECT Act is based on the UNCITRAL Model Law on Electronic. Commerce ... Communications Technology Law 146. 22.
Brindley, Keith
2005-01-01
Starting Electronics is unrivalled as a highly practical introduction for hobbyists, students and technicians. Keith Brindley introduces readers to the functions of the main component types, their uses, and the basic principles of building and designing electronic circuits. Breadboard layouts make this very much a ready-to-run book for the experimenter; and the use of multimeter, but not oscilloscopes, puts this practical exploration of electronics within reach of every home enthusiast's pocket. The third edition has kept the simplicity and clarity of the original. New material
Someya, Takao
2012-01-01
With its comprehensive coverage this handbook and ready reference brings together some of the most outstanding scientists in the field to lay down the undisputed knowledge on how to make electronics stretchable.As such, it focuses on gathering and evaluating the materials, designs, models and technologies that enable the fabrication of fully elastic electronic devices which can sustain high strain. Furthermore, it provides a review of those specific applications that directly benefit from highly compliant electronics, including transistors, photonic devices and sensors. In addition to stre
Energy Technology Data Exchange (ETDEWEB)
Litvinenko,V.
2009-05-04
Cooling intense high-energy hadron beams remains a major challenge in modern accelerator physics. Synchrotron radiation is still too feeble, while the efficiency of two other cooling methods, stochastic and electron, falls rapidly either at high bunch intensities (i.e. stochastic of protons) or at high energies (e-cooling). In this talk a specific scheme of a unique cooling technique, Coherent Electron Cooling, will be discussed. The idea of coherent electron cooling using electron beam instabilities was suggested by Derbenev in the early 1980s, but the scheme presented in this talk, with cooling times under an hour for 7 TeV protons in the LHC, would be possible only with present-day accelerator technology. This talk will discuss the principles and the main limitations of the Coherent Electron Cooling process. The talk will describe the main system components, based on a high-gain free electron laser driven by an energy recovery linac, and will present some numerical examples for ions and protons in RHIC and the LHC and for electron-hadron options for these colliders. BNL plans a demonstration of the idea in the near future.
Parr, E A
1981-01-01
Electronics Pocket Book, Fourth Edition is a nonmathematical presentation of the many varied topics covered by electronics. The book tackles electron physics, electronic components (i.e. resistors, capacitors, and conductors), integrated circuits, and the principles of a.c. and d.c. amplifiers. The text also discusses oscillators, digital circuits, digital computers, and optoelectronics (i.e., sensors, emitters, and devices that utilize light). Communications (such as line and radio communications, transmitters, receivers, and digital techniques); the principles and examples of servosystems; a
Hussain, Muhammad Mustafa; Torres Sevilla, Galo Andres; Diaz Cordero, Marlon Steven
2017-01-01
Electronic stickers may be manufactured on flexible substrates (110, 120, 130) as layers and packaged together. The package may then have an adhesive applied to one side to provide capability for sticking the electronic devices to surfaces
Electronics for LHC Experiments
Energy Technology Data Exchange (ETDEWEB)
NONE
2004-07-01
This document gathers the abstracts of most presentations made at this workshop on electronics for the large hadron collider (LHC) experiments. The presentations were arranged into 6 sessions: 1) electronics for tracker, 2) trigger electronics, 3) detector control systems, 4) data acquisition, 5) electronics for calorimeters and electronics for muons, and 6) links, power systems, grounding and shielding, testing and quality assurance.
Electronics for LHC Experiments
International Nuclear Information System (INIS)
2004-01-01
This document gathers the abstracts of most presentations made at this workshop on electronics for the large hadron collider (LHC) experiments. The presentations were arranged into 6 sessions: 1) electronics for tracker, 2) trigger electronics, 3) detector control systems, 4) data acquisition, 5) electronics for calorimeters and electronics for muons, and 6) links, power systems, grounding and shielding, testing and quality assurance
Electron Bernstein wave electron temperature profile diagnostic (invited)
International Nuclear Information System (INIS)
Taylor, G.; Efthimion, P.; Jones, B.; Munsat, T.; Spaleta, J.; Hosea, J.; Kaita, R.; Majeski, R.; Menard, J.
2001-01-01
Electron cyclotron emission (ECE) has been employed as a standard electron temperature profile diagnostic on many tokamaks and stellarators, but most magnetically confined plasma devices cannot take advantage of standard ECE diagnostics to measure temperature. They are either ''overdense,'' operating at high density relative to the magnetic field (e.g., ω pe >>Omega ce in a spherical torus) or they have insufficient density and temperature to reach the blackbody condition (τ>2). Electron Bernstein waves (EBWs) are electrostatic waves that can propagate in overdense plasmas and have a high optical thickness at the electron cyclotron resonance layers as a result of their large k perp . In this article we report on measurements of EBW emission on the CDX-U spherical torus, where B 0 ∼2kG, e >∼10 13 cm -3 and T e ∼10--200eV. Results are presented for electromagnetic measurements of EBW emission, mode converted near the plasma edge. The EBW emission was absolutely calibrated and compared to the electron temperature profile measured by a multipoint Thomson scattering diagnostic. Depending on the plasma conditions, the mode-converted EBW radiation temperature was found to be ≤T e and the emission source was determined to be radially localized at the electron cyclotron resonance layer. A Langmuir triple probe and a 140 GHz interferometer were employed to measure changes in the edge density profile in the vicinity of the upper hybrid resonance where the mode conversion of the EBWs is expected to occur. Initial results suggest EBW emission and EBW heating are viable concepts for plasmas where ω pe >>Omega ce
International Nuclear Information System (INIS)
Martinez-Sanchez, M.; Cheng, Wai; Dvore, D.; Zahniser, M.S.
1992-01-01
A model was developed to calculate the electron energy spectrum created by an electron beam in the upper atmosphere. A significant feature of the model is the inclusion of the effects of electron-electron collisions which are important at high beam intensity when the ratio of the electron to ambient gas density is high. Comparing the calculated results for a 2.6-kV, 20-A beam at 110-km altitude from models with and without the electron-electron collision term, the electron-electron collisions have the effect of smoothing out the electron spectrum in the low-energy region ( 2 and O 2 are filled in, resulting in an increase in the calculated production rate of these species compared with model calculations that neglect this effect
Interaction of electrons with light metal hydrides in the transmission electron microscope.
Wang, Yongming; Wakasugi, Takenobu; Isobe, Shigehito; Hashimoto, Naoyuki; Ohnuki, Somei
2014-12-01
Transmission electron microscope (TEM) observation of light metal hydrides is complicated by the instability of these materials under electron irradiation. In this study, the electron kinetic energy dependences of the interactions of incident electrons with lithium, sodium and magnesium hydrides, as well as the constituting element effect on the interactions, were theoretically discussed, and electron irradiation damage to these hydrides was examined using in situ TEM. The results indicate that high incident electron kinetic energy helps alleviate the irradiation damage resulting from inelastic or elastic scattering of the incident electrons in the TEM. Therefore, observations and characterizations of these materials would benefit from increased, instead decreased, TEM operating voltage. © The Author 2014. Published by Oxford University Press on behalf of The Japanese Society of Microscopy. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Sustainable Management of Electronics
To provide information on EPAs strategy for electronics stewardship, certified electronics recyclers and the Challenge; as well as where to donate unwanted electronics, how to calculate benefits, and what's going on with electronics mgmt in their states.
Energy Technology Data Exchange (ETDEWEB)
Singh, S. V., E-mail: satyavir@iigs.iigm.res.in; Lakhina, G. S., E-mail: lakhina@iigs.iigm.res.in [Indian Institute of Geomagnetism, New Panvel (W), Navi Mumbai (India); University of the Western Cape, Belville (South Africa); Devanandhan, S., E-mail: devanandhan@gmail.com [Indian Institute of Geomagnetism, New Panvel (W), Navi Mumbai (India); Bharuthram, R., E-mail: rbharuthram@uwc.ac.za [University of the Western Cape, Belville (South Africa)
2016-08-15
A theoretical investigation is carried out to study the obliquely propagating electron acoustic solitary waves having nonthermal hot electrons, cold and beam electrons, and ions in a magnetized plasma. We have employed reductive perturbation theory to derive the Korteweg-de-Vries-Zakharov-Kuznetsov (KdV-ZK) equation describing the nonlinear evolution of these waves. The two-dimensional plane wave solution of KdV-ZK equation is analyzed to study the effects of nonthermal and beam electrons on the characteristics of the solitons. Theoretical results predict negative potential solitary structures. We emphasize that the inclusion of finite temperature effects reduces the soliton amplitudes and the width of the solitons increases by an increase in the obliquity of the wave propagation. The numerical analysis is presented for the parameters corresponding to the observations of “burst a” event by Viking satellite on the auroral field lines.
International Nuclear Information System (INIS)
Zouros, T.J.M.; Lee, D.H.; Sanders, J.M.; Richard, P.
1993-01-01
The effect of electron-electron interactions between projectile and target electrons observed in recent measurements of projectile K-shell excitation and ionization using 0 projectile Auger electron spectroscopy are analysed within the framework of the impulse approximation (IA). The IA formulation is seen to give a good account of the threshold behavior of both ionization and excitation, while providing a remarkably simple intuitive picture of such electron-electron interactions in ion-atom collisions in general. Thus, the applicability of the IA treatment is extended to cover most known processes involving such interactions including resonance transfer excitation, binary encounter electron production, electron-electron excitation and ionization. (orig.)
Wade, Jessica; Hollis, Joseph Razzell; Wood, Sebastian
2018-04-01
The combination of printing technology with manufacturing electronic devices enables a new paradigm of printable electronics, where 'smart' functionality can be readily incorporated into almost any product at low cost. Over recent decades, rapid progress has been made in this field, which is now emerging into the industrial andcommercial realm. However, successful development and commercialisation on a large scale presents some significant technical challenges. For fully-printable electronic systems, all the component parts must be deposited from solutions (inks), requiring the development of new inorganic, organic and hybrid materials.A variety of traditional printing techniques are being explored and adapted forprinting these new materials in ways that result in the best performing electronicdevices. Whilst printed electronics research has initially focused on traditional typesof electronic device such as light-emitting diodes, transistors, and photovoltaics, it is increasingly apparent that a much wider range of applications can be realised. The soft and stretchable nature of printable materials makes them perfect candidates forbioelectronics, resulting in a wealth of research looking at biocompatible printable inks and biosensors. Regardless of application, the properties of printed electronicmaterials depend on the chemical structures, processing conditions, device architecture,and operational conditions, the complex inter-relationships of which aredriving ongoing research. We focus on three particular 'hot topics', where attention is currently focused: novel materials, characterisation techniques, and device stability. With progress advancing very rapidly, printed electronics is expected to grow over the next decade into a key technology with an enormous economic and social impact.
Engineered phages for electronics.
Cui, Yue
2016-11-15
Phages are traditionally widely studied in biology and chemistry. In recent years, engineered phages have attracted significant attentions for functionalization or construction of electronic devices, due to their specific binding, catalytic, nucleating or electronic properties. To apply the engineered phages in electronics, these are a number of interesting questions: how to engineer phages for electronics? How are the engineered phages characterized? How to assemble materials with engineered phages? How are the engineered phages micro or nanopatterned? What are the strategies to construct electronics devices with engineered phages? This review will highlight the early attempts to address these questions and explore the fundamental and practical aspects of engineered phages in electronics, including the approaches for selection or expression of specific peptides on phage coat proteins, characterization of engineered phages in electronics, assembly of electronic materials, patterning of engineered phages, and construction of electronic devices. It provides the methodologies and opens up ex-cit-ing op-por-tu-ni-ties for the development of a variety of new electronic materials and devices based on engineered phages for future applications. Copyright © 2016 Elsevier B.V. All rights reserved.
Electron-electron interactions in graphene field-induced quantum dots in a high magnetic field
DEFF Research Database (Denmark)
Orlof, A.; Shylau, Artsem; Zozoulenko, I. V.
2015-01-01
We study the effect of electron-electron interaction in graphene quantum dots defined by an external electrostatic potential and a high magnetic field. To account for the electron-electron interaction, we use the Thomas-Fermi approximation and find that electron screening causes the formation...... of compressible strips in the potential profile and the electron density. We numerically solve the Dirac equations describing the electron dynamics in quantum dots, and we demonstrate that compressible strips lead to the appearance of plateaus in the electron energies as a function of the magnetic field. Finally...
Tunable Electron-Electron Interactions in LaAlO_{3}/SrTiO_{3} Nanostructures
Directory of Open Access Journals (Sweden)
Guanglei Cheng
2016-12-01
Full Text Available The interface between the two complex oxides LaAlO_{3} and SrTiO_{3} has remarkable properties that can be locally reconfigured between conducting and insulating states using a conductive atomic force microscope. Prior investigations of “sketched” quantum dot devices revealed a phase in which electrons form pairs, implying a strongly attractive electron-electron interaction. Here, we show that these devices with strong electron-electron interactions can exhibit a gate-tunable transition from a pair-tunneling regime to a single-electron (Andreev bound state tunneling regime where the interactions become repulsive. The electron-electron interaction sign change is associated with a Lifshitz transition where the d_{xz} and d_{yz} bands start to become occupied. This electronically tunable electron-electron interaction, combined with the nanoscale reconfigurability of this system, provides an interesting starting point towards solid-state quantum simulation.
Geoghegan, Mark
2013-01-01
Polymer electronics is the science behind many important new developments in technology, such as the flexible electronic display (e-ink) and many new developments in transistor technology. Solar cells, light-emitting diodes, and transistors are all areas where plastic electronics is likely to, or is already having, a serious impact on our daily lives. With polymer transistors and light-emitting diodes now being commercialised, there is a clear need for a pedagogic text thatdiscusses the subject in a clear and concise fashion suitable for senior undergraduate and graduate students. The content
Grivet, Pierre; Bertein, F; Castaing, R; Gauzit, M; Septier, Albert L
1972-01-01
Electron Optics, Second English Edition, Part I: Optics is a 10-chapter book that begins by elucidating the fundamental features and basic techniques of electron optics, as well as the distribution of potential and field in electrostatic lenses. This book then explains the field distribution in magnetic lenses; the optical properties of electrostatic and magnetic lenses; and the similarities and differences between glass optics and electron optics. Subsequent chapters focus on lens defects; some electrostatic lenses and triode guns; and magnetic lens models. The strong focusing lenses and pris
Development of a secondary electron energy analyzer for a transmission electron microscope.
Magara, Hideyuki; Tomita, Takeshi; Kondo, Yukihito; Sato, Takafumi; Akase, Zentaro; Shindo, Daisuke
2018-04-01
A secondary electron (SE) energy analyzer was developed for a transmission electron microscope. The analyzer comprises a microchannel plate (MCP) for detecting electrons, a coil for collecting SEs emitted from the specimen, a tube for reducing the number of backscattered electrons incident on the MCP, and a retarding mesh for selecting the energy of SEs incident on the MCP. The detection of the SEs associated with charging phenomena around a charged specimen was attempted by performing electron holography and SE spectroscopy using the energy analyzer. The results suggest that it is possible to obtain the energy spectra of SEs using the analyzer and the charging states of a specimen by electron holography simultaneously.
International Nuclear Information System (INIS)
Schwartz, M.M.
1974-01-01
Electron-beam equipment is considered along with fixed and mobile electron-beam guns, questions of weld environment, medium and nonvacuum welding, weld-joint designs, tooling, the economics of electron-beam job shops, aspects of safety, quality assurance, and repair. The application of the process in the case of individual materials is discussed, giving attention to aluminum, beryllium, copper, niobium, magnesium, molybdenum, tantalum, titanium, metal alloys, superalloys, and various types of steel. Mechanical-property test results are examined along with the areas of application of electron-beam welding
Electronic signal conditioning
NEWBY, BRUCE
1994-01-01
At technician level, brief references to signal conditioning crop up in a fragmented way in various textbooks, but there has been no single textbook, until now!More advanced texts do exist but they are more mathematical and presuppose a higher level of understanding of electronics and statistics. Electronic Signal Conditioning is designed for HNC/D students and City & Guilds Electronics Servicing 2240 Parts 2 & 3. It will also be useful for BTEC National, Advanced GNVQ, A-level electronics and introductory courses at degree level.
Vibrational and electronic excitation of hexatriacontane thin films by low energy electron impact
International Nuclear Information System (INIS)
Vilar, M.R.; Schott, M.; Pfluger, P.
1990-01-01
Thin polycrystalline films of hexatriacontane (HTC) were irradiated with low energy (E=0.5--15 eV) electrons, and off-specular backscattered electron spectra were measured. Below E∼7 eV, single and multiple vibrational excitations only are observed, which relax the electrons down to the bottom of the HTC conduction band. Due to the negative electron affinity of HTC, thermal electrons are emitted into vacuum. Structure in the backscattered electron current at kinetic energies about 1.5 and 4 eV are associated to conduction band density of states. Above E∼7 eV, the dominant losses correspond to electronic excitations, excitons, or above a threshold (energy of the electron inside the HTC film) at 9.2±0.1 eV, electron--hole pair generation. The latter process is very efficient and reaches a yield of the order of one ∼11 eV. Evidence for chemical reaction above E∼4 eV is observed
International Nuclear Information System (INIS)
Banerjee, Srutarshi; Bhattacharjee, Dhruva; Waghmare, Abhay; Tiwari, Rajnish; Bakhtsingh, R.I.; Dasgupta, K.; Gupta, Sachin; Prakash, Baibhaw; Jha, M.N.
2015-01-01
The paper deals with the characterization of the 100 kW electron beam melting gun for its adaptation in high power DC Electron Accelerators. The indigenously designed electron beam melting system at BARC is chosen for characterization. It comprises of electron gun as source of electrons, two electromagnetic focusing lenses viz. upper focusing lens and lower focusing lens for beam focusing, intermediate beam aperture for vacuum decoupling between gun region and melt zone, deflection and oscillation lens for maneuvering the beam on the melt charge and water cooled crucible that acts as a beam dump. In this system, the electron gun is designed for 40 kV and 100 kW corresponding to a maximum beam current of 2.5 A. The electron gun uses directly heated spiral tungsten filament. The operating temperature of the filament is 2800 °K. The focusing electrode and the anode profile are designed based on Pierce geometry. High Power DC Electron Accelerators require high currents of 1 A. The beam must comply with the requirement of 40 mm beam diameter and 10 mrad divergence at the exit of the electron gun. The characterization of the existing electron gun was done to find out all the beam parameters, for e.g. beam size, beam divergence, perveance etc. to be adapted or to be modified for the design of electron gun for high power DC accelerators. This paper shows limitations and the possible solutions for design of high power DC accelerators. (author)
Organic High Electron Mobility Transistors Realized by 2D Electron Gas.
Zhang, Panlong; Wang, Haibo; Yan, Donghang
2017-09-01
A key breakthrough in inorganic modern electronics is the energy-band engineering that plays important role to improve device performance or develop novel functional devices. A typical application is high electron mobility transistors (HEMTs), which utilizes 2D electron gas (2DEG) as transport channel and exhibits very high electron mobility over traditional field-effect transistors (FETs). Recently, organic electronics have made very rapid progress and the band transport model is demonstrated to be more suitable for explaining carrier behavior in high-mobility crystalline organic materials. Therefore, there emerges a chance for applying energy-band engineering in organic semiconductors to tailor their optoelectronic properties. Here, the idea of energy-band engineering is introduced and a novel device configuration is constructed, i.e., using quantum well structures as active layers in organic FETs, to realize organic 2DEG. Under the control of gate voltage, electron carriers are accumulated and confined at quantized energy levels, and show efficient 2D transport. The electron mobility is up to 10 cm 2 V -1 s -1 , and the operation mechanisms of organic HEMTs are also argued. Our results demonstrate the validity of tailoring optoelectronic properties of organic semiconductors by energy-band engineering, offering a promising way for the step forward of organic electronics. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Downshift of electron plasma oscillations in the electron foreshock region
International Nuclear Information System (INIS)
Fuselier, S.A.
1984-01-01
Electron plasma oscillations in the Earth's electron foreshock region are observed to shift above and below the local electron plasma frequency. As plasma oscillations shift from the plasma frequency, their bandwidth increases and their wavelength decreases. Observations of plasma oscillations well below the plasma frequency are correlated with times when ISEE-I is far downstream of the electron foreshock boundary. Although wavelengths of plasma oscillations below the plasma frequency satisfy klambda/sub De/ approx. = 1, the Doppler shift due to the motion of the solar wind is not sufficient to produce the observed frequency shifts. A beam-plasma interaction with beam velocities on the order of the electron thermal velocity is suggested as an explanation for plasma oscillations above and below the plasma frequency. Frequency, bandwidth, and wavelength changes predicted from the beam-plasma interaction are in good agreement with the observed characteristics of plasma oscillations in the foreshock region
Berkman, P.A.; Garton, D.W.; Haltuch, M.A.; Kennedy, G.W.; Febo, L.R.
2000-01-01
Unexpected habitat innovations among invading species are illustrated by the expansion of dreissenid mussels across sedimentary environments in shallow water unlike the hard substrates where they are conventionally known. In this note, records of population characteristics of invading zebra (Dreissena polymorpha) and quagga (Dreissena bugensis) mussels from 1994 through 1998 are reported from shallow (less than 20 m) sedimentary habitats in western Lake Erie. Haphazard SCUBA collections of these invading species indicated that combined densities of zebra and quagga mussels ranged from 0 to 32,500 individuals per square meter between 1994 and 1998, with D. polymorpha comprising 75-100% of the assemblages. These mixed mussel populations, which were attached by byssal threads to each other and underlying sand-grain sediments, had size-frequency distributions that were typical of colonizing populations on hard substrates. Moreover, the presence of two mussel cohorts within the 1994 samples indicated that these species began expanding onto soft substrates not later than 1992, within 4 years of their initial invasion in western Lake Erie. Such historical data provide baselines for interpreting adaptive innovations, ecological interactions and habitat shifts among the two invading dreissenid mussel species in North America.
Cluster formation in liverwort-associated methylobacteria and its implications
Kutschera, U.; Thomas, J.; Hornschuh, M.
2007-08-01
Pink-pigmented methylotropic bacteria of the genus Methylobacterium inhabit the surfaces of plant organs. In bryophytes, these methylobacteria enhance cell growth, but the nature of this plant-microbe interaction is largely unknown. In this study, methylobacteria were isolated from the upper surface of the free-living thalli of the liverwort Marchantia polymorpha L. Identification of one strain by 16S ribosomal RNA (rRNA) gene-targeted polymerase chain reaction (PCR) and other data show that these microbes represent an undescribed species of the genus Methylobacterium ( Methylobacterium sp.). The growth-promoting activity of these wild-type methylobacteria was tested and compared with that of the type strain Methylobacterium mesophilicum. Both types of methylobacteria stimulated surface expansion of isolated gemmae from Marchantia polymorpha by about 350%. When suspended in water, the liverwort-associated bacteria ( Methylobacterium sp.) formed dense clusters of up to 600 cells. In liquid cultures of Methylobacterium mesophilicum, single cells were observed, but no clustering occurred. We suggest that the liverwort-associated methylobacteria are co-evolved symbionts of the plants: Cluster formation may be a behavior that enhances the survival of the epiphytic microbes during periods of drought of these desiccation-tolerant lower plants.
MIS hot electron devices for enhancement of surface reactivity by hot electrons
DEFF Research Database (Denmark)
Thomsen, Lasse Bjørchmar
A Metal-Insulator-Semiconductor (MIS) based device is developed for investigation of hot electron enhanced chemistry. A model of the device is presented explaining the key concepts of the functionality and the character- istics. The MIS hot electron emitter is fabricated using cleanroom technology...... and the process sequence is described. An Ultra High Vacuum (UHV) setup is modified to facilitate experiments with electron emission from the MIS hot electron emitters and hot electron chemistry. Simulations show the importance of keeping tunnel barrier roughness to an absolute minimum. The tunnel oxide...... to be an important energy loss center for the electrons tunneling through the oxide lowering the emission e±ciency of a factor of 10 for a 1 nm Ti layer thickness. Electron emission is observed under ambient pressure conditions and in up to 2 bars of Ar. 2 bar Ar decrease the emission current by an order...
Directory of Open Access Journals (Sweden)
Andrei A. Fedoseev
2014-01-01
Full Text Available The article analyzes effective electronic tutorials creation and application based on the theory of pedagogy. Herewith the issues of necessary electronic tutorial functional, ways of the educational process organization with the use of information and communication technologies and the logistics of electronic educational resources are touched upon.
Theoretical investigations of molecular wires: Electronic spectra and electron transport
Palma, Julio Leopoldo
The results of theoretical and computational research are presented for two promising molecular wires, the Nanostar dendrimer, and a series of substituted azobenzene derivatives connected to aluminum electrodes. The electronic absorption spectra of the Nanostar (a phenylene-ethynylene dendrimer attached to an ethynylperylene chromophore) were calculated using a sequential Molecular Dynamics/Quantum Mechanics (MD/QM) method to perform an analysis of the temperature dependence of the electronic absorption process. We modeled the Nanostar as a series of connected units, and performed MD simulations for each chromophore at 10 K and 300 K to study how the temperature affected the structures and, consequently, the spectra. The absorption spectra of the Nanostar were computed using an ensemble of 8000 structures for each chromophore. Quantum Mechanical (QM) ZINDO/S calculations were performed for each conformation in the ensemble, including 16 excited states, for a total of 128,000 excitation energies. The spectral intensity was then scaled linearly with the number of conjugated units. Our calculations for both the individual chromophores and the Nanostar, are in good agreement with experiments. We explain in detail the effects of temperature and the consequences for the absorption process. The second part of this thesis presents a study of the effects of chemical substituents on the electron transport properties of the azobenzene molecule, which has been proposed recently as a component of a light-driven molecular switch. This molecule has two stable conformations (cis and trans) in its electronic ground state, with considerable differences in their conductance. The electron transport properties were calculated using first-principles methods combining non-equilibrium Green's function (NEGF) techniques with density functional theory (DFT). For the azobenzene studies, we included electron-donating groups and electron-withdrawing groups in meta- and ortho-positions with
Ballester, Facundo; Granero, Domingo; Pérez-Calatayud, José; Melhus, Christopher S; Rivard, Mark J
2009-09-01
The region of electronic disequilibrium near photon-emitting brachytherapy sources of high-energy radionuclides (60Co, 137CS, 192Ir, and 169Yb) and contributions to total dose from emitted electrons were studied using the GEANT4 and PENELOPE Monte Carlo codes. Hypothetical sources with active and capsule materials mimicking those of actual sources but with spherical shape were examined. Dose contributions due to source photons, x rays, and bremsstrahlung; source beta-, Auger electrons, and internal conversion electrons; and water collisional kerma were scored. To determine if conclusions obtained for electronic equilibrium conditions and electron dose contribution to total dose for the representative spherical sources could be applied to actual sources, the 192Ir mHDR-v2 source model (Nucletron B.V., Veenendaal, The Netherlands) was simulated for comparison to spherical source results and to published data. Electronic equilibrium within 1% is reached for 60Co, 137CS, 192Ir, and 169Yb at distances greater than 7, 3.5, 2, and 1 mm from the source center, respectively, in agreement with other published studies. At 1 mm from the source center, the electron contributions to total dose are 1.9% and 9.4% for 60Co and 192Ir, respectively. Electron emissions become important (i.e., > 0.5%) within 3.3 mm of 60Co and 1.7 mm of 192Ir sources, yet are negligible over all distances for 137Cs and 169Yb. Electronic equilibrium conditions along the transversal source axis for the mHDR-v2 source are comparable to those of the spherical sources while electron dose to total dose contribution are quite different. Electronic equilibrium conditions obtained for spherical sources could be generalized to actual sources while electron contribution to total dose depends strongly on source dimensions, material composition, and electron spectra.
Direct single electron detection with a CMOS detector for electron microscopy
International Nuclear Information System (INIS)
Faruqi, A.R.; Henderson, R.; Pryddetch, M.; Allport, P.; Evans, A.
2005-01-01
We report the results of an investigation into the use of a monolithic active pixel sensor (MAPS) for electron microscopy. MAPS, designed originally for astronomers at the Rutherford Appleton Laboratories, was installed in a 120 kV electron microscope (Philips CM12) at the MRC Laboratory in Cambridge for tests which included recording single electrons at 40 and 120 keV, and measuring signal-to-noise ratio (SNR), spatial resolution and radiation sensitivity. Our results show that, due to the excellent SNR and resolution, it is possible to register single electrons. The radiation damage to the detector is apparent with low doses and gets progressively greater so that its lifetime is limited to 600,000-900,000 electrons/pixel (very approximately 10-15 krad). Provided this detector can be radiation hardened to reduce its radiation sensitivity several hundred fold and increased in size, it will provide excellent performance for all types of electron microscopy