WorldWideScience

Sample records for handicap index vhi

  1. Voice Handicap Index (VHI in Persian Speaking Parkinson\\'s Disease Patients

    Directory of Open Access Journals (Sweden)

    Fatemeh Madjdinasab

    2014-04-01

    Full Text Available Objectives: “Voice” is affected more and sooner than other speech subsystems in Parkinson's Disease (PD. Voice Handicap Index (VHI is the most applicable subjective self-rating questionnaire in VD patients. The aim of this study was the investigation of Voice handicap in Iranian PD patients. Methods & Materials: This cross-sectional, analytical and non-interventional study was done on 50 (35 males, 15 females patients who reported a VD related to their PD. They were selected from thepatients referring to movement disorders’ clinic in Rasool Akram Hospital affiliated withTehran University of medical sciences, through easy sampling. VHI total score (VHIT and its domains (functional-VHIF, Emotional VHIE, Physical VHIP was assessed in all of participants and by gender segregation. Results: 83% of patients reported voice handicap. There wasn't any difference between VHIT and its mentioned 3 domains in both sexes. There is positive correlation between VHIT, VHIE and VHIF with age. VHIT and VHIF had a positive relationship with disease duration (DD. The males VHIT and the mentioned domains had positive correlations with DD. Conclusion: Most of Iranian PD patients feel handicap due to voice disorder caused by PD and their quality of life was affected by voice impairment. Increase in age and disease duration caused more voice disorder and reduced quality of life especially patients feel more handicaps in functional domain (VHIF. In addition, the males feel more handicap than females when DD develops.

  2. Correlation of the Voice Handicap Index-10 (VHI-10) and Voice-Related Quality of Life (V-RQOL) in patients with dysphonia.

    Science.gov (United States)

    Romak, Jonathan J; Orbelo, Diana M; Maragos, Nicolas E; Ekbom, Dale C

    2014-03-01

    This study examines the correlation between two voice-specific patient-reported outcome measures: the Voice Handicap Index-10 (VHI-10) and Voice-Related Quality of Life (V-RQOL). Retrospective chart review. Eight hundred four patients presenting to our voice clinic between May 2009 and August 2011. All patients completed the VHI-10 and V-RQOL in a single sitting. Correlation between the two scales was examined using Spearman rank analysis. Calculated VHI-10 score was derived from V-RQOL score by direct conversion equation and compared with measured VHI-10 score. Receiver Operating Characteristic (ROC) curves were derived for diagnostic groups. Spearman correlation coefficient between the VHI-10 and V-RQOL was -0.91 (P dysphonia (V-RQOL AUC = 0.536 [SE ± 0.026]; VHI-10 AUC = 0.508 [SE ± 0.26]; P = 0.018) groups, with the V-RQOL showing relatively greater sensitivity. The VHI-10 and V-RQOL are highly correlated. However, VHI-10 score cannot be calculated from V-RQOL score using the tested equation. The V-RQOL may be more sensitive than the VHI-10 in detecting the impact of presbyphonia and muscle tension dysphonia. Copyright © 2014 The Voice Foundation. Published by Mosby, Inc. All rights reserved.

  3. Aerodynamic findings and Voice Handicap Index in Parkinson's disease.

    Science.gov (United States)

    Motta, Sergio; Cesari, Ugo; Paternoster, Mariano; Motta, Giovanni; Orefice, Giuseppe

    2018-04-23

    To verify possible relations between vocal disability and aerodynamic measures in selected Parkinson's disease (PD) patients with low/moderate-grade dysphonia. Fifteen idiopathic dysphonic PD male patients were examined and compared with 15 euphonic subjects. Testing included the following measures: Voice Handicap Index (VHI), maximum phonation time (MPT), mean estimated subglottal pressure (MESGP), mean sound pressure level (MSPL), mean phonatory power (MPP), mean phonatory efficiency (MPE) and mean phonatory resistance (MPR). Statistical analysis showed: a significant reduction in MPR and MSPL in PD subjects compared to the healthy ones; a significant positive correlation between VHI score and MSPL, MPR, MPP, MESGP and a significant negative correlation between VHI and MTP within PD subjects. Test for multiple linear regression showed a significant correlation between VHI score, MPT, MPR and MSPL. A relationship between VHI and aerodynamic measures was shown in the present study. Compensatory mechanisms may aggravate vocal disability in PD subjects.

  4. [Voice disorders in female teachers assessed by Voice Handicap Index].

    Science.gov (United States)

    Niebudek-Bogusz, Ewa; Kuzańska, Anna; Woźnicka, Ewelina; Sliwińska-Kowalska, Mariola

    2007-01-01

    The aim of this study was to assess the application of Voice Handicap Index (VHI) in the diagnosis of occupational voice disorders in female teachers. The subjective assessment of voice by VHI was performed in fifty subjects with dysphonia diagnosed in laryngovideostroboscopic examination. The control group comprised 30 women whose jobs did not involve vocal effort. The results of the total VHI score and each of its subscales: functional, emotional and physical was significantly worse in the study group than in controls (p teachers estimated their own voice problems as a moderate disability, while 12% of them reported severe voice disability. However, all non-teachers assessed their voice problems as slight, their results ranged at the lowest level of VHI score. This study confirmed that VHI as a tool for self-assessment of voice can be a significant contribution to the diagnosis of occupational dysphonia.

  5. [Applicability of Voice Handicap Index to the evaluation of voice therapy effectiveness in teachers].

    Science.gov (United States)

    Niebudek-Bogusz, Ewa; Kuzańska, Anna; Błoch, Piotr; Domańska, Maja; Woźnicka, Ewelina; Politański, Piotr; Sliwińska-Kowalska, Mariola

    2007-01-01

    The aim of this study was to assess the applicability of Voice Handicap Index (VHI) to the evaluation of effectiveness of functional voice disorders treatment in teachers. The subjects were 45 female teachers with functional dysphonia who evaluated their voice problems according to the subjective VHI scale before and after phoniatric management. Group I (29 patients) were subjected to vocal training, whereas group II (16 patients) received only voice hygiene instructions. The results demonstrated that differences in the mean VHI score before and after phoniatric treatment were significantly higher in group 1 than in group II (p teacher's dysphonia.

  6. Correlation between acoustic parameters and Voice Handicap Index in dysphonic teachers.

    Science.gov (United States)

    Niebudek-Bogusz, E; Woznicka, E; Zamyslowska-Szmytke, E; Sliwinska-Kowalska, M

    2010-01-01

    The aim of this study was to investigate the relationship between acoustic analysis and biopsychosocial implications of voice problems, evaluated by the Voice Handicap Index (VHI). The study comprised 120 female teachers with voice disorders, evaluated by videolaryngostroboscopy. 60.8% of this group were diagnosed as having functional dysphonia and 39.2% had dysphonia with benign vocal fold masses (nodules and polyps). The controls consisted of 30 euphonic women. The correlations between VHI and acoustic analysis were assessed in both groups using the Pearson correlation coefficient and regression analysis. In teachers, the total VHI score was over 5 times as high as in controls (p teachers, significant positive correlations were found between the total VHI score and the frequency perturbation parameters and amplitude perturbation parameters when both statistical methods were used. These acoustic parameters also significantly correlated with the score on the functional and emotional subscales, but rarely with the physical subscale of the VHI. The study revealed a significant relationship between the objective voice measurements and the VHI. The results confirmed that VHI can be a valuable tool for assessing biopsychosocial implications of occupational dysphonia and should be incorporated in multidimensional voice evaluation. (c) 2010 S. Karger AG, Basel.

  7. Validity and Reliability Study of Bahasa Malaysia Version of Voice Handicap Index-10.

    Science.gov (United States)

    Ong, Fei Ming; Husna Nik Hassan, Nik Fariza; Azman, Mawaddah; Sani, Abdullah; Mat Baki, Marina

    2018-05-21

    This study aimed to determine the validity and reliability of Bahasa Malaysia version of Voice Handicap Index-10 (mVHI-10). This cross-sectional study was carried out in the Otorhinolaryngology, Head and Neck Surgery Department of Universiti Kebangsaan Malaysia Medical Centre (UKMMC) from June 2015 to May 2016. The mVHI-10 was produced following a rigorous forward and backward translation. One hundred participants, including 50 healthy volunteers (17 male, 33 female) and 50 patients with voice disorders (26 male, 24 female), were recruited to complete the mVHI-10 before flexible laryngoscopic examinations and acoustic analysis. The mVHI-10 was repeated in 2 weeks via telephone interview or clinic visit. Its reliability and validity were assessed using interclass correlation. The test-retest reliability for total mVHI-10 and each item score was high, with the Cronbach alpha of >0.90. The total mVHI-10 score and domain scores were significantly higher (P Kaiser-Meyer-Olkin measure was 0.92, which depicted excellent construct validity. There was a significant positive correlation between the mVHI-10 score and jitter and shimmer result (P < 0.001). The present study showed good reliability and validity of the mVHI-10 when applied to both healthy volunteers and patients with voice disorders. We recommend the use of the mVHI-10 in daily clinical practice among Bahasa Malaysia-speaking population. Copyright © 2018 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  8. Reliability and validity of the Korean version of Pediatric Voice Handicap Index: in school age children.

    Science.gov (United States)

    Park, Sung Shin; Kwon, Tack-Kyun; Choi, Seong Hee; Lee, Won Yong; Hong, Young Hye; Jeong, Nyun Gi; Sung, Myung-Whun; Kim, Kwang Hyun

    2013-01-01

    The aim of this study was to assess the reliability and validity of the Pediatric Voice Handicap Index (pVHI) for cross-cultural adaptation of the Korean version with school age children. The questionnaire was translated into Korean and was completed by 101 Korean parents who have children with or without disordered voice. The Korean version-pVHI scores were obtained with 60 parents of normal children and 41 parents who have children with voice problems. Content validity was verified by five experienced speech-language pathologists with clinical specialization in voice disorders. Internal consistency was calculated through Cronbach's α coefficient and test-retest reliability of the Korean version-pVHI score was determined using Pearson product-moment correlation coefficients. Mann-Whitney U test was used to compare GRBAS with the Korean version-pVHI scores between normal and dysphonia group. The relationship between the parent-reported the Korean version-pVHI total scores and perceptual ratings of voice quality from experts was investigated using Spearman correlation coefficients. The results showed that the Korean version-pVHI provided a high internal consistency (α=0.92) and test-retest reliability of its subscales: total (T) 0.97, functional (F) 0.90, physical (P) 0.95, emotional (E) 0.92. The Korean version-pVHI mean scores in normal group were 1.28 (T), 0.62 (F), 0.35 (P) and 0.32 (E), respectively whereas those of the Korean version-pVHI in children group with dysphonia were 23.13 (T), 8.90 (F), 9.54 (P) and 4.93 (E). Significant differences in the Korean version-pVHI (T, F, P, E) and perceptual evaluation (grade, rough, breathy) between normal and dysphonia group were revealed (PKorean version-pVHI parameters (T) and perceptual measures (G) was exhibited in children with dysphonia. The subjective Korean version-pVHI can be applicable and useful supplementary tool for evaluating parents' perception of their children's voice dysfunction, identifying

  9. [Comparison of VHI scores in teachers with voice disorders and the non-professional dysphonic population].

    Science.gov (United States)

    Kuzańska, Anna; Niebudek-Bogusz, Ewa; Woźnicka, Ewelina; Kopczyńska, Jerzy; Sliwińska-Kowalska, Mariola

    2009-01-01

    The aim of this study was to assess the application of Voice Handicap Index (VHI) in the diagnosis of occupational voice disorders in teachers as compared with the dysphonic non-teachers population. The subjective assessment of voice by VHI was performed in 105 teachers with dysphonia and 60 dysphonic subjects whose jobs did not involve vocal effort. The control group comprised 65 healthy individuals with normal voice. The results of total VHI score and each of its subscales, functional, emotional and physical, were significantly worse in the study groups (I and II) than in the control group (p teachers and 16% of non-teachers reported severe voice disability. All individuals in the control group assessed their voice problems as minor, their results fell within the range of the lowest level of VHI score. This study confirmed that VHI as a tool for self-assessment of voice can significantly contribute to the diagnosis of occupational and non-occupational dysphonia.

  10. A comparison of the VHI, VHI-10, and V-RQOL for measuring the effect of botox therapy in adductor spasmodic dysphonia.

    Science.gov (United States)

    Morzaria, Sanjay; Damrose, Edward J

    2012-05-01

    Although disease-specific quality-of-life (QOL) instruments are an invaluable outcome measure in spasmodic dysphonia, there is no consensus on which QOL instrument should be used. To determine the responsiveness of the Voice Handicap Index (VHI), Voice Handicap Index-10 (VHI-10), and Voice-Related Quality of Life (V-RQOL) to the treatment effect of botulinum toxin (Botox) in adductor spasmodic dysphonia (ADSD). Stanford University Voice and Swallowing Center. Prospective case series (level of evidence=4). Consecutive ADSD patients with a stable Botox dose-response relationship were recruited prospectively. VHI, VHI-10, and V-RQOL scores were obtained pretreatment and during the middle third of the posttreatment injection cycle. Thrity-seven patients completed the follow-up. The average total Botox dose was 0.88 units. The average follow-up time after injection was 7.84 weeks. The pretreatment QOL scores reflected the burden of the disease. All the three instruments were highly correlated in subscale and total scores. After treatment, all three instruments showed significant improvement. The VHI, VHI-10, and V-RQOL all reflected the morbidity associated with ADSD and were significantly responsive to the effect of Botox therapy. The choice of instrument should be based on physician preference. Copyright © 2012 The Voice Foundation. Published by Mosby, Inc. All rights reserved.

  11. VHI-10 and SVHI-10 Differences in Singers' Self-perception of Dysphonia Severity.

    Science.gov (United States)

    Renk, Elizabeth; Sulica, Lucian; Grossman, Chad; Georges, Jenny; Murry, Thomas

    2017-05-01

    Previous investigations of the Voice Handicap Index (VHI)-10 in clinical practice noted that specific information relevant to singers was not forthcoming. Consequently, a second index, the Singing Voice Handicap Index (SVHI) as well as its shortened counterpart the SVHI-10, was developed. The purpose of this study was to directly compare the differences in scores between the VHI-10 and the SVHI-10 in a group of 50 singers. A retrospective chart review of 50 singers (26 women, 24 men) was performed between June 2014 and November 2014 at Weill Cornell Medical College, New York. Subjects completed both the VHI-10 and the SVHI-10 at their initial evaluation. The results from the VHI-10 and the SVHI-10 were then compared using paired t test and two-way analysis of variance. The SVHI-10 scores from the performers were significantly higher than those of the VHI-10 (P < 0.0001). The mean score on the VHI-10 was 12.1 compared with 20.4 on the SVHI-10 (maximum score for each questionnaire is 40). There were no significant gender differences when comparing the VHI-10 and the SVHI-10 on the overall scores or for individual items. The analysis of variance also found no significant gender difference (P = 0.865) and confirmed a significant difference between VHI-10 and SVHI-10 (P = 0.0003). Whereas singers may have general complaints about their voice, they also have specific complaints that relate only to their singing voice. Finding a significant difference between the scores of the VHI-10 and the SVHI-10 suggests the importance of assessing the singer's perception of voice severity using a tool that focuses on the singing voice. Copyright © 2017 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  12. Health-related quality of life in children with dysphonia and validation of the French Pediatric Voice Handicap Index.

    Science.gov (United States)

    Oddon, P A; Boucekine, M; Boyer, L; Triglia, J M; Nicollas, R

    2018-01-01

    voice disorders are common in the pediatric population and can negatively affect children's quality of life. The pediatric voice handicap Index (pVHI) is a valid instrument to assess parental perception of their children voice but it is not translated into French language. The aim of the present study was to adapt a French version of the pVHI and to evaluate its psychometric properties including construct validity, reliability, and some aspects of external validity. we performed a cross sectional study including 32 dysphonic children and 60 children with no history of voice problems between 3 and 12 years of age. The original pVHI was translated into French language according to forward-backward rules and then administered to parents or caregivers. Construct validity and internal consistency were explored using confirmatory factor analysis and Cronbach's alpha. The questionnaire was filled twice to assess test-retest reliability using the intra-class correlation coefficient. The external validity was explored by comparing the French pVHI total and subscales scores between dysphonic and asymptomatic children. Correlations between the French pVHI and both the perceptual GRBAS scale and the health-related quality of life (HRQOL) survey "Vécu et Santé Perçu de l'Adolescent et de l'Enfant" (VSP-Ap) were also performed. the structure of the French pVHI showed a good fit with excellent reliability (α = 0.929) and high test-retest reliability. Significant differences were found between the group of dysphonic children and the control group (p life in children with voice disorder. We recommend its use in the multidimensional protocols for assessing voice disorder in the pediatric population. Copyright © 2017. Published by Elsevier B.V.

  13. Long-term voice handicap index after type II thyroplasty using titanium bridges for adductor spasmodic dysphonia.

    Science.gov (United States)

    Sanuki, Tetsuji; Yumoto, Eiji; Kodama, Narihiro; Minoda, Ryosei; Kumai, Yoshihiko

    2014-06-01

    To determine the long-term functional outcomes of type II thyroplasty using titanium bridges for adductor spasmodic dysphonia (AdSD) by perceptual analysis using the Voice Handicap Index-10 (VHI-10) and by acoustic analysis. Fifteen patients with AdSD underwent type II thyroplasty using titanium brides between August 2006 and February 2011. VHI-10 scores, a patient-based survey that quantifies a patient's perception of his or her vocal handicap, were determined before and at least 2 years after surgery. Concurrent with the VHI-10 evaluation, acoustic parameters were assessed, including jitter, shimmer, harmonic-to-noise ratio (HNR), standard deviation of F0 (SDF0), and degree of voice breaks (DVB). The average follow-up interval was 30.1 months. No patient had strangulation of the voice, and all were satisfied with the voice postoperatively. In the perceptual analysis, the mean VHI-10 score improved significantly, from 26.7 to 4.1 two years after surgery. All patients had significantly improved each score of three different aspects of VHI-10, representing improved functional, physical, and emotional well-being. All acoustic parameters improved significantly 2 years after surgery. The treatment of AdSD with type II thyroplasty significantly improved the voice-related quality of life and acoustic parameters 2 years after surgery. The results of the study suggest that type II thyroplasty using titanium bridges provides long-term relief of vocal symptoms in patients with AdSD. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  14. Predictors of Choral Directors' Voice Handicap

    Science.gov (United States)

    Schwartz, Sandra

    2013-01-01

    Vocal demands of teaching are considerable and these challenges are greater for choral directors who depend on the voice as a musical and instructive instrument. The purpose of this study was to (1) examine choral directors' vocal condition using a modified Voice Handicap Index (VHI), and (2) determine the extent to which the major variables…

  15. A study of VHI scores and acoustic features in street vendors as occupational voice users.

    Science.gov (United States)

    Natour, Yaser S; Darawsheh, Wesam B; Bashiti, Sara; Wari, Majd; Taha, Juhayna; Odeh, Thair

    to investigate acoustic features of phonation and perception of voice handicap in street vendors. Eighty-eight participants (44 street vendors, 44 controls) were recruited. The mean age of the group was 38.9±16.0 years (range: 20-78 years). Scores of the Arabic version of the Voice Handicap Index (VHI-Arab) were used for analysis. Acoustic measures of fundamental frequency (F 0 ), jitter, shimmer, and signal-to-noise ratio (SNR) were also analyzed. Analysis showed a significant difference between street vendors and controls in the total score of the VHI-Arab (p<0.001) as well as scores of all three VHI-Arab subsections: functional (p<0.001), physical (p<0.001), and emotional (p=0.025). Weak correlations were found among all of the VHI scores and acoustic measures (-0.219≤ r≤0.355), except for SNR where a moderate negative correlations were found (r=-0.555; -0.4) between the VHI (physical and total) scores and SNR values. Significant differences also were found in F 0 , jitter, and SNR among specific subgroups of street vendors when stratified by weekly hours worked (p<0.05), and in jitter (p=0.39) when stratified by educational level. Perception of voice handicap and a possible effect on vocal quality in street vendors were noted. The effect of factors, namely work hours and educational level, on voice quality should be further studied. Copyright © 2017. Published by Elsevier Inc.

  16. The Effects of a Voice Education Program on VHI Scores of Elementary School Teachers.

    Science.gov (United States)

    Faham, Maryam; Ahmadi, Akram; Drinnan, Michael; Saadatmand, Najme; Fatahi, Elahe; Jalalipour, Maryam

    2016-11-01

    Teachers seem to be vulnerable to voice disorders because of excessive use of their voice. The purpose of this study was to investigate the effects of a voice education program on the Vocal Handicap Index (VHI) scores of elementary school teachers in the Persian education system. This was a semi-experimental study, performed in Shiraz public schools. Ten schools were selected on their similarity in number of students and teachers, and allocated at random to training or control groups. Sixty-one teachers in the training group and 66 teachers in the control group completed the VHI in the first week. Teachers in the trained group received voice education for 4 weeks, and then continued to follow the program for a further 4 weeks. The control group received no training. After 8 weeks, all subjects completed the questionnaire again. Compliance was good for all practices except "breathing exercises" and "using amplifiers" where it was exceptionally poor. Teachers in the training group improved significantly in total VHI score (from 14.2 to 6.8), whereas the control group showed a significant worsening (from 10.1 to 13.7). These effects were significant (P teachers, even without dysphonia, in the middle of their teaching. Such a program may have a place in the Persian education system. Copyright © 2016 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  17. Vocal handicap index in popular and erudite professional singers.

    Science.gov (United States)

    Loiola-Barreiro, Camila Miranda; Silva, Marta Assumpção de Andrada E

    To compare the voice handicap index of popular and erudite professional singers according to gender, age, professional experience time, and presence or absence of self-reported vocal complaints. One hundred thirty-two professional singers, 74 popular and 58 erudite, who responded to a questionnaire with regards to identification, age, gender, professional experience time in singing, musical genres (for popular singers), vocal classification (for erudite singers), presence of self-reported vocal complaints, and the specific protocols for popular (Modern Singing Handicap Index - MSHI) and erudite (Classical Singing Handicap Index - CSHI) singing. Higher proportion of women and higher incidence of vocal complaints were observed in the popular singers compared with the erudite singers. Most of the popular singers belonged to the genre of Brazilian Popular Music. Regarding the classification of erudite singers, there was greater participation of sopranos and tenors. No statistical differences were observed with respect to age and professional experience time between the groups. Comparison of the MSHI and CSHI scores showed no statistically significant difference between these scores and genre or age in both groups of singers. Professional experience time was related to the total score and the subscales disability and impairment in the MSHI, only for popular singers with vocal complaints. There was no correlation between these variables and the CSHI for erudite singers. The impact of vocal difficulty/problem interferes differently in these two musical genres when related to vocal complaint and professional experience time. The MSHI and CSHI protocols proved to be important tools not only for the identification of problems, but also for the understanding of how these individuals relate their voices with this occupational activity.

  18. Correlation between vocal tract symptoms and modern singing handicap index in church gospel singers.

    Science.gov (United States)

    Pinheiro, Joel; Silverio, Kelly Cristina Alves; Siqueira, Larissa Thaís Donalonso; Ramos, Janine Santos; Brasolotto, Alcione Ghedini; Zambon, Fabiana; Behlau, Mara

    2017-08-24

    To verify the correlation between vocal tract discomfort symptoms and perceived voice handicaps in gospel singers, analyzing possible differences according to gender. 100 gospel singers volunteered, 50 male and 50 female. All participants answered two questionnaires: Vocal Tract Discomfort (VTD) scale and the Modern Singing Handicap Index (MSHI) that investigates the vocal handicap perceived by singers, linking the results of both instruments (psinging. Female gospel singers present higher frequency and intensity of vocal tract discomfort symptoms, as well as higher voice handicap for singing than male gospel singers. The higher the frequency and intensity of the laryngeal symptoms, the higher the vocal handicap will be.

  19. The Barthel index as predictor of handicap in stroke survivors: a ...

    African Journals Online (AJOL)

    Results: After adjusting for other variables, the multivariable analysis showed that handicap in stroke is significantly associated with the Barthel index (p<0.05) and atrial fibrillation (p<0.05). Conclusion: Barthel index is an important predictor of handicap following stroke. Atrial fibrillation should also be considered in the ...

  20. A Comparative Study of the VHI-10 and the V-RQOL for Quality of Life Among Chinese Teachers With and Without Voice Disorders.

    Science.gov (United States)

    Lu, Dan; Wen, Bei; Yang, Hui; Chen, Fei; Liu, Jun; Xu, Yanan; Zheng, Yitao; Zhao, Yu; Zou, Jian; Wang, Haiyang

    2017-07-01

    To investigate the differences and correlation between the Voice Handicap Index-10 (VHI-10) and the Voice-Related Quality of Life (V-RQOL) in teachers in China with and without voice disorders. This is a cross-sectional descriptive analytical study. The participants were 864 teachers (569 women, 295 men) whose vocal cords were examined using a flexible nasofibrolaryngoscope. Questionnaire results were obtained for both the VHI-10 and the V-RQOL. Of the 864 participants, 409 teachers had no voice disorders and 455 teachers had voice disorders. The most common voice complaint was hoarseness (n = 298) and the most common throat complaint was globus pharyngis (n = 79) in teachers with voice disorders. Chronic laryngitis (n = 218) and polyps and nodules (n = 182) were the most frequent diagnoses in teachers with voice disorders. Significant differences were seen on the VHI-10 between teachers with and those without voice disorders (P teachers with voice disorders (P teachers. Teachers with voice disorders have poor voice-related quality of life, with more impairment seen among female than male teachers. Different groups of voice disorders have different effects on voice-related quality of life. A moderate correlation was found between the results of the VHI-10 and the V-RQOL. Copyright © 2017 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  1. Determinants and Effects of Voice Disorders among Secondary School Teachers in Peninsular Malaysia Using a Validated Malay Version of VHI-10.

    Directory of Open Access Journals (Sweden)

    Foong Ming Moy

    Full Text Available To establish the prevalence of voice disorder using the Malay-Voice Handicap Index 10 (Malay-VHI-10 and to study the determinants, quality of life, depression, anxiety and stress associated with voice disorder among secondary school teachers in Peninsular Malaysia.This study was divided into two phases. Phase I tested the reliability of the Malay-VHI-10 while Phase II was a cross-sectional study with two-stage sampling. In Phase II, a self-administered questionnaire was used to collect socio-demographic and teaching characteristics, depression, anxiety and stress scale (Malay version of DASS-21; and health-related quality of life (Malay version of SF12-v2. Complex sample analysis was conducted using multivariate Poisson regression with robust variance.In Phase I, the Spearman correlation coefficient and Cronbach alpha for total VHI-10 score was 0.72 (p 11. Compared to Malays, a greater proportion of ethnic Chinese teachers reported voice disorder while ethnic Indian teachers were less likely to report this problem. There was a higher prevalence ratio (PR of voice disorder among single or divorced/widowed teachers. Teachers with voice disorder were more likely to report higher rates of absenteeism (PR: 1.70, 95% CI 1.33, 2.19, lower quality of life with lower SF12-v2 physical (0.98, 95% CI 0.96, 0.99 and mental (0.97, 95% CI 0.96, 0.98 component summary scales; and higher anxiety levels (1.04, 95% CI 1.02, 1.06.The Malay-VHI-10 is valid and reliable. Voice disorder was associated with increased absenteeism, marginally associated with reduced health-related quality of life as well as increased anxiety among teachers.

  2. Dicty_cDB: VHI141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHI141 (Link to dictyBase) - - - Contig-U15722-1 VHI141P (Link... to Original site) VHI141F 635 VHI141Z 922 VHI141P 1537 - - Show VHI141 Library VH (Link to library) Clone ID VHI141 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...LDCSTPNGTCDNNTGNCTCHNEHFGNSC EFTRCPLDCSTPNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHK...PNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHKCSTKHGICDNDSG

  3. Muscular tension and body posture in relation to voice handicap and voice quality in teachers with persistent voice complaints.

    Science.gov (United States)

    Kooijman, P G C; de Jong, F I C R S; Oudes, M J; Huinck, W; van Acht, H; Graamans, K

    2005-01-01

    The aim of this study was to investigate the relationship between extrinsic laryngeal muscular hypertonicity and deviant body posture on the one hand and voice handicap and voice quality on the other hand in teachers with persistent voice complaints and a history of voice-related absenteeism. The study group consisted of 25 female teachers. A voice therapist assessed extrinsic laryngeal muscular tension and a physical therapist assessed body posture. The assessed parameters were clustered in categories. The parameters in the different categories represent the same function. Further a tension/posture index was created, which is the summation of the different parameters. The different parameters and the index were related to the Voice Handicap Index (VHI) and the Dysphonia Severity Index (DSI). The scores of the VHI and the individual parameters differ significantly except for the posterior weight bearing and tension of the sternocleidomastoid muscle. There was also a significant difference between the individual parameters and the DSI, except for tension of the cricothyroid muscle and posterior weight bearing. The score of the tension/posture index correlates significantly with both the VHI and the DSI. In a linear regression analysis, the combination of hypertonicity of the sternocleidomastoid, the geniohyoid muscles and posterior weight bearing is the most important predictor for a high voice handicap. The combination of hypertonicity of the geniohyoid muscle, posterior weight bearing, high position of the hyoid bone, hypertonicity of the cricothyroid muscle and anteroposition of the head is the most important predictor for a low DSI score. The results of this study show the higher the score of the index, the higher the score of the voice handicap and the worse the voice quality is. Moreover, the results are indicative for the importance of assessment of muscular tension and body posture in the diagnosis of voice disorders.

  4. Cross-cultural Adaption and Validation of the Danish Voice Handicap Index

    DEFF Research Database (Denmark)

    Sorensen, Jesper Roed; Printz, Trine; Mehlum, Camilla Slot

    2018-01-01

    version of the VHI was used. Data from 208 patients with voice disorders of different etiology (neurogenic, functional, and structural) and a control group of 85 vocally healthy individuals were included. A test-retest reliability analysis of 42 patients and 45 control persons was performed. The internal...

  5. Validity and Reliability of the Persian Version of the Dysphagia Handicap Index (DHI).

    Science.gov (United States)

    Asadollahpour, Faezeh; Baghban, Kowsar; Asadi, Mozhgan

    2015-05-01

    The Dysphagia Handicap Index (DHI) is one of the instruments used for measuring a dysphagic patient's self-assessment. In some ways, it reflects the patient's quality of life. Although it has been recognized and widely applied in English speaking populations, it has not been used in its present forms in Persian speaking countries. The purpose of this study was to adapt a Persian version of the DHI and to evaluate its validity, consistency, and reliability in the Persian population with oropharyngeal dysphagia. Some stages for cross-cultural adaptation were performed, which consisted in translation, synthesis, back translation, review by an expert committee, and final proof reading. The generated Persian DHI was administered to 85 patients with oropharyngeal dysphagia and 89 control subjects at Zahedan city between May 2013 and August 2013. The patients and control subjects answered the same questionnaire 2 weeks later to verify the test-retest reliability. Internal consistency and test-retest reliability were evaluated. The results of the patients and the control group were compared. The Persian DHI showed good internal consistency (Cronbach's alpha coefficients range from 0.82 to 0.94). Also, good test-retest reliability was found for the total scores of the Persian DHI (r=0.89). There was a significant difference between the DHI scores of the control group and those of the oropharyngeal dysphagia group (P‹0.001). The Persian version of the DHI achieved Face and translation validity. This study demonstrated that the Persian DHI is a valid tool for self-assessment of the handicapping effects of dysphagia on the physical, functional, and emotional aspects of patient life and can be a useful tool for screening and treatment planning for the Persian-speaking dysphagic patients, regardless of the cause or the severity of the dysphagia.

  6. Validity and Reliability of the Persian Version of the Dysphagia Handicap Index (DHI

    Directory of Open Access Journals (Sweden)

    faezeh asadollahpour

    2015-05-01

    Full Text Available Introduction: The Dysphagia Handicap Index (DHI is one of the instruments used for measuring a dysphagic patient’s self-assessment. In some ways, it reflects the patient’s quality of life. Although it has been recognized and widely applied in English speaking populations, it has not been used in its present forms in Persian speaking countries. The purpose of this study was to adapt a Persian version of the DHI and to evaluate its validity, consistency, and reliability in the Persian population with oropharyngeal dysphagia.   Materials and Methods: Some stages for cross-cultural adaptation were performed, which consisted in translation, synthesis, back translation, review by an expert committee, and final proof reading. The generated Persian DHI was administered to 85 patients with oropharyngeal dysphagia and 89 control subjects at Zahedan city between May 2013 and August 2013. The patients and control subjects answered the same questionnaire 2 weeks later to verify the test-retest reliability. Internal consistency and test-retest reliability were evaluated. The results of the patients and the control group were compared.   Results: The Persian DHI showed good internal consistency (Cronbach’s alpha coefficients range from 0.82 to 0.94. Also, good test-retest reliability was found for the total scores of the Persian DHI (r=0.89. There was a significant difference between the DHI scores of the control group and those of the oropharyngeal dysphagia group (P‹0.001.   Conclusion:  The Persian version of the DHI achieved Face and translation validity. This study demonstrated that the Persian DHI is a valid tool for self-assessment of the handicapping effects of dysphagia on the physical, functional, and emotional aspects of patient life and can be a useful tool for screening and treatment planning for the Persian-speaking dysphagic patients, regardless of the cause or the severity of the dysphagia.

  7. Dicty_cDB: VHI285 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHI285 (Link to dictyBase) - - - Contig-U16073-1 - (Link to Or...iginal site) VHI285F 136 - - - - - - Show VHI285 Library VH (Link to library) Clone ID VHI285 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16073-1 Original site URL http://dictycdb.b... DNA Score E Sequences producing significant alignments: (bits) Value N ( BJ423035 ) Dict...yostelium discoideum cDNA clone:ddv47i22, 5' ... 72 2e-27 3 ( BJ419916 ) Dictyostelium discoideum cD

  8. Comparação dos escores dos protocolos QVV, IDV e PPAV em professores Comparison of V-RQOL, VHI and VAPP scores in teachers

    Directory of Open Access Journals (Sweden)

    Alessandra Sayuri Tutya

    2011-09-01

    Handicap Index and VAPP (Voice Activity and Participation Profile, and to analyze the correspondence of information obtained by these instruments. METHODS: Fourty six teachers with voice complaints that sought for speech-language pathology intervention and were diagnosed with behavioral dysphonia answered randomly the V-RQOL, VHI and VAPP questionnaires. RESULTS: Dysphonic teachers presented worse quality of life than the general dysphonic population on the V-RQOL. The VHI showed no significant handicap. On the VAPP, teachers had lower scores in the effects in social communication. The physical (VHI and physical functioning (V-RQOL domains were similar to each other. The VAPP provides information about aspects not contemplated by the other protocols; self-perception of the severity of dysphonia was correlated with all domains of the three protocols. The items with greatest impact on the V-RQOL were from the physical functioning domain, and, on the VHI, from the physical domain. On the VAPP, the two questions with greater occurrence were related to the effect of voice over emotion. Hence, for this population, it is suggested the use of the VAPP questionnaire, because it comprises aspects that the others don't; in addition, the V-RQOL should also be used, because it has fewer questions and more impact (total and emotional scores than the VHI. CONCLUSION: The protocols do not show the same information for dysphonic teachers. The physical functioning (V-RQOL and physical (VHI domains provide similar results, however social-emotional domain of the V-RQOL exhibited more evidently the impact of the voice disorder in dysphonic teachers than the VHI. The VAPP present information not contemplated by the other protocols.

  9. Effect of intralaryngeal muscle synkinesis on perception of voice handicap in patients with unilateral vocal fold paralysis.

    Science.gov (United States)

    Lin, R Jun; Munin, Michael C; Rosen, Clark A; Smith, Libby J

    2017-07-01

    Intralaryngeal muscle synkinesis associated with unilateral vocal fold paralysis (UVFP) is thought to preserve thyroarytenoid-lateral cricoarytenoid muscle complex tone, resulting in a better voice despite the presence of vocal fold paralysis (VFP). This study compares voice handicap in patients with unilateral VFP (UVFP) with and without evidence of adductory synkinesis on laryngeal electromyography (LEMG). Retrospective review of LEMG data and Voice Handicap Index-10 (VHI-10) scores of patients diagnosed with permanent UVFP. LEMG was performed within 1 to 6 months post onset of UVFP. Patients were stratified into two groups: 1) recurrent laryngeal nerve (RLN) neuropathy with synkinesis and 2) RLN neuropathy without synkinesis. Synkinesis was diagnosed when the sniff to phonation maximum amplitude ratio was ≥0.65. VHI-10 scores at 6-month follow-up were recorded. Four hundred forty-nine patients with UVFP and who had an LEMG were reviewed. Eighty-three patients met the inclusion criteria, with 16 in group 1 and 67 in group 2. There was no significant difference between the groups with regard to age, timing of LEMG from onset of VFP, number of patients undergoing temporary vocal fold injection or use of off-label nimodipine. Average VHI-10 scores at 6 months post onset of VFP were 14.4 ± 10.6 for patients with LEMG-identified synkinesis (group 1) and 21.0 ± 10.1 for patients with no LEMG evidence of synkinesis (group 2). This was statistically significant (P = .02). Patients with unilateral vocal fold paralysis and LEMG evidence of laryngeal synkinesis are more likely to have less perceived voice handicap than those without synkinesis. 4. Laryngoscope, 127:1628-1632, 2017. © 2016 The American Laryngological, Rhinological and Otological Society, Inc.

  10. Quality of life, functional outcome, and voice handicap index in partial laryngectomy patients for early glottic cancer

    Directory of Open Access Journals (Sweden)

    Kandogan Tolga

    2005-05-01

    part 1. (p = 0. A statistically significant difference was also established between cordectomy and fronto-lateral laryngectomy groups, as well as between cordectomy and cricohyoidopexi groups in answers to the University of Washington- Quality of Life- Revised survey part 2. (p = 0,036 and p = 0.009, respectively. Cricohyoidopexi group has given the lowest scores and the cordectomy group has given the highest scores in three survey questions representing the quality of life, performances and new voices. These ranges are also consistent with the laryngeal tissue excised during surgery (cricohyoidopexi > fronto-lateral laryngectomy > cordectomy. There was no statistically significant difference between groups in Performance Status Scale for Head and Neck cancer patients instrument. The difference between the Voice Handicap Index and Voice Handicap Index (functional; Voice Handicap Index (physical and Voice Handicap Index (emotional scores in three patient groups was not significant either. All of the patients evaluated that their new voices have similar functional, physical and emotional impact on their life. Decanulation and oral feeding times of cricohyoidopexi and fronto-lateral laryngectomy patients are found to be significantly longer than cordectomy patients. Lastly, the removal of arytenoid does not have any significant adverse effects on the quality of life, the functional outcomes, or the quality of voice. Conclusion In the present study, all patients with early glottic cancer, treated with different surgical technics reported fairly good quality of life outcomes, functional results and voice qualities. This study also finds that the removal of arytenoid does not have any adverse effects on the quality of life and voice from the patients' point of view.

  11. Comparison of Nursing Home Hearing Handicap Index with Audiological Findings: A Presbycusis Study

    Directory of Open Access Journals (Sweden)

    M. H. Nilforoush

    2012-01-01

    Full Text Available Hearing evaluation usually includes hearing threshold assessment, middle ear function, and word recognition tests that lead to an accurate result of peripheral and central auditory system. However, they have some limitations because they cannot fully encompass all aspects of hearing loss problems. Using self-assessment approach, via a questionnaire or telephone survey, is one of the easiest methods to study hearing loss in population. In this research, 60 nursing home residents (27 females and 33 males ranging from 55 to 85 years with a mean age of were studied via completing self-assessment questionnaire by the elderly cases (NHHI self-version and the other one was filled by the nursing home personnel (NHHI staff-version. The effects of the hearing loss level on the self- and staff-version scores indicated that there is a significant relationship between self- and staff-version with hearing loss levels ( in male and female. Results from this study demonstrate the usefulness of NHHI questionnaire for evaluating hearing handicap of aged people and it may be a useful adjunct in setting up treatment and determining proper care.

  12. Connections between voice ergonomic risk factors and voice symptoms, voice handicap, and respiratory tract diseases.

    Science.gov (United States)

    Rantala, Leena M; Hakala, Suvi J; Holmqvist, Sofia; Sala, Eeva

    2012-11-01

    The aim of the study was to investigate the connections between voice ergonomic risk factors found in classrooms and voice-related problems in teachers. Voice ergonomic assessment was performed in 39 classrooms in 14 elementary schools by means of a Voice Ergonomic Assessment in Work Environment--Handbook and Checklist. The voice ergonomic risk factors assessed included working culture, noise, indoor air quality, working posture, stress, and access to a sound amplifier. Teachers from the above-mentioned classrooms reported their voice symptoms, respiratory tract diseases, and completed a Voice Handicap Index (VHI). The more voice ergonomic risk factors found in the classroom the higher were the teachers' total scores on voice symptoms and VHI. Stress was the factor that correlated most strongly with voice symptoms. Poor indoor air quality increased the occurrence of laryngitis. Voice ergonomics were poor in the classrooms studied and voice ergonomic risk factors affected the voice. It is important to convey information on voice ergonomics to education administrators and those responsible for school planning and taking care of school buildings. Copyright © 2012 The Voice Foundation. Published by Mosby, Inc. All rights reserved.

  13. Quality of life in oncological patients with oropharyngeal dysphagia: validity and reliability of the Dutch version of the MD Anderson Dysphagia Inventory and the Deglutition Handicap Index.

    Science.gov (United States)

    Speyer, Renée; Heijnen, Bas J; Baijens, Laura W; Vrijenhoef, Femke H; Otters, Elsemieke F; Roodenburg, Nel; Bogaardt, Hans C

    2011-12-01

    Quality of life is an important outcome measurement in objectifying the current health status or therapy effects in patients with oropharyngeal dysphagia. In this study, the validity and reliability of the Dutch version of the Deglutition Handicap Index (DHI) and the MD Anderson Dysphagia Inventory (MDADI) have been determined for oncological patients with oropharyngeal dysphagia. At Maastricht University Medical Center, 76 consecutive patients were selected and asked to fill in three questionnaires on quality of life related to oropharyngeal dysphagia (the SWAL-QOL, the MDADI, and the DHI) as well as a simple one-item visual analog Dysphagia Severity Scale. None of the quality-of-life questionnaires showed any floor or ceiling effect. The test-retest reliability of the MDADI and the Dysphagia Severity Scale proved to be good. The test-retest reliability of the DHI could not be determined because of insufficient data, but the intraclass correlation coefficients were rather high. The internal consistency proved to be good. However, confirmatory factor analysis could not distinguish the underlying constructs as defined by the subscales per questionnaire. When assessing criterion validity, both the MDADI and the DHI showed satisfactory associations with the SWAL-QOL (reference or gold standard) after having removed the less relevant subscales of the SWAL-QOL. In conclusion, when assessing the validity and reliability of the Dutch version of the DHI or the MDADI, not all psychometric properties have been adequately met. In general, because of difficulties in the interpretation of study results when using questionnaires lacking sufficient psychometric quality, it is recommended that researchers strive to use questionnaires with the most optimal psychometric properties.

  14. Validation of the Cepstral Spectral Index of Dysphonia (CSID) as a Screening Tool for Voice Disorders: Development of Clinical Cutoff Scores.

    Science.gov (United States)

    Awan, Shaheen N; Roy, Nelson; Zhang, Dong; Cohen, Seth M

    2016-03-01

    The purposes of this study were to (1) evaluate the performance of the Cepstral Spectral Index of Dysphonia (CSID--a multivariate estimate of dysphonia severity) as a potential screening tool for voice disorder identification and (2) identify potential clinical cutoff scores to classify voice-disordered cases versus controls. Subjects were 332 men and women (116 men, 216 women) comprised of subjects who presented to a physician with a voice-related complaint and a group of non-voice-related control subjects. Voice-disordered cases versus controls were initially defined via three reference standards: (1) auditory-perceptual judgment (dysphonia +/-); (2) Voice Handicap Index (VHI) score (VHI +/-); and (3) laryngoscopic description (laryngoscopic +/-). Speech samples were analyzed using the Analysis of Dysphonia in Speech and Voice program. Cepstral and spectral measures were combined into a CSID multivariate formula which estimated dysphonia severity for Rainbow Passage samples (i.e., the CSIDR). The ability of the CSIDR to accurately classify cases versus controls in relation to each reference standard was evaluated via a combination of logistic regression and receiver operating characteristic (ROC) analyses. The ability of the CSIDR to discriminate between cases and controls was represented by the "area under the ROC curve" (AUC). ROC classification of dysphonia-positive cases versus controls resulted in a strong AUC = 0.85. A CSIDR cutoff of ≈24 achieved the best balance between sensitivity and specificity, whereas a more liberal cutoff score of ≈19 resulted in higher sensitivity while maintaining respectable specificity which may be preferred for screening purposes. Weaker but adequate AUCs = 0.75 and 0.73 were observed for the classification of VHI-positive and laryngoscopic-positive cases versus controls, respectively. Logistic regression analyses indicated that subject age may be a significant covariate in the discrimination of dysphonia-positive and VHI

  15. Citizens and Handicaps.

    Science.gov (United States)

    Thomas, Stanley B., Jr.

    In a speech delivered at the National Easter Seal Society's Annual Convention (1974), the author discusses progress toward full citizenship for the handicapped focusing on the roles of the Department of Health, Education, and Welfare (DHEW) and the Office for the Handicapped, Constitutional guarantees of equal rights for all citizens, and national…

  16. Teaching the Handicapped Imagination.

    Science.gov (United States)

    Sloane, Sarah

    1983-01-01

    The article describes exercises in drama and creative writing to broaden the imaginations of visually handicapped children through stories and poems with a nonvisual imagery. Examples of stories and poems written specifically for the visually handicapped are included. (Author/CL)

  17. Analysis of Agricultural Drought in East Java Using Vegetation Health Index

    OpenAIRE

    Amalo, Luisa Febrina; Hidayat, Rahmat; Sulma, Sayidah

    2018-01-01

    Drought is a natural hazard indicated by the decreasing of rainfall and water storage and impacting agricultural sector. Agricultural drought assessment has been used to monitor agricultural sustainability, particularly in East Java as national agricultural production center. Identification of drought characteristics –correlated with El Niño-Southern Oscillation, and agricultural impact on paddy fields and rice production using VHI (Vegetation Health Index) were conducted. VHI is produced by ...

  18. Facilitating creativity in handicapped and non-handicapped children ...

    African Journals Online (AJOL)

    The prime objective of this paper is to create awareness on the presence of the handicapped in Nigeria and the need to facilitate creative potentials in handicapped and non-handicapped children. Various factors that could facilitate creativity and other factors that could inhibit creativity were discussed. The implications for ...

  19. Handicap, Architecture & Design

    DEFF Research Database (Denmark)

    1996-01-01

    Cd-rommen er et visuelt projekteringsværktøj for byggeriets parter. Den viser nogle af de problemer mennesker med handicap har ved at færdes i de fysiske omgivelser, men peger også mulige løsninger for at gøre omgivelserne tilgængelige for alle....

  20. The Multiply Handicapped Child.

    Science.gov (United States)

    Wolf, James M., Ed.; Anderson, Robert M., Ed.

    Articles presented in the area of the medical and educational challenge of the multiply handicapped child are an overview of the problem, the increasing challenge, congenital malformations, children whose mothers had rubella, prematurity and deafness, the epidemiology of reproductive casualty, and new education for old problems. Discussions of…

  1. Benefits for handicapped children

    CERN Multimedia

    2003-01-01

    The introduction of long-term care benefits within the CERN Health Insurance Scheme requires the coordination of the benefits foreseen for handicapped children. Measures were adopted by the Management following the recommendation made by the Standing Concertation Committee on 26 March 2003. A document clarifying these measures is available on the Web at the following address: http://humanresources.web.cern.ch/humanresources/external/soc/Social_affairs/social_affairs.asp Social Affairs Service 74201

  2. Self-handicapping and burnout.

    Science.gov (United States)

    Akin, Ahmet

    2012-02-01

    Self-handicapping is a process containing strategies of externalization in which an individual can excuse failure and internalize success. This study investigated the relationship of self-handicapping with measures of burnout. The Self-handicapping Scale and the Maslach Burnout Inventory were administered to 309 university students. Self-handicapping was positively correlated to emotional exhaustion, lowered personal accomplishment, and depersonalization. A structural equation model fit the data well and accounted for 20% of the variance in emotional exhaustion, 14% in lowered personal accomplishment, and 10% in depersonalization.

  3. Costs of self-handicapping.

    Science.gov (United States)

    Zuckerman, Miron; Tsai, Fen-Fang

    2005-04-01

    Four studies examined the relation of trait self-handicapping with health-related measures. Study 1 showed that, over time, self-handicapping and maladjustment reinforce each other. Study 2 showed that self-handicappers reported a loss in competence satisfaction which, in turn, mediated the relation of self-handicapping with negative mood. Study 3 found that, over time, self-handicappers report an increase in substance use. Study 4 showed that self-handicappers reported a loss in intrinsic motivation for their jobs. It was suggested that people with unstable (or contingent) self-esteem use self-handicapping to bolster a fragile self-concept.

  4. Telecommunication for the Physically Handicapped.

    Science.gov (United States)

    Cunningham, Pat; Gose, Joan

    The paper examines the uses of telecommunication for physically handicapped students. Basic equipment, including a modem and keyboard interface, are described. The types and uses of computer bulletin boards are also described. Among benefits of telecommunications for physically handicapped students noted in the paper are social prestige,…

  5. Working with Handicapped Art Students.

    Science.gov (United States)

    Silver, Rawley A.

    Presented at the 1979 National Art Education Association Convention on the arts in special education, the paper focuses on studies of the aesthetic and therapeutic use of special art procedures with handicapped students. The art education needs of handicapped students are briefly discussed, along with the impact and implications of new…

  6. Sexual Adjustment in the Handicapped

    Science.gov (United States)

    Glass, Dorothea D.; Padrone, Frank J.

    1978-01-01

    Major topics discussed include introduction and background of the growing recognition of sexual feelings and concerns of the handicapped, attitudes and assumptions resulting from lack of information for both the handicapped and the various disciplines that serve them, medical and psychological aspects of sexual response, and services for the…

  7. The Self-Handicapping Phenomenon.

    Science.gov (United States)

    Ferguson, Janet M.; Dorman, Jeffrey

    2002-01-01

    Asserts that self-handicapping students protect their self-images by deliberately not trying to achieve for fear of trying hard, failing anyway, and appearing "dumb." Surveys of high school students examined three areas of students' perceptions (self-handicapping, academic self-efficacy, and classroom environment). The correlation…

  8. Indexed

    CERN Document Server

    Hagy, Jessica

    2008-01-01

    Jessica Hagy is a different kind of thinker. She has an astonishing talent for visualizing relationships, capturing in pictures what is difficult for most of us to express in words. At indexed.blogspot.com, she posts charts, graphs, and Venn diagrams drawn on index cards that reveal in a simple and intuitive way the large and small truths of modern life. Praised throughout the blogosphere as “brilliant,” “incredibly creative,” and “comic genius,” Jessica turns her incisive, deadpan sense of humor on everything from office politics to relationships to religion. With new material along with some of Jessica’s greatest hits, this utterly unique book will thrill readers who demand humor that makes them both laugh and think.

  9. Handicap questionnaires: what do they assess?

    NARCIS (Netherlands)

    Cardol, M.; Brandsma, J. W.; de Groot, I. J.; van den Bos, G. A.; de Haan, R. J.; de Jong, B. A.

    1999-01-01

    There is an increasing need to get insight into the social and societal impact of chronic conditions on a person's life, i.e. person-perceived handicap. The purpose of this study is to report how current handicap questionnaires assess handicap. A literature search using both Medline and the database

  10. Emotionally Handicapped Pupils: Developing Appropriate Educational Programs.

    Science.gov (United States)

    North Carolina State Dept. of Public Instruction, Raleigh. Div. for Exceptional Children.

    The document is designed to assist local school systems as they plan, develop, and improve programs for emotionally handicapped students. Sections cover the following areas: definition of emotionally handicapped students; pre-planninq for emotionally handicapped programs; identification, referral, screening, assessment, and placement; service…

  11. Psychology and the Handicapped Child.

    Science.gov (United States)

    Sherrick, Carl E., Ed.; And Others

    Reviewed in seven author contributed chapters are findings of experimental psychology relevant to the education of handicapped children in the areas of sensory processes, visual perception, memory, cognition and language development, sustained attention and impulse control, and personality and social development. Noted in an introductory chapter…

  12. Equine Therapy for Handicapped Students.

    Science.gov (United States)

    Minner, Sam; And Others

    1983-01-01

    Four aspects in planning a therapeutic horsemanship program for handicapped individuals are considered: training instructors, obtaining the needed horses and equipment, identifying the participants, and implementing the program and developing a curriculum. An example of a horsemanship program begun in Kentucky is offered. (CL)

  13. Handicaps No Hindrance with Horses

    Science.gov (United States)

    Seeley, Colleen

    1974-01-01

    A horseback riding program, sponsored by 4-H members for handicapped children in Michigan's Genesse County, has proven physically and emotionally veneficial for the children. All therapeutic exercises were performed with the approval of the child's physician and therapist. Plans for expanding the program are being considered. (AG)

  14. Tooth-brushing intervention programme among children with mental handicap.

    Science.gov (United States)

    Stefanovska, E; Nakova, M; Radojkova-Nikolovska, V; Ristoska, S

    2010-01-01

    For realizing our study the supervised tooth-brushing program was carried out among 100 schoolchildren at the age of 9-12 and 13-16 years with low and moderate mental handicap in Skopje. To evaluate the results of six months intervention program, concentrated on encouragement of independent manual skills, OHI levels were detected by Green-Vermillion and CPITN index levels to characterize the gingival and periodontal health. For comparative analyzes of date-base OHI levels and after six months of intervention program, we detected that the mean date-base OHI index level for mentally handicaped children are 2.46, and at the end of the program (after six months) it was 0.73. CPITN index levels at the beginning and after six months of intervention programmed for mentally handicaped children in both age groups, also confirmed r statistical significance for this examined parameter, with evident reduction of CPITN mean levels from 2.11 to 0.95. Correlation among date-base OHI levels and levels at the end of our intervention program means high positive correlation between these index levels at the beginningand final examinations. This program gave promising results and was effective in reducing the plaque and gingivitis scores, so the key to long-term success of the program is to maintain the subjects' motivation to make oral hygiene a part of their daily routine and thus sustain this improvement (Tab. 1, Fig. 4, Ref. 12). Full Text (Free, PDF) www.bmj.sk.

  15. Orthodontics for mentally handicapped patients [Orthodontie bij pati�nten met een verstandelijke handicap

    NARCIS (Netherlands)

    Remmelink, H.J.

    2006-01-01

    The mentally handicapped exhibit a 3 times higher incidence of malocclusions and related functional problems than the general population. In contrast there is little available literature relating to the orthodontic treatment of handicapped patients. Based on published articles on orthodontic

  16. Educational assistance to students with physical handicaps

    Directory of Open Access Journals (Sweden)

    Anselmo Vázquez Vázquez

    2015-03-01

    Full Text Available The present study was developed with the aim of determining the state of educational attention to students with handicaps. The Methods used are: General dialectical, Historic and logical and Systemic, Observation, Interview and Survey. As sample were taken 20 teachers and 100% of the students with handicaps from the faculty. Results: The educational assistance to students with ha ndi caps is being given empirically , regulations and guidelines from the Higher Ministry of Education related to handicaps are not known; There is scarce knowledge about the characteristics of handicaps and needs of guidance for effective learning. It recog nizes the importance of providing necessary resources for inclusion in the Higher Education.

  17. EARLY TREATMENT OF HANDICAPPED CHILDREN-ESPECIALLY OF MENTALLY HANDICAPPED

    Directory of Open Access Journals (Sweden)

    Peter SKUBER

    1997-06-01

    Full Text Available In my discussion about the early treatment, I am going to point out three important matters:1. Open public health serviceThe deliveries are made at hospitals and the health service is the first to detect and treat children who are disturbed in their development. It also supervisor pregnancies. Upon the delivery, the screening test is used to analyze the risk delivery. At the beginning, the treatment is individual.2. Group (5-8 children in regular kindergartenThe transition of the child from the clinical treatment to the kindergarten is the result of an agreement between the team of experts both from the health institutes and pedagogical field of activity working in this way also when the child is in the nursery.The group of 5-8 handicapped children is now under the supervision of a nursery teacher having been to obtain special pedagogical education.3. Seminars of parentsThe state unity of associations providing for handicapped, in cooperation with local associations, organizes seminars lasting several days for parents and children.The purpose of the seminars is first of all helping parents in solving their emotional problems and also informing them on numerous issues appearing in connection with their child and themselves.

  18. Euthanasia of Severely Handicapped Infants: Ethical Issues.

    Science.gov (United States)

    Cohen, Libby

    Ethical decisions are involved in life and death decisions for severely handicapped infants. Although it has become common practice for physicians not to treat severely handicapped infants, the ethical considerations involved in euthanasia are complex. A review of the literature reveals that concerns center around the quality of life of the…

  19. Arts for the Handicapped Child. Why?

    Science.gov (United States)

    National Committee, Arts for the Handicapped, Washington, DC.

    Presented is a collection of case studies by therapists, educators, artists, parents, and recreation leaders, dealing with the arts as learning experiences for handicapped children. Each of the ten articles records the positive effects of arts experiences (dance, art, music, drama) on the growth and development of a particular handicapped child or…

  20. 28 CFR 41.31 - Handicapped person.

    Science.gov (United States)

    2010-07-01

    ... Persons § 41.31 Handicapped person. (a) Handicapped person means any person who has a physical or mental...: (1) Physical or mental impairment means: (i) Any physiological disorder or condition, cosmetic... disorder, such as mental retardation, organic brain syndrome, emotional or mental illness, and specific...

  1. Handicapped Litigation: A Review of Significant Decisions.

    Science.gov (United States)

    Bowen, John W.

    Since 1979 many courts have handed down rulings in favor of handicapped children under the Education of the Handicapped Act. This twentieth chapter in a book on school law summarizes these cases. In "Kruelle v. Biggs," the court ruled that a school district must provide residential placement free of charge if such placement is necessary…

  2. Anatomical correlates of self-handicapping tendency.

    Science.gov (United States)

    Takeuchi, Hikaru; Taki, Yasuyuki; Nouchi, Rui; Hashizume, Hiroshi; Sekiguchi, Atsushi; Kotozaki, Yuka; Nakagawa, Seishu; Miyauchi, Carlos M; Sassa, Yuko; Kawashima, Ryuta

    2013-04-01

    Self-handicaps are obstacles created (or claimed) by individuals in anticipation of failure. Despite the vast amount of psychological research on self-handicapping tendency, the neural mechanisms underlying individual differences in self-handicapping tendency in young and healthy subjects are unknown. We used voxel-based morphometry (VBM) and a questionnaire to measure individual self-handicapping tendency, and we investigated the association between regional gray matter volume (rGMV) and self-handicapping tendency across the brain in healthy young adult (mean age, 21.3 years; standard deviation - SD = 1.9) men (n = 94) and women (n = 91). We discovered that higher individual self-handicapping tendency was associated with larger rGMV in the subgenual cingulate gyrus (sgCG). A wide range of previous studies showed (a) the opposite pattern is seen in the association between rGMV in the sgCG and depression and (b) this area is active when negative emotions are suppressed. The present results suggest that the sgCG is also involved in self-handicapping, which is a behavior thought to be engaged in the protection of self-esteem. Copyright © 2013 Elsevier Ltd. All rights reserved.

  3. Consumer Education for the Mentally Handicapped

    Science.gov (United States)

    Alperstein, Neil M.

    1977-01-01

    Discusses community placement of mentally handicapped people and remedial procedures for encouraging independent decision making and behavior. Intertwines this behavior change with an alternative method of consumer education. (Author/RK)

  4. Is Being Gifted a Social Handicap?

    Science.gov (United States)

    Coleman, Laurence J.; Cross, Tracy L.

    1988-01-01

    Interviews with 15 gifted/talented adolescents indicated that many of them experienced giftedness as a social handicap. Some students coped with this by managing information about themselves to minimize their visibility as gifted students to others. (Author/JDD)

  5. Enhancing the prediction of self-handicapping.

    Science.gov (United States)

    Harris, R N; Snyder, C R; Higgins, R L; Schrag, J L

    1986-12-01

    Levels of test anxiety, Type A and Type B coronary-prone behavior, fear of failure, and covert self-esteem were studied as predictors of self-handicapping performance attributions for college women who were placed in either a high- (N = 49) or low- (N = 49) evaluative test or task situation. We hypothesized that test anxiety. Type A or Type B level, and their interaction would account for reliable variance in the prediction of self-handicapping. However, we also theorized that underlying high fear of failure and low covert self-esteem would explain the self-handicapping claims of test-anxious and Type A subjects. The results indicated that only high levels of test anxiety and high levels of covert self-esteem were related to women's self-handicapping attributions.

  6. Aurally Handicapped -- Research; A Selective Bibliography. Exceptional Child Bibliography Series No. 625.

    Science.gov (United States)

    Council for Exceptional Children, Reston, VA. Information Center on Exceptional Children.

    The selected bibliography of research on aurally handicapped children contains approximately 95 abstracts with indexing information explained to be drawn from the computer file of abstracts representing the Council for Exceptional Children Information Center's complete holdings as of August, 1972. Abstracts are said to be chosen using the criteria…

  7. Handicap principle implies emergence of dimorphic ornaments.

    Science.gov (United States)

    Clifton, Sara M; Braun, Rosemary I; Abrams, Daniel M

    2016-11-30

    Species spanning the animal kingdom have evolved extravagant and costly ornaments to attract mating partners. Zahavi's handicap principle offers an elegant explanation for this: ornaments signal individual quality, and must be costly to ensure honest signalling, making mate selection more efficient. Here, we incorporate the assumptions of the handicap principle into a mathematical model and show that they are sufficient to explain the heretofore puzzling observation of bimodally distributed ornament sizes in a variety of species. © 2016 The Author(s).

  8. Vocal Hygiene Habits and Vocal Handicap Among Conservatory Students of Classical Singing.

    Science.gov (United States)

    Achey, Meredith A; He, Mike Z; Akst, Lee M

    2016-03-01

    This study sought to assess classical singing students' compliance with vocal hygiene practices identified in the literature and to explore the relationship between self-reported vocal hygiene practice and self-reported singing voice handicap in this population. The primary hypothesis was that increased attention to commonly recommended vocal hygiene practices would correlate with reduced singing voice handicap. This is a cross-sectional, survey-based study. An anonymous survey assessing demographics, attention to 11 common vocal hygiene recommendations in both performance and nonperformance periods, and the Singing Voice Handicap Index 10 (SVHI-10) was distributed to classical singing teachers to be administered to their students at two major schools of music. Of the 215 surveys distributed, 108 were returned (50.2%), of which 4 were incomplete and discarded from analysis. Conservatory students of classical singing reported a moderate degree of vocal handicap (mean SVHI-10, 12; range, 0-29). Singers reported considering all 11 vocal hygiene factors more frequently when preparing for performances than when not preparing for performances. Of these, significant correlations with increased handicap were identified for consideration of stress reduction in nonperformance (P = 0.01) and performance periods (P = 0.02) and with decreased handicap for consideration of singing voice use in performance periods alone (P = 0.02). Conservatory students of classical singing report more assiduous attention to vocal hygiene practices when preparing for performances and report moderate degrees of vocal handicap overall. These students may have elevated risk for dysphonia and voice disorders which is not effectively addressed through common vocal hygiene recommendations alone. Copyright © 2016 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  9. Learning Handicapped and Nonlearning Handicapped Female Juvenile Offenders: Educational and Criminal Profiles.

    Science.gov (United States)

    Fejes-Mendoza, Kathy E.; Rutherford, Robert B., Jr.

    1987-01-01

    Interviews with 30 female juvenile offenders were conducted to (1) describe their educational and criminal backgrounds and (2) describe a subgroup of learning handicapped juvenile female offenders. Nearly one third had received special education services prior to their incarceration with additional offenders diagnosed as handicapped upon entry…

  10. "I know you self-handicapped last exam": gender differences in reactions to self-handicapping.

    Science.gov (United States)

    Hirt, Edward R; McCrea, Sean M; Boris, Hillary I

    2003-01-01

    Past research has shown that self-handicapping involves the trade-off of ability-related attributional benefits for interpersonal costs. Study 1 examined whether perceiver or target sex moderates impressions of self-handicapping targets. Although target sex was not an important factor, female perceivers were consistently more critical of behavioral self-handicappers. Two additional studies replicated this gender difference with variations of the handicap. Study 3 examined the motives inferred by perceivers and found that women not only view self-handicappers as more unmotivated but also report greater suspicion of self-handicapping motives; furthermore, these differences in perceived motives mediated sex differences in reactions to self-handicappers. Implications for the effectiveness of self-handicapping as an impression management strategy are discussed.

  11. Can a conditioning programme improve Handicap Index in ...

    African Journals Online (AJOL)

    This study was conducted to determine the effects of a conditioning programme on body composition, flexibility, muscular strength, muscular endurance, ... The 14-week training programme consisted of a 60-minute supervised basic conditioning phase (Weeks 1-4: 9 resistance training exercises, 2-3 sets, 12-20 repetitions), ...

  12. Handicapped Infants and Euthanasia: A Challenge to Our Advocacy.

    Science.gov (United States)

    Smith, J. David

    1985-01-01

    The issue of pediatric euthanasia for handicapped newborns is examined and contrasting viewpoints emphasizing the quality and the sanctity of life are considered. The author asserts that advocacy for handicapped children involves decisions regarding the euthanasia question. (CL)

  13. Handicapping: the effects of its source and frequency.

    Science.gov (United States)

    McElroy, James C; Crant, J Michael

    2008-07-01

    Using a sample of 246 working adults, the authors created a 2 x 2 x 2 experimental design to isolate the influence of performance outcome, source of handicapping, and frequency of handicapping on reactions to handicapping in organizations. Dependent measures were observers' allocations of credit/blame, interpersonal affect, and the perceived credibility of the explanation. Results showed direct effects on observer impressions for all 3 independent variables, along with a significant Source x Frequency interaction. Handicapping information presented by others yielded more favorable observer impressions than did self-handicapping, and frequent handicapping decreased observer impressions. The least credible handicapping strategy was multiple self-handicaps. A significant 3-way interaction showed that source and frequency affected perceived credibility differently, depending upon whether actual performance was a success or a failure.

  14. Low trait self-control predicts self-handicapping.

    Science.gov (United States)

    Uysal, Ahmet; Knee, C Raymond

    2012-02-01

    Past research has shown that self-handicapping stems from uncertainty about one's ability and self-presentational concerns. The present studies suggest that low dispositional self-control is also associated with self-handicapping. In 3 studies (N = 289), the association between self-control and self-handicapping was tested. Self-control was operationalized as trait self-control, whereas self-handicapping was operationalized as trait self-handicapping in Study 1 (N = 160), self-reported self-handicapping in Study 2 (N = 74), and behavioral self-handicapping in Study 3 (N = 55). In all 3 studies, hierarchical regression analyses revealed that low self-control predicts self-handicapping, independent of self-esteem, self-doubt, social desirability, and gender. © 2012 The Authors. Journal of Personality © 2012, Wiley Periodicals, Inc.

  15. Review of the Studies on Self-Handicapping

    OpenAIRE

    伊藤, 忠弘

    1992-01-01

    Since Jones & Berglas (1978) presented the conception of self-handicapping, a lot of empirical research on self-handicapping was reported. Some reseachers drew a distinction between ""acquired"" (or ""behavioral"") self-handicapping such as drug ingestion, alcohol consumption, effort reduction, and choosing a difficult task, and ""claimed"" (or ""self-reported"") self-handicapping such as verbal claim to be ill, socially anxious, test anxious, or in a bad mood. This paper reviewed these studi...

  16. The Special Needs of Prison Inmates with Handicaps: An Assessment.

    Science.gov (United States)

    Veneziano, Louis; And Others

    1987-01-01

    Surveyed 45 workers in correctional agencies to examine number of handicapped inmates and types of programs provided to them. Found that most prison systems had identified some handicapped inmates. Variety of programs were offered to inmates, many systems did not have specialized treatment for handicapped. Found need for evaluation and treatment…

  17. Handicap og beskæftigelse i 2006

    DEFF Research Database (Denmark)

    Høgelund, Jan; Larsen, Brian; Kløft Schademan, Helle

    Denne rapport giver ny viden om beskæftigelsessituationen for personer med handicap. Den viser, at personer med handicap er lige så tilfredse med deres arbejde, som personer uden handicap, og at de oplever at de har de samme jobkrav og de samme muligheder for indflydelse og udvikling, og de har s...

  18. Excuses, Excuses: Self-Handicapping in an Australian Adolescent Sample.

    Science.gov (United States)

    Warner, Suzanne; Moore, Susan

    2004-01-01

    The purpose of the present study was to examine gender differences in the self-handicapping tendencies of a sample of 337 Australian school attending adolescents, who were aged between 15 and 19 years. Self-handicapping, as measured by the shortened Self-Handicapping Scale, was examined in relation to self-esteem, performance attributions, coping…

  19. Self-Handicapping Behavior: A Critical Review of Empirical Research.

    Science.gov (United States)

    Carsrud, Robert Steven

    Since the identification of self-handicapping strategies in 1978, considerable attention has been paid to this phenomenon. Self-handicapping is a strategy for discounting ability attributions for probable failure while augmenting ability attributions for possible success. Behavioral self-handicaps are conceptually distinct from self-reported…

  20. Telecommunications: A New Horizon for the Handicapped.

    Science.gov (United States)

    Cunningham, Pat; Gose, Joan

    The paper describes a computer bulletin board program operated by physically handicapped high school students. Through the bulletin board system, resource people have been contacted, students' written communication and interpersonal relationships have been strengthened, and professional contact has been strengthened. Administrative implications…

  1. Therapeutic Intervention for the Physically Handicapped

    Science.gov (United States)

    Spillios, James; Janzen, Henry L.

    1978-01-01

    The need for training counselors specifically for intervention with the physically handicapped is the major focus of this article. Definitions of disabilities, rehabilitation and emotional factors are stressed as important variables in physical and psychotherapeutic treatment. The authors review some of the psychological aspects in counseling the…

  2. Rehabilitation and Care of the Handicapped.

    Science.gov (United States)

    Engberg, Eugenie; And Others

    An overview of services to help the handicapped is given in light of the characteristics of social conditions and social development in Denmark, and the history of rehabilitative care is examined. Information is given on the following areas: legislative, organization and financing; the national health service; the general education of handicapped…

  3. Disability and handicap among elderly Singaporeans.

    Science.gov (United States)

    Yadav, S S

    2001-08-01

    Singapore's elderly population has been growing rapidly and is expected to constitute more than 25 percent of the total population by the year 2030. The ageing process brings with it a host of health problems. Here the question arises--Are the increasing years of life going to create a high proportion of sick and disabled elderly people, or a rich human resource of healthy senior citizens? Since more women are living longer than men, who would face a higher risk of disability and handicap? These questions are yet to be answered in Singapore. This paper seeks answers to these questions. The study is based on a sample survey of 1209 elderly Singaporeans living in Kampong Glam, Kreta Ayer and Bukit Merah parliamentary constituencies which have some of the highest proportions of the aged population. The results revealed that more than half of the aged had a disability and the rate of disability was significantly higher among the women as compared to the men. More than one-third of the elderly had a handicap and the rate of handicap among the women was twice as much as that among the men. Severity of handicap was directly correlated with age.

  4. Handicapped Students in the Danish Educational System.

    Science.gov (United States)

    Ministry of Education, Copenhagen (Denmark).

    The educational policy of Denmark and the educational system which has evolved from this policy are described. The policy states that everyone has a right to the same access to education and training, regardless of sex, social origins, geographic origins, and physical or mental handicap; and all public education is free of charge from the age of 5…

  5. Employment of Handicapped People in Leisure Occupations.

    Science.gov (United States)

    Compton, David M.; Vinton, Dennis A.

    In response to the need for up-to-date information on employment opportunities for handicapped people in the leisure occupations, a national survey was conducted to determine both existing levels of employment and employer practices. The survey was sent to 500 agencies and businesses representing four leisure occupational subclusters: travel,…

  6. Reducing Truancy in Students with Mild Handicaps.

    Science.gov (United States)

    Hess, Albert M.; And Others

    1990-01-01

    Contingency contracting and group counseling were provided to 26 mildly to moderately handicapped middle school students with high rates of truancy. Subjects exhibited attendance gains after treatment; gains were not maintained at followup but attendance rates were still higher than the rates of control students. Measures of academic performance…

  7. Development of Self-Handicapping Tendencies.

    Science.gov (United States)

    Kimble, Charles; Kimble, Emily A.; Croy, Nan A.

    1998-01-01

    Determines when U.S. children begin to self-handicap, that is, to reduce preparation effort before evaluations. Finds that the high-self-esteem third graders acted adaptively by practicing more for the evaluation task, while the high-self-esteem sixth graders prepared more only if they had been reminded of their personal resources beforehand. (CMK)

  8. [Respiratory handicap. Recognition, evaluation and social benefits].

    Science.gov (United States)

    Marsac, J; Pujet, J C

    1983-01-01

    The medico-social aspects of respiratory handicap pose some perplexing problems, notably in their recognition, rigorous evaluation and in the granting of social security benefits. The clinical and respiratory function data should be standardised and classified according to type and significance of respiratory disease and also according to the degree of co-operation and understanding of the patient. The respiratory handicap should be evaluated after considering the functional disability engendered by the disorder and their socio-professional repercussions. The abnormality in the lungs should be measured by resting tests; the degree of disability by exercise studies; the socio-professional handicap by ergonometric tests to assess the scale of the demands and requirements of family and social and professional life, indeed the cultural and economic style of the individual concerned. Such combined studies would enable recognition of severe chronic respiratory handicap leading to decisions for exemption certificates, such as cases of severe respiratory failure in patients requiring supplementary treatment for oxygen therapy or assisted ventilation. The benefits and grants offered to those with respiratory handicaps would involve a number of rights relating to: care, work, costs of replacement of workers in the event of prolonged sick leave or the benefits of an invalidity pension. There will be other allowances such as invalidity cards, lodging special studies and other rights particularly relating to lodging and special equipment. The present scale is difficult to use both because of its lack of specificity and its ill-chosen terminology. For better balance between the handicap and the benefits offered, a common and more flexible system, with a printed table should be at hand for the doctor to use for certain decisions: long term illness, period of invalidity or early retirement because of medical incapacity. Within each table a sub-section should exist to allow for

  9. Grief elaboration in families with handicapped member.

    Science.gov (United States)

    Calandra, C; Finocchiaro, G; Raciti, L; Alberti, A

    1992-01-01

    Families with handicapped member seem to follow the same five stages (rejection and isolation, anger, dealing with the problem, depression, acceptance) of Kubler-Ross grief elaboration theory while dealing with the narcissistic wound of a handicapped child. Some of these families show a block in one of the stages. The effort of psychotherapy is to remove the block and let them reach the last stage. In this paper families under systemic psychotherapeutic treatment are analyzed, who had in common the birth of a child with low or modest invalidating signs and psychotic or autistic features. The families structure did not show the characteristics of a psychotic family. Nevertheless either one or both parents ignored the evidence of their child disease and they built a "disease-incongrous" wait around the child, trying to push away the painful reality. The authors explain the importance of this approach for the improvement of the autistic traits.

  10. Examining the relationship between authenticity and self-handicapping.

    Science.gov (United States)

    Akin, Ahmet; Akin, Umran

    2014-12-01

    Self-handicapping includes strategies of externalization in which people excuse failure and internalize success, but which also prevents them from behaving in an authentic way. The goal was to investigate the relation of authenticity with self-handicapping. The study was conducted with 366 university students (176 men, 190 women; M age = 20.2 yr.). Participants completed the Turkish version of the Authenticity Scale and the Self-handicapping Scale. Self-handicapping was correlated positively with two factors of authenticity, accepting external influence and self-alienation, and negatively with the authentic living factor. A multiple regression analysis indicated that self-handicapping was predicted positively by self-alienation and accepting external influence and negatively by authentic living, accounting for 21% of the variance collectively. These results demonstrated the negative association of authenticity with self-handicapping.

  11. The Relationship Between Academic Identity and Self-Handicapping

    OpenAIRE

    Carlisle, Brandon Lamare

    2015-01-01

    The purpose of the present dissertation was to examine whether, and how, behavioral academic self-handicapping and claimed academic self-handicapping differentially relate to the academic identity statuses (i.e., achieved, diffused, moratorium, and foreclosed). Self-handicapping has been defined as creating or claiming obstacles to performance in order to enhance the ability to externalize failure and internalize success. Academic identity status involves a student’s decision to attend colleg...

  12. The London handicap scale: a re-evaluation of its validity using standard scoring and simple summation

    OpenAIRE

    Jenkinson, C.; Mant, J.; Carter, J.; Wade, D.; Winner, S.

    2000-01-01

    OBJECTIVE—To assess the validity of the London handicap scale (LHS) using a simple unweighted scoring system compared with traditional weighted scoring
METHODS—323 patients admitted to hospital with acute stroke were followed up by interview 6 months after their stroke as part of a trial looking at the impact of a family support organiser. Outcome measures included the six item LHS, the Dartmouth COOP charts, the Frenchay activities index, the Barthel index, and the hospital...

  13. Honig v. Doe: the suspension and expulsion of handicapped students.

    Science.gov (United States)

    Yell, M L

    1989-09-01

    Public Law 94-142 provides for a free appropriate public education for all handicapped children, but does not address the issue of disciplining handicapped students. The result has been confusion and uncertainty, particularly concerning expulsion and suspension. The courts have been forced into this vacuum, acting as arbiters. The Supreme Court's ruling in Honig v. Doe will help to delineate the proper role of educators in the suspension and expulsion of handicapped students. This article examines that role and offers recommendations for school policies regarding the discipline of handicapped students.

  14. A motivational analysis of defensive pessimism and self-handicapping.

    Science.gov (United States)

    Elliot, Andrew J; Church, Marcy A

    2003-06-01

    Two studies examined motivational influences on and correlates of defensive pessimism and self-handicapping and investigated the relationship between these two cognitive strategies and performance attainment. The findings indicated that defensive pessimism and self-handicapping have similar motivational profiles, with the primary difference being that self-handicapping represents the absence of approach motivation in the achievement domain, as well as the presence of avoidance motivation. Self-handicapping, but not defensive pessimism, was shown to undermine performance-attainment, and performance-avoidance goals were validated as mediators of this negative relationship. Issues regarding the functional nature of the two cognitive strategies are discussed.

  15. Academic self-handicapping and their correlates in adolescence

    Directory of Open Access Journals (Sweden)

    Cocoradă, E.

    2011-01-01

    Full Text Available The self-handicapping has been examined as a self-protectivestrategy, used by adults and young, males and females, in different situations assessed as threatening for the positive self-esteem. The purpose of this study is to explore the relations between self-handicapping and some variables relevant in the academic field as learning motivation, academic results, selfesteem. Age and gender are the criteria of our analysis. The results suggestthe males and later adolescents (males and females self-handicap more that the females and the young adolescents. Self-esteem and some components of learning motivation are the variables that influence self-handicapping at significant levels.

  16. Discipline in the Public Schools: A Dual Standard for Handicapped and Nonhandicapped Students?

    Science.gov (United States)

    Simon, Sue G.

    1984-01-01

    Federal regulation protects handicapped students' education against unwarranted interruption without specifying procedures for disciplining handicapped students. This article reviews court decisions in disciplinary cases and provides procedural guidelines to follow in disciplining handicapped students. (MD)

  17. Estimating MCC System Dryness Index using the Vineyard Water Indicator

    Directory of Open Access Journals (Sweden)

    Conceição Marco Antônio Fonseca

    2016-01-01

    Full Text Available The Dryness Index (DI is one of the three Geoviticulture Multicriteria Climatic Classification System (MCC System indices and its calculation is based on a soil water balance approach. However, other climatic indices can be used for the same purpose. One of them is the Vineyard Water Indicator (VWI that represents the ratio between the total rainfall and the vineyard water requirement during the productive period of the culture. When compared to DI, the VWI presents a simpler calculation methodology. Therefore, the aim of the present study was to establish a model to estimate DI based on VWI values. Climate data of 80 winegrowing regions in 18 countries were used. Four regression models were evaluated: linear, quadratic, logarithmic and the Mitscherlich model. Real and simulated data were compared using the confidence coefficient (c that corresponds to the product of the correlation coefficient (r by the exactness coefficient (d. The best fit was obtained employing the quadratic model and DI can be calculated using the following equation: DI = −363.84 VWI2+ 834.47 VWI – 257.17 (R2 = 0.93, for VHI <0.905. For VHI values equal to or greater than 0.905, DI is constant and equal to 200.

  18. Objective Quantification of Pre-and Postphonosurgery Vocal Fold Vibratory Characteristics Using High-Speed Videoendoscopy and a Harmonic Waveform Model

    Science.gov (United States)

    Ikuma, Takeshi; Kunduk, Melda; McWhorter, Andrew J.

    2014-01-01

    Purpose: The model-based quantitative analysis of high-speed videoendoscopy (HSV) data at a low frame rate of 2,000 frames per second was assessed for its clinical adequacy. Stepwise regression was employed to evaluate the HSV parameters using harmonic models and their relationships to the Voice Handicap Index (VHI). Also, the model-based HSV…

  19. Vocational Reintegration of Handicapped Workers with Assistive Devices

    Science.gov (United States)

    Cooper, N. E.

    1977-01-01

    Two approaches to vocational reintegration of handicapped workers are described: (1) adapting the disabled to the working environment through treatment, therapy, counseling, selective placement, and prostheses, and (2) adapting the working environment to particular handicaps, with the assistive device fitted to the machine or tool rather than to…

  20. The Impact of Handicapping Conditions on Consumer Attitudes in Families.

    Science.gov (United States)

    Collins, Eleanor M.; And Others

    The report summarizes results of a study of attitudes of 222 undergraduate university students (University of Minnesota, Duluth) toward financial decisions involving a family member with a handicap. The Situational Attitude Scale--Handicapped Family Consumer (which assesses attitudes toward parental expenditure of money for siblings or…

  1. "Euthanasia" of Persons with Severe Handicaps: Refuting the Rationalizations.

    Science.gov (United States)

    Lusthaus, Evelyn

    1985-01-01

    The article examines two common rationalizations for euthanasia of persons with severe handicaps and presents arguments to refute them. The article calls for parents, professionals, and friends of persons with severe handicaps to be vocal in refuting euthanasia and its rationales. (Author/CL)

  2. Mortality of mentally handicapped patients after mass inter-hospital ...

    African Journals Online (AJOL)

    1990-08-18

    Aug 18, 1990 ... handicapped group the death rate was as high as 58,5/1 000 because it was an older population. In our patients we observed that in spite of the preparation before transfer, and the improved facilities and nursing care afterwards, there was an increase in the death rate of mentally handicapped patients after ...

  3. Frequency of Divorce Among Parents of Handicapped Children.

    Science.gov (United States)

    Shufeit, Lawrence J.; Wurster, Stanley R.

    Seventy-six parents of handicapped children were surveyed to compare the frequency of divorce in the sample population to that of the U.S. population. A research review revealed that the first-born child causes extensive to severe crises in the parents' marital relationship; that the presence of a child with a handicapping condition causes a…

  4. Academic Self-Handicapping and Achievement: A Meta-Analysis

    Science.gov (United States)

    Schwinger, Malte; Wirthwein, Linda; Lemmer, Gunnar; Steinmayr, Ricarda

    2014-01-01

    Self-handicapping represents a frequently used strategy for regulating the threat to self-esteem elicited by the fear of failing in academic achievement settings. Several studies have documented negative associations between self-handicapping and different educational outcomes, inter alia academic achievement. However, studies on the relation…

  5. Underachievers' Cognitive and Behavioral Strategies--Self-Handicapping at School.

    Science.gov (United States)

    Nurmi, Jari-Erik; And Others

    1995-01-01

    Two studies with a total of 153 junior and senior high-school students and vocational students in Finland investigated whether underachievers applied a self-handicapping or learned-helplessness strategy in achievement contexts. Underachievers seemed to apply a self-handicapping strategy rather than a learned-helplessness approach. (SLD)

  6. Academic Self-Handicapping and Achievement Goals: A Further Examination.

    Science.gov (United States)

    Midgley, Carol; Urdan, Tim

    2001-01-01

    This study extends previous research on the relations among students' personal achievement goals, perceptions of the classroom goal structure, and reports of the use of self-handicapping strategies. Surveys, specific to the math domain, were given to 484 7th-grade students in nine middle schools. Personal performance-avoid goals positively predicted handicapping, whereas personal performance-approach goals did not. Personal task goals negatively predicted handicapping. Perceptions of a performance goal structure positively predicted handicapping, and perceptions of a task goal structure negatively predicted handicapping, independent of personal goals. Median splits used to examine multiple goal profiles revealed that students high in performance-avoid goals used handicapping more than did those low in performance-avoid goals regardless of the level of task goals. Students low in performance-avoid goals and high in task goals handicapped less than those low in both goals. Level of performance-approach goals had little effect on the relation between task goals and handicapping. Copyright 2001 Academic Press.

  7. Self-Handicapping by Task Choice: An Attribute Ambiguity Analysis.

    Science.gov (United States)

    Handelsman, Mitchell M.; And Others

    Self-handicapping strategies are behaviors or choices of performance settings which allow people to maintain self-esteem by avoiding negative self-relevant attributions. People will behave in such a way that accurate, nonambiguous attributions about their performance cannot be made. Research on self-handicapping has focused on clinically relevant…

  8. Siblings of the Handicapped: A Literature Review for School Psychologists.

    Science.gov (United States)

    Hannah, Mary Elizabeth; Midlarsky, Elizabeth

    1985-01-01

    Siblings of handicapped children may have adjustment problems associated with increased family responsibilities, increased parental expectations, and perceived parental neglect in favor of the disabled sibling. Problems may be related to socioeconomic status; family size; age, sex, and birth order of the sibling; and severity of the handicap. (GDC)

  9. Personal Integration Resources of Mentally Handicapped Teenagers into Society

    Science.gov (United States)

    Konovalova, Natalia

    2016-01-01

    The paper deals with the issues concerning the study of mentally handicapped teenagers' integrative potential within modernisation of contemporary Russian education. The research is concentrated on the study of personal and social determinants influencing the readiness of mentally handicapped students to be integrated into the environment.…

  10. Non-Discriminatory Psychological Assessment of the Handicapped.

    Science.gov (United States)

    Phelps, William R.

    In 1979 the National Research Council established a panel to study testing of handicapped people for selection and placement purposes in educational and employment settings. The study involved the review of relevant literature, solicitation of pertinent information from organizations representing handicapped persons and from professionals involved…

  11. Antroduodenal motility in neurologically handicapped children with feeding intolerance

    Directory of Open Access Journals (Sweden)

    Werlin Steven L

    2004-09-01

    Full Text Available Abstract Background Dysphagia and feeding intolerance are common in neurologically handicapped children. The aim is to determine the etiologies of feeding intolerance in neurologically handicapped children who are intolerant of tube feedings. Methods Eighteen neurologically handicapped children, followed in the Tube Feeding Clinic at the Children's Hospital of Wisconsin who were intolerant of gastrostomy feedings. The charts of these 18 patients were reviewed. Past medical history, diagnoses, history of fundoplication and results of various tests of gastrointestinal function including barium contrast radiography, endoscopy and antroduodenal manometry were documented. Results Five of 11 children had abnormal barium upper gastrointestinal series. Seven of 14 had abnormal liquid phase gastric emptying tests. Two of 16 had esophagitis on endoscopy. All 18 children had abnormal antroduodenal motility. Conclusions In neurologically handicapped children foregut dysmotility may be more common than is generally recognized and can explain many of the upper gastrointestinal symptoms in neurologically handicapped children.

  12. Factors related to tinnitus and hyperacusis handicap in older people.

    Science.gov (United States)

    Aazh, Hashir; Lammaing, Karen; Moore, Brian C J

    2017-09-01

    The aim was to assess factors related to tinnitus and hyperacusis handicap in older people. Retrospective cross-sectional. Data were gathered for 184 patients with an average age of 69 years. Tinnitus handicap as measured via the Tinnitus Handicap Inventory (THI) was significantly predicted by tinnitus annoyance as measured via the visual analogue scale (VAS) (regression coefficient, b = 2.9, p tinnitus on the patient's life as measured via the VAS (b = 3.9, p tinnitus annoyance significantly predicts tinnitus handicap, it is important to explore factors associated with annoyance that may be useful in designing appropriate rehabilitative interventions aimed at reducing tinnitus handicap in older people. Future studies should explore whether hyperacusis and insomnia in older people with tinnitus need to be managed in conjunction with treatment for depression.

  13. The Dance Within: A Pilot Project in Dance for the Handicapped and Teaching Dance for the Handicapped: A Curriculum Guide.

    Science.gov (United States)

    Michigan Dance Association, Lansing.

    The Michigan Dance Association's Dance Project for the Handicapped is the subject of the two pamphlets that make up this document. The first pamphlet, "The Dance Within," describes the history, nature and goals of the Jackson Pilot Project, the first handicapped dance program in Michigan; it also offers suggestions on how to set up similar…

  14. Laterality of cerebral hemispheres on CT scan and gross motor function in severely handicapped children

    Energy Technology Data Exchange (ETDEWEB)

    Iwasaki, Nobuaki; Hamano, Kenzo; Nakamoto, Natsue; Okada, Yusuke [Tsukuba Univ., Ibaraki (Japan); Takeya, Toshiki

    1997-06-01

    The relation between brain damage and gross motor function in severely handicapped children (spastic type) was studied. The subjects were fifteen cases with laterality in their cerebral hemisphere CT scans (laterality group) and 28 cases with no laterality (control group). All cases were divided into four groups according to the level of gross motor function. The grade of brain damage was estimated based on CT scan analysis using the following parameters and index: maximum frontal extracerebral space (ES), maximum width of Sylvian fissure (SY), Evans` ratio, and cella media index. In the laterality group, the parameters and index were measured for both cerebral hemispheres, respectively. In the more severely disturbed hemisphere of the laterality group, ES and SY were significantly enlarged compared with those of the cases with the same level of motor function in the control group (p<0.01). In the less severely disturbed hemisphere of the laterality group, the ES, SY, Evans` ratio and cell media index were not significantly enlarged compared to cases with the same level of motor function as the control group. These findings may indicate that gross motor function of severely handicapped children is closely related to the less severely disturbed cerebral hemisphere. (author)

  15. Laterality of cerebral hemispheres on CT scan and gross motor function in severely handicapped children

    International Nuclear Information System (INIS)

    Iwasaki, Nobuaki; Hamano, Kenzo; Nakamoto, Natsue; Okada, Yusuke; Takeya, Toshiki.

    1997-01-01

    The relation between brain damage and gross motor function in severely handicapped children (spastic type) was studied. The subjects were fifteen cases with laterality in their cerebral hemisphere CT scans (laterality group) and 28 cases with no laterality (control group). All cases were divided into four groups according to the level of gross motor function. The grade of brain damage was estimated based on CT scan analysis using the following parameters and index: maximum frontal extracerebral space (ES), maximum width of Sylvian fissure (SY), Evans' ratio, and cella media index. In the laterality group, the parameters and index were measured for both cerebral hemispheres, respectively. In the more severely disturbed hemisphere of the laterality group, ES and SY were significantly enlarged compared with those of the cases with the same level of motor function in the control group (p<0.01). In the less severely disturbed hemisphere of the laterality group, the ES, SY, Evans' ratio and cell media index were not significantly enlarged compared to cases with the same level of motor function as the control group. These findings may indicate that gross motor function of severely handicapped children is closely related to the less severely disturbed cerebral hemisphere. (author)

  16. Desvantagem vocal em cantores de igreja Vocal handicap of church singers

    Directory of Open Access Journals (Sweden)

    Tatiane Prestes

    2012-10-01

    containing questions about self-perception of singing and vocal practices and the protocol Modern Singing Handicap Index (MSHI, composed by 30 questions regarding disability, handicap, and defect. We performed a screening for perceptual classification of adapted or changed voices, and measured the degrees of change. RESULTS: the total average score was 23 points in the MSHI. The highest subscale scores obtained were "defect" (10.9, followed by "disability" (7.6 and "handicap" (4.5, with the difference between them (p = 0.001. Singers who have never passed through singing lesson had higher scores in the "handicap" (p = 0.003. The higher was the score of MSHI, the score given by singers in relation to their own voice sank (p = 0.046. Participants with altered voice quality had higher scores on handicap and disability subscales and on total domination of MSHI when compared with those who have adapted vocal quality (p = 0.012, p = 0.049 and p = 0.015, respectively. Moreover, the greater is the degree of voice alteration, increased scores were related to disability subscale (p = 0.022. CONCLUSION: church singers have major vocal handicap. When you have voice disorders, this handicap is even greater. The higher is the degree of voice alteration, the greater are the limitations regarding the singing voice. Vocal singing lessons seem to minimize the handicap.

  17. A Comparison of the Long-term Health Related Quality of Life and Handicap of Stroke Patients in Mainland China and Hong Kong

    Directory of Open Access Journals (Sweden)

    T Kwok

    2010-01-01

    Full Text Available Purpose To compare health related quality of life (HRQOL and handicap of stroke survivors in Hong Kong (HK and Chengdu (CD in Mainland China. Method Fifty-four pairs of first ever stroke patients in CD and in HK matched by age, sex and Modified Barthel Index (MBI were interviewed using a structured questionnaire at 16–36 months after stroke. HRQOL and handicap outcomes were evaluated by the Chinese version of the Short-Form Health Survey (SF-36 and London Handicap Scale (LHS respectively. Results Compared to stroke patients in CD, HK subjects reported significantly greater handicap, especially in the occupation domain. HK subjects also had significantly lower HRQOL Z scores in domains of role limitations due to emotional or physical problems, and bodily pain. CD subjects had more social support, but had more difficulties in meeting medical costs, and were less likely to have regular medical follow-up and dysphagia symptom. After adjusting for social and health related factors, the site differences in handicap and the role limitation (physical domain of SF36 became insignificant. Conclusions CD stroke survivors had better scores in HRQOL and fewer handicaps than their counterparts in HK, because of social and health related factors.

  18. Parents' Evaluations of Their Children's Dysphonia: The Mamas and the Papas.

    Science.gov (United States)

    Amir, Ofer; Wolf, Michael; Mick, Liron; Levi, Omer; Primov-Fever, Adi

    2015-07-01

    This study aimed to evaluate the validity and reliability of a Hebrew translation of the Pediatric Voice Handicap Index (pVHI). It also examined differences between mothers and fathers in evaluating their child's dysphonia. Observational design. The pVHI was first translated and adapted to Hebrew. The translated version was, then, administered to a group of 141 parents of children aged younger than 14 years. Fifty-eight parents had a dysphonic child, and 83 had a nondysphonic child. Based on the parents' responses to the pVHI, statistical analyses were performed, evaluating validity and reliability, as well as group differences. Following, a subset of the participants, in which only cases where the responses of both parents were available, was examined for evaluating differences between the responses of mothers (n = 46) and fathers (n = 46). Statistical analyses revealed high reliability of the Hebrew version of the pVHI (Cronbach alpha = .97). Parents of the dysphonic children rated their children significantly higher than parents of the nondysphonic group (P  0.05). The Hebrew version of the pVHI is a reliable tool for quantifying parents' perception of their child's voice handicap. Mothers of dysphonic children evaluate their children's voice handicap more severely than fathers, whereas both parents of nondysphonic children perform this evaluation similarly. Copyright © 2015 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  19. Translation, validity, and reliability of a persian version of the iowa tinnitus handicap questionnaire.

    Science.gov (United States)

    Arian Nahad, Homa; Rouzbahani, Masomeh; Jarollahi, Farnoush; Jalaie, Shohreh; Pourbakht, Akram; Mokrian, Helnaz; Mahdi, Parvane; Amali, Amin; Nodin Zadeh, Abdolmajid

    2014-04-01

    Tinnitus is a common otologic symptom that can seriously affect a patient's quality of life. The purpose of the present study was to translate and validate the Iowa Tinnitus Handicap Questionnaire (THQ) into the Persian language, and to make it applicable as a tool for determining the effects of tinnitus on a patient's life. The main version of the THQ was translated into the Persian language. The agreed Persian version was administered to 150 tinnitus patients. The validity of the Persian THQ was evaluated and internal reliability was confirmed using Cronbach's α-coefficient. Finally, the effect of independent variables such as age, mean patient threshold, gender, and duration of tinnitus were considered in order to determine the psychometric properties of tinnitus. After an exact translation process, the Persian THQ was found to exhibit face validity. In terms of content validity, content validity index in total questionnaire was 0.93. Further, in structural validity measurements, intermediate correlation with annoyance from tinnitus (r=0.49), low correlation with duration of tinnitus (r=0.34) and high correlation with the Tinnitus Handicap Inventory (THI) questionnaire (r=0.84) were demonstrated. Additionally, a negligible effect of gender and age was noted on degree of tinnitus handicap (P= 0.754, P= 0.573, respectively). In the internal reliability assessment for Factors 1, 2, 3, and the whole questionnaire, Cronbach`s α-coefficient was 0.95, 0.92, 0.25 and 0.88, respectively. The Persian version of the Iowa THQ demonstrates high validity and reliability and can be used for the determination of tinnitus handicap and for following-up in the intervention process in Persian tinnitus patients.

  20. The Role of Classroom Goal Structure in Students' Use of Self-Handicapping Strategies.

    Science.gov (United States)

    Urdan, Tim; Midgley, Carol; Anderman, Eric M.

    1998-01-01

    Surveyed 656 fifth graders on their use of self-handicapping strategies and examined predictors of self-handicapping. Boys used handicapping more than girls did, and grade point average and perceived academic competence were negatively related to handicapping. Ability goal structure and teaching practices highlighting relative ability were…

  1. Self-handicapping status, claimed self-handicaps and reduced practice effort following success and failure feedback.

    Science.gov (United States)

    Thompson, T; Richardson, A

    2001-03-01

    Self-handicapping involves the strategic establishment of an impediment or obstacle to success prior to a performance situation which thereby provides a convenient excuse for poor performance. The study sought to establish that relative to low trait self-handicappers, high trait self-handicappers exposed to failure in an intellectually evaluative situation will (a) pre-emptively claim more handicaps, and (b) behaviourally self-handicap through reduced practice effort, and (c) report greater anxiety and negative affect relative to low trait self-handicappers. Participants were 72 undergraduate students, divided equally between high and low self-handicapping groups. This study utilised a 2 (self-handicapping status: high, low) x 3 (performance feedback: fail, low task importance; fail, high task importance; success) between-subjects factorial design to investigate claimed and behavioural self-handicapping through reduced practice effort. This was done by manipulating performance outcome and perceived task importance. Relative to low trait self-handicappers, high trait high self-handicappers claimed more handicaps and engaged in greater behavioural self-handicapping following failure when working on tasks that were described as potentially diagnostic of low ability. While low self-handicappers internalised their success more than their failure in the high task importance condition, high self-handicappers were undifferentiated in their attributions across performance conditions. Greater anxiety and greater negative affect were also characteristic of high self-handicappers. The study highlights the self-protective benefit of self-handicapping in sparing the individual from conclusions of low ability, and the failure of high self-handicappers to fully internalise their success. These elements and the role of uncertain estimates of ability are discussed in considering implications for intervention.

  2. Voice restoration following total laryngectomy by tracheoesophageal prosthesis: Effect on patients' quality of life and voice handicap in Jordan

    Directory of Open Access Journals (Sweden)

    Wreikat Mahmoud M

    2008-03-01

    Full Text Available Abstract Background Little has been reported about the impact of tracheoesophageal (TE speech on individuals in the Middle East where the procedure has been gaining in popularity. After total laryngectomy, individuals in Europe and North America have rated their quality of life as being lower than non-laryngectomized individuals. The purpose of this study was to evaluate changes in quality of life and degree of voice handicap reported by laryngectomized speakers from Jordan before and after establishment of TE speech. Methods Twelve male Jordanian laryngectomees completed the University of Michigan Head & Neck Quality of Life instrument and the Voice Handicap Index pre- and post-TE puncture. Results All subjects showed significant improvements in their quality of life following successful prosthetic voice restoration. In addition, voice handicap scores were significantly reduced from pre- to post-TE puncture. Conclusion Tracheoesophageal speech significantly improved the quality of life and limited the voice handicap imposed by total laryngectomy. This method of voice restoration has been used for a number of years in other countries and now appears to be a viable alternative within Jordan.

  3. Self-reported versus behavioral self-handicapping: empirical evidence for a theoretical distinction.

    Science.gov (United States)

    Hirt, E R; Deppe, R K; Gordon, L J

    1991-12-01

    The present study was an investigation of how Ss would respond when given 2 self-handicapping options, 1 behavioral (withdrawal of practice effort) and 1 self-reported (reporting high levels of stress). Ss anticipating a diagnostic test of intellectual ability were given different instructions regarding the effects of stress and practice on test performance. Ss were told that (a) stress only, (b) practice only, (c) both stress and practice, or (d) neither stress nor practice affected test scores. Ss were then given the opportunity to self-report a handicap on a stress inventory and to behaviorally self-handicap by failing to practice before the test. High self-handicapping men and women showed evidence of self-reported handicapping, but only high self-handicapping men behaviorally self-handicapped. However, when both self-handicaps were viable, both high self-handicapping men and women preferred the self-reported over the behavioral self-handicap.

  4. Horticulture for Secondary Level Handicapped Adolescents: The Cherokee County Model.

    Science.gov (United States)

    Frith, Greg H.; And Others

    1981-01-01

    The Cherokee County (Alabama) horticulture training program provides 40 mildly mentally retarded adolescents with vocational training in a marketable skills. The broad spectrum of vocational skills makes horticulture ideal for the handicapped. (DB)

  5. Handicaps for the large scale commercial application of micropropagation.

    NARCIS (Netherlands)

    Pierik, R.L.M.

    1988-01-01

    In the last 10 years micropropagation has shown a spectacular development. However, at present the widespread use of micropropagation is handicapped by the following facts: Frequently mutations occur, particularly when applying the adventitious bud technique and callus systems. Basic knowledge

  6. Sexuality and the Developmentally Handicapped: Health Education Strategies.

    Science.gov (United States)

    Martin, Mary-Lou; Forchuk, Cheryl

    1987-01-01

    The article describes a sex education program for small groups of developmentally handicapped adolescents and young adults which includes information on and discussion of body parts, acceptable social behavior, assertiveness, birth control, and sexually transmitted diseases. (Author/JW)

  7. Personal, interpersonal, and situational influences on behavioral self-handicapping.

    Science.gov (United States)

    Brown, Christina M; Kimble, Charles E

    2009-12-01

    This study explored the combined effects of personal factors (participant sex), interpersonal factors (experimenter sex), and situational factors (performance feedback) on two forms of behavioral self-handicapping. Participants received non-contingent success or failure feedback concerning their performance on a novel ability and were given the opportunity to self-handicap before performing again. Behavioral self-handicapping took the form of (a) exerting less practice effort (practice) or (b) choosing a performance-debilitating tape (choice). Men practiced least after failure feedback and chose a debilitating tape if they were interacting with a female experimenter. Generally, across all participants in both choice and practice conditions, high performance concern and the presence of a male experimenter led to the most self-handicapping. Results are interpreted in terms of self-presentational concerns that emphasize a desire to impress or an awareness of the female or male experimenter's acceptance of self-handicappers.

  8. Effect of maternal education on the rate of childhood handicap.

    Science.gov (United States)

    Shawky, S; Milaat, W M; Abalkhail, B A; Soliman, N K

    2001-01-01

    The objectives of this study were to determine the relation between maternal education and various maternal risk factors, identify the impact of maternal education on the risk of childhood handicap and estimate the proportion of childhood handicap that can be prevented by maternal education. Data was collected from all married women attending the two major maternity and child hospitals in Jeddah during April 1999. Women with at least one living child were interviewed for sociodemographic factors and having at least one handicapped child. The risk of having a handicapped child and the population attributable risk percent were calculated. Some potential risk factors are dominant in our society as approximately 30% of women did not attend school and 84% did not work. Consanguineous marriages accounted for about 43%. Pre-marriage counseling was limited as only 10% of women counseled before marriage. The proportion of unemployment and consanguineous marriages decreased significantly by increase in maternal education level. Conversely, the proportion of women reporting pre-marriage counseling increased significantly by increase in maternal education level. Approximately, 7% of women reported having at least one handicapped child. The risk of having a handicapped child showed a significant sharp decline with increase in maternal education level. At least 25% of childhood handicap can be prevented by achieving female primary education and up to half of cases can be prevented if mothers finish their intermediate education. Female education plays a major role in child health. The results of this study suggest investment in female education, which would have substantial positive effects in reducing incidence of childhood handicap in Jeddah.

  9. Self-Handicapping and Its Impact on Mental Health

    Directory of Open Access Journals (Sweden)

    Yeter Sinem Uzar Ozcetin

    2016-06-01

    Full Text Available Self handicapping is characterized by experiencing anxiety at succeeding a mission although the person has the capacity to fulfill the assignment or duty. It describes one's showing tendency to link own failures to problems in own performance instead of own abilities to protect oneself from the possibility of failure. When individuals care about performance much but doubt about success, they display self-handicapping strategies to protect their self. Self-handicappers try to protect their self by internalizing successes and externalizing failures. This strategies help them feel well in both successes and failures. Self-handicapping becomes a trait of personality in time and the individual begins to use it continuously as a negative coping mechanism to protect his/her self and to avoid failures. These actions eliminates the capability of rational thinking and prevents solution of the problems as a result of irrational interpretations. Self-handicapping causes the decrease of life satisfaction and motivation, and causes the increase of maladaptation, negative mood, somatic symptoms and alcohol-drug abuse. As a conclusion, self-handicapping hinders performance and this negative performance influences adaptation and psychological well-being. The most essential approach to prevent occurrence of self-handicapping behaviours is empowerment of the self. [Psikiyatride Guncel Yaklasimlar - Current Approaches in Psychiatry 2016; 8(2: 145-154

  10. [Physical handicapped, economic practices and matrimonial strategies in Senegal].

    Science.gov (United States)

    Fassin, D

    1991-01-01

    Social relations around the handicapped are generally presented in terms of economic dependence and social inadaptation. This point of view leads to give greater importance, especially in Africa, to studying the way in which group and society help the physically or mentally ill. Actually, this approach does not give a complete account about the real situation of the handicapped in social relations of production and reproduction. From a series of in-depth interviews conducted in handicapped families of the suburbs of Dakar, two aspects are analyzed: the economic role of the handicapped, through the circulation of the product of his begging in his household or through the exploitation of his work as apprentice in a workshop; and his value on the marriage market, where invalid persons are given without dowry if they are women, and must pay a much more important amount if they are men. The social situation of the handicapped thus is not only a matter of assistance or charity, but as well of strategies that the handicapped and above all his circle implement in order to take advantage of the stigma or on the contrary try to erase it.

  11. Academic Goals and Self-Handicapping Strategies in University Students.

    Science.gov (United States)

    Ferradás, María del Mar; Freire, Carlos; Valle, Antonio; Núñez, José Carlos

    2016-05-23

    In highly competitive settings like university, the fear of failure leads some students to protect their self-worth using self-handicapping strategies. The present investigation examines to what extent academic goals are related to those tactics in university students. Specifically, MANCOVA was applied to estimate statistical differences linked to behavioral and claimed self-handicapping strategies according to the level (high/medium/low) of four types of academic goal (achievement approach, achievement avoidance, mastery approach, and work avoidance). Degree, year in school, and gender were entered as covariates. 940 students (86.5% women) from University of A Coruña (M = 20.44; SD = 1.73) participated. Results show that: (a) both behavioral and claimed self-handicapping are promoted by ego-oriented goals (achievement avoidance, F(2, 937) = 23.56, p self-handicapping (F(2, 937) = 9.09, p self-handicapping; and (c) mastery approach goals are significantly, negatively related to both types of self-handicapping (F(2, 937) = 20.09, p < .001, η p 2 = .041). Psychological and educational implications of the findings are discussed.

  12. Discussion of the dizziness handicap inventory.

    Science.gov (United States)

    Mutlu, Basak; Serbetcioglu, Bulent

    2013-01-01

    A review of the Dizziness Handicap Inventory (DHI). NUMBER OF STUDIES: Seventy-four studies. Articles published between January 1990 and May 2012 were identified by searches in PubMed electronic database. Of the 227 articles meeting the inclusion criteria 74 were reviewed. These articles are discussed under nine topics; Reliability, validity and internal consistency of the original version of DHI, relationship between vestibular/balance tests and DHI, association between DHI and the other scales related to balance impairments, exploratory factor analysis of the DHI, screening version of DHI, translations of DHI into other languages, the role of DHI to assess the success of the treatment of balance disorder, DHI results in various vestibular disorders, general characteristics of DHI in patients with balance impairment. Self reported measures represent unique pieces of the information important for the management of dizzy patients. DHI is the most widely used self reported measurement of patients with dizziness. It has been translated into fourteen languages, so it is widely accepted.

  13. INDEXING AND INDEX FUNDS

    Directory of Open Access Journals (Sweden)

    HAKAN SARITAŞ

    2013-06-01

    Full Text Available Proponents of the efficient market hypothesis believe that active portfolio management is largely wasted effort and unlikely to justify the expenses incurred. Therefore, they advocate a passive investment strategy that makes no attempt to outsmart the market. One common strategy for passive management is indexing where a fund is designed to replicate the performance of a broad-based index of stocks and bonds. Traditionally, indexing was used by institutional investors, but today, the use of index funds proliferated among individual investors. Over the years, both international and domestic index funds have disproportionately outperformed the market more than the actively managed funds have.

  14. SYNCHRONIC DISTANCE EDUCATION FROM THE PERSPECTIVE OF A HANDICAPPED PERSON

    Directory of Open Access Journals (Sweden)

    Hasan KARAL

    2011-04-01

    Full Text Available Nowadays knowledge and communication technologies are developing rapidly and changing people’s lives. With the help of the developing technologies, people can access knowledge independent of time and place and distance education technologies offer handicapped students a range of opportunities in order that they may access a better level of education. By defining perceptions related to the distance education of a physically handicapped student engaged in a program of synchrony distance education at Karadeniz Technical University to throw a fresh light on this topic. Due to the nature research problem, phenomenology, one of qualitative research patterns, was used in this study which has a qualitative character. In this study, because it was intended to present a handicapped person’s thoughts related to distance education, semi-structured interview, one of qualitative data collection techniques was thought to be the most appropriate data collection instrument. The sampling of the research included the handicapped student receiving courses by synchrony distance education in Karadeniz Technical University, two friends of the student following the same course and the assistant in the course environment. The interviews were recorded with a video camera, a transcript of each of the interviews was prepared and the data was analyzed scientifically. In the light of the research findings, it was decided that the synchrony distance education environment helped handicapped person feel more secure and relaxed and for his handicap not to be noticed by others. In addition, without the lecturers’ feeling of compassion, it presented handicapped student with an opportunity to prove himself. Also, because the courses classes? were recorded in this environment, students could review the content of the class in their own time and this process could be repeated, thus the students could learn at their own speed.

  15. Dysphonia in nursing home and assisted living residents: prevalence and association with frailty.

    Science.gov (United States)

    G Nichols, Brent; Varadarajan, Varun; Bock, Jonathan M; Blumin, Joel H

    2015-01-01

    Previous studies of geriatric dysphonia prevalence have been limited to ambulatory outpatient and senior communities. Our goal was to identify prevalence of dysphonia in nursing home residents and assisted living residents and search for correlations between indices of dysphonia and indices of frailty. Prospective epidemiological survey. Residents of a vertically integrated senior care organization who were 65 or older and able to understand and complete the questionnaire were recruited to complete the voice handicap index 10 (VHI-10) to assess for dysphonia (VHI-10 > 10 = dysphonia) and Vulnerable Elders Survey 13 (VES-13), a validated instrument to assess for frailty (VES > 3 = frailty). A total of 119 residents were surveyed. Thirty-three percent of nursing home residents, and 25% of assisted living residents reported dysphonia with 29% of all respondents reporting dysphonia. The mean VHI-10 was 7.4, the median was 5, and the interquartile range was 2-12.5. There was a significant relationship between VHI-10 and VES-13 score (P = 0.029). There were no statistically significant relationships between frailty, age, or type of living and dysphonia or VHI-10. There is a high prevalence of voice dysfunction in assisted living and nursing home residents. The correlation between VHI-10 and VES-13 suggests that voice declines as frailty increases. Copyright © 2015 The Voice Foundation. All rights reserved.

  16. Personality traits, age and sex as predictors for self-handicapping tendency

    Directory of Open Access Journals (Sweden)

    Čolović Petar

    2009-01-01

    Full Text Available Self-handicapping is one of the strategies people use when facing potential failure. Paper presents new scale for assessing self-handicapping tendency as relatively stable trait, as well as its relations with personality traits, sex and age. Self-handicapping questionnaire and shortened form of Zuckerman-Kuhlman Personality Questionnaire were administered to 230 participants of both sexes, age 18 to 59. Confirmatory factor analysis shows that model with four latent dimensions, encompassed by a higher-order latent dimension, fits the data well. Those lower order dimensions correspond to originally created scales: External handicaps in interpersonal area, Internal handicaps in interpersonal area, Internal handicaps in achievement area and External handicaps in achievement area. Results of MANCOVA shows that Neuroticism is predictor of all dimensions of self- handicapping. Impulsive sensation seeking predicts choice of external handicaps in interpersonal area, as well as internal handicaps in achievement area. Latter is predicted also by low Activity. Younger subjects show significantly higher tendency to use internal handicaps, and men in general show more self-handicapping tendency than women, except in choosing internal handicaps in achievement area, where sex shows no significant effect.

  17. Treatment of Orally Handicapped Edentulous Older Adults Using Dental Implants.

    Science.gov (United States)

    Zahedi, Charles

    2016-07-01

    The oral handicap of complete edentulism is the terminal outcome of a multifactorial process involving biological factors and patient-related factors. Fully edentulous orally handicapped older adults have been neglected because removable acrylic dentures have been the classic therapy for complete edentulism but are only rehabilitative, not therapeutic. Not replacing missing teeth with stable dentures could prevent adequate food intake. Osseointegrated endosseous implants used as a therapeutic adjunct can reduce the problem of long-term bone resorption to less than 0.1 mm per year. Implant-borne prostheses substantially increase the overall health and quality of life of orally handicapped fully edentulous older adults. Copyright © 2016 Elsevier Inc. All rights reserved.

  18. DESIGN OF CITY BUS LIFT FOR THE HANDICAPPEDS

    Directory of Open Access Journals (Sweden)

    K. Turgut GÜRSEL

    2003-03-01

    Full Text Available Although the technological developments, the handicappeds do not take part sufficiently in the social and economic life, because buildings, road construction features and means of the transport are not suitable for them. In this study, a lift for handicappeds was designed, that is supposed to be installed to the middle door of city buses. The lift, whose installation should require a few changes at the bus, is driven by a hydraulic system from the street to the level of the bus floor and vice-versa. In the work, at first a construction was developed in accordance with the dimensions of the middle door of a city bus. After determining of dimensions of all elements, a hydraulic mechanism was constructed, that raises the handicapped, its wheelchair and the platform. Furthermore the construction of the elements of the system were determined, and its proofs of strength analysis were indicated

  19. Correlations between self-handicapping and self-defeating personality.

    Science.gov (United States)

    Schill, T; Morales, J; Beyler, J; Tatter, T; Swigert, L

    1991-10-01

    In this study scores on Strube's self-handicapping scale were correlated with scores on Schill's self-defeating personality scale. Berglas believes there are subtypes of self-defeating personality and that his concept of self-handicapping should be correlated with the three criteria which represent a self-protective component of self-defeating personality. Some support for Berglas' proposition was found, particularly for men. However, correlations with other components of self-defeating personality suggest the criteria thought to be self-protective may need to be reconsidered.

  20. Minimizing Teacher Stress. Structuring Positive Interactions for Handicapped and Nonhandicapped Children in Physical Education.

    Science.gov (United States)

    Colvin, Nola R.; And Others

    1982-01-01

    Components of an integrated physical education program, which consists of handicapped and nonhandicapped students, include: (1) activities that promote interaction among all students; (2) strategies that place handicapped and nonhandicapped students together; and (3) reinforcement of cooperative behavior. (CJ)

  1. Growth motivation as a moderator of behavioral self-handicapping in women.

    Science.gov (United States)

    Brown, Christina M; Park, Sun W; Folger, Susan F

    2012-01-01

    Behavioral self-handicapping is a strategy used to protect attributions about ability. People behaviorally self-handicap by creating an obstacle to their success so failure is attributed to the obstacle instead of to their ability. Although past research has observed behavioral self-handicapping exclusively in men, the current research revealed a moderator of behavioral self-handicapping in women: growth motivation, which reflects the desire to develop one's abilities and learn from failure. Participants (N = 100) completed a test purportedly predictive of successful careers and relationships, and some were given failure feedback about their performance. Participants could behaviorally self-handicap by choosing to complete another test in a performance-impairing environment. Although men self-handicapped more overall, women self-handicapped more after failure when they were low in growth motivation. These results highlight a novel moderator of behavioral self-handicapping in women.

  2. 13 CFR 113.3-3 - Structural accommodations for handicapped clients.

    Science.gov (United States)

    2010-01-01

    ... handicapped clients. 113.3-3 Section 113.3-3 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION... ADMINISTRATOR General Provisions § 113.3-3 Structural accommodations for handicapped clients. (a) Existing... by handicapped clients. Where structural changes are necessary to make the recipient's goods or...

  3. Re-Examining the Effects of Noncontingent Success on Self-Handicapping Behaviour

    Science.gov (United States)

    Thompson, T.

    2004-01-01

    Background: Self-handicapping refers to the practice on the part of certain individuals to handicap their performance when poor performance is likely to reveal low ability. Noncontingent success (feedback that is inflated relative to performance) is more likely to promote self-handicapping behaviour than noncontingent failure (failure feedback…

  4. An Assessment of the Self-Protective Function of Self-Handicapping.

    Science.gov (United States)

    Steinhauer, Annie; And Others

    Self-handicapping is the phenomenon of setting oneself up to fail a feared evaluation task to protect a sense of self-worth. A study examined whether individuals self-handicap to protect a general or global perception of themselves or to protect perceptions of competence in the specific domain being evaluated. Handicapping behaviors related to…

  5. Some Costs of Caring at Home for an Intellectually Handicapped Child.

    Science.gov (United States)

    Chetwynd, Jane

    1985-01-01

    Household expenditure patterns of families in the general population were compared with those of 91 families caring for an intellectually handicapped child. Results indicated that handicapped child families spent on average $NZ17 per week more on household items and $NZ7 a week on items related to care of the handicapped child. (Author/CL)

  6. Assessment of Self-Recognition in Young Children with Handicaps.

    Science.gov (United States)

    Kelley, Michael F.; And Others

    1988-01-01

    Thirty young children with handicaps were assessed on five self-recognition mirror tasks. The set of tasks formed a reproducible scale, indicating that these tasks are an appropriate measure of self-recognition in this population. Data analysis suggested that stage of self-recognition is positively and significantly related to cognitive…

  7. Curricular Guidelines for Dental Hygiene Care for the Handicapped.

    Science.gov (United States)

    Journal of Dental Education, 1984

    1984-01-01

    The American Association of Dental Schools' guidelines for dental hygiene curriculum cover the scope and definitions of care for the handicapped, interrelationships between disciplines and courses, a curriculum overview, primary educational goals, prerequisites, a core content outline, specific behavioral objectives, sequencing, faculty, and…

  8. Workshops for the Handicapped; An Annotated Bibliography - No. 6.

    Science.gov (United States)

    Perkins, Dorothy C., Comp.; And Others

    An annotated bibliography of workshops for the handicapped covers the literature on work programs for the period July, 1968 through June, 1969. One hundred and fifty four publications were reviewed; the number of articles on administration, management, and planning of facilities and programs has increased since the last edition. (Author/RJ)

  9. Aerobic energy expenditure of handicapped children after training

    NARCIS (Netherlands)

    Dresen, M. H.; de Groot, G.; Mesa Menor, J. R.; Bouman, L. N.

    1985-01-01

    The effect is reported of a 10-week physical training program, consisting of three sessions with a total duration of two hours weekly, on the physical work capacity and efficiency of physically handicapped children aged 8 to 14 years. The program for the experimental group (n = 6) was an

  10. Demographic and audiological factors as predictors of hearing handicap

    Directory of Open Access Journals (Sweden)

    Leposavić Ljubica

    2006-01-01

    Full Text Available INTRODUCTION Currently available evidence reveals comparatively few studies of psychological effects of hearing impairments, in spite of the fact that clinicians have for a long time been aware of a connection between the acquired hearing impairment and mental disorders. They are focused on the investigation of dysfunction in general. Thus, three domains of the auditory imbalance may be distinguished: disorder, disability and handicap. 'Handicap', according to the definition of the World Health Organization, is a hindrance in an individual that results from an impairment or disability and represents psychological response of the individual to the impairment. OBJECTIVE Validation of acquired hearing impairment as a risk factor of psychical disorders as well as an analysis of relation of some demographic factors (sex, age, education and audiological factors (degree and duration of the impairment with the frequency of hearing handicap. METHOD MMPI-201 has been applied in 60 subjects affected with otosclerosis, potential candidates for stapedectomy, before and after the surgery. RESULTS Individuals with acquired hearing impairment manifest more frequent disorders of psychical functioning in comparison with general population, while demographic and audiometric parameters did not correlate with acquired hearing handicap. CONCLUSION It may be assumed that the very recognition of demographic and audio-logical factors can not help much in the understanding of the psychological stress associated with hearing impairment.

  11. Effects of Handicap and Job Characteristics on Selection Evaluations.

    Science.gov (United States)

    Rose, Gerald L.; Brief, Arthur P.

    1979-01-01

    Business administration students evaluated a hypothetical job applicant who was either an amputee, an epileptic, or "normal." The hypothetical job openings varied as to levels of supervisory responsibility and public contact. With some noted exceptions, the handicapped applicants were evaluated no differently than the normal applicants.…

  12. Signal modulation as a mechanism for handicap disposal

    Science.gov (United States)

    Gavassa, Sat; Silva, Ana C.; Gonzalez, Emmanuel; Stoddard, Philip K.

    2012-01-01

    Signal honesty may be compromised when heightened competition provides incentive for signal exaggeration. Some degree of honesty might be maintained by intrinsic handicap costs on signalling or through imposition of extrinsic costs, such as social punishment of low quality cheaters. Thus, theory predicts a delicate balance between signal enhancement and signal reliability that varies with degree of social competition, handicap cost, and social cost. We investigated whether male sexual signals of the electric fish Brachyhypopomus gauderio would become less reliable predictors of body length when competition provides incentives for males to boost electric signal amplitude. As expected, social competition under natural field conditions and in controlled lab experiments drove males to enhance their signals. However, signal enhancement improved the reliability of the information conveyed by the signal, as revealed in the tightening of the relationship between signal amplitude and body length. Signal augmentation in male B. gauderio was independent of body length, and thus appeared not to be curtailed through punishment of low quality (small) individuals. Rather, all individuals boosted their signals under high competition, but those whose signals were farthest from the predicted value under low competition boosted signal amplitude the most. By elimination, intrinsic handicap cost of signal production, rather than extrinsic social cost, appears to be the basis for the unexpected reinforcement of electric signal honesty under social competition. Signal modulation may provide its greatest advantage to the signaller as a mechanism for handicap disposal under low competition rather than as a mechanism for exaggeration of quality under high competition. PMID:22665940

  13. Game Plans for Victors: New Skills for Severely Handicapped Children.

    Science.gov (United States)

    Schoen, Sharon; And Others

    The paper describes an approach in which games were planned to provide instruction for three severely handicapped children (5-6 years old) with few leisure, social, or academic skills and many aberrant behaviors. The first of two games involved a language program to teach verbal interactions, picture identification, and picture matching. The…

  14. Comprehensive Social Service Programs for Handicapped Citizens through Title XX.

    Science.gov (United States)

    Roten, Shelby Jean

    Reviewed are present and potential services and social programs for handicapped children in Mississippi through purchase of service contracts under Title XX of the Social Security Act. Sections cover the following topics: background and purpose of Title XX which gives states greater control over social service programs, planning state supported…

  15. Social Interpersonal Skills of Handicapped and Nonhandicapped Adults at Work

    OpenAIRE

    Lignugaris/Kraft, Benjamin; Rule, S.; Salzberg, Charles L.; Stowitschek, J. J.

    1986-01-01

    The pattern and content of social interactions of successful handicapped and nonhandicapped employees were observed in two employment settings. Data suggest that both groups were active social interactants who frequently worked cooperatively, yet interacted relatively infrequently with their supervisors. Implications for future research are discussed.

  16. Assessing Transition Service for Handicapped Youth: A Cooperative Interagency Approach.

    Science.gov (United States)

    Stodden, Robert A.; Boone, Rosalie

    1987-01-01

    The article presents a cooperative interagency approach for assessing effectiveness of programs and services to facilitate the transition of handicapped students from school to adult community living. Features of the model include cooperative planning at the policy level, implementation level, and direct service level; and collaboration by state…

  17. Occupational Opportunities for the Physically Handicapped. Part B. Manual.

    Science.gov (United States)

    Uthe, Elaine F.

    This manual presents the master lists of 206 job titles of 167 different Dictionary of Occupational Titles (DOT) code numbers which were held by physically handicapped graduates/completers of vocational programs as determined by a business and industry survey and graduate followup. (The project itself is reported in CE 026 163; survey and followup…

  18. Early Intervention and the Integration of Handicapped and Nonhandicapped Children.

    Science.gov (United States)

    Guralnick, Michael J.

    This collection of 11 articles focuses on integrating handicapped and nonhandicapped children in preschool programs. Article 1 presents arguments for preschool integration. Article 2 discusses research on peer interaction and mixed-age socialization. Article 3 advocates a behavior analysis and operant conditioning approach to studying and…

  19. Common Vocational Training Project for the Handicapped (CVTPH).

    Science.gov (United States)

    Amritmahal, Ananda; Mehta, J. M.

    1987-01-01

    A project of the Poona (India) District Leprosy Committee offers training in the industrial sector to leprosy patients, orthopedically handicapped individuals, and socioeconomically disadvantaged individuals, under a common roof. The project aims to combat the leprosy stigma and to aid rehabilitation by making the trainees economically…

  20. 2001: Employment Odyssey or Opportunity for Persons with Handicapping Conditions?

    Science.gov (United States)

    Linari, Ronald F.; Belmont, Robert M.

    1986-01-01

    Implications of trends in population, families, communications, automation, the environment, and employment changes are noted for the training and employment of handicapped persons. The need for emphasis in vocational education on generalizability, job readiness and vocational adjustment skills, and job analysis is stressed. (CL)

  1. Some Personality Characteristics of Self-Handicapping Behavior.

    Science.gov (United States)

    Levey, Cathy A.

    Based on a modification of Berglas and Jones' (1978) design, conditions of contingent and noncontingent success and failure were manipulated to determine when and why individuals choose to adopt self-handicapping strategies. Male undergraduates (N=76) were informed that they were participating in a study investigating the effects of music on…

  2. Predictors of Middle School Students' Use of Self- Handicapping Strategies.

    Science.gov (United States)

    Midgley, Carol; Urdan, Tim

    1995-01-01

    By procrastinating, allowing others to keep them from studying, deliberately not trying, and using other "self-handicapping" strategies, students can convey that those circumstances, rather than lack of ability, are the reasons for subsequent poor performance. Survey data from 256 eighth-grade students indicated that boys use those strategies more…

  3. Attitudes of Preschool Teachers toward the Integration of Handicapped Children.

    Science.gov (United States)

    Dyson, Lily L.; Kubo, H. Richard

    Forty-six supervisors and teachers were surveyed regarding their attitudes toward integration of handicapped children in a regular preschool program, the helpfulness of supportive services, and the necessary conditions for the integration of their programs. Findings showed that the majority of teachers were in favor of integration and supportive…

  4. Developmental Trampoline Activities for Individuals with Multiple Handicapping Conditions.

    Science.gov (United States)

    Thomas, Bill

    1979-01-01

    The use of trampoline activities with multiple handicapped students is discussed. Management considerations in safety are noted, and developmental trampoline skills are listed beginning with bouncing for stimulation. Progression to limited independence and finally independent jumping is described. The position statement of the American Alliance…

  5. 49 CFR Appendix A to Part 609 - Elderly and Handicapped

    Science.gov (United States)

    2010-10-01

    ... capabilities, are unable without special facilities or special planning or design to utilize mass... planning, facilities, or design. However, deafness is recognized as a handicap in the Department of Transportation's ADA regulation, and applicants for Section 5 assistance are encouraged to include the deaf as...

  6. Employers' Attitudes toward Employing People with Mental Handicap.

    Science.gov (United States)

    Tse, John W. L.

    1993-01-01

    A survey of 66 Hong Kong companies and factories identified factors affecting employers' decisions to hire workers with mental handicaps. The five most important factors were emotional problems and personalities of workers, workers' ability to perform the job, availability of low-level jobs, productivity of workers, and possible special…

  7. Aquatics for the Handicapped--A Review of Literature.

    Science.gov (United States)

    Christie, Irene

    1985-01-01

    The author reviews the literature on aquatic activity for the disabled, discussing the physical, physiological, psychological, and sociological benefits of swimming and water safety activities. Unique properties of water and legal requirements regarding physical education of the handicapped, specifically citing the development of skills in…

  8. Causal uncertainty, claimed and behavioural self-handicapping.

    Science.gov (United States)

    Thompson, Ted; Hepburn, Jonathan

    2003-06-01

    Causal uncertainty beliefs involve doubts about the causes of events, and arise as a consequence of non-contingent evaluative feedback: feedback that leaves the individual uncertain about the causes of his or her achievement outcomes. Individuals high in causal uncertainty are frequently unable to confidently attribute their achievement outcomes, experience anxiety in achievement situations and as a consequence are likely to engage in self-handicapping behaviour. Accordingly, we sought to establish links between trait causal uncertainty, claimed and behavioural self-handicapping. Participants were N=72 undergraduate students divided equally between high and low causally uncertain groups. We used a 2 (causal uncertainty status: high, low) x 3 (performance feedback condition: success, non-contingent success, non-contingent failure) between-subjects factorial design to examine the effects of causal uncertainty on achievement behaviour. Following performance feedback, participants completed 20 single-solution anagrams and 12 remote associate tasks serving as performance measures, and 16 unicursal tasks to assess practice effort. Participants also completed measures of claimed handicaps, state anxiety and attributions. Relative to low causally uncertain participants, high causally uncertain participants claimed more handicaps prior to performance on the anagrams and remote associates, reported higher anxiety, attributed their failure to internal, stable factors, and reduced practice effort on the unicursal tasks, evident in fewer unicursal tasks solved. These findings confirm links between trait causal uncertainty and claimed and behavioural self-handicapping, highlighting the need for educators to facilitate means by which students can achieve surety in the manner in which they attribute the causes of their achievement outcomes.

  9. Inter-relationship of intelligence-quotient and self-concept with dental caries amongst socially handicapped orphan children.

    Science.gov (United States)

    Virk, Pks; Jain, R L; Pathak, A; Sharma, U; Rajput, J S

    2012-01-01

    India has been the focus of many health surveys among normal, physically, and mentally handicapped children. However, the data, concerning oral health conditions of socially handicapped children living in orphanages, are scanty. To study the effect of parental inadequacy, environmental deprivation, and emotional disturbances on dental caries through intelligence quotient (IQ) and self-concept in orphan children and also to co-relate dental caries with different levels of IQ and self-concept. The study was carried out amongst socially handicapped children living in orphanages. 100 children in the age group of 10-14 years from orphanages were selected. Malin's Intelligence Scale for Indian Children (MISIC) was used to assess the intelligence quotient; self-concept questionnaire to assess self-concept of the child and recording of dental caries status of children was done as per WHO Index (1997). To assess the relationship of dental caries with IQ, student's unpaired t-test was used and; to find the relationship between self-concept and dental caries, Karl-Pearson's coefficient of co-relation was applied. the children in orphanages had a lower IQ and high caries experience but had an above average self-concept. There was also no co-relation between dental caries and self-concept. Orphan children, being socially handicapped, are at an increased risk for dental caries due to a lower IQ level, parental deprivation, and institutionalization. Moreover, lack of co-relation between dental caries and self-concept could be explained by the fact that dental caries is a lifelong process whereas different dimensions of self-concept are in a state of constant flux.

  10. Self-Assessed Hearing Handicap in Older Adults with Poorer-than-Predicted Speech Recognition in Noise

    Science.gov (United States)

    Eckert, Mark A.; Matthews, Lois J.; Dubno, Judy R.

    2017-01-01

    Purpose: Even older adults with relatively mild hearing loss report hearing handicap, suggesting that hearing handicap is not completely explained by reduced speech audibility. Method: We examined the extent to which self-assessed ratings of hearing handicap using the Hearing Handicap Inventory for the Elderly (HHIE; Ventry & Weinstein, 1982)…

  11. Assessment of voice related quality of life and its correlation with socioeconomic status after total laryngectomy.

    Science.gov (United States)

    Agarwal, Sangeet Kumar; Gogia, Shweta; Agarwal, Alok; Agarwal, Rajiv; Mathur, Ajay Swaroop

    2015-10-01

    After total laryngectomy for laryngeal cancer, the major determinants of QOL is the patient's voice related quality of life (V-RQOL). The primary aim of this study was to assess the V-RQOL and impact of socioeconomic status over it in Indian population by using two validated scales [voice handicap index (VHI) and V-RQOL questionnaires]. Total 104 patients underwent total laryngectomy but 71 were eligible for study. Patients filled the VHI and V-RQOL questionnaires after completion of 1 year of usage of the TEP voice. The socioeconomic status of the patients was calculated according to various domains related to their life and were divided into lower and higher status. A total of 76.1% patients had VHI score between 0 to 30 (minimal voice handicap), 19.7% had score between 31 to 60 (moderate voice handicap) and only 4.2% patients had VHI score more than 61 (serious voice handicap). On V-RQOL scores, 16.9% patients had score between 10 to 15 (excellent), 40.8% patients, between 16 to 20 (very good), 22.5% patients, between 21 and 25 (good voice), 15.5% patients, between 26 and 30 (fair) and only 4.2% patients scored more than 30 with poor quality of voice. Patients with lower socioeconomic group had better V-RQOL than with high socioeconomic group. VHI and V-RQOL scores in our series were superior to other studies due to major population with lower socioeconomic status and better social support which exists in our society.

  12. Evaluation of attitudes of university students for handicapped individuals

    Directory of Open Access Journals (Sweden)

    Özkan Zekiye

    2017-01-01

    Full Text Available Education has an important role in humans’ behaviours. Undergraduate education has headed among factors that influence maturation period before vocational lifes of individuals. The purpose of this study is to determine whether attitudes of university students for handicapped individuals differ according to some variables. This study which was carried out in screening model was done with 1167 people including 646 females 521 males who maintain their education at faculties taking initial teacher training in 2016 spring term at Yuzuncu Yil University. As data collection tool, Attitude Scale for Being Educated of Handicapped Individuals and Personal Information Form, which was developed by Kosterilioglu [12], was used. As statistical method, Duncan’s multiple range test was used in determining different groups following one-wat analysis of variance. Among these variables, pearson coefficients of correlation were calculated separately in groups in determining relation. In determining relationship between groups and categorical variables , chi square test was used. In calculations, value of p was taken as 0,05 and SPSS statistic program was used for calculations. While point average of attitudes of male students , who maintain their educations at Yuzuncu Yil University, for handicapped people was ascertained as 54.27±23.54, point average of attitudes of female students was determined as 55.86±26.34. A significant difference between male and female students according to gender variable was not seen in attitudes for being educated of handicapped individuals (P>0,05. It was observed that attitudes for being educated of handicapped individuals in starting and end of undergraduate term were higher than intermediate classes (P<0,01. Although a significant difference in kind of high schools from which students graduated was not seen, attitudes of graduates from science and sport high schools were found higher than graduates from other high schools

  13. Voice-controlled Internet Browsing for Motor-handicapped Users

    DEFF Research Database (Denmark)

    Brøndsted, Tom; Aaskoven, Erik

    2006-01-01

    The public-funded project "Indtal" ("Speak-it") has succeeded in developing a Danish voice-controlled utility for internet browsing targeting motor-handicapped users having difficulties using a standard keyboard and/or a standard mouse. The system has been designed and implemented in collaboration...... with an advisory board of motor-handicapped (potential) end-users and underlies a number of a priori defined design criteria: learnability and memorability rather than naturalness, minimal need for maintenance after release, support for "all" web standards (not just HTML conforming to certain "recommendations......"), independency of the language on the websites being browsed, etc. These criteria have lead to a primarily message-driven system interacting with an existing browser on the end users' systems...

  14. Military Families with Handicapped Children: The Reassignment Problem

    Science.gov (United States)

    1981-02-01

    of them ( education service center, Lub- bock Medical facilities , Lubbock State School, psychiatric facilities , etc.) 18. Additional comments: Rapidly...Attached DD ) AN 73 1473 EDITION OF I NOV6GS IS OBSOLETE UNCL 23 Oct 81 8 1 10 2oc 0 6 2 !CURITY CLASSIFICATION OF THIS PAGE (I7,n Data Entered) AIR WAR...COLLEGE AIR UNIVERSITY Report No. MS107-81 MILITARY FAMILIES WITH HANDICAPPED CHILDREN: THE REASSIGNMENT PROBLEM (A (WiDE TO SPECIAL EDUCATION AVAILABLE

  15. Development of bladder control in mentally handicapped children

    Directory of Open Access Journals (Sweden)

    Bruschini Homero

    2003-01-01

    Full Text Available PURPOSE:To analyze the role of mental handicap as a possible source of lack of development of bladder control and to find out the chance of continence to advise future patients. MATERIALS AND METHODS: The parents and relatives of 100 consecutive mentally handicapped patients were inquired by a personal interview. Questions included the age when they stopped using diapers, enuretic events, frequency, urgency and leakage episodes, urinary infections. Etiology of their mental problem was unknown in 34, perinatal anoxia in 17, Down syndrome in 15, phenylketonuria in 18 and others minors causes. The grade of mental deficiency were profound in 1, severe in 10, moderate in 39, mild in 33 and normal inferior value in 17. The age varied from 7 to 37 years old, with an average of 14 by the time of the interview, comprising 60 males and 40 females. RESULTS: All profound and severe patients presented leakage episodes regardless of the age. The mild and normal inferior value acquired progressive urinary control with aging, and 33% still remain with urinary symptoms above 16 years old. Urinary infection was similar in males and females, around 29%. The most committed group presented less urinary infections. The etiology of the mental handicap was not correlated to the incidence of urinary leakage. CONCLUSIONS: The lack of bladder control was correlated to the grade of mental handicap. In severe and profound groups, the expectancy of control is disappointing. In the less compromised groups, there is a delay in bladder training, with achievement of control in 2/3 after 16 years of age. Those in the normal inferior value have a chance of postponed urinary control, easily misdiagnosed by normal urological interviews.

  16. Fear of failure and self-handicapping in college physical education.

    Science.gov (United States)

    Chen, Lung Hung; Chen, Mei-Yen; Lin, Meng-Shyan; Kee, Ying Hwa; Shui, Shang-Hsueh

    2009-12-01

    The purpose of this study was to examine the relationship between fear of failure and self-handicapping within the context of physical education. Participants were 103 college freshmen enrolled in aerobic dance physical education classes in Taiwan. They completed the Performance Failure Appraisal Inventory and Self-Handicapping Scale for Sport 3 mo. after entering the class. Hierarchical regression indicated that scores on fear of failure predicted self-handicapping scores.

  17. The Comparison of Thyroarytenoid Muscle Myectomy and Type II Thyroplasty for Spasmodic Dysphonia.

    Science.gov (United States)

    Nomoto, Masaki; Tokashiki, Ryoji; Hiramatsu, Hiroyuki; Konomi, Ujimoto; Motohashi, Rei; Sakurai, Eriko; Toyomura, Fumimasa; Ueda, Yuri; Inoue, Shun; Tsukahara, Kiyoaki; Suzuki, Mamoru

    2015-07-01

    Surgical treatments for adductor spasmodic dysphonia include bilateral thyroarytenoid muscle myectomy (TAM) and type II thyroplasty (TPII), both of which are commonly performed. The present study aimed to compare the effects of TAM and TPII. Retrospective study. Subjects were 30 and 35 patients who underwent TAM and TPII, between March 2008 and November 2012. Voice quality was evaluated based on "voice handicap index 10 (VHI10)" and auditory impressions before and 6 months after surgery using five parameters: "strangulation," "interruption," "tremor," "grade," and "breathiness." Comparison of the two procedures revealed significant improvements in VHI10, strangulation, interruption, and tremor, and a significant decline in breathiness after surgery. In particular, VHI10 was improved by more than six points in 90% of patients with TAM, and 96% with TPII. No significant difference was observed between the severities of two procedures preoperatively. Comparison of each postoperative score between the two procedures revealed that TAM significantly improved strangulation, interruption, and tremor, and significantly worsened breathiness, with no significant difference in VHI10. Scatter plots (x: preoperative scores; y: postoperative scores) and regression lines of evaluation items demonstrated that TAM is more effective than TPII in severe cases. Compared with TPII, TAM tends to improve strangulation, interruption, and tremor; however, it tends to worsen breathiness postoperatively. Postoperative VHI10 scores did not differ significantly between the two procedures. Given favorable improvement rates, both surgical procedures were considered effective. Copyright © 2015 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  18. Selective nontreatment of handicapped newborns: a critical essay.

    Science.gov (United States)

    Kohrman, A F

    1985-01-01

    The neonatal intensive care unit is the site of some of the most dramatic technology, complex decision-making and costly activity in the current range of medical institutions. Thus, the decisions made there are particularly visible, and of concern to a society which has increasingly scrutinized and challenged medical practices. Questions of marginal utility and cost-benefit relationships are becoming increasingly prominent. These concerns are heightened by the social and political tensions over issues of the time of initiation of life, quality of life, and assurances of equity for those less well off or handicapped from birth. Robert Weir's book, Selective Nontreatment of Handicapped Newborns, successfully summarizes the current dilemmas and identifies areas of uncertainty and lack of knowledge which cloud the decision-making processes. The book reviews the positions of the major protagonists of the last several years; inevitably, their positions will undergo continuous evolution in response to new data and vigorous political and public policy activity. Weir appropriately identifies the difficulty in arriving at an accurate prognosis as an important and prominent problem in decision-making about defective newborns. The population of surviving, compromised newborns is relatively unfamiliar and their problems remain largely unstudied. Weir's discussion of the desirability of the establishment of Infant Care Review Committees in those institutions which care for defective and handicapped newborns thoughtfully concludes that such committees are, on the balance, desirable. As experience accumulates with Infant Care Review Committees, they should serve the positive purpose of generating open discussion of legitimate disagreements. These committees will provide a forum in which decision-makers can disclose uncertainty, consider alternatives, and receive counsel.(ABSTRACT TRUNCATED AT 250 WORDS)

  19. The music therapy of an anorectic mentally handicapped adult.

    Science.gov (United States)

    Heal, M; O'Hara, J

    1993-03-01

    Where words fail, music may be a medium through which to explore one's inner world and experiences. Psychodynamic approaches have helped us to understand what it means to be handicapped (e.g. Sinason, 1992). The subtleties of diagnosing anorexia nervosa have recently been recognized in this group (e.g. Cottrell & Crisp, 1984). Music therapy has been used with clients of normal intelligence who have eating disorders (Nolan, 1989; Sloboda, 1993; Smeijsters & van den Hurk 1993). This article illustrates the music therapy of a woman with Down's syndrome (IQ = 50) and anorexia nervosa. It describes her management and progress in music therapy in relation to her external world and anorectic behaviours.

  20. Infanticide for handicapped infants: sometimes it's a metaphysical dispute.

    Science.gov (United States)

    Long, T A

    1988-01-01

    Since 1973 the practice of infanticide for some severely handicapped newborns has been receiving more open discussion and defence in the literature on medical ethics. A recent and important argument for the permissibility of infanticide relies crucially on a particular concept of personhood that excludes the theological. This paper attempts to show that the dispute between the proponents of infanticide and their religious opponents cannot be resolved because one side's perspective on the infant is shaped by a metaphysics that is emphatically rejected by the other. In such a situation philosophical argument is powerless to bring about a resolution because there can be no refutation of one side by the other. PMID:2969052

  1. Object permanence development in infants with motor handicaps.

    Science.gov (United States)

    Fetters, L

    1981-03-01

    This study was an investigation of the effects of a motor handicap on the development of object permanence in the young child. Motor abilities were evaluated for 12 infants aged 13 to 29 months. Based on this evaluation, the children were described as manipulators or nonmanipulators in reference to their upper extremity skills. Their stage of object permanence was assessed using traditional and nontraditional assessments. Heart rate and visual tracking were recorded during the nontraditional assessment. Heart rate did not significantly relate to visual fixation or search response. There was, however, a significant difference (p less than .02) between stage achievement with traditional testing and age-appropriate levels. There was no significant difference between the nontraditional assessment and the age-appropriate levels. In addition, there was no significant difference in the development of object permanence between infants described as manipulators and those described as nonmanipulators. The last two findings suggest that infants with motor handicaps may develop object permanence at the expected ages, according to a nontraditional assessment.

  2. Ethics of professional relations to functionally handicapped users

    Directory of Open Access Journals (Sweden)

    Mateja Griljc

    1999-01-01

    Full Text Available The basic purpose of 1ibrarianship code is to form and build librarian personality who can make possible the same opportunity to acquiring knowledge for all users, irrespective of their different demands or special needs.When we discuss the importance of building librarian personality the demanding work with users we confront the problem of ethical treatment very often. Ethics advises only general rules which are rarely simple and they are frequently opposite to each other.The process of reacting between the librarian and the user - as with general information needs as with special functional needs - is also dependent on librarian's professional relation which is formed on important elements such as professional qualification,experiences, creativeness and ethics.We are also interested in question where is the border between ethical and non - ethical action in key situations when the 1ibrarian meets functionally handicapped user. Opportunities for non - ethical reaction of professional workers are much more possible if the library's premises and the furniture don't offer suitable conditions for adaptable communication with the handicapped.But on the other side the 1ibrarian has just because of the bad arhitectural conditions better occasion to introduce himself as one of the best ethically formed personalies compared with other professions. With adaptable communication, creative work and with professional relation in offering help to disabled people, the librarian can contribute to more quality service and even more - he/she becomes an example to other professions - also in ethical sense.

  3. Supporting for Visually Handicapped to Walk Around with RFID Technologies

    Directory of Open Access Journals (Sweden)

    Masayoshhi Asano

    2015-11-01

    Full Text Available Visually handicapped use their white cane to find obstacles. They follow tactile walking surface indicators to find routes and intersections. They use all sensory organs they can use to acquire the surrounding information. They match the surrounding information with routing information they have, to find their current location and target direction. However, even if tactile walking surface indicators are installed, it is difficult for them to visit unknown places because they have no correct routing information. When they go outside depending on tactile walking surface indicators, they have to follow them. They cannot plan their walking routes for themselves in unknown places. It is impossible for them to walk around various places such as shopping malls and station concourses as sighted persons, which is indispensable to enjoy their daily life. In this work, we propose a method which supports visually handicapped people to visit and walk around in their unknown places. We use RFID technologies to achieve voice navigation with the direction to their destination from their current location and their moving direction. To verify effectiveness of our system, we navigate blindfolded people experimentally. In the experiment, we have confirmed the success rate is 81 %.

  4. KI-Aikido for Handicapped Students at Leeward Community College: Theory and Practice.

    Science.gov (United States)

    MacGugan, Kirk

    In an effort to provide physical education instruction for handicapped students, Leeward Community College implemented, on a pilot basis, a non-credit course in KI-Aikido, an oriental martial art which combines theory and exercise toward the goal of controlling the body through the power of the mind. The course, offered to both handicapped and…

  5. Self-Esteem, Achievement Goals, and Self-Handicapping in College Physical Education.

    Science.gov (United States)

    Chen, Zuosong; Sun, Kaihong; Wang, Kun

    2017-01-01

    This study aims to investigate the relationships among self-esteem, achievement goals, and self-handicapping and the potential mediating role of achievement goals in the relationship between self-esteem and self-handicapping in college physical education. The participants were 320 Chinese college students. Three validated scales were employed to assess participants' self-esteem, achievement goals, and self-handicapping in college physical education. Results showed that self-esteem had a negative effect on self-handicapping. Self-esteem had a positive effect on mastery goals, but had a negative effect on performance-avoidance goals. Mastery goals had a negative effect and performance-avoidance goals had a positive effect on self-handicapping. Moreover, mastery goals and performance-avoidance goals partially mediated the relationship between self-esteem and self-handicapping, and self-esteem had both direct and indirect effects on self-handicapping in college physical education. The findings indicate that improving individual's self-esteem and promoting mastery goals while reducing performance-avoidance goals may be relevant strategies to reduce self-handicapping in college physical education.

  6. [22q11.2 deletion: handicap-related problems and coping strategies of primary caregivers].

    Science.gov (United States)

    Briegel, Wolfgang; Schneider, Marco; Schwab, K Otfried

    2009-11-01

    To investigate handicap-related problems of children and adolescents with 22q11.2 deletion syndrome and their primary caregivers' coping strategies. Primary caregivers of 153 subjects aged 2-16 years were anonymously asked to fill out questionnaires, e.g., the Handicap Related Problems for Parents Inventory. Primary caregivers of 96 subjects (53 males, 43 females; mean age: 7;0 [2;1-16;11] years) sent back questionnaires. Patient's behaviour and discipline were the most important handicap-related problems. Significant correlations could be found between the patient's age and his/her relationship with the primary caregiver (rho=0.228; p=.029) and other family members (rho=0.293; p=.004). Compared to other parents of physically handicapped children or those with multiple handicaps, these parents did not experience increased stress. The more the coping strategies "self-fulfillment" and "intensification of partnership" were used, the lower parental stress was (p=.012, p=.025, respectively). "Focusing on the handicapped child" was positively correlated with high parental stress (p=.000). With regard to parental stress and coping strategies, primary caregivers of children and adolescents with 22q11.2 deletion do not significantly differ from other parents of physically handicapped children. As handicap-related family problems increase with the patient's age, a growing need for counseling, especially for aspects of parenting and discipline, and for treatment can be presumed.

  7. Trait self-esteem and claimed self-handicapping motives in sports situations.

    Science.gov (United States)

    Finez, Lucie; Berjot, Sophie; Rosnet, Elisabeth; Cleveland, Christena; Tice, Dianne M

    2012-12-01

    We examined the relationship between physical self-esteem and claimed self-handicapping among athletes by taking motives into consideration. In Study 1, 99 athletes were asked to report their tendency to engage in claimed self-handicapping for self-protective and self-enhancement motives (trait measures). Low self-esteem athletes reported a higher tendency to engage in claimed self-handicapping for these two motives compared with high self-esteem athletes. Neither low nor high self-esteem athletes reported a preference for one motive over the other. In Study 2, 107 athletes participated in a test that was ostensibly designed to assess high physical abilities - and thus to encourage self-handicapping for self-enhancement motives (success-meaningful condition) - or to assess low physical abilities, and thus to encourage self-handicapping for self-protective motives (failure-meaningful condition). Before starting the test, athletes were given the opportunity to claim handicaps that could impair their performance. Low self-esteem athletes claimed more handicaps than high self-esteem athletes in both conditions. Findings suggest that low physical self-esteem athletes engage more in claimed handicapping regardless of motives, relative to high physical self-esteem athletes.

  8. TOWARD DEVELOPMENT OF INSTITUTIONAL PROTECTION, REHABILITATUION OF HANDICAPPED PEOPLE IN MACEDONIA (basis for furtherer studies

    Directory of Open Access Journals (Sweden)

    Ljupco AJDINSKI

    2000-12-01

    Full Text Available This work gives an detailed review of the basic issues of development of protection and rehabilitation of handicapped people in Macedonia with data especially for the period pf the last five decades.A plentitude of documentary materials proved to be important starting assumption for further historical studies on protection and rehabilitation of handicapped people in the Republic of Macedonia.

  9. The natural environment and human development: implications for handicapped children in urban settings

    Science.gov (United States)

    Dennis A. Vinton; Donald E. Hawkins

    1977-01-01

    This review of literature is intended to promote awareness of the needs of the 15 percent of the nation's children and youth who are afflicted with some form of handicap. It is imperative that those who design children's programs that utilize natural environments understand the special problems of handicapped children.

  10. Self-Handicapping, Defensive Pessimism, and Goal Orientation: A Qualitative Study of University Students.

    Science.gov (United States)

    Martin, Andrew J.; Marsh, Herbert W.; Williamson, Alan; Debus, Raymond L.

    2003-01-01

    Interviews with university students selected as high or low in either self-handicapping or defensive pessimism identified personal perspectives on the nature of self-handicapping and defensive pessimism, the perceived reasons why they engage in these strategies and the perceived advantages that follow from them, and the extent to which ego goals…

  11. Academic Self-Handicapping: The Role of Self-Concept Clarity and Students' Learning Strategies

    Science.gov (United States)

    Thomas, Cathy R.; Gadbois, Shannon A.

    2007-01-01

    Background: Self-handicapping is linked to students' personal motivations, classroom goal structure, academic outcomes, global self-esteem and certainty of self-esteem. Academic self-handicapping has yet to be studied with respect to students' consistency in self-description and their description of themselves as learners. Aims: This study…

  12. Self-Handicapping in School Physical Education: The Influence of the Motivational Climate

    Science.gov (United States)

    Standage, Martyn; Treasure, Darren C.; Hooper, Katherine; Kuczka, Kendy

    2007-01-01

    Background: Self-handicapping is an attribution-related process whereby individuals create performance impediments/excuses to protect self-worth in socially evaluative environments. Thus, the prevailing motivational climate would appear to be an important factor when attempting to understand the situational self-handicapping process within school…

  13. The effects of self-handicapping on attributions and perceived judo competence.

    Science.gov (United States)

    Greenlees, Iain; Jones, Simon; Holder, Tim; Thelwell, Richard

    2006-03-01

    The aim of this study was to examine hypotheses derived from Jones and Berglas's (1978) self-handicapping model. It was hypothesized that individuals using many self-handicaps would use more internal attributions and report greater gains in perceived judo ability following success than individuals using few self-handicaps. In addition, it was hypothesized that individuals using many self-handicaps would use more external attributions and report less reduction in perceived judo ability following failure. Fifty-three judo players completed measures of trait self-handicapping, situational self-handicapping and a measure of perceived judo ability before competition. Following competition, the participants completed the Causal Dimension Scale II and the measure of perceived judo ability for a second time. Analyses of variance revealed that high self-handicappers attributed failure to more external factors than low self-handicappers. It was also found that high self-handicappers reported less of a reduction in perceived judo ability following failure than low self-handicappers. The findings therefore provide support for the potential short-term benefits of self-handicapping in sport, although further research is required to examine the long-term implications of using self-handicaps.

  14. Implications of Self-Handicapping Strategies for Academic Achievement: A Reconceptualization.

    Science.gov (United States)

    Murray, Carolyn B.; Warden, M. Robert

    1992-01-01

    Presents questionnaire results concerning self-handicapping, course-related expectancies, and study habits. Reports that self-handicappers were more likely than others to make external and unstable attributions. Concludes that the underlying cognitive mechanism of self-handicapping strategies is a defensive attributional pattern that protects an…

  15. The Relationship between High School Mathematics Classroom Environment and Student Self-Handicapping.

    Science.gov (United States)

    Dorman, Jeffrey P.; Adams, Joan E.; Ferguson, Janet M.

    Classroom environment research investigating the relationship between classroom environment and self-handicapping was conducted in Australian, Canadian, and British high schools. A sample of 3,602 students from 29 schools responded to a questionnaire that assessed student perceptions of classroom environment, self-handicapping, and academic…

  16. Causes of blindness in blind unit of the school for the handicapped ...

    African Journals Online (AJOL)

    To describe the causes of blindness in pupils and staff in the blind unit of the School for the Handicapped in Kwara State. 2. To identify problems in the blind school and initiate intervention. All the blind or visually challenged people in the blind unit of the school for the handicapped were interviewed and examined using a ...

  17. Implicit theory of athletic ability and self-handicapping in college students.

    Science.gov (United States)

    Chen, Lung Hung; Chen, Mei-Yen; Lin, Meng-Shyan; Kee, Ying Hwa; Kuo, Chin Fang; Shui, Shang-Hsueh

    2008-10-01

    Self-handicapping is a maladaptive behavior which undermines students' achievements, but the antecedents of self-handicapping are not well studied in physical education. The aim was to examine the relations of implicit theory of abilities and self-handicapping in physical education. 264 college students, whose mean age was 20.3 yr. (SD = 1.7), completed the Conceptions of the Nature of Athletic Ability Questionnaire-2 and Self-handicapping Scale for Sport. Analysis indicated entity beliefs positively predicted reduced effort and making excuses. Also, incremental beliefs negatively predicted reduced effort. Results are discussed in terms of implicit theory of ability and self-handicapping. Directions for research and implications are stated.

  18. Relations between female students' personality traits and reported handicaps to rhythmic gymnastics performance.

    Science.gov (United States)

    Ferrand, Claude; Champely, Stephane; Brunel, Philippe C

    2005-04-01

    The present study evaluated the relative contributions of Self-esteem, Trait anxiety, and Public Self-consciousness to self-handicapping on a sex-typed task, within a specific academic sport context. Prior to the competitive examination used to recruit French Physical Education Teachers, female sport students (N = 74) were asked to list and rate on a 7-point scale handicaps which could be disruptive to their Rhythmic Gymnastics performance. Self-esteem did not account for significant variance in any category of handicaps. Trait Anxiety was negatively related to handicaps related to Rhythmic Gymnastics and to Social and Work Commitments. Public Self-consciousness was significantly related to endorsement of Friends and Family Commitments handicaps. These results were discussed in relation to the literature.

  19. 13 CFR 113.3-1 - Consideration of race, color, religion, sex, marital status, handicap, or national origin.

    Science.gov (United States)

    2010-01-01

    ..., religion, sex, marital status, handicap, or national origin. 113.3-1 Section 113.3-1 Business Credit and... of race, color, religion, sex, marital status, handicap, or national origin. (a) This regulation does not prohibit the consideration of race, color, religion, sex, marital status, handicap, or national...

  20. Psychosocial Environment and Student Self-Handicapping in Secondary School Mathematics Classes: A Cross-National Study.

    Science.gov (United States)

    Dorman, Jeffrey P.; Adams, Joan E.; Ferguson, Janet M.

    2002-01-01

    Presents an investigation of the relationship between classroom environment and self-handicapping in Australian, Canadian, and British secondary schools. Explores student perceptions of classroom environment, self-handicapping, and academic efficacy. Reports that classroom environment scales accounted for variance in self-handicapping beyond what…

  1. Predicting Academic Self-Handicapping in Different Age Groups: The Role of Personal Achievement Goals and Social Goals

    Science.gov (United States)

    Leondari, Angeliki; Gonida, Eleftheria

    2007-01-01

    Background: Academic self-handicapping refers to the use of impediments to successful performance on academic tasks. Previous studies have shown that it is related to personal achievement goals. A performance goal orientation is a positive predictor of self-handicapping, whereas a task goal orientation is unrelated to self-handicapping. Aims: The…

  2. STATE ANXIETY, SUBJECTIVE IMBALANCE AND HANDICAP IN VESTIBULAR SCHWANNOMA

    Directory of Open Access Journals (Sweden)

    Yougan Saman

    2016-07-01

    Full Text Available ABSTRACTEvidence is emerging of a significant clinical and neuro-anatomical relationship between balance and anxiety. Research has suggested a potentially priming effect with anxiety symptoms predicting a worsening of balance function in patients with underlying balance dysfunction. We propose to show that a vestibular stimulus is responsible for an increase in state anxiety and there is a relationship between increased state anxiety and worsening balance function. Aims1.To quantify state anxiety following a vestibular stimulus in patients with a chronic vestibular deficit.2.To determine if state anxiety during a vestibular stimulus would correlate with the severity of chronic balance symptoms and handicap. MethodsTwo separate cohorts Vestibular Schwannoma (VS patients underwent vestibular tests (electronystagmography, cervical and ocular vestibular evoked myogenic potentials and caloric responses and questionnaire assessment (Vertigo handicap Questionnaire, Vertigo Symptom Scale, State Trait Anxiety InventoryFifteen post resection Vestibular schwannoma patients, with complete unilateral vestibular deafferentation, were assessed at a minimum of 6 months after surgery in Experiment 1 (Aim 1. Forty-five patients with VS in-situ and with preserved vestibular function formed the cohort for Experiment 2 (Aim 2. Experiment 1: VS subjects (N=15 with a complete post-resection unilateral vestibular deafferentation completed a State anxiety questionnaire before caloric assessment and again afterwards with the point of maximal vertigo as the reference (Aim 1. Experiment 2: State anxiety measured at the point of maximal vertigo following a caloric assessment was compared between two groups of presenting with balance symptoms (Group 1 N=26 and without balance symptoms (Group 2 N=11 (Aim 2. The presence of balance symptoms was defined as having a positive score on the VSS-VER.ResultsIn experiment 1, a significant difference (p<0.01 was found when comparing

  3. Walkability Index

    Science.gov (United States)

    The Walkability Index dataset characterizes every Census 2010 block group in the U.S. based on its relative walkability. Walkability depends upon characteristics of the built environment that influence the likelihood of walking being used as a mode of travel. The Walkability Index is based on the EPA's previous data product, the Smart Location Database (SLD). Block group data from the SLD was the only input into the Walkability Index, and consisted of four variables from the SLD weighted in a formula to create the new Walkability Index. This dataset shares the SLD's block group boundary definitions from Census 2010. The methodology describing the process of creating the Walkability Index can be found in the documents located at ftp://newftp.epa.gov/EPADataCommons/OP/WalkabilityIndex.zip. You can also learn more about the Smart Location Database at https://edg.epa.gov/data/Public/OP/Smart_Location_DB_v02b.zip.

  4. Paradox, reprimand and extinction in adults with mental handicap.

    Science.gov (United States)

    Wood, V E; Chamove, A S

    1991-08-01

    To assess the efficacy of paradoxical directives, levels of challenging behaviour during 2 weeks of paradox, reprimand and extinction were compared with baseline levels in four adults with mental handicaps attending a day centre. Paradox was the most effective procedure for reducing the frequency and severity of challenging behaviour by an average of over 70% by the end of 2 weeks and up to 90% in certain subjects; extinction was least effective. Paradox was most effective with more defiant subjects, when staff rated treatment success as low, when improvement using extinction and reprimand was poorest, and in reducing aggressive behaviour. The present authors suggest the overjustification effect offers an explanation for the effects of paradox.

  5. Psychological distress longitudinally mediates the effect of vertigo symptoms on vertigo-related handicap.

    Science.gov (United States)

    Probst, Thomas; Dinkel, Andreas; Schmid-Mühlbauer, Gabriele; Radziej, Katharina; Limburg, Karina; Pieh, Christoph; Lahmann, Claas

    2017-02-01

    Vertigo symptoms can lead to more or less vertigo-related handicap. This longitudinal study investigated whether depression, anxiety, and/or somatization mediate the relationship between vertigo symptoms and vertigo-related handicap. N=111 patients with vertigo/dizziness provided complete data on the following measures: Vertigo symptoms at baseline, depression at 6-month follow-up, anxiety at 6-month follow-up, somatization at 6-month follow-up, and vertigo handicap at 12-month follow-up. Mediation analyses with bootstrapping were performed to investigate the mediating role of anxiety, depression, and somatization in the relationship between vertigo symptoms and vertigo-related handicap. When the mediating role of anxiety, depression, and somatization was evaluated separately from each other in single mediation models, the effect vertigo symptoms at baseline exerted on vertigo-related handicap at 12-month follow-up was significantly mediated by depression at 6-month follow-up (pvertigo symptoms at baseline on vertigo-related handicap at 12-month follow-up (pvertigo symptoms lead to vertigo-related handicap. Copyright © 2016 Elsevier Inc. All rights reserved.

  6. The role of the different aspects of academic motivation and competitiveness in explaining self-handicapping

    Directory of Open Access Journals (Sweden)

    Damjan Šimek

    2010-05-01

    Full Text Available In the present research on self-handicapping, the goal was to examine the role of different types of academic motivation according to the level of self-determination. Since the existing research on self-handicapping has examined only the role of interpersonal competition, we also aimed to explore the role of different kinds of competition, i.e., the role of the reasons that motivate people to participate in competition, and the role of the reasons for the avoidance of competition. 748 high school students participated in the study. Regarding the role of academic motivation in self-handicapping the prevailing role of amotivation stood out. Intrinsic motivation predicted self-handicapping negatively, but extrinsic motivation proved to be a positive predictor. The factor structure of the Academic Motivation Scale only enabled differentiation of the reasons for education on the level of three basic types. With regard to the role of the different dimensions of competitiveness in self-handicapping, results show that those denoted by fear of failure and self-worth protection proved to be more characteristic of self-handicapping than those defined by a high valuation of the importance of quality of task accomplishment. Among others, our research suggests that by diverting students away from hypercompetitive values, functionality of self-handicapping can be decreased.

  7. Train in vain: the role of the self in claimed self-handicapping strategies.

    Science.gov (United States)

    Finez, Lucie; Sherman, David K

    2012-10-01

    Two field studies investigate the role of self in the tendency of athletes to engage in claimed handicapping strategies during training (anticipatively claiming that handicaps may interfere with their performance). Study 1 tested the relationship between trait self-esteem and athletes' engagement in claimed self-handicapping. As hypothesized, low physical self-esteem athletes claimed more handicaps than high physical self-esteem athletes. For stronger evidence for the causal role of the self, Study 2 tested whether securing athletes' self-worth through self-affirmation would lead to decreased claimed self-handicapping by using a mixed model design that allows for both between-subjects (affirmation vs. control condition) and within-subject comparisons (before vs. after self-affirmation intervention). Self-affirmed athletes had decreased levels of claimed self-handicapping. Studies 1 and 2 also demonstrate that athletes engage in claimed self-handicapping during training, which could have deleterious effects on subsequent performance. Discussion centers on theoretical implications and applications for coaches, sport teachers, and sport psychologists.

  8. AP Index

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Planetary Amplitude index - Bartels 1951. The a-index ranges from 0 to 400 and represents a K-value converted to a linear scale in gammas (nanoTeslas)--a scale that...

  9. Disciplining handicapped students: legal issues in light of Honig v. Doe.

    Science.gov (United States)

    Bartlett, L

    1989-01-01

    Court decisions interpreting the effect of the education for All Handicapped children Act on traditional forms of public school discipline have raised many question. This article reviews these decisions and confirms that most forms of minor disciplinary remedies remain available to educators so long as they are also used with nonhandicapped students. However, many legal problems arise with expulsion and long-term, or indefinite, suspensions of handicapped students, especially in the light of the recent Supreme court ruling regarding the expulsion of handicapped students.

  10. [Psychosocial adjustment of the handicapped child--possibilities and problems of rehabilitation].

    Science.gov (United States)

    Eulitz, R

    1989-01-01

    A successful childhood is to be striven after particularly for a handicapped child. Habilitation and rehabilitation, only carefully adapted to one another referring to medical specialties in colaboration with the family, may rise to the demand of the individuality of every one handicapped child. On prior conditions children with chiefly physical handicaps may be integrated into the polytechnical secondary school providing general education in the home town. The total-body examination of these children remains to be the basis for all paediatric actions.

  11. An Evolutionary Comparison of the Handicap Principle and Hybrid Equilibrium Theories of Signaling

    Science.gov (United States)

    Kane, Patrick; Zollman, Kevin J. S.

    2015-01-01

    The handicap principle has come under significant challenge both from empirical studies and from theoretical work. As a result, a number of alternative explanations for honest signaling have been proposed. This paper compares the evolutionary plausibility of one such alternative, the “hybrid equilibrium,” to the handicap principle. We utilize computer simulations to compare these two theories as they are instantiated in Maynard Smith’s Sir Philip Sidney game. We conclude that, when both types of communication are possible, evolution is unlikely to lead to handicap signaling and is far more likely to result in the partially honest signaling predicted by hybrid equilibrium theory. PMID:26348617

  12. Assessment of Object Permanence in Severely Handicapped Students as a Function of Motor and Prompting Variables.

    Science.gov (United States)

    Ilmer, Steven; And Others

    1981-01-01

    The study assessed object permanence construct performance in 20 severely handicapped students (4 to 14 years old) who were differentiated by treatment (prompt) condition and motor ability level. Results revealed a trait (motor ability) x treatment interaction. (Author/SB)

  13. Self-handicapping and intrinsic motivation: buffering intrinsic motivation from the threat of failure.

    Science.gov (United States)

    Deppe, R K; Harackiewicz, J M

    1996-04-01

    High and low self-handicappers (as measured by E. E. Jones & F. Rhodewalt's [1982] Self-Handicapping Scale) were asked to play a game of pinball (in a competitive or noncompetitive setting) after they had practices as much as they wanted on a related task (thus, not practicing could have served as a self-handicap). High self-handicappers who did not practice much became more involved in the game and subsequently reported enjoying the game more than high self-handicappers who practiced a lot. Furthermore, the effects on enjoyment were mediated by task involvement, suggesting that the protection afforded by self-handicapping affects intrinsic motivation by allowing the individual to become absorbed in the activity instead of focusing on performance concerns. Individuals who self-handicap may be providing themselves with the "breathing room" they need to become absorbed in an activity and to experience the activity as enjoyable.

  14. Consequences of self-handicapping: effects on coping, academic performance, and adjustment.

    Science.gov (United States)

    Zuckerman, M; Kieffer, S C; Knee, C R

    1998-06-01

    Self-handicappers erect impediments to performance to protect their self-esteem. The impediments may interfere with the ability to do well and, as such, may result in poor adjustment. Using a longitudinal design, the present studies examined prospective effects of self-handicapping on coping, academic performance, and several adjustment-related variables (e.g., self-esteem). It was found that, compared to low self-handicappers, high self-handicappers reported higher usage of coping strategies implying withdrawal and negative focus. High self-handicappers performed less well academically, an effect that was mediated in part by poor study habits. Finally, high self-handicapping resulted in poorer adjustment over time, and poorer adjustment resulted in higher self-handicapping over time. These relations are consistent with the idea of a vicious cycle in which self-handicapping and poor adjustment reinforce one another.

  15. Creating aesthetically resonant environments for the handicapped, elderly and rehabilitation: Sweden

    DEFF Research Database (Denmark)

    Brooks, Tony; Hasselblad, Stefan

    2005-01-01

    CARE HERE (Creating Aesthetically Resonant Environments for the Handicapped, Elderly and Rehabilitation) was realised as a full European IST (Information Society Technologies) project, involving adults and children with learning disability, PMLD (Profound and Multiple Learning Disability...

  16. AA Index

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The geomagnetic aa index provides a long climatology of global geomagnetic activity using 2 antipodal observatories at Greenwich and Melbourne- IAGA Bulletin 37,...

  17. Walkability Index

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Walkability Index dataset characterizes every Census 2010 block group in the U.S. based on its relative walkability. Walkability depends upon characteristics of...

  18. Diversity Index

    Data.gov (United States)

    Town of Chapel Hill, North Carolina — This map service summarizes racial and ethnic diversity in the United States in 2012.The Diversity Index shows the likelihood that two persons chosen at random from...

  19. AUTHOR INDEX

    Indian Academy of Sciences (India)

    a granitic terrain of southern India using factor analysis and GIS. 1059. Radhakrishna M see Dev Sheena V .... Landslide susceptibility analysis using Probabilistic. Certainty Factor ... index via entropy-difference analysis. 687. Yidana Sandow ...

  20. Sociocultural handicap of foreign pupils and professional qualification of teachers

    Directory of Open Access Journals (Sweden)

    Markéta Zachová

    2017-11-01

    Full Text Available The presented text shows the results of research carried out within the dissertation thesis. The main topic is the phenomenon of sociocultural handicap of foreign pupils (pupils with a different mother tongue. The research is based on the expert belief that integration of foreign pupils (pupils with a different mother tongue into Czech schools and the training of teachers in this field is still somewhat marginal, even though there is a growing debate about increasing cultural diversity, increasing heterogeneity of schools and introduction of inclusive measures. The aim of the research was to analyze professional training of teachers in relation to the sociocultural handicap of foreign pupils (pupils with a different mother tongue. The goal was refined by the formulation of research questions: What possible problems (difficulties reflect teachers in the teaching process of foreign pupils? What procedures and strategies do teachers use to help these pupils to be integrated successfully? How do teachers assess their professional readiness for education of foreign pupils (whether they were sufficiently prepared to work with foreign pupils in the course of their undergraduate studies, where they find benefits, deficiencies in this training? How do students assess their undergraduate education for foreign-pupil teaching (whether they were ready to work with foreign pupils in their previous undergraduate education, where they find benefits, deficiencies in this training? The research used questionnaire survey techniques for teachers and students and semi-structured interviews for teachers. The partial technique was the analysis of study subjects focused on the education of foreign pupils at the Faculty of Education at West Bohemian University in Pilsen (hereinafter WBU. The research group was made up of teachers of the 1st grade of primary schools of the Pilsen and Karlovy Vary regions and students of the 4th grade of the field of Teaching for the

  1. Intelligent indexing

    International Nuclear Information System (INIS)

    Farkas, J.

    1992-01-01

    In this paper we discuss the relevance of artificial intelligence to the automatic indexing of natural language text. We describe the use of domain-specific semantically-based thesauruses and address the problem of creating adequate knowledge bases for intelligent indexing systems. We also discuss the relevance of the Hilbert space ι 2 to the compact representation of documents and to the definition of the similarity of natural language texts. (author). 17 refs., 2 figs

  2. Intelligent indexing

    Energy Technology Data Exchange (ETDEWEB)

    Farkas, J

    1993-12-31

    In this paper we discuss the relevance of artificial intelligence to the automatic indexing of natural language text. We describe the use of domain-specific semantically-based thesauruses and address the problem of creating adequate knowledge bases for intelligent indexing systems. We also discuss the relevance of the Hilbert space {iota}{sup 2} to the compact representation of documents and to the definition of the similarity of natural language texts. (author). 17 refs., 2 figs.

  3. The Knowledge of Nurses and Midwives Related to Mentally-Handicapped Children

    Directory of Open Access Journals (Sweden)

    Hatice Yildirim Sari

    2008-04-01

    Full Text Available AIM/BACKGROUND: The purpose of this research is to determine the knowledge of nurses and midwives who are working at primary health care services. METHODS: The information regarding the research has been given to the nurses and midwives working at primary health centers of Manisa, and 70 nurses and midwives have accepted to attend the research. In collecting the data, two questionnaire forms prepared by the researchers have been used and these forms are composed of two parts. In the first part of the questionnaire, there are questions about the sociodemografhic characteristics of midwives and nurses; in the second one the questions are related to the symptoms and causes of mental-handicap and the attempts regarding the mentally-handicapped child and his family. RESULTS: The nurses and midwives have stated that the most important cause of mental handicap is marriages among relatives (92.9%. and that in a situation of not being able to fullfill mental motor skills in relation to age, they suspect mental handicap (90%. They have also stated that they mostly have or can have difficulty in communucating with the mentally-handicapped child (64%. CONCLUSION: As a result, the nurses and midwives have adequate knowledge about the causes and symptoms of mental handicap. On the other hand, their knowledge regarding the services to be planned in care of mentally-handicapped children is limited. At the primary health care services, educational studies can be planned in order to give better health service for mentally-handicapped individuals. [TAF Prev Med Bull 2008; 7(2.000: 127-132

  4. Seroprevalence of hepatitis B and C virus in two institutions caring for mentally handicapped adults.

    OpenAIRE

    Cramp, M E; Grundy, H C; Perinpanayagam, R M; Barnado, D E

    1996-01-01

    Hepatitis B virus infection is common in institutions caring for the mentally handicapped. Hepatitis B virus and hepatitis C virus share routes of transmission but the prevalence of hepatitis C virus infection in this population is unknown. We have tested 101 patients from two institutions in South-East England caring for adults with mental handicap for the presence of hepatitis C antibody, hepatitis B core antibody, and if necessary hepatitis B surface antigen. None tested positive for hepat...

  5. Music Communication, Projection and Analogy of Handicapped Children in Music Therapy

    OpenAIRE

    Lipský, Matěj

    2014-01-01

    /Abstract Music Communication, Projection and Analogy of Handicapped Children in Music Therapy Presented work takes an interest in music contents produced by handicapped children attending music therapy sessions. The contents of music were gained from the children by the method of improvisation, particularly by "concert technique". In the theoretical part we present philosophical background for the music therapy in a field of special education and research. This background thought we have fou...

  6. Motivation and future temporal orientation: a test of the self-handicapping hypothesis.

    Science.gov (United States)

    Lennings, C J

    1999-06-01

    Self-handicapping motivation refers to the likelihood a person will project personal ambition into the future, make a pessimistic judgement, and then mobilise effort in the present to avoid an anticipated negative outcome. It should, therefore, be a correlate of future time perspective. This study showed for a sample of 120 first-year students that, whilst future time perspective did strongly predict scores on a measure of self-handicapping motivation, neither variable was a useful predictor of outcome.

  7. Depressive self-presentation: beyond self-handicapping.

    Science.gov (United States)

    Weary, G; Williams, J P

    1990-05-01

    An experiment was conducted to examine the notion that depressives' responses would reflect a protective self-presentation style (Hill, Weary, & Williams, 1986), the underlying goal of which would be the avoidance of future performance demands and potential losses in self-esteem. In this study, depressed and nondepressed Ss were asked to perform a relatively simple visual-motor task. Half of the depressed and half of the nondepressed Ss were told that if they were successful at the task, they would be asked to perform a 2nd, similar task. The remaining Ss were given no such expectation of future performance. We predicted and found that depressed compared with nondepressed Ss strategically failed at the task when presented with the possibility of future performance and further losses in esteem. Moreover, this strategic failure was associated with some costs; depressed-future performance expectancy Ss experienced more discomfort or negative affect as a result of their performance. The relationship between this depressive self-presentation and self-handicapping strategies is discussed.

  8. Wireless hydrotherapy smart suit for monitoring handicapped people

    Science.gov (United States)

    Correia, Jose H.; Mendes, Paulo M.

    2005-02-01

    This paper presents a smart suit, water impermeable, containing sensors and electronics for monitoring handicapped people at hydrotherapy sessions in swimming-pools. For integration into textiles, electronic components should be designed in a functional, robust and inexpensive way. Therefore, small-size electronics microsystems are a promising approach. The smart suit allows the monitoring of individual biometric data, such as heart rate, temperature and movement of the body. Two solutions for transmitting the data wirelessly are presented: through a low-voltage (3.0 V), low-power, CMOS RF IC (1.6 mm x 1.5 mm size dimensions) operating at 433 MHz, with ASK modulation and a patch antenna built on lossy substrates compatible with integrated circuits fabrication. Two different substrates were used for antenna implementation: high-resistivity silicon (HRS) and Corning Pyrex #7740 glass. The antenna prototypes were built to operate close to the 5 GHz ISM band. They operate at a center frequency of 5.705 GHz (HRS) and 5.995 GHz (Pyrex). The studied parameters were: substrate thickness, substrate losses, oxide thickness, metal conductivity and thickness. The antenna on HRS uses an area of 8 mm2, providing a 90 MHz bandwidth and ~0.3 dBi of gain. On a glass substrate, the antenna uses 12 mm2, provides 100 MHz bandwidth and ~3 dBi of gain.

  9. Documenting handicap situations and eliminations through Universal Design patterns

    Directory of Open Access Journals (Sweden)

    Ann Heylighen

    2009-11-01

    Full Text Available According to contemporary academic and social insights,human functional limitations and handicaps are not exclusively the result of the physical and / or mental characteristics of the individual (medical model, but theycan just as well be a consequence of a maladjustment of the social and physical environment (conflict / social model.This radical reversal of focus from person to environment,or in other words, from the assessment that the person isimpeded to the insight that the physical and socialenvironment is an impediment, has far-reaching consequences for the designing of human-made environments.The recent Universal Design paradigm extends beyond accommodating ‘modal’ users and aims to include the realdiversity of user populations, including those with physical and / or mental impairments and functional limitations. To achieve this, a large amount of design information in connection with human dis-abilities (limitations andpossibilities is required.Together with prescriptive laws and regulations, designers need descriptive information about; on the one hand,CONFLICTS between users and built environments, and onthe other hand, empirically evident design RESOLUTIONS. In response to this need, the paper advances the development of specific Universal Design Patterns (UD Patterns in order to collect and organise this information for decision makers and for designers.

  10. Virginia ESI: INDEX (Index Polygons)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains vector polygons representing the boundaries of all hardcopy cartographic products produced as part of the Environmental Sensitivity Index...

  11. Indexing mechanisms

    International Nuclear Information System (INIS)

    Wood, A.G.; Parker, G.E.; Berry, R.

    1976-01-01

    It is stated that the indexing mechanism described can be used in a nuclear reactor fuel element inspection rig. It comprises a tubular body adapted to house a canister containing a number of fuel elements located longtitudinally, and has two chucks spaced apart for displacing the fuel elements longitudinally in a stepwise manner, together with a plunger mechanism for displacing them successively into the chucks. A measuring unit is located between the chucks for measuring the diameter of the fuel elements at intervals about their circumferences, and a secondary indexing mechanism is provided for rotating the measuring unit in a stepwise manner. (U.K.)

  12. Incapacidad vocal en docentes de la provincia de Huelva Voice handicap in Huelva's teachers

    Directory of Open Access Journals (Sweden)

    Francisco Javier Barbero-Díaz

    2010-03-01

    Full Text Available Introducción: La prevalencia de trastornos de la voz en docentes en nuestro entorno se sitúa entre el 34% y 57%. Desde el año 2006 la patología por nódulos de las cuerdas vocales se considera enfermedad profesional. El Índice de Incapacidad Vocal es una herramienta validada para valorar el menoscabo asociado a la disfonía que percibe la persona. Objetivos: Valorar el impacto de la disfonía y las posibles diferencias en la incapacidad vocal entre factores relacionados con la disfonía. Material y Métodos: Durante el examen de salud voluntario los docentes son interrogados sobre síntomas de disfonía y cumplimentan el Índice de Incapacidad Vocal. Resultados: Los docentes con incapacidad moderada y severa representan el 16,6% y 1,2% respectivamente. Un 50,9% han presentado síntomas de disfonía en algún momento de su vida laboral. Se encuentran diferencias significativas en la incapacidad vocal según el diagnostico de nódulos de cuerdas vocales, la presencia de síntomas y el número de síntomas. Conclusiones: la disfonía supone un importante impacto en la población estudiada. El diagnostico de nódulos de cuerdas vocales, la presencia de síntomas y el número de síntomas de disfonía conllevan diferencias al valorar el menoscabo. No es posible realizar la extrapolación.Introduction: The prevalence of voice disorders in teachers in our environment is between 34% and 57%. Since 2006, the pathology of vocal cord nodules is considered an occupational disease. Vocal Handicap Index is a validated tool to assess the impairment associated with the perceived dysphonia. Objectives: To assess the impact of dysphonia and the possible differences in the vocal disability in function of dysphonia-related factors in teachers. Methods: During the exam of health, volunteer teachers are interviewed about symptoms of dysphonia and complete the Vocal Handicap Index. Results: Teachers with moderate and severe disability represent 16.6% and 1

  13. Horticultural therapy--aspects of land use for the mentally handicapped. A system of planning for the requirements of the mentally handicapped gardener.

    Science.gov (United States)

    Spurgeon, T; Underhill, C

    1979-01-01

    An increasing number of facilities for the mentally handicapped use horticulture, agriculture and gardening in their training programmes. This paper contains a review of: (1) some aspects of land use as a medium for leisure, rehabilitation, therapy and training for the mentally handicapped, (2) employment, both sheltered and open, in land use as reflected in a recent survey, (3) the variety of knowledge available through the medium of land use. The main emphasis of the paper deals with: (1) the need for planning, (2) a suggested planning system that assists the instructor in understanding the requirements of the mentally handicapped gardener when he approaches a given job, (3) some problems peculiar to land use work with the mentally handicapped. In conclusion the authors briefly examine: (1) the need for assessment, (2) the need to distinguish between production and training, (3) suggestions towards an expansion of the planning system to take in other areas of the horticultural unit than were originally described, (4) social activities connected with the horticultural activities described, (5) the hierarchy identified through the use of a particular planning system.

  14. The Effect of Colour Psychodynamic Environment on the Psychophysiological and Behavioural Reactions of Severely Handicapped Children. Effects of Colour/Light Changes on Severely Handicapped Children.

    Science.gov (United States)

    Wohlfarth, H.; Sam, C.

    The effects of varied lighting and coloring in the classroom environment were examined on the behavior of seven severely handicapped 8 to 11 year olds with behavior problems. Analysis of changes in systolic blood pressure indicated that Ss were more comfortable and relaxed in the experimental room (in which the fluorescent lights were replaced by…

  15. Author Index

    Indian Academy of Sciences (India)

    user1

    Astr. (2012) 33, 419–420. Author Index. 419. AGGARWAL SUNNY. Photoionization Cross-Section of Chlorine-like Iron, 291. AMBASTHA ASHOK see Das, A. C., 1. ARAKIDA HIDEYOSHI. Effect of Inhomogeneity of the Universe on a Gravitationally. Bound Local System: A No-Go Result for Explaining the Secular Increase in.

  16. AUTHOR INDEX

    Indian Academy of Sciences (India)

    automorphic solutions to fractional order abstract integro-differential equations. 323. Afrouzi G A see Ala Samira ... 521. Agarwal Praveen. Certain fractional integral operators and the generalized multi-index Mittag- ... of positive solutions for sys- tems of second order multi-point bound- ary value problems on time scales 353.

  17. Self-esteem, self-conscious emotions, resilience, trait anxiety and their relation to self-handicapping tendencies

    OpenAIRE

    Török, Lilla; Szabó, Zsolt Péter; Boda-Ujlaky, Judit

    2014-01-01

    Jones and Berglas (1978) define self-handicapping as any action or choice of performance setting that enhances the opportunity to externalize (or excuse) failure and to internalize (reasonably accept credit for) success (p. 406). The present study examined the role of potential precursors in the self-handicapping process. A total of 626 undergraduates from various Hungarian universities completed measures of dispositional self-handicapping, self-esteem, self-conscious emotions, trait anxiety,...

  18. Endoscopic laser thyroarytenoid myoneurectomy in patients with adductor spasmodic dysphonia: a pilot study on long-term outcome on voice quality.

    Science.gov (United States)

    Tsuji, Domingos Hiroshi; Takahashi, Marystella Tomoe; Imamura, Rui; Hachiya, Adriana; Sennes, Luiz Ubirajara

    2012-09-01

    Adductor spasmodic dysphonia (ADSD) is a focal laryngeal dystonia, which compromises greatly the quality of life of the patients involved. It is a severe vocal disorder characterized by spasms of laryngeal muscles during speech, producing phonatory breaks, forced, strained and strangled voice. Its symptoms result from involuntary and intermittent contractions of thyroarytenoid muscle during speech, which causes vocal fold to strain, pressing each vocal fold against the other and increasing glottic resistance. Botulinum toxin injection remains the gold-standard treatment. However, as injections should be repeated periodically leading to voice quality instability, a more definitive procedure would be desirable. In this pilot study we report the long-term vocal quality results of endoscopic laser thyroarytenoid myoneurectomy. Prospective study. Surgery was performed in 15 patients (11 females and four males), aged between 29 and 73 years, diagnosed with ADSD. Voice Handicap Index (VHI) was obtained before and after surgery (median 31 months postoperatively). A significant improvement in VHI was observed after surgery, as compared with baseline values (P=0.001). The median and interquartile range for preoperative VHI was 99 and 13, respectively and 24 and 42, for postoperative VHI. Subjective improvement of voice as assessed by the patients showed median improvement of 80%. Because long-term follow-up showed significant improvement of voice quality, this innovative surgical technique seems a satisfactory alternative treatment of ADSD patients who seek a definite improvement of their condition. Copyright © 2012 The Voice Foundation. Published by Mosby, Inc. All rights reserved.

  19. Afghanistan Index

    DEFF Research Database (Denmark)

    Linnet, Poul Martin

    2007-01-01

    basis. The data are divided into different indicators such as security, polls, drug, social, economic, refugees etc. This represents a practical division and does not indicate that a picture as to for instance security can be obtained by solely looking at the data under security. In order to obtain...... a more valid picture on security this must incorporate an integrated look on all data meaning that for instance the economic data provides an element as to the whole picture of security.......The Afghanistan index is a compilation of quantitative and qualitative data on the reconstruction and security effort in Afghanistan. The index aims at providing data for benchmarking of the international performance and thus provides the reader with a quick possibility to retrieve valid...

  20. ATTITUDES OF HEALTHY CHILDREN PARENTS TOWARDS HANDICAPPED CHILDREN AT THE PRE-SCHOOL AGE

    Directory of Open Access Journals (Sweden)

    Ruzica KERAMICIEVA

    1997-03-01

    Full Text Available Since the 1970-ties, in the USA and Western and Eastern Europe, the model of segregated education has been abandoned, and nowadays the handicapped children attend regular schools all together with other healthy pupils. This , so called Integrative Pedagogy, proceeds from the mental hygiene aspects according to which the restrictive environment in special schools has not been a favorable one for the development of those children.The integrational process of these children in preschool institutions and schools has rather been difficult due to a number of reasons. As one of them, already mentioned and found in literature , has been the negative attitude of non-handicapped children parents towards those handicapped in their development.The problem of this research is to check and test the attitude of healthy children parents towards handicapped children at preschool age. This research shall also tend to analyze the origin of the such attitudes i. e. , whether they have been a result of an insufficient information and ignorance of the obstacles during development, or been produced by imitation of the environment, or due to an empathy, or even because of the fear that “ such a thing better never enter their home”, etc.We sincerely believe that, revealing the above parents’ attitudes and their origin, would certainly bring finding ways of their successful socialization and making the integrational process of handicapped children with their normal mates in preschool institutions easier.

  1. A home-centered instructional communication strategy for severely handicapped children.

    Science.gov (United States)

    Wulz, S V; Hall, M K; Klein, M D

    1983-02-01

    Family involvement is an essential element of language intervention with severely handicapped children for several reasons. First, the parent-child interaction is the focus of normal language development, and can be a powerful impetus in language learning for handicapped children. Second, limited generalization and maintenance of skills often occur when they are acquired in environments that do not also teach the appropriate use of skills. Third, parents can be successful intervention agents and may generalize their skills to other interactions with their child. Training conducted in the home must be compatible with that environment: it should involve only those skills that are of immediate use in the home. The Instructional Communication Strategy described herein represents such a program. It is a synthesis of training strategies used with normal and handicapped children, and is applicable regardless of child's level of functioning, age, or handicapping condition. This training model involves considerable modification in the role of speech-language pathologists dealing with the severely handicapped. The professional's skills are best utilized for assessment, program development, monitoring progress, and training specialized skills. The parents provide most of the direct training; however, professionals are also utilized for the child's maximum benefit.

  2. Social distance and behavioral attributes of developmentally handicapped and normal children.

    Science.gov (United States)

    Sherman, L W; Burgess, D E

    1985-12-01

    20 behavioral attributes predicting social distance were examined among 101 junior high school students in six classrooms. The sample included 8 developmentally handicapped students, of whom at least one of each was mainstreamed into each classroom. Subjects were predominantly white, middle-class, suburban midwesterners. A sociometric nomination measure was used to obtain behavioral attribute profiles of the students which were then used to predict a psychometric measure of social distance. Handicapped students were not more socially distant than their normal peers. Factor analysis of the 20 behavioral attributes yielded four factors, three of which were significant predictors of classroom social distance, accounting for better than half the variance in social distance. These were described as Incompetent/Unassertive, Positive/Active/Assertive, and Passive/Unassertive. Social rejection in mainstreamed classrooms is more a function of perceived behavioral attributes than the label developmentally handicapped.

  3. Hearing Handicap and Speech Recognition Correlate With Self-Reported Listening Effort and Fatigue.

    Science.gov (United States)

    Alhanbali, Sara; Dawes, Piers; Lloyd, Simon; Munro, Kevin J

    To investigate the correlations between hearing handicap, speech recognition, listening effort, and fatigue. Eighty-four adults with hearing loss (65 to 85 years) completed three self-report questionnaires: the Fatigue Assessment Scale, the Effort Assessment Scale, and the Hearing Handicap Inventory for Elderly. Audiometric assessment included pure-tone audiometry and speech recognition in noise. There was a significant positive correlation between handicap and fatigue (r = 0.39, p speech recognition and fatigue (r = 0.22, p speech recognition both correlate with self-reported listening effort and fatigue, which is consistent with a model of listening effort and fatigue where perceived difficulty is related to sustained effort and fatigue for unrewarding tasks over which the listener has low control. A clinical implication is that encouraging clients to recognize and focus on the pleasure and positive experiences of listening may result in greater satisfaction and benefit from hearing aid use.

  4. The role of uncertain self-esteem in self-handicapping.

    Science.gov (United States)

    Harris, R N; Snyder, C R

    1986-08-01

    In this article, the hypothesis that some individuals confronted with an intellectual evaluation use a lack of preparation as a "self-handicapping" strategy (Jones & Berglas, 1978) was studied. Sex and both level and certainty of self-esteem were examined in regard to the self-handicapping strategy of lack of effort. Subjects were 54 men and 54 women, certain and uncertain, high and low self-esteem college students, who believed that the experiment was designed to update local norms for a nonverbal test of intellectual ability. After subjects' level of state anxiety was assessed, they were instructed in the benefits of practicing for the evaluation. Subsequently, subjects' state anxiety and preparatory efforts (the primary dependent variables) were measured. Subjects' practice, self-protective attributions, and related affect supported a self-handicapping interpretation for uncertain males but not for uncertain females.

  5. Transmissão vertical do HIV: expectativas e ações da gestante soropositiva Transmisión vertical del VHI: expectativas y acciones de la gestante seropositiva HIV perinatal transmission: expectations and actions of hiv-positive pregnant women

    Directory of Open Access Journals (Sweden)

    Edilene Lins de Moura

    2006-06-01

    Full Text Available Este estudo descritivo, com abordagem qualitativa, foi motivado pelo elevado número de casos de transmissão vertical do HIV. Teve como objetivo identificar as expectativas e ações da gestante HIV positivo quanto à gravidez e ao concepto. A amostra constituiu-se de 14 gestantes infectadas, assintomáticas, que conheciam sua soropositividade antes da gravidez e que estavam no 3º trimestre de gestação. Utilizou-se entrevista para a coleta de dados que ocorreu em 2001 e 2002. Empregou-se o Método do Discurso do Sujeito Coletivo para analisar os dados. Verificou-se que, quanto à maternidade, as gestantes tinham expectativas semelhantes, adaptaram-se à gravidez, e acreditavam na soronegatividade do bebê e na efetividade do tratamento. Concluiu-se pela necessidade de implementação de orientação para a saúde direcionada à mulher com enfoque na transmissão vertical do HIV/aids.Este estudio descriptivo, con aproximación cualitativa, fue motivado por el gran número de niños con transmisión vertical del VHI. Tuvo como objetivo identificar las expectativas y acciones de la gestante VHI positivo en cuanto al embarazo y al concepto. La muestra se constituyó de 14 gestantes infectadas, asintomáticas, que conocían su seropositividad antes del embarazo y que estaban en el 3.er trimestre de gestación. Para la recolección de los datos, realizada en el período de 2001 y 2002, se utilizó la entrevista. El Método de Discurso de Sujeto Colectivo fue empleado para analizar los datos. Se verificó que, en cuanto a la maternidad, las gestantes tenían expectativas semejantes. Se adaptaron a la gestación, confiaban en que el bebé seria suero negativo y en la efectividad del tratamiento realizado. Las conclusiones orientan hacia la necesidad de implementación de orientación sobre la salud de la mujer con acercamiento en la transmisión vertical del VHI/SIDA.This descriptive study with a qualitative approach was motivated by the high number

  6. Formation en TIC destinée aux personnes handicapées en ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Formation en TIC destinée aux personnes handicapées en Amérique latine. En Amérique latine et dans les Caraïbes, les personnes handicapées représentent environ 10 % de la population. La population de cette région affiche des taux de pauvreté et de chômage élevés; assurer des moyens de subsistance décents aux ...

  7. Handicap discrimination considerations in treating the impaired worker: drugs, alcohol, pregnancy, and AIDS in the workplace.

    Science.gov (United States)

    Postol, L P

    1988-04-01

    In dealing with applicants and employees, administrators must comply with handicap and pregnancy discrimination statutes, any union collective bargaining agreement, and any state or local statutes specifically directed at protecting certain classes of handicapped persons. The employer must make reasonable accommodations which allow the disabled worker to perform the job, although the employer need not implement accommodations which are an undue hardship. Similarly, if the impaired employee cannot safely perform the essential functions of the job, he or she need not be hired or retained. Employers must also recognize their responsibilities and liability under their health benefit plans and other liability statutes, and attempt to minimize their exposure.

  8. [Golf handicap score is a suitable scale for monitoring rehabilitation after apoplexia cerebri].

    Science.gov (United States)

    Jensen, Per; Meden, Per; Knudsen, Lars V; Knudsen, G M; Thomsen, Carsten; Feng, Ling; Pinborg, Lars H

    2015-12-21

    A 67-year-old male was examined nine, 35 and 135 days after stroke using conventional stroke scales, 18 holes of golf, functional MRI (fist closures) and translocator protein imaging of microglial function in the brain using single photon emission computed tomography. The data showed that the over 100-year-old golf handicap scale is better suited for quantifying recovery after stroke than conventional stroke assessment scales, which are prone to ceiling effect. We suggest that rating with golf handicap should be used more widely in stroke research, and we find it tremendously important that these new findings are published before Christmas.

  9. The impact of self-handicapping strategies use on the impression formation

    OpenAIRE

    Hip-Fabek, Irena

    2006-01-01

    Self-handicapping is usually defined as any claim, action or choice of performance setting that enhances the opportunity to externalize (or excuse) failure and to internalize (accept credit for) success. The purpose of this study was to examine the impact of using different self-handicapping strategies on formation of the impression about the person. We collected data from 365 participants, whose task was to read a story about the person who failed on the task delegated to him/her, and to app...

  10. Self-handicapping and obesity: is there a sympathetic audience out there?

    Science.gov (United States)

    Schill, T; Beyler, J; Wehr, J; Swigert, L; Tatter, T

    1991-06-01

    After reading a case description of a 20-year-old woman, subjects attributed her personal shortcomings to her weight rather than to herself per se. In particular, people who scored higher on a measure of self-handicapping were even more likely to attribute shortcomings to a person's weight and excuse or overlook them. A person who attributes shortcomings to being overweight will very likely find a sympathetic audience. These results support the suggestion by Baumeister, Kahn, and Tice (1990) that obesity can be a self-handicapping strategy.

  11. The EU Offshore Safety Directive and its potential effects. Opportunity or handicap?; Die EU Offshore Safety Directive und ihre moeglichen Auswirkungen. Chance oder Handicap?

    Energy Technology Data Exchange (ETDEWEB)

    Schwiederowski, Claudia [RWE Dea AG, Hamburg (Germany)

    2014-07-01

    The purpose of the EU Offshore Safety Directive, which took effect on 18 July 2013, is to define minimum requirements for the prevention of severe accidents in connection with offshore crude oil or natural gas activities of any kind and the containment of the follow-on effects of such accidents. This is without question a logical consequence of the offshore incidents seen around the globe over the past decades. An interesting question in this context is for whom the EU Offshore Safety Directive has become an opportunity and for whom a handicap. [German] Ziel der am 18. Juli 2013 in Kraft getretenen EU Offshore Safety Direktive ist die Festlegung von Mindestanforderungen fuer die Verhinderung schwerer Unfaelle bei Offshore-Erdoel- bzw. - Erdgasaktivitaeten und die Begrenzung etwaiger Unfallfolgen. Nach den weltweiten Offshore- Ereignissen der vergangenen Jahrzehnte ist dies ohne Zweifel eine logische Entwicklung. Nun stellt sich die Frage: Fuer wen entwickelt sich die EU Offshore Safety Directive zur Chance, fuer wen zum Handicap?.

  12. The Relationship Between Attitudes Toward the Handicapped and Nonverbal Behavior with Educators of Special Needs Students: An Exploratory Study.

    Science.gov (United States)

    Stodden, Robert A.; And Others

    Examined were the relationships between attitudes toward the handicapped and nonverbal behavior of 60 special education teachers involved in inservice or preservice coursework. Ss were administered the Attitudes Toward Handicapped Individuals (ATHI) Scale and the Nonverbal Behavior Characteristics Scale (NBCS). Analysis of the data indicated a…

  13. The Effect of Biological Movement Variability on the Performance of the Golf Swing in High- and Low-Handicapped Players

    Science.gov (United States)

    Bradshaw, Elizabeth J.; Keogh, Justin W. L.; Hume, Patria A.; Maulder, Peter S.; Nortje, Jacques; Marnewick, Michel

    2009-01-01

    The purpose of this study was to examine the role of neuromotor noise on golf swing performance in high- and low-handicap players. Selected two-dimensional kinematic measures of 20 male golfers (n = 10 per high- or low-handicap group) performing 10 golf swings with a 5-iron club was obtained through video analysis. Neuromotor noise was calculated…

  14. The relation of vocal fold lesions and voice quality to voice handicap and psychosomatic well-being

    NARCIS (Netherlands)

    Smits, R.; Marres, H.A.; de Jong, F.

    2012-01-01

    BACKGROUND: Voice disorders have a multifactorial genesis and may be present in various ways. They can cause a significant communication handicap and impaired quality of life. OBJECTIVE: To assess the effect of vocal fold lesions and voice quality on voice handicap and psychosomatic well-being.

  15. When a High Distinction Isn't Good Enough: A Review of Perfectionism and Self-Handicapping

    Science.gov (United States)

    Kearns, Hugh; Forbes, Angus; Gardiner, Maria; Marshall, Kelly

    2008-01-01

    This paper addresses two problems which are common amongst university students, namely perfectionism and self-handicapping. Perfectionism deals with setting unreasonably high standards for one's own performance, while self-handicapping behaviours provide a possible excuse for poor performance, for example putting tasks off until the last minute.…

  16. Self-Handicapping and Defensive Pessimism: Exploring a Model of Predictors and Outcomes from a Self-Protection Perspective.

    Science.gov (United States)

    Martin, Andrew J.; Marsh, Herbert W.; Debus, Raymond L.

    2001-01-01

    Examines self-handicapping and defensive pessimism, the factors that predict these strategies, and the associations between these strategies and a variety of academic outcomes. Findings reveal that task orientation negatively predicts both self-handicapping and defensive expectations and positively predicts reflectivity. Students high in…

  17. Associations between Students' Perceptions of Mathematics Classroom Environment and Self-Handicapping in Australian and Canadian High Schools

    Science.gov (United States)

    Dorman, Jeffrey P.; Ferguson, Janet M.

    2004-01-01

    Research investigating the relationship between classroom environment and self-handicapping was conducted in Australian and Canadian high schools. A sample of 2,006 students responded to a questionnaire that assessed student perceptions of classroom environment and self-handicapping. Simple and multiple correlational analyses showed that classroom…

  18. New Directions in Vocational Education for the Handicapped: Implications for Research and Development. Occasional Paper No. 35.

    Science.gov (United States)

    Martin, Edwin

    The history of educational programming for the handicapped has unfortunately been one of quiet discrimination. This pattern has come from the evolution of an isolation-based society. Society is moving increasingly toward the human and equity-based treatment of disabled people. Reflecting some court decisions, the Education of the Handicapped Act…

  19. The Use of WISC-R Subtest Scatter in the Identification of Intellectually Gifted Handicapped Children: An Inappropriate Task?

    Science.gov (United States)

    Brown, Scott W.

    1984-01-01

    The paper discusses issues involved in the identification of gifted handicapped children, reviewing several research studies that attempted to define a specific configuration of Wechsler Intelligence Scale for Children-Revised subtest scores indicative of handicapped children possessing intellectual gifts. The author concludes that profiles and…

  20. Acoustic analysis with vocal loading test in occupational voice disorders: outcomes before and after voice therapy.

    Science.gov (United States)

    Niebudek-Bogusz, Ewa; Kotyło, Piotr; Politański, Piotr; Sliwińska-Kowalska, Mariola

    2008-01-01

    To assess the usefulness of acoustic analysis with vocal loading test for evaluating the treatment outcomes in occupational voice disorders. Fifty-one female teachers with dysphonia were examined (Voice Handicap Index--VHI, laryngovideostroboscopy and acoustic analysis with vocal loading) before and after treatment. The outcomes of teachers receiving vocal training (group I) were referred to outcomes of group II receiving only voice hygiene instructions. The results of subjective assessment (VHI score) and objective evaluation (acoustic analysis) improved more significantly in group I than in group II. The post-treatment examination revealed a decreased percentage of subjects with deteriorated jitter parameters after vocal loading, particularly in group I. Acoustic analysis with vocal loading test can be a helpful tool in the diagnosis and evaluation of treatment efficacy in occupational dysphonia.

  1. Relative contributions of self-efficacy, self-regulation, and self-handicapping in predicting student procrastination.

    Science.gov (United States)

    Strunk, Kamden K; Steele, Misty R

    2011-12-01

    The relative contributions of self-efficacy, self-regulation, and self-handicapping student procrastination were explored. College undergraduate participants (N = 138; 40 men, 97 women, one not reporting sex) filled out the Procrastination Scale, the Self-Handicapping Scale-Short Form, and the Self-regulation and Self-handicapping scales of the Motivated Strategies for Learning Questionnaire. A hierarchical regression of the above measures indicated that self-efficacy, self-regulation, and self-handicapping all predicted scores on the Procrastination Scale, but self-regulation fully accounted for the predictive power of self-efficacy. The results suggested self-regulation and self-handicapping predict procrastination independently. These findings are discussed in relation to the literature on the concept of "self-efficacy for self-regulation" and its use in the field of procrastination research.

  2. Claudius, the handicapped Caesar (41-54 A.D.

    Directory of Open Access Journals (Sweden)

    Francois P. Retief

    2010-01-01

    Full Text Available Claudius, fourth Caesar of the Roman Empire, proved himself an able administrator, but physically and emotionally handicapped from birth. His parents, members of the imperial family, considered him mentally deficient and he was isolated from the general public and put in the care of an uneducated tutor who firmly disciplined the youngster. The historians report that he had a weak constitution caused by frequent illness, and when he appeared in public he was muffled in a protective cloak. To avoid possible embarrassment the ceremony of the toga virilis, at approximately 14 years of age, was a secretive affair held at midnight and devoid of the traditional procession. His grandfather, Augustus Caesar, had some sympathy for the young lad, but did not consider him capable of managing any position of public office appropriate for his age and position. This would also be the approach of the succeeding emperor, Tiberius. Claudius spent the fi rst four decades of his life in relative idleness, isolated from his family and upper class Romans, consorting with the lower classes, playing dice and revelling in excessive eating and drinking. He did, however, also involve himself seriously in a study of the sciences, literature, Greek and history – his role model in the latter being Livy. During his life time he published quite extensively, including dramas, an autobiography, a work in defence of Cicero, histories of Rome, Carthage and Etruria, and a book on dice. His first public office (besides an augurship under Augustus was at the age of 47 years when the new emperor, Gaius (Caligula made him a consul for two months. The Knights and a section of Senate now warmed towards Claudius, but Gaius and the majority of aristocratic Romans still despised him as dull-witted. After the assassination of Gaius, the Praetorian Guard in an extraordinary step, proclaimed a protesting Claudius (50 years old as emperor, and convinced an astounded Senate to endorse

  3. He Will Lift Up His Head: A Report to the Developmental Disabilities Office on the Situation of Handicapped Navajos and the Implications Thereof for All Native Americans.

    Science.gov (United States)

    Haskins, James S.; Stifle, J. M.

    Issues involved in education of handicapped Navajo children are examined. Background sections contrast the history of treatment for the handicapped in America with the treatment received by handicapped Navajos. Unemployment, substandard housing, lack of accessibility within the reservation, overpopulation, language barriers, and the relationship…

  4. Training Teachers at a School for the Handicapped in Quezaltenango, Guatemala.

    Science.gov (United States)

    Lasky, Beth

    A 5 day course was developed to train teachers at the Instituto Neurologico (Guatemala), a day school for about 50 children (aged 3 to 16) considered to be learning handicapped and educationally or trainably retarded. The course addressed five topics (one each day): special education, class routines and schedules, classroom management, evaluating…

  5. Self-Esteem of Gifted, Normal, and Mild Mentally Handicapped Children.

    Science.gov (United States)

    Chiu, Lian-Hwang

    1990-01-01

    Administered Coopersmith Self-Esteem Inventory (SEI) Form B to elementary school students (N=450) identified as gifted, normal, and mild mentally handicapped (MiMH). Results indicated that both the gifted and normal children had significantly higher self-esteem than did the MiMH children, but there were no differences between gifted and normal…

  6. The DEBT Project: Early Intervention for Handicapped Children and Their Parents.

    Science.gov (United States)

    Macy, Daniel J.; And Others

    Project DEBT (Developmental Education Birth through Two), an early identification and intervention program for handicapped and at risk children and their parents, is described. The Koontz Child Developmental Program, the core curriculum for instructional planning and intervention in DEBT, is reviewed, and new data are presented. It is explained…

  7. Investigating the Relationship between Self-Handicapping Tendencies, Self-Esteem and Cognitive Distortions

    Science.gov (United States)

    Yavuzer, Yasemin

    2015-01-01

    The purpose of this study is to examine the relationship between cognitive distortions, self-handicapping tendencies, and self-esteem in a sample of students studying in a school of education. The sample of the study was comprised of 507 volunteer students chosen through random sampling from a total of 4,720 students who were studying teaching at…

  8. Out-of-Level Testing for Special Education Students with Mild Learning Handicaps.

    Science.gov (United States)

    Jones, Eric D.; And Others

    The purpose of this study was to evaluate the utility of out-of-level testing (OLT) when it is applied to the assessment of special education students with mild learning handicaps. This evaluation of OLT involved testing hypotheses related to: (1) the adequacy of vertical scaling, (2) the reliability and (3) the validity of OLT scores. Fifty-eight…

  9. Medical Considerations for Multiple-Handicapped Children in the Public Schools

    Science.gov (United States)

    Bryan, Elizabeth; And Others

    1978-01-01

    The authors discuss concerns and practical suggestions involved in the education of multiply handicapped children in the following problem areas: first aid, emergency care and disaster planning; sanitation; environment; safety in routine and supplemental activities; therapy procedures; and staff protection, training, orientation, and special…

  10. Self-Modification Technique for the Control of Eating Behavior for the Visually Handicapped.

    Science.gov (United States)

    Snoy, Mary T.; van Benten, Letitia

    1978-01-01

    A ten-week study was done of four visually handicapped overweight adolescents (ages 15-19 years) in a residential school to evaluate the efficacy of an operant conditioning technique designed to promote weight loss by altering eating habits. (Author/DLS)

  11. Treatment or Involuntary Euthanasia for Severely Handicapped Newborns: Issues of Philosophy and Public Policy.

    Science.gov (United States)

    Powell, T. Hennessy; And Others

    1982-01-01

    Recent reports have indicated that parents and/or physicians occasionally decide not to provide life-sustaining treatment (referred to as involuntary euthanasia), thus ensuring that the severely handicapped newborn will die. The issues involved relative to treatment or involuntary euthanasia are reviewed from two opposing perspectives…

  12. Attending Behavior: Commonalities and Differences Among Educable Retarded, Learning Disabled, and Emotionally Handicapped Juvenile Delinquents.

    Science.gov (United States)

    Hill, Nancy C.; And Others

    The study investigated three variables--juvenile delinquency, academic achievement, and attention span--with 77 incarcerated juveniles [18 emotionally handicapped (EH), 20 learning disabled (LD), 19 educable mentally retarded (EMR), and 20 nonidentified]. The Detroit Tests of Learning Aptitude were used for testing in the areas of visual and…

  13. An Approximation of an Instructional Model for Developing Home Living Skills in Severely Handicapped Students.

    Science.gov (United States)

    Hamre, S.

    The author discusses the need for severely handicapped students to acquire basic home living skills, reviews task analysis principles, and provides sample instructional programs. Listed are basic grooming, dressing, domestic maintenance, and cooking skills. A sample task analysis procedure is demonstrated for the skill of brushing teeth. Reported…

  14. Training Pragmatic Language Skills through Alternate Strategies with a Blind Multiply Handicapped Child.

    Science.gov (United States)

    Evans, C. J.; Johnson, C. J.

    1988-01-01

    A blind multiply handicapped preschooler was taught to respond appropriately to two adjacency pair types ("where question-answer" and "comment-acknowledgement"). The two alternative language acquisition strategies available to blind children were encouraged: echolalia to maintain communicative interactions and manual searching…

  15. Nursing-care dependency : Development of an assessment scale for demented and mentally handicapped patients

    NARCIS (Netherlands)

    Dijkstra, Ate; Buist, Girbe; Dassen, T

    1996-01-01

    This article describing the first phase in the development of an assessment scale of nursing-care dependency (NCD) for Dutch demented and mentally handicapped patients focuses on the background to the study and the content validation of the nursing-care dependency scale. The scale aims to

  16. Strategic behaviour of institutional providers in mental handicapped care in the Netherlands

    NARCIS (Netherlands)

    van Harten, Willem H.; Veldhuis, Marleen J.M.; Hoeksma, Bernhard H.; Krabbendam, Johannes Jacobus

    2007-01-01

    Purpose – The purpose of this paper is to describe an inventory of the strategic responses of institutional providers of mental handicapped care to the strengthening of consumer choice through a personal care budget (PCB) Design/methodology/approach – Semi structured interviews were conducted among

  17. Guidelines for Assessing Job-Related Social Skills of Mildly Handicapped Students.

    Science.gov (United States)

    Bullis, Michael; Foss, Gilbert

    1986-01-01

    Effective assessment of job-related social skills of mildly handicapped workers should consider three components of social competence: context, cognition, and performance. A comprehensive profile of social competence is best obtained through use of several assessment tools, such as: rating scales; role play; problem-solving tests; applied…

  18. Feeding Management of a Child with a Handicap: A Guide for Professionals.

    Science.gov (United States)

    Smith, Mary Ann Harvey; And Others

    Intended for professionals from a variety of disciplines (such as nutrition, dentistry, nursing, occupational and physical therapy, speech pathology, social work, and education), the guide presents information on feeding problems of children with handicaps. Part I, which traces the development of feeding, considers in detail normal development and…

  19. Materials on Creative Arts (Arts, Crafts, Dance, Drama, Music, Bibliotherapy) for Persons with Handicapping Conditions. Revised.

    Science.gov (United States)

    American Alliance for Health, Physical Education, and Recreation, Washington, DC. Information and Research Utilization Center.

    Intended as a resource guide for persons who include such subjects as arts, crafts, dance, and music in programs for the handicapped, resources are listed for printed materials, audiovisual materials, resource persons and organizations, and material and equipment suppliers. Brief literature reviews sum up the state of the art in the specific art…

  20. Pots and Pans Activities for Parent and Child: Activities for Preschool Multiple Handicapped Children.

    Science.gov (United States)

    Van Tassel, Jean

    Intended for parents and teachers of multiply handicapped preschool children, the booklet provides lesson plans in three major areas--basic concepts, motor activities, and language activities. Each lesson plan is broken down into four parts: purpose (a descriptive statement of what the lesson hopes to accomplish), materials (list of materials…

  1. Oral Health Status Of Handicapped Primary School Pupils In Dar Es ...

    African Journals Online (AJOL)

    calculus, with highest mean scores mainly among the blind (p= 0.008). Conclusion: The caries prevalence among handicapped primary school pupils was quite low. However, there was relatively high level of gingival bleeding and calculus. Regarding treatment needs, 23% required dental fillings mainly of one and two ...

  2. Mental and Behavioral Symptoms of Person's with Asperger's Syndrome: Relationships with Social Isolation and Handicaps

    Science.gov (United States)

    Tani, Masayuki; Kanai, Chieko; Ota, Haruhisa; Yamada, Takashi; Watanabe, Hiromi; Yokoi, Hideki; Takayama, Yuko; Ono, Taisei; Hashimoto, Ryuichiro; Kato, Nobumasa; Iwanami, Akira

    2012-01-01

    People with Asperger's syndrome (AS) experience mental comorbidities, and behavioral symptoms that can deepen social isolation and handicaps. We compared the frequency of mental and behavioral symptoms, motor abnormality, and life history between adults with AS and those with no mental disorders but with disturbance of social functions and…

  3. Reevaluation of the Amsterdam Inventory for Auditory Disability and Handicap Using Item Response Theory

    Science.gov (United States)

    Hospers, J. Mirjam Boeschen; Smits, Niels; Smits, Cas; Stam, Mariska; Terwee, Caroline B.; Kramer, Sophia E.

    2016-01-01

    Purpose: We reevaluated the psychometric properties of the Amsterdam Inventory for Auditory Disability and Handicap (AIADH; Kramer, Kapteyn, Festen, & Tobi, 1995) using item response theory. Item response theory describes item functioning along an ability continuum. Method: Cross-sectional data from 2,352 adults with and without hearing…

  4. STATEMENT OF GEORGE W. FELLENDORF BEFORE THE MARYLAND COMMISSION TO STUDY EDUCATIONAL NEEDS OF HANDICAPPED CHILDREN.

    Science.gov (United States)

    FELLENDORF, GEORGE W.

    THE EXECUTIVE DIRECTOR OF THE ALEXANDER GRAHAM BELL ASSOCIATION FOR THE DEAF URGED THAT THE STATE OF MARYLAND CONTINUE TO INVESTIGATE NEW DEVELOPMENTS IN THE AREA OF EDUCATION OF THE HANDICAPPED. HE RECOMMENDED THAT CONTINUAL REVIEW AND RECOMMENDATIONS OF NEEDS BE MADE BY REGIONAL SUBCOMMITTEES, PROGRAMS BE COORDINATED BY AN ADMINISTRATOR AT THE…

  5. Cost Accounting and Accountability for Early Education Programs for Handicapped Children.

    Science.gov (United States)

    Gingold, William

    The paper offers some basic information for making decisions about allocating and accounting for resources provided to young handicapped children. Sections address the following topics: reasons for costing, audiences for cost accounting and accountability information, and a process for cost accounting and accountability (defining cost categories,…

  6. Identification of Aurally Handicapped Children and Methods and Procedures of Developing a Program.

    Science.gov (United States)

    Colorado State Dept. of Education, Denver. Div. of Special Education Services.

    An article on identification of preschool and school age aurally handicapped children and program development by John J. O'Neill precedes discussions of the role of the audiologist in evaluation of these children by Jack A. Willeford, and educational aspects of planning by John J. O'Neill. Three articles are presented on the role of the teacher in…

  7. The Placement Handbook. A Guide for the Competitive Employment of the Handicapped.

    Science.gov (United States)

    Horn, Adelaide; Drury, Stephen

    This handbook stresses those components that are considered peripheral to the placement process but that must precede the actual placement. The philosophy of placement upon which this guide is based appears first. Discussions follow of the basic components of the process of training and placement of handicapped individuals, including a varied…

  8. Designing Environments for Handicapped Children: A Design Guide and Case Study. First Edition.

    Science.gov (United States)

    Moore, Gary T.; And Others

    This guide addresses the planning and architectural design of play/learning environments for special needs children. The exceptional children discussed include those with most types of mild to severe handicaps and developmental disabilities. Specifically excluded from consideration are health impairments, severe psycho-emotional difficulties such…

  9. Arte en la Clase para Personas Incapacitadas (Art in the Classroom for Handicapped Persons).

    Science.gov (United States)

    National Committee, Arts for the Handicapped, Washington, DC.

    The Spanish translation contains a collection of arts strategies intended to stimulate, motivate, and teach basic skills to handicapped children. The lessons involve one or more of the basic art forms (movement, music, drama, and art) and are further divided into five levels of aesthetic development: awareness, imitation, self-initiation, skill…

  10. Fear of Failure, Self-Handicapping, and Negative Emotions in Response to Failure

    Science.gov (United States)

    Bartels, Jared M.; Herman, William E.

    2011-01-01

    Research suggests that students who fear failure are likely to utilize cognitive strategies such as self-handicapping that serve to perpetuate failure. Such devastating motivational dispositions clearly limit academic success. The present study examined negative emotional responses to scenarios involving academic failure among a sample of…

  11. Predictors of Academic Self-Handicapping and Achievement: Examining Achievement Goals, Classroom Goal Structures, and Culture

    Science.gov (United States)

    Urdan, Tim

    2004-01-01

    The purposes of this study were to examine the predictors and achievement consequences of academic self-handicapping and to explore cultural variations in the pursuit and effects of performance goals and perceived classroom performance goal structures. Data were collected in 2 consecutive academic years from a diverse sample of high school…

  12. Self-Handicapping and Irrational Beliefs about Approval in a Sample of Teacher Candidates

    Science.gov (United States)

    Kaya, Çinar; Ugur, Erol; Sar, Ali Haydar; Ercengiz, Mustafa

    2017-01-01

    The main objective of the current study is to examine the relationships between self-handicapping, and irrational beliefs about approval, irrational beliefs about interpersonal relationships, irrational beliefs about self and the overall level of irrational beliefs by reference to the " ABC " framework. Participants of the study were 263…

  13. Sex differences in claimed and behavioral self-handicapping and ADHD symptomatology in emerging adults.

    Science.gov (United States)

    Jaconis, Maryanne; Boyd, Stephen J; Hartung, Cynthia M; McCrea, Sean M; Lefler, Elizabeth K; Canu, Will H

    2016-12-01

    Although the research is clear that boys with ADHD have higher symptomatology and impairment than girls with ADHD, for adults the research is mixed. Some studies suggest no sex differences, whereas others suggest that women might have higher symptomatology and impairment. The present study examined sex differences in ADHD symptomatology and impairment, and the possible role of claimed and behavioral self-handicapping as an explanation for any differences. Claimed self-handicapping (CSH) involves reports of performance-inhibiting conditions, whereas behavioral self-handicapping (BSH) involves reporting more objective, intentional acts that could undermine performance. College students (N = 699) completed an online study. Sex differences were found for hyperactivity such that women reported higher levels, but not for inattention or impairment. The test of the indirect effect of sex through CSH was significant, suggesting that higher levels of CSH in women were associated with elevated ADHD symptoms and impairment. The test of the indirect effect of sex through BSH was also significant, suggesting that higher levels of BSH in men are associated with elevated symptoms of ADHD and impairment. These data extend the literature by suggesting that self-handicapping might at least partially explain differential self-reporting of ADHD symptoms and impairment in emerging adults across the sexes.

  14. Prevention of Self-Handicapping--The Protective Function of Mastery Goals

    Science.gov (United States)

    Schwinger, Malte; Stiensmeier-Pelster, Joachim

    2011-01-01

    Drawing on modern diathesis-stress theories which suggest a multiplicative approach to determine one's personal vulnerability status, we posit that the degree of an individual's vulnerability for using self-handicapping strategies in case of self-threatening events depends on the interaction between different vulnerability and protective factors.…

  15. Predictors of Self-Handicapping: An Examination of Personal and Contextual Factors.

    Science.gov (United States)

    Garcia, Teresa; And Others

    Evaluation is so paramount in students' lives that researchers have found that, for many students, one's self-worth is intricately tied to one's performance. Self-handicapping is a strategy that may be used to maintain one's self-worth. This anticipatory tactic typically involves the use of procrastination; by procrastinating, one clouds the…

  16. Evaluating Post-School Transition of Secondary Students with Moderate to Severe Handicaps. Final Report.

    Science.gov (United States)

    Bruininks, Robert H.; Thurlow, Martha L.

    The final report describes a 3-year project which had four primary objectives: (1) development of a followup system feasible for schools to use to obtain information on individuals with handicaps who leave school; (2) data collection on three special education samples; (3) data analysis to evaluate long-term effects of secondary programs and…

  17. A Leisure Activities Curricular Component for Severely Handicapped Youth: Why and How.

    Science.gov (United States)

    Voeltz, Luanna M.; Apffel, James A.

    1981-01-01

    A rationale for including a leisure time activities curriculum component in educational programing for severely handicapped individuals is presented. The importance of play and the constructive use of leisure time is described through the use of a model demonstration project. (JN)

  18. Relating the Capabilities of the Handicapped to the Human Attribute Requirements of Jobs: Appendixes.

    Science.gov (United States)

    Ohio State Univ., Columbus. National Center for Research in Vocational Education.

    Twenty-five appendixes from a study attempting to match capabilities of the handicapped to the human attribute requirements of three jobs (general secretary, automotive mechanic, and business data programmer) are presented. Appendixes include information on such topics as data analysis for identification of key tasks; job descriptions for the…

  19. Issues in the Enumeration of Handicapping Conditions in the United States.

    Science.gov (United States)

    Martini, Linda; MacTurk, Robert H.

    1985-01-01

    The article identifies sources of prevalence and incidence rates for handicaps and disabilities, points out problems regarding obtaining this information, and examines reasons for the problems. Two measures are suggested: first, to set up a national directory of those health statistics already being collected; and second, to develop a nationwide…

  20. Integrating Severely Handicapped Learners: Potential Teacher Liability in Community Based Programs.

    Science.gov (United States)

    Brady, Michael P.; Dennis, H. Floyd

    1984-01-01

    The paper examines elements of negligence and other legal concerns in view of the evolving trend to educate severely handicapped persons in integrated, community based settings. Duty, care, risk, and appropriate placement and instruction are discussed. Finally, recommendations for avoiding teacher liability are presented. (Author/CL)

  1. Relationships between Competitive Anxiety, Social Support and Self-Handicapping in Youth Sport

    Science.gov (United States)

    Wezyk, Agata

    2011-01-01

    Study aim: To assess the level of self-handicapping tendency, competitive anxiety (trait) and social support within groups of young male and female athletes, as well as to determine the relationships between those variables. Material and methods: A group of 75 athletes (46 male football players and 29 female volleyball players) from Sport Mastery…

  2. Education of the handicapped child: Status, trend, and issues related to electronic delivery

    Science.gov (United States)

    Rothenberg, D.

    1973-01-01

    This study is part of a broader investigation of the role of large-scale educational telecommunications systems. Thus, data are analyzed and trends and issues discussed to provide information useful to the systems designer who wishes to identify and assess the opportunities for large-scale electronic delivery of education for the handicapped.

  3. Coping Strategies and Adaptation of Mothers of Children with Handicapping Conditions.

    Science.gov (United States)

    Hooshyar, Nahid T.

    Mothers' coping mechanisms and adaptations to having a handicapped child were analyzed through extensive structured interviews with mothers of eight preschool-aged Down syndrome children and a language impaired child. Three illustrative case studies are presented, and general conclusions are drawn. Mothers of Down syndrome children go through the…

  4. The Professional Education of Handicapped People in Moscow: Opportunities and Obstacles

    Science.gov (United States)

    Chadova, T. A.

    2014-01-01

    In Moscow, one priority area of urban social policy has focused on the formation of equal opportunities for handicapped people and those with impaired health in the process of their integration into all spheres of life and activity, including professional education. The year 2009 was declared to be the Year of Equal Opportunities. The…

  5. The psychometric properties of the Tinnitus Handicap Questionnaire in a Dutch-speaking population.

    Science.gov (United States)

    Vanneste, S; To, W T; De Ridder, D

    2011-02-01

    The aim of the study is to translate and validate the tinnitus handicap questionnaire (THQ) for a Dutch-speaking population. The factor structure of the questionnaire, the reliability and the validity is determined. Furthermore, a statistical comparison with the original English version of the tinnitus handicap questionnaire is performed. We assessed 101 patients at the Tinnitus Research Initiative clinic of Antwerp University Hospital. Twenty-seven Dutch items from the tinnitus handicap questionnaire by Kuk et al. [(1990), Ear Hear11:434-45.] were obtained by the process of translation and back translation. The factor structure, internal consistency, was evaluated using Cronbach's alpha coefficient and item correlations were used to confirm reliability. The construct validity was confirmed with a visual analogue scale for loudness and distress, awareness, annoyance, the Tinnitus Questionnaire (TQ), the mini-Tinnitus Questionnaire, the Hospital Anxiety and Depression Scale (HADS), the Beck Depression Inventory (BDI) and the Profile of Mood State (POMS), ensuring that this new instrument measures the tinnitus handicap. This study demonstrates that the Dutch version of the tinnitus handicap questionnaire is a reliable (Cronbach's alpha coefficient α = 0.93) and valid measure of self-perceived tinnitus-related distress [with visual analogue scale for loudness (r = 0.39) and distress (r =0.45), awareness (r = 0.39), annoyance (r = 0.57), the Tinnitus Questionnaire (r = 0.82), the mini-Tinnitus Questionnaire (r = 0.79), the Hospital Anxiety and Depression Scale (r = 0.62) and the Beck Depression Inventory (r = 0.32)]. The psychometric properties are in line with previous findings on the English version with regard to reliability and validity. However, the items in the subscales differ from the English version. While the English version has three subscales, our version has only two subscales. Yet, the English version reports that for the three factors, there is a low

  6. [Combined hepatitis A/B vaccination: evaluation of a vaccination schedule in facilities for handicapped people].

    Science.gov (United States)

    Wolters, B; Müller, T; Ross, R S; Kundt, R; Roggendorf, M; Roggendorf, H

    2014-02-01

    People with mental and physical disabilities have a higher risk of infection with hepatitis viruses. Studies conducted so far show contradictory results on the success of vaccination in this population. These people live and work under special conditions and sometimes have immune defects. We investigated the antibody response after combined vaccination against hepatitis A and B in facilities for handicapped people in the city of Essen/Germany. Antibodies were determined in people with disabilities (n=949) and also in social workers taking care of handicapped people (n=115). Protective antibodies against hepatitis A were detected in 98.9% in people with disabilities and social workers. The seroconversion rate against hepatitis B in handicapped people was 90.2% and was comparable to the seroconversion rate in social workers (91.3%). Re-vaccinations were offered to all people with anti-HBs titres below 100 IU/L (28% of handicapped and 23.5% of social workers). In the group of low responders in handicapped people about 50% developed anti-HBs concentration above 100 IU/L. Non-responders showed 30-40% seroconversion rate after re-vaccination. Based on this study we would recommend serological tests about 4-8 weeks after vaccination to confirm seroconversion. By this procedure people who need a booster vaccination will be recognized and non-responders should be offered another HBV vaccination. In about 20% of the non-responders included in this study HBs antigen was detected. © Georg Thieme Verlag KG Stuttgart · New York.

  7. Vocal outcome after endoscopic thyroarytenoid myoneurectomy in patients with adductor spasmodic dysphonia.

    Science.gov (United States)

    Gandhi, Sachin; Remacle, Marc; Mishra, Prasun; Desai, Vrushali

    2014-12-01

    Spasmodic dysphonia (SD) remains one of the most difficult of laryngeal pathologies to treat. With limited role for speech therapy, various surgical modalities have been tried with various success rates. The objective of the study is to report the results of vocal outcome after thyroarytenoid myoneurectomy in patients of adductor spasmodic dysphonia (ASD). 15 patients of ASD were selected. GRBAS, and voice handicap index (VHI) were used for perceptual evaluation of voice. Thyroarytenoid myoneurectomy was performed by vaporizing the muscular layer of the vocal fold with CO2 laser, at an intensity of 6 W with 1.2 mm diameter in scanner mode. Voice analysis was repeated at 12, 24 and 48 months follow-up. Preoperative GRBAS scores and VHI score of all the patients were poor. At 12 months 12/15 (80 %) patients having strain score of 0. There was marked improvement in VHI scores at 6 months. 10/15 (67 %) patients have been followed up for 24 months. 5/10 (50 %) patients have strain (S) value of 0. VHI scoring of 5/10 (50 %) patients was <30. Two of the four patients completed 48 months follow-up had a strain (S) value of 0, one patient has strain value of 1 and one patient had strain value of 2. 2/4 patients had VHI score of <30; one patient had that of 40. Trans-oral CO2 laser thyroarytenoid myoneurectomy shows significant long-term improvement in voice quality in terms of reduced speech brakes, effort and strain in voice.

  8. A randomized controlled trial of stretch-and-flow voice therapy for muscle tension dysphonia.

    Science.gov (United States)

    Watts, Christopher R; Hamilton, Amy; Toles, Laura; Childs, Lesley; Mau, Ted

    2015-06-01

    To investigate the effect of stretch-and-flow voice therapy on vocal function and handicap. Randomized controlled trial. Participants with primary muscle tension dysphonia were randomly assigned to experimental or control groups. Experimental participants received vocal hygiene education followed by 6 weeks of stretch-and-flow voice therapy. Control participants received vocal hygiene education only. Outcome variables consisted of a measure of vocal handicap (Voice Handicap Index [VHI]), maximum phonation time, s/z ratio, and acoustic measures. All measures were obtained at baseline prior to treatment and within 2 weeks posttreatment or at the end of the control period. The pre- to posttreatment measurement change (delta Δ) was applied to statistical analyses. A multivariate analysis of variance revealed significant group differences in pre-to-post changes on measures of VHI, maximum phonation time, and cepstral peak prominence (CPP) in connected speech and vowels (P = 0.003, 0.013, 0.025, and 0.017 respectively), with a significant reduction of VHI (Cohen's d = 1.6), increase in maximum phonation time (Cohen's d = 1.2), increase of CPP in connected speech (Cohen's d = 1.2), and increase of CPP in vowels (Cohen's d = 1.1) in the experimental group compared to the control group. This preliminary small sample randomized controlled trial found significantly greater improvement in vocal handicap, maximum phonation time, and acoustic measures of vocal function after participants received stretch-and-flow voice therapy compared to participants receiving vocal hygiene education alone. Additional research incorporating larger samples will be needed to confirm and further investigate these findings. 1b. © 2015 The American Laryngological, Rhinological and Otological Society, Inc.

  9. Flexible parents: joint effects of handicapping and brood size manipulation on female parental care in Nicrophorus vespilloides.

    Science.gov (United States)

    Ratz, Tom; Smiseth, Per T

    2018-02-22

    Parental care is highly variable, reflecting that parents make flexible decisions in response to variation in the cost of care to themselves and the benefit to their offspring. Much of the evidence that parents respond to such variation derives from handicapping and brood size manipulations, the separate effects of which are well understood. However, little is known about their joint effects. Here, we fill this gap by conducting a joint handicapping and brood size manipulation in the burying beetle Nicrophorus vespilloides. We handicapped half of the females by attaching a lead weight to their pronotum, leaving the remaining females as controls. We also manipulated brood size by providing each female with 5, 20 or 40 larvae. In contrast to what we predicted, handicapped females spent more time provisioning food than controls. We also found that handicapped females spent more time consuming carrion. Furthermore, handicapped females spent a similar amount of time consuming carrion regardless of brood size, whereas controls spent more time consuming carrion as brood increased. Females spent more time provisioning food towards larger broods, and females were more likely to engage in carrion consumption when caring for larger broods. We conclude that females respond to both handicapping and brood size manipulations, but these responses are largely independent of each other. Overall, our results suggest that handicapping might lead to a higher investment into current reproduction and that it might be associated with compensatory responses that negate the detrimental impact of higher cost of care in handicapped parents. © 2018 Crown copyright. Journal of Evolutionary Biology © 2018 European Society For Evolutionary Biology This article is published with the permission of the Controller of HMSO and the Queen’s Printer for Scotland. Note: some government agencies may require additional wording and acknowledgement.

  10. Applicability of the Arabic version of Vocal Tract Discomfort Scale (VTDS) with student singers as professional voice users.

    Science.gov (United States)

    Darawsheh, Wesam B; Natour, Yaser S; Sada, Eve G

    2018-07-01

    This pilot study aimed to evaluate the internal consistency, convergent construct validity and criterion validity of Arabic version of the Vocal Tract Discomfort Scale (VTDS), and to investigate the correlation between the scores of the VTDS, the VHI and the acoustic measures of fundamental frequency (F0), shimmer, jitter and signal-to-noise ratio (SNR). A cross-sectional study where 97 participants participated (47 males and 50 females) (mean age 20.5 ± 2.1 years) (31 student singers and 66 other non-professional voice user students). Participants were without self-perceived voice disorders who completed the VTDS-Arab scale and the Voice Handicap Index (VHI-Arab), and recorded a vocal sample of/a:/at a comfortable level. A positive internal consistency that signifies reliability was confirmed by Cronbach's α = .884 and 0.874 for the VTDS-Arab frequency and severity subscales, respectively. A moderate positive correlation was found between the VTDS-Arab (frequency, severity, total) and the VHI-Arab total where values of Pearson's correlation coefficient were r= 0.459, 0.430 and 0.451, respectively. Weak correlations were found between all of the acoustic measures and the scores of the VTDS-Arab and VHI-Arab (total and subscales). The area under curve for the VTDS was AUC= 0.824, 0.804 and 0.817 for the VTDS frequency, VTDS severity and VTDS total, respectively. The VTDS-Arab is a valid and reliable tool in measuring vocal tract sensations and predicting the perception of vocal handicap in student singers and can be used to predict the vocal load among professional voice users.

  11. The immunocompetence handicap hypothesis in two sexually dimorphic pinniped species - there a sex difference in immunity during early development?

    NARCIS (Netherlands)

    Hall, A.J.; Engelhard, G.H.; Brasseur, S.M.J.M.; Vecchione, A.; Burton, H.R.; Reijnders, P.J.H.

    2003-01-01

    The 'immunocompetence handicap hypothesis' predicts that highly sexually dimorphic and polygynous species will exhibit sex differences in immunity. We tested this hypothesis in southern elephant and grey seals during their early development by measuring the following parameters: leucocyte counts,

  12. The immunocompetence handicap hypothesis in two sexually dimorphic pinniped species - is there a sex difference in immunity during early development?

    NARCIS (Netherlands)

    Hall, AJ; Englehard, GH; Brasseur, SMJM; Vecchione, A; Burton, HR; Reijnders, PJH

    2003-01-01

    The 'immunocompetence handicap hypothesis' predicts that highly sexually dimorphic and polygynous species will exhibit sex differences in immunity. We tested this hypothesis in southern elephant and grey seals during their early development by measuring the following parameters: leucocyte counts,

  13. The Philosophy behind a (Danish) Voice-controlled Interface to Internet Browsing for motor-handicapped

    DEFF Research Database (Denmark)

    Brøndsted, Tom

    2005-01-01

    The public-funded project "Indtal" ("Speak-it") has succeeded in developing a Danish voice-controlled utility for internet browsing targeting motor-handicapped users having difficulties using a standard keyboard and/or a standard mouse. The system underlies a number of a priori defined design cri...... with the unimodal oral mode, etc. These criteria have lead to a primarily message-driven system interacting with an existing browser on the end users' systems.......The public-funded project "Indtal" ("Speak-it") has succeeded in developing a Danish voice-controlled utility for internet browsing targeting motor-handicapped users having difficulties using a standard keyboard and/or a standard mouse. The system underlies a number of a priori defined design...

  14. Psychosomatic symptoms in medical outpatients: an investigation of self-handicapping theory.

    Science.gov (United States)

    Organista, P B; Miranda, J

    1991-01-01

    Investigated self-handicapping theory as it relates to somatization in medical patients. We predicted that medical outpatients (N = 113) would report psychosomatic symptoms in response to events that threaten their self-esteem. As predicted, results of hierarchical multiple regression indicated that high-perfectionism patients reported somatic symptoms positively related to the number of events that jeopardize their sense of accomplishment, whereas low-perfectionism patients' somatic symptoms were not related to these events (p = .005). Contrary to prediction, high-dependency patients did not differ significantly from low-dependency patients in the relationship of somatic symptoms and events that threatened their interpersonal relationships (p = .115). Implications of these findings and the utility of self-handicapping theory for predicting somatization in medical patients are discussed.

  15. The Effects of Incidental Teaching on the Generalized Use of Social Amenities at School by a Mildly Handicapped Adolescent

    OpenAIRE

    Oswald, L. K.; Lignugaris/Kraft, Benjamin; West, R.

    1990-01-01

    Recently, researchers have begun exploring the effects of incidental teaching on the acquisition of socially appropriate behavior by handicapped children and adults. The results of these investigations suggest that incidental teaching may facilitate the generalization of newly trained social skills. This study used incidental teaching procedures to teach a 16-year-old mildly handicapped student to use social amenities in a resource classroom. In addition, generalization was assessed to anothe...

  16. Behavioral and physiological responses to male handicap in chick-rearing black-legged kittiwakes

    Science.gov (United States)

    Leclaire, S.; Bourret, V.; Wagner, R.H.; Hatch, Shyla A.; Helfenstein, F.; Chastel, O.; Danchin, E.

    2011-01-01

    Parental investment entails a trade-off between the benefits of effort in current offspring and the costs to future reproduction. Long-lived species are predicted to be reluctant to increase parental effort to avoid affecting their survival. We tested this hypothesis in black-legged kittiwakes Rissa tridactyla by clipping flight feathers of experimental males at the beginning of the chick-rearing period. We analyzed the consequences of this handicap on feeding and attendance behavior, body condition, integument coloration, and circulating levels of corticosterone and prolactin in handicapped males and their mates in comparison to unmanipulated controls. Chicks in both groups were compared in terms of aggressive behavior, growth, and mortality. Handicapped males lost more mass, had less bright integuments, and attended the nest less often than controls. Nevertheless, they fed their chicks at the same rate and had similar corticosterone and prolactin levels. Compared with control females, females mated with handicapped males showed a lower provisioning rate and higher nest attendance in the first days after manipulation. Their lower feeding rate probably triggered the increased sibling aggression and mortality observed in experimental broods. Our findings suggest that experimental females adaptively adjusted their effort to their mate's perceived quality or that their provisioning was constrained by their higher nest attendance. Overall, our results suggest that kittiwake males can decrease their condition for the sake of their chicks, which seems to contradict the hypothesis that kittiwakes should be reluctant to increase parental effort to avoid affecting their survival. ?? 2011 The Author. Published by Oxford University Press on behalf of the International Society for Behavioral Ecology. All rights reserved.

  17. Medical Services from the Point of View of People with a Sight Handicap

    OpenAIRE

    Nováková Peršínová, Lenka

    2010-01-01

    My thesis deals with the provision of medical services to people with a severe sight handicap. My research focuses on fully blind people. The aim of my thesis is to find out the situation of these people within medical facilities. I try to reveal blind people's experience of how healthcare workers communicate with them, how well prepared healthcare professionals are and how blind people themselves are prepared. I also examine what technical obstacles are encountered by blind people in medical...

  18. In Turkey, factors which urge physically handicapped sporters to start badminton sport and their expectations

    Directory of Open Access Journals (Sweden)

    Arslan Ersin

    2017-01-01

    Full Text Available The purpose of the study is to determine factors, which lead physically handicapped badminton players in Turkey to tend towards badminton sport, and expectations of sporters. 45 (Male: 29 Female: 16 physically handicapped sporters, who participated in Turkey Bandminton Championship for Physically Handicapped, which was arranged in Antalya on 24-26 February, 2017, from different cities, attended the study voluntarily. Developed by Sunay and his colluages [13], tendency to sports and expectation survey was used in badminton branch after expert opinions, firstly, were received and necessary regulations were made for using it in our study. In order to determine whether the difference between opinions of sporters, attending the study, according to their genders, their ages, their best sport degrees, their sport years, their parents’ educational backgrounds and jobs, is important or not, one-way analysis of variance was used. To identify resource of the difference, Duncan’s multiple range test was used. Kruskal Wallis H test was used when normality and homogeneity of variances were not provided. Value of p for comparisons was taken as 0,05. Consequently, it was determined that, in Turkey, effects of environment, friend-peer group and trainer on sporters playing at elite level as physically handicapped are high in starting badminton firstly while effects of sport complex, parents and siblings, mass media such as television and media organs on tendency to badminton are quite low. It was ascertained that liking badminton sport and delighting in earning success were effective as the reasons of physically handicappeds’ playing badminton sport and their expectations were, firstly, to be chosen for national team and to be national team sporters.

  19. Self-handicapping, excuse making, and counterfactual thinking: consequences for self-esteem and future motivation.

    Science.gov (United States)

    McCrea, Sean M

    2008-08-01

    Researchers interested in counterfactual thinking have often found that upward counterfactual thoughts lead to increased motivation to improve in the future, although at the cost of increased negative affect. The present studies suggest that because upward counterfactual thoughts indicate reasons for a poor performance, they can also serve as excuses. In this case, upward counterfactual thoughts should result in more positive self-esteem and reduced future motivation. Five studies demonstrated these effects in the context of self-handicapping. First, upward counterfactual thinking was increased in the presence of a self-handicap. Second, upward counterfactual thoughts indicating the presence of a self-handicap protected self-esteem following failure. Finally, upward counterfactual thoughts that protect self-esteem reduced preparation for a subsequent performance as well as performance itself. These findings suggest that the consequences of upward counterfactuals for affect and motivation are moderated by the goals of the individual as well as the content of the thoughts. (c) 2008 APA, all rights reserved

  20. The social representation about handicapped students in inclusive education: the view of children

    Directory of Open Access Journals (Sweden)

    Karina Mendonça Vasconcellos

    2011-12-01

    Full Text Available Historically excluded, handicapped people have been socially included through new standards guided by egalitarian principles. The Social Representation Theory, which studies how the common sense builds “theories” about relevant objects, was used to answer how this situation affects children socially and psychologically in inclusive schools. We use a multimethodological approach with free associations, drawings and focus groups to study the social representations of 39 third and fourth grade students about their handicapped colleagues, all the children being from a state school in Recife, Pernambuco. The data were submitted to content analysis and analysis using the EVOC software, and the results indicate that handicapped children are seen as people limited by a temporary or permanent shortage or disability; they learn differently from others and disrupt classes; they require constant care and protection; they are allowed to join the group, but not to be part of it. The group seems to be outlining the contours of otherness, which shows a representation under construction.

  1. Children's experiences of war: handicapped children in England during the Second World War.

    Science.gov (United States)

    Wheatcroft, Sue

    2008-01-01

    The experiences of children during the Second World War have attracted considerable attention, both scholarly and popular. Not all children however, have received equal attention. Handicapped children are conspicuous by their absence from all types of literature, both on evacuation and on children's experiences of the Second World War. This article restores these children to the story of wartime England and assesses their experiences. It examines the plans that were made for their evacuation and how they were carried out, and compares their lives, both individually and institutionally (i.e. in the various types of 'special' school) with those who, for various reasons, were not evacuated. It also compares their experiences, to a lesser degree, with those of their non-handicapped counterparts. The article argues that for many handicapped children it was a positive experience but one which depended on specific aspects, such as the attitudes of the authorities and of the general public, and perhaps more importantly, the attitudes and quality of the teaching and nursing staff, who were responsible for the children on a daily basis.

  2. The handicapped child: psychological effects of parental, marital, and sibling relationships.

    Science.gov (United States)

    Fisman, S; Wolf, L

    1991-03-01

    Although the nature and severity of a handicapping condition are not the sole determinants of family functioning, the presence of a child with a pervasive developmental disorder has a significant effect on family members. Maternal mental health suffers, and the resulting depression affects her role as mother and marriage partner. Unlike other handicapping conditions with obvious physical stigmata, the invisible handicap of the autistic child and the frequent delay in diagnosis contribute to the mother's self-doubt about her parental competence. While the impact on paternal psychological health is less, the fathers of autistic children are nevertheless highly stressed and appear to be particularly vulnerable to the stress generated by these difficult children. Living within this family climate, the risks for emotional and behavioral problems for siblings must be evaluated, along with their intrinsic strengths, to plan preventive interventions for these children. Effective work with these families requires an understanding of the evolution of family system problems and their dynamic and reciprocal interaction over time.

  3. [Handicapped patients and leisure sports--a chance for social integration].

    Science.gov (United States)

    Wilhelm, U

    2000-10-01

    Organizing leisure time in an active way with lots of experiences is getting more and more important in western society. Accordingly, sports activities and travelling as well as their combination, holiday sports activities, are in great demand. A general idea of the literature in that field with regard to the possibilities and difficulties of handicapped persons is that holiday sports activities are considered apt to offer outstanding prerequisites for handicapped and nonhandicapped people getting closer to each other. Starting out on this basis, this survey is mainly dedicated to the following questions: What is the situation for handicapped persons in holiday sports activities? Is holiday sporting in a position to meet the expectations of social integration, and to what extent? A questionnaire about these items was answered by wheelchair users, making it clear, on the one hand, that there are hardly any offers for disabled people to take part in holiday sporting activities. On the other hand, the survey confirms that holiday sports activities are well suited to answer major demands of the integration issue, i.e., communication and interaction as well as other factors conducive to social integration. Subsequently, the author formulates the request that access to and participation in holiday sporting activities be made easier for disabled people so that greater use can be made of these special opportunities for social integration.

  4. Achievement goals, self-handicapping, and performance: a 2 x 2 achievement goal perspective.

    Science.gov (United States)

    Ntoumanis, Nikos; Thøgersen-Ntoumani, Cecilie; Smith, Alison L

    2009-11-01

    Elliot and colleagues (2006) examined the effects of experimentally induced achievement goals, proposed by the trichotomous model, on self-handicapping and performance in physical education. Our study replicated and extended the work of Elliot et al. by experimentally promoting all four goals proposed by the 2 x 2 model (Elliot & McGregor, 2001), measuring the participants' own situational achievement goals, using a relatively novel task, and testing the participants in a group setting. We used a randomized experimental design with four conditions that aimed to induce one of the four goals advanced by the 2 x 2 model. The participants (n = 138) were undergraduates who engaged in a dart-throwing task. The results pertaining to self-handicapping partly replicated Elliot and colleagues' findings by showing that experimentally promoted performance-avoidance goals resulted in less practice. In contrast, the promotion of mastery-avoidance goals did not result in less practice compared with either of the approach goals. Dart-throwing performance did not differ among the four goal conditions. Personal achievement goals did not moderate the effects of experimentally induced goals on self-handicapping and performance. The extent to which mastery-avoidance goals are maladaptive is discussed, as well as the interplay between personal and experimentally induced goals.

  5. Tendency to self-handicapping in the situation of expected failure

    Directory of Open Access Journals (Sweden)

    Smederevac-Stokić Snežana

    2003-01-01

    Full Text Available The basic objective of this research is to determine what type of self-handicapping strategies subjects will use when they face potential failure, under the condition that they have the possibility of strategy choice. Another research objective is directed to the research of relation between the selected self-handicapping strategy and personality characteristics. 120 student of the second and third year of the Department of psychology, University of Novi Sad has been taken into sample. In the first research stage, all students administrated a series of personality self-report tests. In the second experiment stage, the participants were divided into four groups, on the basis of two criteria: the solvability of intelligence test tasks and the presence of hampering factors during task solving. The research results show that there are at least two types of self-handicapping strategies. One type is used by the majority of people when found in the situation where potential failure is expected. It refers to searching for alibis in external circumstances and it is probably the reflection of sound tendencies of facing possible consequences of information on one’s own incompetence. Another type of strategies presents consistent behaviour pattern, determined by the higher degree of adverse affectivity and negative image of oneself, and it is manifested in the use of poor psychophysical condition as the alibi for failure.

  6. Does CPAP treatment affect the voice?

    Science.gov (United States)

    Saylam, Güleser; Şahin, Mustafa; Demiral, Dilek; Bayır, Ömer; Yüceege, Melike Bağnu; Çadallı Tatar, Emel; Korkmaz, Mehmet Hakan

    2016-12-20

    The aim of this study was to investigate alterations in voice parameters among patients using continuous positive airway pressure (CPAP) for the treatment of obstructive sleep apnea syndrome. Patients with an indication for CPAP treatment without any voice problems and with normal laryngeal findings were included and voice parameters were evaluated before and 1 and 6 months after CPAP. Videolaryngostroboscopic findings, a self-rated scale (Voice Handicap Index-10, VHI-10), perceptual voice quality assessment (GRBAS: grade, roughness, breathiness, asthenia, strain), and acoustic parameters were compared. Data from 70 subjects (48 men and 22 women) with a mean age of 44.2 ± 6.0 years were evaluated. When compared with the pre-CPAP treatment period, there was a significant increase in the VHI-10 score after 1 month of treatment and in VHI- 10 and total GRBAS scores, jitter percent (P = 0.01), shimmer percent, noise-to-harmonic ratio, and voice turbulence index after 6 months of treatment. Vague negative effects on voice parameters after the first month of CPAP treatment became more evident after 6 months. We demonstrated nonsevere alterations in the voice quality of patients under CPAP treatment. Given that CPAP is a long-term treatment it is important to keep these alterations in mind.

  7. Does CPAP Affect Patient-Reported Voice Outcomes?

    Science.gov (United States)

    Hartke, Vance; Gillespie, Amanda; Smith, Libby J; Soose, Ryan J

    2018-04-01

    Upper aerodigestive tract symptoms are common in patients with obstructive sleep apnea (OSA). It remains unclear whether continuous positive airway pressure (CPAP) improves or worsens these otolaryngology symptoms. As therapy-related side effects limit CPAP adherence, this study aimed to determine if CPAP negatively affects voice, sinonasal, and reflux symptoms of the upper airway. Case series with planned data collection was performed at an academic otolaryngology sleep center. Newly diagnosed patients with OSA were evaluated before and 6 months after initiating CPAP therapy. Data collected included CPAP data download, Reflux Symptom Index (RSI), Epworth Sleepiness Scale (ESS), Voice Handicap Index 10 (VHI-10), Sino-Nasal Questionnaire (SNQ), and oral dryness visual analog scale (VAS). For the 11 CPAP-adherent participants, the RSI significantly improved with CPAP (mean RSI, 22.0-9.5; P = .002); however, the VAS, VHI-10, and SNQ did not change after 6 months of CPAP therapy. In a small sample size, patient-reported voice outcomes (VHI-10) and other upper aerodigestive tract symptoms did not worsen with CPAP; rather, CPAP therapy was associated with a reduction in reflux symptoms.

  8. The performance-perceptual test and its relationship to unaided reported handicap.

    Science.gov (United States)

    Saunders, Gabrielle H; Forsline, Anna; Fausti, Stephen A

    2004-04-01

    Measurement of hearing aid outcomes is necessary for demonstration of treatment efficacy, third-party payment, and cost-benefit analysis. Outcomes are usually measured with hearing-related questionnaires and/or tests of speech recognition. However, results from these two types of test often conflict. In this paper, we provide data from a new test measure, known as the Performance-Perceptual Test (PPT), in which subjective and performance aspects of hearing in noise are measured using the same test materials and procedures. A Performance Speech Reception Threshold (SRTN) and a Perceptual SRTN are measured using the Hearing In Noise Test materials and adaptive procedure. A third variable, the discrepancy between these two SRTNs, is also computed. It measures the accuracy with which subjects assess their own hearing ability and is referred to as the Performance-Perceptual Discrepancy (PPDIS). One hundred seven subjects between 24 and 83 yr of age took part. Thirty-three subjects had normal hearing, while the remaining seventy-four had symmetrical sensorineural hearing loss. Of the subjects with impaired hearing, 24 wore hearing aids and 50 did not. All subjects underwent routine audiological examination and completed the PPT and the Hearing Handicap Inventory for the Elderly/Adults on two occasions, between 1 and 2 wk apart. The PPT was conducted for unaided listening with the masker level set to 50, 65, and 80 dB SPL. PPT data show that the subjects with normal hearing have significantly better Performance and Perceptual SRTNs at each test level than the subjects with impaired hearing but that PPDIS values do not differ between the groups. Test-retest reliability for the PPT is excellent (r-values > 0.93 for all conditions). Stepwise multiple regression analysis showed that the Performance SRTN, the PPDIS, and age explain 40% of the variance in reported handicap (Hearing Handicap Inventory for the Elderly/Adults scores). More specifically, poorer performance

  9. Utility approach to decision-making in extended T1 and limited T2 glottic carcinoma.

    Science.gov (United States)

    van Loon, Yda; Stiggelbout, Anne M; Hakkesteegt, Marieke M; Langeveld, Ton P M; de Jong, Rob J Baatenburg; Sjögren, Elisabeth V

    2017-04-01

    It is still undecided if endoscopic laser surgery or radiotherapy is the preferable treatment in extended T1 and limited T2 glottic tumors. Health utilities assessed from patients can aid in decision-making. Patients treated for extended T1 or limited T2 glottic carcinoma by laser surgery (n = 12) or radiotherapy (n = 14) assigned health utilities using a visual analog scale (VAS), time tradeoff (TTO) technique and scored their voice handicap using the Voice Handicap Index (VHI). VAS and TTO scores were slightly lower for the laser group compared to the radiotherapy group, however, not significantly so. The VHI showed a correlation with the VAS score, which was very low in both groups and can be considered (near) normal. Patients show no clear preference for the outcomes of laser surgery or radiotherapy from a quality of life (QOL) or voice handicap point of view. These data can now be incorporated into decision-making models. © 2017 Wiley Periodicals, Inc. Head Neck, 2017 © 2016 Wiley Periodicals, Inc. Head Neck 39: 779-785, 2017. © 2017 Wiley Periodicals, Inc.

  10. EJSCREEN Indexes 2015 Public

    Data.gov (United States)

    U.S. Environmental Protection Agency — There is an EJ Index for each environmental indicator. There are eight EJ Indexes in EJSCREEN reflecting the 8 environmental indicators. The EJ Index names are:...

  11. EJSCREEN Indexes 2016 Public

    Data.gov (United States)

    U.S. Environmental Protection Agency — There is an EJ Index for each environmental indicator. There are eleven EJ Indexes in EJSCREEN reflecting the 11 environmental indicators. The EJ Index names are:...

  12. Comparison of Irrational Believes between Mothers of Severe or Profound Mentally Handicapped Children with Healthy Children Mothers

    Directory of Open Access Journals (Sweden)

    Behrouz Hivadi

    2007-10-01

    Full Text Available Objective: The purpose of present research was the comparison of mothers irrational believes with severe or profound mentally handicapped child and mothers with normal child from 6 to14 years old in Tehran city. Materials & Methods: This study was an analytical, cross – sectional and comparative (case – control research. From mothers with severe or profound mentally handicapped child who had refered to Tehran welfare services centers, 80 mothers were selected by regular randomized sampling from two rehabilitation centers and 80 mothers with normal child were selected for peering with the group of testimonial from schools areas of east, west, south, north and center of Tehran, through multi - stage cluster sampling in for variables of: age of mothers, educational levels, the location of living and the number of children. They answered to questionnaire of irrational believes of jons (IBT. Analysis of data was done by descriptive and infringing statistics methods (Independent T test, U Mann Whitney, Chi-square and fisher. Results: The findings showed that: there are significantly differences in total irrational believes and irrational believes of blame proneness, frustration reactive, anxious over concern, problem avoiding and dependency, perfectionism between two groups of mothers (P<0/05. There was no significant difference in irrational believes between mothers who had mental handicap daughter and mothers who had mental handicap son (P=0/314. There was no significantly difference between two groups of mothers in four believes of demand for approval (P=0/737, high-self expectation (P=0/126, emotional irresponsibility (P=0/727, helplessness for change (p=0/283. Conclusion: Irrational believes and many its sub scales. In mothers of severe or profound mental handicap children were more than mothers with normal child. But believes of demand for approval, high self expectation, emotional irresponsibility, helplessness for change in mothers with

  13. CT of the infants and children with mental and/or physical handicaps

    International Nuclear Information System (INIS)

    Okada, Junichiro; Takeuchi, Kazuo

    1980-01-01

    Computed tomography (CT) was performed on 47 children and adolescents with mental and/or physical handicaps. Of these series, 22 cases of morphological change were noted. Another 25 cases showed no overt CT abnormality. These 47 cases were divided into three groups in the following manner. Group 1, with no CT abnormality; Group 2, with ventricular dilatation and/or cerebral atrophy, and Group 3, with a major morphological anomaly of the brain. Group 1 (25 cases) showed a marked dissociation between the CT findings and the IQ. EEG showed normal findings in two cases, diffuse abnormality in 5 cases, and focal abnormality in 9 cases. This group alone included 8 cases of athetosis. Group 2 (14 cases). Seven cases of EEG showed diffuse abnormality in 3 cases and focal abnormality in 4 cases. So-called cerebral palsy was noted in 11 cases. Group 3 (8 cases). This group included cases of hemihydranencephaly, porencephaly, agenesis of the corpus callosum, and arachnoid cyst. The mean and standard deviations of the IQ's in the groups are 57.1 +- 21.6, 65.2 +- 20.5, and 72.0 +- 8.0. That is, an inverted correlation between the CT abnormality and the IQ was noted. CT is a noninvasive study and a reasonable method of investigation for mentally handicapped children. DeMyer gave three categories of cerebral malformation: cytogenetic malformations, organogenetic disorders, and histogenetic disorders. On the other hand, EEG aimed at evaluating cerebral function and CT undertaken for morphological evaluation reveal no intimate correlation with one another. Rather, these two procedures each have their one value for the evaluation of the function and the structure of the brain. Mentally and/or physically handicapped patients without any overt cerebral anomaly have been found to be as follows: Murobushi, 12.29%; Malamud, 34%; Gross, 15.8%; Benda, 15%, and Hamada, 45.4%. (author)

  14. Investigating the Effects of Glottal Stop Productions on Voice in Children With Cleft Palate Using Multidimensional Voice Assessment Methods.

    Science.gov (United States)

    Aydınlı, Fatma Esen; Özcebe, Esra; Kulak Kayıkçı, Maviş E; Yılmaz, Taner; Özgür, Fatma F

    2016-11-01

    The aim was to investigate the effects of glottal stop productions (GS) on voice in children with cleft palate using multidimensional voice assessment methods. This is a prospective case-control study. Children with repaired cleft palate (n = 34) who did not have any vocal fold lesions were separated into two groups based on the results of the articulation test. The glottal stop group (GSG) consisted of 17 children who had GS. The control group (CG) consisted of an equal number of age- and gender-matched children who did not have GS. The voice evaluation protocol included acoustic analysis, Pediatric Voice Handicap Index (pVHI), and perceptual analysis (Grade, Roughness, Breathiness, Asthenia, Strain method). The velopharyngeal statuses of the groups were compared using the nasopharyngoscopy and the nasometer. The total pVHI score and the subscales of the pVHI were found to be significantly higher in the GSG. The F0, jitter, and shimmer were found to be numerically higher in the GSG with the difference being statistically significant in jitter (P speech and language pathology intervention including voice therapy techniques. Copyright © 2016 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  15. Voice-related of quality of life after treatment for laryngeal cancer

    International Nuclear Information System (INIS)

    Oridate, Nobuhiko; Furuta, Yasushi; Homma, Akihiro; Suzuki, Seigo; Suzuki, Fumiyuki; Hatakeyama, Hiromitsu; Taki, Shigenari; Sakashita, Tomohiro; Fukuda, Satoshi

    2007-01-01

    There are many methods of treating laryngeal cancers: definitive irradiation with or without concurrent chemotherapy, endoscopic laser surgery, partial surgery techniques, and total laryngectomy. Few studies have been reported on vocal function and quality of life of patients after the definitive treatment for laryngeal cancer, using single voice related QOL measures. The aim of this study was to examine voice related QOL in patients treated with various modalities using a Voice-Related Quality of Life (V-RQOL) questionnaire as well as Voice Handicap Index-10 (VHI-10) questionnaire. Between August 2006 and May 2007, survey data on voice utilizing the V-RQOL and VHI-10 were obtained from a total of 130 patients who had received definitive treatment for laryngeal cancers with follow-up at the Hokkaido University Hospital, and who were alive with no evidence of malignancy at the time of survey. Mean V-RQOL scores of the patients who received radiation therapy (n=63), chemoradiotherapy (n=29), laser resection (n=14) and total laryngectomy (n=27) as the final treatment for laryngeal cancer were 92.6, 92.9, 85.5, and 68.4, respectively. Mean VHI-10 values were 2.87, 2.34, 5.43, and 11.26. Such measures of quality of life are important endpoints to help judge the overall effectiveness of treatment options for laryngeal cancers. (author)

  16. Psychological effects of dysphonia in voice professionals.

    Science.gov (United States)

    Salturk, Ziya; Kumral, Tolgar Lutfi; Aydoğdu, Imran; Arslanoğlu, Ahmet; Berkiten, Güler; Yildirim, Güven; Uyar, Yavuz

    2015-08-01

    To evaluate the psychological effects of dysphonia in voice professionals compared to non-voice professionals and in both genders. Cross-sectional analysis. Forty-eight 48 voice professionals and 52 non-voice professionals with dysphonia were included in this study. All participants underwent a complete ear, nose, and throat examination and an evaluation for pathologies that might affect vocal quality. Participants were asked to complete the Turkish versions of the Voice Handicap Index-30 (VHI-30), Perceived Stress Scale (PSS), and the Hospital Anxiety and Depression Scale (HADS). HADS scores were evaluated as HADS-A (anxiety) and HADS-D (depression). Dysphonia status was evaluated by grade, roughness, breathiness, asthenia, and strain (GRBAS) scale perceptually. The results were compared statistically. Significant differences between the two groups were evident when the VHI-30 and PSS data were compared (P = .00001 and P = .00001, respectively). However, neither HADS score (HADS-A and HADS-D) differed between groups. An analysis of the scores in terms of sex revealed that females had significantly higher PSS scores (P = .006). The GRBAS scale revealed no difference between groups (P = .819, .931, .803, .655, and .803, respectively). No between-sex differences in the VHI-30 or HADS scores were evident We found that voice professionals and females experienced more stress and were more dissatisfied with their voices. 4. © 2015 The American Laryngological, Rhinological and Otological Society, Inc.

  17. The Effectiveness of the Comprehensive Voice Rehabilitation Program Compared With the Vocal Function Exercises Method in Behavioral Dysphonia: A Randomized Clinical Trial.

    Science.gov (United States)

    Pedrosa, Vanessa; Pontes, Antônio; Pontes, Paulo; Behlau, Mara; Peccin, Stella Maria

    2016-05-01

    To evaluate the effectiveness of the Comprehensive Voice Rehabilitation Program (CVRP) compared with Vocal Function Exercises (VFEs) to treat functional dysphonia. This is a randomized blinded clinical trial. Eighty voice professionals presented with voice complaints for more than 6 months with a functional dysphonia diagnosis. Subjects were randomized into two voice treatment groups: CVRP and VFE. The rehabilitation program consisted of six voice treatment sessions and three assessment sessions performed before, immediately after, and 1 month after treatment. The outcome measures were self-assessment protocols (Voice-Related Quality of Life [V-RQOL] and Voice Handicap Index [VHI]), perceptual evaluation of vocal quality, and a visual examination of the larynx, both blinded. The randomization process produced comparable groups in terms of age, gender, signs, and symptoms. Both groups had positive outcome measures. The CVRP effect size was 1.09 for the V-RQOL, 1.17 for the VHI, 0.79 for vocal perceptual evaluation, and 1.01 for larynx visual examination. The VFE effect size was 0.86 for the V-RQOL, 0.62 for the VHI, 0.48 for the vocal perceptual evaluation, and 0.51 for larynx visual examination. Only 10% of the patients were lost over the study. Both treatment programs were effective. The probability of a patient improving because of the CVRP treatment was similar to that of the VFE treatment. Copyright © 2016 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  18. The Role of Occupational Voice Demand and Patient-Rated Impairment in Predicting Voice Therapy Adherence.

    Science.gov (United States)

    Ebersole, Barbara; Soni, Resha S; Moran, Kathleen; Lango, Miriam; Devarajan, Karthik; Jamal, Nausheen

    2018-05-01

    Examine the relationship among the severity of patient-perceived voice impairment, perceptual dysphonia severity, occupational voice demand, and voice therapy adherence. Identify clinical predictors of increased risk for therapy nonadherence. A retrospective cohort study of patients presenting with a chief complaint of persistent dysphonia at an interdisciplinary voice center was done. The Voice Handicap Index-10 (VHI-10) and the Voice-Related Quality of Life (V-RQOL) survey scores, clinician rating of dysphonia severity using the Grade score from the Grade, Roughness Breathiness, Asthenia, and Strain scale, occupational voice demand, and patient demographics were tested for associations with therapy adherence, defined as completion of the treatment plan. Classification and Regression Tree (CART) analysis was performed to establish thresholds for nonadherence risk. Of 166 patients evaluated, 111 were recommended for voice therapy. The therapy nonadherence rate was 56%. Occupational voice demand category, VHI-10, and V-RQOL scores were the only factors significantly correlated with therapy adherence (P demand are significantly more likely to be nonadherent with therapy than those with high occupational voice demand (P 40 is a significant cutoff point for predicting therapy nonadherence (P demand and patient perception of impairment are significantly and independently correlated with therapy adherence. A VHI-10 score of ≤9 or a V-RQOL score of >40 is a significant cutoff point for predicting nonadherence risk. Copyright © 2018 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  19. Vocal Function Exercises for Muscle Tension Dysphonia: Auditory-Perceptual Evaluation and Self-Assessment Rating.

    Science.gov (United States)

    Jafari, Narges; Salehi, Abolfazl; Izadi, Farzad; Talebian Moghadam, Saeed; Ebadi, Abbas; Dabirmoghadam, Payman; Faham, Maryam; Shahbazi, Mehdi

    2017-07-01

    Muscle tension dysphonia (MTD) is a functional dysphonia, which appears with an excessive tension in the intrinsic and extrinsic laryngeal musculatures. MTD can affect voice quality and quality of life. The purpose of the present study was to assess the effectiveness of vocal function exercises (VFEs) on perceptual and self-assessment ratings in a group of 15 subjects with MTD. The study comprised 15 subjects with MTD (8 men and 7 women, mean age 39.8 years, standard deviation 10.6, age range 24-62 years). All participants were native Persian speakers who underwent a 6-week course of VFEs. The Voice Handicap Index (VHI) (the self-assessment scale) and Grade, Roughness, Breathiness, Asthenia, Strain (GRBAS) scale (perceptual rating of voice quality) were used to compare pre- and post-VFEs. GRBAS data of patients before and after VFEs were compared using Wilcoxon signed-rank test, and VHI data of patients pre- and post-VFEs were compared using Student paired t test. These perceptual parameters showed a statistically significant improvement in subjects with MTD after voice therapy (significant at P self-assessment ratings measurements (with the VHI). As a result, the data provide evidence regarding the efficacy of VFEs in the treatment of patients with MTD. Copyright © 2017 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  20. Using Trial Vocal Fold Injection to Select Vocal Fold Scar Patients Who May Benefit From More Durable Augmentation.

    Science.gov (United States)

    Carroll, Thomas L; Dezube, Aaron; Bauman, Laura A; Mallur, Pavan S

    2018-02-01

    Clinical indications for vocal fold injection augmentation (VFI) are expanding. Prior studies demonstrate the benefit of trial VFI for select causes of glottic insufficiency. No studies have examined trial VFI for glottic insufficiency resulting from true vocal fold (TVF) scar. Retrospective chart review of patients who underwent trial VFI for a dominant pathology of TVF scar causing dysphonia. Patients who subsequently underwent durable augmentation were identified. The primary study outcome was the difference in Voice Handicap Index-10 (VHI-10) score from pretrial VFI to post-durable augmentation. Twenty-eight patients underwent trial VFI for TVF scar, 22 of whom reported a positive response. Fifteen of 22 subjects who underwent durable augmentation had viable data for analysis. Mean VHI-10 improved from 26.9 to 18.6 ( P 5). A trial VFI is a potentially useful, low-risk procedure that appears to help the patient and clinician identify when global augmentation might improve the voice when vocal fold scar is present. Patients who reported successful trial VFI often demonstrated significant improvement in their VHI-10 after subsequent durable augmentation.

  1. Impact of Perioperative Voice Therapy on Outcomes in the Surgical Management of Vocal Fold Cysts.

    Science.gov (United States)

    Tibbetts, Kathleen M; Dominguez, Laura M; Simpson, C Blake

    2018-05-01

    Vocal fold cysts are benign mid-membranous lesions of the true vocal fold, classified as mucus retention or epidermal inclusion cysts. Treatment is surgical excision with or without postoperative voice therapy. A retrospective review was performed of the demographics, treatment approach, and outcomes of patients treated for vocal fold cysts between 2009 and 2014. Voice Handicap Index (VHI)-10 scores before and after treatment were compared using the Wilcoxon Rank-Sum test and the two-tailed Student's t test. Videostroboscopy examinations were reviewed for posttreatment changes in vibratory characteristics of the vocal folds. Twenty-five patients were identified, and one was excluded for incomplete records. Mean age was 41.9 years (66.7% female), and mean follow-up time was 5.58 months. Microflap excision was pursued by 21/24 (87.5%) patients, with 14 patients (58.3%) undergoing perioperative voice therapy. One cyst recurred. Two patients elected for observation, and their cysts persisted. VHI-10 decreased from 23.8 to 6.6 (P Vocal fold cysts impact mucosal wave and glottic closure. Surgical excision resulted in low rates of recurrence, and in improvement in the mucosal wave and VHI-10. Perioperative voice therapy did not offer a significant benefit. Mucus retention cysts were the majority, in contrast to other published studies. Copyright © 2018 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  2. Temporalis Fascia Transplantation for Sulcus Vocalis and Vocal Fold Scar: Long-Term Outcomes.

    Science.gov (United States)

    Karle, William E; Helman, Samuel N; Cooper, Amy; Zhang, Yuan; Pitman, Michael J

    2018-04-01

    Sulcus vocalis and vocal fold scar involve derangement of the superficial lamina propria of the vocal fold, which results in significant dysphonia. Many options exist for treatment, most of which have unsatisfactory and unpredictable outcomes. Autologous transplantation of temporalis fascia into the vocal fold (ATFV) has the potential to be a better treatment option, but long-term outcomes have not been well studied. Retrospective chart review and patient survey. Twenty-one patients diagnosed with vocal fold scar or sulcus vocalis and treated with ATFV with at least 1-year follow-up were included. Voice Handicap Index 10 (VHI-10) questionnaires were collected preoperatively and 6 months postoperatively. Patients were reached at the time of the study to complete another VHI-10 and a Likert scale survey. The mean decrease in VHI-10 scores between preoperation and 6 months postoperation was 8.35 ( P vocal fold for the treatment of vocal fold scar and sulcus vocalis is a safe surgery with good long-term outcomes and high patient satisfaction.

  3. Spasmodic dysphonia follow-up with videolaryngoscopy and voice spectrography during treatment with botulinum toxin.

    Science.gov (United States)

    Esposito, Marcello; Dubbioso, R; Apisa, P; Allocca, R; Santoro, L; Cesari, U

    2015-09-01

    Spasmodic dysphonia (SD) is a focal dystonia of laryngeal muscles seriously impairing quality of voice. Adductor SD (ADSD) is the most common presentation of this disorder that can be identified by specialized phoniatricians and neurologists firstly on a clinical evaluation and then confirmed by videolaryngoscopy (VL). Botulinum toxin (BTX) injection with electromyographic guidance in muscles around vocal cords is the most effective treatment. Voice Handicap Index (VHI) questionnaire is the main tool to assess dysphonia and response to treatment. Objective of this study is to perform VL and voice spectrography (VS) to confirm the efficacy of BTX injections over time. 13 patients with ADSD were studied with VHI, VL and VS before and after 4 consecutive treatment with onobotulinumtoxin-A. For each treatment vocal improvement was proved by a significant reduction of VHI score and increase of maximum time phonation and harmonic-to-noise ratio while VL showed the absence of spasm in most of patients. No change of the response to BTX was found between injections. This study supports the efficacy of the treatment of SD with BTX with objective measurements and suggests that the efficacy of recurring treatments is stable over time.

  4. Special sliding door with storable handrail to support senior and handicapped persons to walk by themselves

    Science.gov (United States)

    Saitou, K.; Noda, N.-A.; Sano, Y.; Takase, Y.; Murai, K.; Wang, Z. F.; Li, S. Q.; Liu, X.; Tanaka, H.; Kubo, Y.

    2018-06-01

    In this paper, special sliding door is designed in order to support senior and handicapped persons to walk by themselves in hospitals and nursing facilities. This semiautomatic lifting equipment is utilized for the storable handrail to make sure the bad health persons are able to open the door by using a weak force. In this study, to design the equipment of the handrail, the theoretical formula of opening force is derived. Then the simulation is performed by varying geometrical conditions. The simulation results are compared with the experiment results.

  5. Methodology for the identification, evaluation and prioritization of market handicaps which prevent the implementation of Demand Response: Application to European electricity markets

    International Nuclear Information System (INIS)

    Alcázar-Ortega, Manuel; Calpe, Carmen; Theisen, Thomas; Carbonell-Carretero, José Francisco

    2015-01-01

    This paper presents a methodology for the identification, analysis and comparative assessment of the handicaps which nowadays prevent the higher implementation of Demand Response (DR) in the electricity market. Its application provides a hierarchical organization of handicaps from the most critical to the less critical and then, from the easiest to the most difficult to overcome. This makes possible to determine which barriers would be a priority, which may indicate the direction of regulatory changes to properly address these handicaps and so, stimulating a higher participation of the demand side in electricity markets. After applying the methodology to three European countries, 34 handicaps have been identified, analyzing which of these handicaps affect such stakeholders as grid operators, retailers and customers and how these stakeholders are affected. For each handicap, the criticality and difficulty to overcome the different handicaps have been studied, based on detailed information coming from personal interviews to experts representing the different stakeholders in the electricity trading chain. Regulatory barriers have been identified as the most critical and difficult to overcome. Together with regulatory changes, the promotion of aggregators and the training of customers on DR applications are some of the most significant initiatives. - Highlights: • Market handicaps prevent the application of Demand Response in electricity markets. • A methodology to identify and organize such market handicaps has been developed. • The evaluation and quantification of criticality and difficulty to overcome is done. • A hierarchical list prioritizing handicaps to be addressed is obtained. • Market handicaps of three European countries were evaluated through this methodology.

  6. Mixité sociale : les handicapés dans la société britannique 

    Directory of Open Access Journals (Sweden)

    Marie-Hélène Adveille

    2007-11-01

    Full Text Available Depuis la seconde moitié du XXe siècle le regard porté sur la place des handicapés dans la société, a changé de manière significative. Les personnes en situation de handicap qui n’étaient souvent vues auparavant que comme les bénéficiaires d’une aide charitable, ont acquis, grâce à l’action de nombreuses organisations, le droit d’être reconnues comme des individus devant jouir des mêmes droits que les personnes ordinaires. Cependant, bien que des changements aient été opérés dans la perception que les valides ont des handicapés, il n’en demeure pas moins que les personnes en situation de handicap sont toujours confrontées à de nombreux problèmes dans leur vie de tous les jours. La société a fait des progrès pour ce qui est des aides qu’elle apporte aux handicapés moteurs, en instituant par exemple qu’ils puissent avoir accès aux bâtiments publics ainsi qu’aux moyens de transport urbain, ferroviaire, aérien. Les difficultés des handicapés sensoriels (vue, ouie sont prises en compte, avec la mise en place, par exemple, des signaux sonores dans la cité, en favorisant la présence de chiens d’aveugle. Cependant l’accès aux droits fondamentaux de ceux qui présentent des handicaps mentaux (intellectuels et/ou psychiques est encore peu développé. C’est donc sur la politique d’intégration et d’inclusion dans la vie ordinaire des personnes présentant des handicaps intellectuels que portera principalement cette étude. Nous aborderons en premier lieu la législation mise en œuvre pour favoriser leur insertion dans la société britannique, puis nous étudierons la façon dont les enfants sont intégrés dans le système scolaire. Enfin, les arguments qui soulignent l’intérêt que peut revêtir une intégration réussie pour l’adulte et pour la société seront examinés.The way in which the disabled were viewed underwent significant changes in the second half of the 20th century

  7. Improving Learning Tasks for Mentally Handicapped People Using AmI Environments Based on Cyber-Physical Systems

    Directory of Open Access Journals (Sweden)

    Diego Martín

    2018-01-01

    Full Text Available A prototype to improve learning tasks for mentally handicapped people is shown in this research paper using ambient intelligence techniques and based on cyber-physical systems. The whole system is composed of a worktable, a cyber-glove (both with several RFID and NFC detection zones, and an AmI software application for modeling and workflow guidance. A case study was carried out by the authors where sixteen mentally handicapped people and 3 trainers were involved in the experiment. The experiment consisted in the execution of several memorization tasks of movements of objects using the approach presented in this paper. The results obtained were very interesting, indicating that this kind of solutions are feasible and allow the learning of complex tasks to some types of mentally handicapped people. In addition, at the end of the paper are presented some lessons learned after performing the experimentation.

  8. Dicty_cDB: VHI137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available alignments: (bits) Value AY698035_1( AY698035 |pid:none) Desmognathus marmoratus isolate 69... 40 0.067 AY6...12344_1( AY612344 |pid:none) Desmognathus marmoratus voucher KH... 40 0.088 DQ018662_1( DQ018662 |pid:none) ...Plethodon dunni isolate 75356 NADH... 37 0.57 AY612348_1( AY612348 |pid:none) Desmog...nathus quadramaculatus vouch... 36 1.3 AY698038_1( AY698038 |pid:none) Desmognathus marmoratus isolate T0...... 36 1.3 AY698041_1( AY698041 |pid:none) Desmognathus marmoratus isolate T0... 36 1.3 CP000270_2676( CP000

  9. Dicty_cDB: VHI760 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 7( AC116551 |pid:none) Dictyostelium discoideum chromoso... 79 3e-13 AJ575138_1( AJ575138 |pid:none) Sorda...ria macrospora app gene for a... 50 1e-04 BX571864_113( BX571864 |pid:none) Photorh

  10. Dicty_cDB: VHI340 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mammvlpsqerfyfkmnfpllclltetgrldresylsmwksipesnersveiqvrlph vdvdsilrrlnsknifeivrkkapxx Translated Amino Acid ...vgqstdvtipiscngqisnplnpv idmammvlpsqerfyfkmnfpllclltetgrldresylsmwksipesnersveiqvrlph vdvdsilrrlnsknife

  11. Dicty_cDB: VHI203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s producing significant alignments: (bits) Value AF325215_2( AF325215 |pid:none) Lymphocytic choriomeningitis...5090 |pid:none) Schistosoma japonicum SJCHGC03255 ... 36 2.8 EU480452_2( EU480452 |pid:none) Lymphocytic choriomeningitis...325214_2( AF325214 |pid:none) Lymphocytic choriomeningitis virus... 35 8.2 BX2941

  12. Dicty_cDB: VHI165 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *nlifqel*lqiei*lnglqlnyicivildqnhqeih gvvhy*qfsqsfhqielfyhhqkvnlhvlsmqyy*lmkhqsml...EQQTQQ*lskkykq*kn*kn*nkiflnk ir Translated Amino Acid sequence (All Frames) Frame A: ---ivsqmlqk*lkimvqislvy

  13. Dicty_cDB: VHI867 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available scular mycorrhiza of cultivar Jemalong of Medicago truncatula (barrel medic). 46 0....uence. 44 0.006 2 AL387523 |AL387523.1 Medicago truncatula EST MtBC43B08F1 : T3 end of clone MtBC43B08 of cDNA library MtBC from arbu

  14. Dicty_cDB: VHI131 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AJ271965_3( AJ271965 |pid:none) Transmissible gastroenteritis viru... 35 4.4 AY452031_1( AY452031 |pid:none) Feline infectious perito...nitis viru... 35 4.4 protein update 2009. 7.13 PSORT psg: 1.00 gvh: 0.65 alm: 0.51

  15. Dicty_cDB: VHI692 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Pongo abelii mRNA; cDNA DKFZp469L1... 53 4e-06 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid... oxidas... 53 4e-06 BC027622_1( BC027622 |pid:none) Homo sapiens pipecolic acid o... AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 53 4e-06 AX882278_1( AX882278 |pid:none) Sequence

  16. Dicty_cDB: VHI393 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available none) Homo sapiens full open reading fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13 protein

  17. Dicty_cDB: VHI816 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available omal sarcosine oxidase; S... 75 3e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... ...pid:none) Homo sapiens full open reading fra... 75 5e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli

  18. Dicty_cDB: VHI596 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 295 |pid:none) Pongo abelii mRNA; cDNA DKFZp469L1... 62 9e-09 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli...one) Synthetic construct Homo sapiens c... 61 2e-08 BC027622_1( BC027622 |pid:none) Homo sapiens pipecolic a

  19. Dicty_cDB: VHI876 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 002.10.25 Translated Amino Acid sequence vsrtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevgir*gvcnnspakwtspeng *r*qwm...me A: vsrtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevgir*gvcnnspakwtspeng *r*qwmvdaqslke

  20. Dicty_cDB: VHI308 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ih**ipqkvlvh*dsrtvamevgir*gvcnnspa kwtspeng*r*qwmvdaqslkeviilltcrka*r*rrslnvnssgvvfsadldggskysk eftlkaevgkgs...dktsnih**ipqkvlvh*dsrtvamevgir*gvcnnspa kwtspeng*r*qwmvdaqslkeviilltcrka*r*rrslnvnssgvvfsadldggskysk eftlkae

  1. Dicty_cDB: VHI275 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TTTAATCCTATTTGGTGTTCGTACCAATAACCAXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence *gvcnns...GP*kpdygi*sylvfvpit--- Translated Amino Acid sequence (All Frames) Frame A: *gvcnnspakwtspeng*r*qwmvdaqslkev

  2. Dicty_cDB: VHI834 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available wdktsnih**ipqkvlvh*dsrtvamevgir*gvcnns pakwtspeng*r*qwmvdaqslkeviilltcrka*r*rrsln...sgpflvsrtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevgir*gvcnns pakwtspeng*r*qwmvdaqslkeviilltcrka*r*rrslnvnssgvvfsa

  3. International Religion Indexes: Government Regulation, Government Favoritism, and Social Regulation of Religion*

    Science.gov (United States)

    Grim, Brian J.; Finke, Roger

    2014-01-01

    The study of religion is severely handicapped by a lack of adequate cross-national data. Despite the prominence of religion in international events and recent theoretical models pointing to the consequences of regulating religion, cross-national research on religion has been lacking. We strive to fill this void by developing measurement models and indexes for government regulation, government favoritism, and social regulation of religion. The indexes rely on data from an extensive coding of the 2003 International Religious Freedom Report for 196 countries and territories. Using a series of tests to evaluate the new data and indexes, we find that the measures developed are highly reliable and valid. The three indexes will allow researchers and others to measure the government’s subsidy and regulation of religion as well as the restrictions placed on religion by social and cultural forces beyond the state. PMID:25484633

  4. How indexes have changed

    International Nuclear Information System (INIS)

    Farrar, G.L.

    1993-01-01

    The accompanying table compares refinery construction and operating wages monthly for the years 1990 and 1991. The Nelson-Farrar refinery construction cost indexes are inflation indexes, while the operating indexes incorporate a productivity which shows improvement with experience and the increasing size of operations. The refinery construction wage indexes in the table show a steady advance over the 2-year period. Common labor indexes moved up faster than skilled indexes. Refinery operating wages showed a steady increase, while productivities averaged higher near the end of the period. Net result is that labor costs remained steady for the period

  5. [Sport as integration factor of the physically handicapped in our society].

    Science.gov (United States)

    Labronici, R H; Cunha, M C; Oliveira, A D; Gabbai, A A

    2000-12-01

    The objective of this study was to make use of sports as a rehabilitation method, as well as to assess the physical, psychological, and social aspects of those present some physical handicap, particularly those who have some kind of chronic disease and are no longer taking part in any rehabilitation program. Thirty handicapped people were evaluated: fifteen started with basketball and fifteen with swimming, according either to the specific preference of each one of them or to the degree and kind of physical impairment. They were submmited to the following evaluations: clinical examination, physiotherapy assessment, social interview and use of the Rivermead Social Scale, functional classification of the sport, use of the Barthel and Rivermead Functional Scales, and the psychological profile test (POMS). After two years, no relevant change in the moving evolution of the athletes were reported. Concerning the POMS psychological test, both basketball and swimming groups presented with high vigor and low depression levels. Considering the social aspects, both groups presented substantial improvement, specially regarding their relationship to one person or more people and also in the everyday activities (be it social, leisure, or domestic), thus leading them to better social integration. This essay shows that sport can bring people who are physically impaired a better social integration and physical conditions.

  6. On the self-serving function of social anxiety: shyness as a self-handicapping strategy.

    Science.gov (United States)

    Snyder, C R; Smith, T W; Augelli, R W; Ingram, R E

    1985-04-01

    We tested the hypothesis that socially anxious or shy individuals use their anxiety symptoms as a strategy to control attributions made about their performances in social-evaluative settings (i.e., self-handicapping strategies). Specifically, we predicted that trait-socially anxious or shy persons would report more symptoms of social anxiety in an evaluative setting in which anxiety or shyness could serve as an excuse for poor performance than would individuals in (a) an evaluative setting in which shyness was precluded as an excuse or (b) a nonevaluative setting. Furthermore, we predicted that this self-protective pattern of symptom reporting would not occur for individuals who were not trait-socially anxious because these persons would not commonly use such symptoms as a self-handicapping strategy. Results supported these predictions for male subjects, but not for female subjects. Sex differences in the strategic use of shyness are discussed in relation to other research on sex differences in the etiology and correlates of social anxiety.

  7. Mobility of people and goods in the urban environment: mobility of the handicapped and elderly. Second year final report. [Methodology

    Energy Technology Data Exchange (ETDEWEB)

    Falcocchio, J.; Santimataneedol, S.; Horwitz, L.; Stephanis, B.

    1976-09-01

    An evaluation methodology for the analysis of alternative transportation improvements for the handicapped and elderly is proposed. The approach is based on the ability to incorporate the qualitative attributes of transportation systems which are particularly significant to the handicapped and elderly groups. These attributes include comfort and convenience, security and safety, and accessibility. In addition, this study addresses the issues of demonstration projects planning and offers guidelines for the design of demonstration experiments which can produce results that are capable of objective analytical interpretation.

  8. Adler's psychology (of use) today: personal history of traumatic life events as a self-handicapping strategy.

    Science.gov (United States)

    DeGree, C E; Snyder, C R

    1985-06-01

    We investigated the hypothesis that the reporting of a history of traumatic life events may serve as a strategy to control attributions about performance in an evaluative setting (i.e., self-handicapping). Following from Alfred Adler's early theorization in the psychology of use, as well as more recent theory and research on self-handicapping, we predicted that individuals would emphasize the adversity of events and experiences in their background when an uncertain evaluation was expected and when a traumatic background would serve as a suitable excuse for potential failure. Results generally supported the hypothesized self-protective reporting of traumatic life events.

  9. Late onset polio sequelae : Disabilities and handicaps in a population-based cohort of the 1956 poliomyelitis outbreak in The Netherlands

    NARCIS (Netherlands)

    Ivanyi, Barbara; Nollet, E; Redekop, WK; De Haan, R; Wohlgemuht, M; van Wijngaarden, JK; de Visser, Marianne

    Objective: To investigate the prevalence of new neuromuscular symptoms, disabilities, and handicaps in a group of polio survivors. Design: A self-constructed health questionnaire about neuromuscular complaints and disability and handicap levels during the stable period after recovery from polio and

  10. Late onset polio sequelae: disabilities and handicaps in a population-based cohort of the 1956 poliomyelitis outbreak in The Netherlands

    NARCIS (Netherlands)

    Ivanyi, B.; Nollet, F.; Redekop, W. K.; de Haan, R.; Wohlgemuht, M.; van Wijngaarden, J. K.; de Visser, M.

    1999-01-01

    OBJECTIVE: To investigate the prevalence of new neuromuscular symptoms, disabilities, and handicaps in a group of polio survivors. DESIGN: A self-constructed health questionnaire about neuromuscular complaints and disability and handicap levels during the stable period after recovery from polio and

  11. Reaching Rural Handicapped Children: The Transportation Situation in Rural Service Delivery. Making It Work in Rural Communities. A Rural Network Monograph.

    Science.gov (United States)

    Tucker, Jamie; And Others

    Almost everyone who responded to three transportation surveys of rural Handicapped Children's Early Education Program (HCEEP) projects identified transportation as a critical problem in the delivery of services to handicapped children in rural areas. Transportation problems encountered were attributed to environmental/geographic factors,…

  12. Nutritional Needs of the Child with a Handicap or Chronic Illness. Manual II: Clinical Nutrition. Presentations from a National Interdisciplinary Symposium.

    Science.gov (United States)

    Ekvall, Shirley M.; Wheby, Elizabeth A.

    The following papers were presented at a symposium on clinical nutrition for the child who is chronically ill or handicapped: (1) "Food Allergy"; (2) "Anemia and the Chronically Ill or Handicapped Child"; (3) "Nutrition and Neurotransmitters--Clinical Implications"; (4) "The Importance of Lipid Type in the Diet after Burn Injury"; (5) "Advances of…

  13. The History of Care for the Low-Incident Handicapped in the Territory of Guam: Is There a Necessary Development Change in the Delivery of Special Education Services?

    Science.gov (United States)

    Peckens, Gloria

    A brief history of care for handicapped individuals on Guam is traced from early refusal to acknowledge their existence, to their increased visibility and current efforts toward least restrictive placement for education and care. It is explained that societal attitudes toward the handicapped in Guam are characterized by pity, neglect and repulsion…

  14. Self-Handicapping Prior to Academic-Oriented Tasks in Children with Attention Deficit/Hyperactivity Disorder (ADHD): Medication Effects and Comparisons with Controls

    Science.gov (United States)

    Waschbusch, Daniel A.; Craig, Rebecca; Pelham, William E., Jr.; King, Sara

    2007-01-01

    The authors examined self-handicapping prior to academic-oriented tasks in children with and without ADHD and examined whether stimulant medication influenced self-handicapping. Participants were 61 children ages 6 to 13, including 22 children with ADHD tested after taking a placebo, 21 children with ADHD tested after taking stimulant medication,…

  15. Unanswered Questions on Educating Handicapped Children in Local Public Schools. Report to the Congress by the Comptroller General of the United States.

    Science.gov (United States)

    Comptroller General of the U.S., Washington, DC.

    The report by the General Accounting Office examines the status of education for handicapped children in 10 states. P.L. 94-142, the Education for All Handicapped Children Act, is reviewed briefly, and the states' compliance with the following aspects was assessed: eligibility criteria, individualized educational programs, and provision of a free…

  16. An Investigation into the Self-Handicapping Behaviors of Undergraduates in Terms of Academic Procrastination, the Locus of Control and Academic Success

    Science.gov (United States)

    Akça, Figen

    2012-01-01

    The aim of this study was to investigate the relationship between self-handicapping, academic procrastination, the locus of control and academic success. The aim was also to determine whether these variables predicted self-handicapping behavior. The population of the study consisted of 263 undergraduates studying in different departments of the…

  17. Western Alaska ESI: INDEX (Index Polygons)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains vector polygons representing the boundaries of all the hardcopy cartographic products produced as part of the Environmental Sensitivity Index...

  18. Master Veteran Index (MVI)

    Data.gov (United States)

    Department of Veterans Affairs — As of June 28, 2010, the Master Veteran Index (MVI) database based on the enhanced Master Patient Index (MPI) is the authoritative identity service within the VA,...

  19. Human Use Index (Future)

    Data.gov (United States)

    U.S. Environmental Protection Agency — Human land uses may have major impacts on ecosystems, affecting biodiversity, habitat, air and water quality. The human use index (also known as U-index) is the...

  20. Human Use Index

    Data.gov (United States)

    U.S. Environmental Protection Agency — Human land uses may have major impacts on ecosystems, affecting biodiversity, habitat, air and water quality. The human use index (also known as U-index) is the...

  1. IndexCat

    Data.gov (United States)

    U.S. Department of Health & Human Services — IndexCat provides access to the digitized version of the printed Index-Catalogue of the Library of the Surgeon General's Office; eTK for medieval Latin texts; and...

  2. Body Mass Index Table

    Science.gov (United States)

    ... Families ( We Can! ) Health Professional Resources Body Mass Index Table 1 for BMI greater than 35, go ... Health Information Email Alerts Jobs and Careers Site Index About NHLBI National Institute of Health Department of ...

  3. Superiority of resection over enucleation for schwannomas of the cervical vagus nerve: A retrospective cohort study of 22 consecutive patients.

    Science.gov (United States)

    Illuminati, Giulio; Pizzardi, Giulia; Minni, Antonio; Masci, Federica; Ciamberlano, Bernardo; Pasqua, Rocco; Calio, Francesco G; Vietri, Francesco

    2016-05-01

    Schwannoma of the cervical vagus nerve is rare. Treatment options include intracapsular enucleation and en bloc resection. The purpose of this study was to compare the outcomes of enucleation and resection in terms of postoperative mortality and morbidity, freedom from vocal cord palsy, freedom from local recurrence, quality-adjusted life-year (QALY) and vocal handicap index (VHI). Twentytwo consecutive patients were divided into two groups. Patients in group A (n = 9) underwent intracapsular enucleation, whereas patients in Group B (n = 13) underwent en bloc resection. Main endpoints of the study were postoperative mortality and morbidity, freedom from vocal cord palsy, freedom from local recurrence and quality of life. The quality of life after surgery was assessed according to the quality-adjusted life-year (QALY) EQ-5D-5L methodology, and calculation of the voice handicap index (VHI). Postoperative mortality was nil. Morbidity included 1 wound dehiscence in group A and 2 transitory dysphagias in group B. Freedom from vocal cord palsy was 22% in group A and zero in group B (p = 0.15). Operation-specific local recurrence rate was 33% (3/9 patients) in group A and nil in group B (0/23 patients) (p = 0.05). QALYs was 0.55 in group A and 0.54 in group B (p = 1.0). VHI was 23.77 in group A and 26.15 in group B (p = 1.00). Resection is superior to enucleation in terms of freedom from local recurrence. Functional results are comparable for both techniques. Copyright © 2016 IJS Publishing Group Ltd. Published by Elsevier Ltd. All rights reserved.

  4. Long-term consequences of vocal fold hemorrhage.

    Science.gov (United States)

    Kerwin, Lewis J; Estes, Christine; Oromendia, Clara; Christos, Paul; Sulica, Lucian

    2017-04-01

    To assess the long-term impact of vocal fold hemorrhage (VFH) on vocal function and health, and compare these parameters to those in similar patients who have not had VFH. Retrospective cohort study. Patients with a history of VFH (N = 41) were characterized through a review of records and assessed by means of a survey for vocal health and professional functioning as well as the Voice Handicap Index-10 (VHI-10) and, if appropriate (n = 30, 73.2%), the Singing Voice Handicap Index (SVHI-10). They were compared to a group of demographically and occupationally similar patients without VFH (N = 25, 60.9%). Patients with multiple episodes of VFH (n = 9, 22.0%) were compared to patients with a single event. After a median of 41 months follow-up, patients with VFH had favorable vocal function assessment and low median VHI-10 and SVHI-10 scores (4 and 6, respectively), substantially similar to patients without VFH (VHI-10, P = .905 and SVHI 10, P =.991). The two groups showed similarly low rates of change in occupation (7.3%vs. 8.0%, P =.999). Patients with VFH were more likely to have missed days of work due to a voice problem. Analysis of patients with one versus multiple VFH episodes showed no differences, except patients with multiple episodes had significantly greater confidence in their ability to address future VFH. Contrary to commonly held belief, VFH appears to have no significant long-term impact on vocational stability, subjective voice quality, or perceptions of vocal function. Moreover, among those with VFH, recurrence seems only to diminish anxiety over this transient injury. 4 Laryngoscope, 127:900-906, 2017. © 2016 The American Laryngological, Rhinological and Otological Society, Inc.

  5. Voice deviation, dysphonia risk screening and quality of life in individuals with various laryngeal diagnoses

    Science.gov (United States)

    Nemr, Katia; Cota, Ariane; Tsuji, Domingos; Simões-Zenari, Marcia

    2018-01-01

    OBJECTIVES: To characterize the voice quality of individuals with dysphonia and to investigate possible correlations between the degree of voice deviation (D) and scores on the Dysphonia Risk Screening Protocol-General (DRSP), the Voice-Related Quality of Life (V-RQOL) measure and the Voice Handicap Index, short version (VHI-10). METHODS: The sample included 200 individuals with dysphonia. Following laryngoscopy, the participants completed the DRSP, the V-RQOL measure, and the VHI-10; subsequently, voice samples were recorded for auditory-perceptual and acoustic analyses. The correlation between the score for each questionnaire and the overall degree of vocal deviation was analyzed, as was the correlation among the scores for the three questionnaires. RESULTS: Most of the participants (62%) were female, and the mean age of the sample was 49 years. The most common laryngeal diagnosis was organic dysphonia (79.5%). The mean D was 59.54, and the predominance of roughness had a mean of 54.74. All the participants exhibited at least one abnormal acoustic aspect. The mean questionnaire scores were DRSP, 44.7; V-RQOL, 57.1; and VHI-10, 16. An inverse correlation was found between the V-RQOL score and D; however, a positive correlation was found between both the VHI-10 and DRSP scores and D. CONCLUSION: A predominance of adult women, organic dysphonia, moderate voice deviation, high dysphonia risk, and low to moderate quality of life impact characterized our sample. There were correlations between the scores of each of the three questionnaires and the degree of voice deviation. It should be noted that the DRSP monitored the degree of dysphonia severity, which reinforces its applicability for patients with different laryngeal diagnoses. PMID:29538494

  6. Multidisciplinary approach in the treatment of T1 glottic cancer. The role of patient preference in an homogenous patient population

    International Nuclear Information System (INIS)

    Dinapoli, Nicola; Parrilla, Claudio; Galli, Jacopo

    2010-01-01

    To compare oncological outcome and voice quality among a uniform and well-defined subset of patients with T1 glottic carcinoma. Patients, affected by laryngeal glottic carcinoma, treated by laser CO 2 surgery or radiotherapy, have been analyzed. Overall survival and disease-free survival were calculated. In order to verify differences in functional outcomes and voice quality, all patients were interviewed during their last follow-up visit during 2009 using the VHI (Voice Handicap Index) questionnaire. The data were analyzed using the MedCalc software. A total of 143 patients were analyzed: 73 underwent surgery and 70 underwent radiotherapy. No statistically significant differences were found between the two groups in terms of overall survival and disease-free survival; dividing patients into stages T1a and T1b also made no difference. In order to evaluate the differences in outcomes for surgery and radiotherapy, patients were interviewed using the VHI questionnaire. Better scores for each category in the VHI were found for patients receiving radiotherapy compared to surgery (physical: p = 0.0023; functional: p < 0.0001; environmental: p < 0.001). The median VHI score for radiotherapy patients was 4, while for surgical patients it was 18 (p < 0.0001). This study confirms the well-known knowledge that results from radiotherapy and surgery in early glottic cancer treatment are equivalent. Furthermore, the role of patient preference in the treatment modality choice and the value of a multidisciplinary approach for a detailed and multi-oriented discussion with the patient are outlined. (orig.)

  7. Multidisciplinary approach in the treatment of T1 glottic cancer. The role of patient preference in an homogenous patient population

    Energy Technology Data Exchange (ETDEWEB)

    Dinapoli, Nicola [Catholic Univ. of the Sacred Heart, Rome (Italy). Dept. of Radiation Oncology; Parrilla, Claudio; Galli, Jacopo [Catholic Univ. of the Sacred Heart, Rome (IT). Dept. of Otorhinolaryngoiatry] (and others)

    2010-11-15

    To compare oncological outcome and voice quality among a uniform and well-defined subset of patients with T1 glottic carcinoma. Patients, affected by laryngeal glottic carcinoma, treated by laser CO{sub 2} surgery or radiotherapy, have been analyzed. Overall survival and disease-free survival were calculated. In order to verify differences in functional outcomes and voice quality, all patients were interviewed during their last follow-up visit during 2009 using the VHI (Voice Handicap Index) questionnaire. The data were analyzed using the MedCalc software. A total of 143 patients were analyzed: 73 underwent surgery and 70 underwent radiotherapy. No statistically significant differences were found between the two groups in terms of overall survival and disease-free survival; dividing patients into stages T1a and T1b also made no difference. In order to evaluate the differences in outcomes for surgery and radiotherapy, patients were interviewed using the VHI questionnaire. Better scores for each category in the VHI were found for patients receiving radiotherapy compared to surgery (physical: p = 0.0023; functional: p < 0.0001; environmental: p < 0.001). The median VHI score for radiotherapy patients was 4, while for surgical patients it was 18 (p < 0.0001). This study confirms the well-known knowledge that results from radiotherapy and surgery in early glottic cancer treatment are equivalent. Furthermore, the role of patient preference in the treatment modality choice and the value of a multidisciplinary approach for a detailed and multi-oriented discussion with the patient are outlined. (orig.)

  8. The Handicap Principle for Trust in Computer Security, the Semantic Web and Social Networking

    Science.gov (United States)

    Ma, Zhanshan (Sam); Krings, Axel W.; Hung, Chih-Cheng

    Communication is a fundamental function of life, and it exists in almost all living things: from single-cell bacteria to human beings. Communication, together with competition and cooperation,arethree fundamental processes in nature. Computer scientists are familiar with the study of competition or 'struggle for life' through Darwin's evolutionary theory, or even evolutionary computing. They may be equally familiar with the study of cooperation or altruism through the Prisoner's Dilemma (PD) game. However, they are likely to be less familiar with the theory of animal communication. The objective of this article is three-fold: (i) To suggest that the study of animal communication, especially the honesty (reliability) of animal communication, in which some significant advances in behavioral biology have been achieved in the last three decades, should be on the verge to spawn important cross-disciplinary research similar to that generated by the study of cooperation with the PD game. One of the far-reaching advances in the field is marked by the publication of "The Handicap Principle: a Missing Piece of Darwin's Puzzle" by Zahavi (1997). The 'Handicap' principle [34][35], which states that communication signals must be costly in some proper way to be reliable (honest), is best elucidated with evolutionary games, e.g., Sir Philip Sidney (SPS) game [23]. Accordingly, we suggest that the Handicap principle may serve as a fundamental paradigm for trust research in computer science. (ii) To suggest to computer scientists that their expertise in modeling computer networks may help behavioral biologists in their study of the reliability of animal communication networks. This is largely due to the historical reason that, until the last decade, animal communication was studied with the dyadic paradigm (sender-receiver) rather than with the network paradigm. (iii) To pose several open questions, the answers to which may bear some refreshing insights to trust research in

  9. Language Acquisition and Assessment in Normal and Handicapped Preschool Children: A Review of the Literature. Final Report. Volume II.

    Science.gov (United States)

    Longhurst, Thomas M.

    The second of four documents provides a summary of the scientific literature pertaining to spontaneous language acquisition in handicapped preschool children, and reviews and evaluates procedures for assessing language acquisition in these children. Chapter l focuses on language development in nonhandicapped children after they have acquired their…

  10. Title I/PSEN Individualized Reading and Math Services for the Handicapped, 1980-81. Final Evaluation Report.

    Science.gov (United States)

    New York City Board of Education, Brooklyn, NY. Office of Educational Evaluation.

    The Title I Umbrella Program provided compensatory instruction in reading, mathematics, and writing to 24,000 mildly or moderately handicapped students in New York City. The program was comprised of seven discrete components for the remediation of reading and writing skills, five after-school models, and two components for the remediation of math…

  11. Social Comparison, Multiple Reference Groups, and the Self-Concepts of Academically Handicapped Children Before and After Mainstreaming.

    Science.gov (United States)

    Strang, Louise; And Others

    1978-01-01

    Predictions from social comparison theory and group reference theory were tested in two experiments assessing the impact of half-day mainstreaming upon the self-concepts of academically handicapped children. The results supported the theoretical viability of social comparison theory and group reference theory in educational settings. (Author/BH)

  12. Education of the Handicapped Act Amendments of 1990, P.L. 101-476: A Summary. CRS Report for Congress.

    Science.gov (United States)

    Aleman, Steven R.

    This summary of the Education of the Handicapped Act Amendments of 1990, Public Law 101-476, identifies how these Amendments extend and expand special education research, demonstration, and training programs of the Individuals with Disabilities Education Act (IDEA). IDEA authorizes three state formula grant programs and several discretionary grant…

  13. A Comparison of Forward and Concurrent Chaining Strategies in Teaching Laundromat Skills to Students with Severe Handicaps.

    Science.gov (United States)

    McDonnell, John; McFarland, Susan

    1988-01-01

    In a study which taught four high school students with severe handicaps to use a commercial washing machine and laundry soap dispenser, a concurrent chaining strategy was found more efficient than forward chaining in facilitating skill acquisition. Concurrent chaining also resulted in better maintenance at four- and eight-week follow-up…

  14. Child Functional Independence and Maternal Psychosocial Stress as Risk Factors Threatening Adaptation in Mothers of Physically or Sensorially Handicapped Children.

    Science.gov (United States)

    Wallander, Jan L; And Others

    1990-01-01

    Investigated contribution of child functional independence and maternal psychosocial stress to adaptation of 119 mothers of physically or sensorially handicapped children between the ages of 2 and 18. Child functional independence did not uniquely explain variation in mothers' adaptation. Maternal stress was uniquely associated with maternal…

  15. You Should be Dancin:! The Role of Performing Arts in the Lives of the Severely and Profoundly Handicapped.

    Science.gov (United States)

    Barringer, Mary Dean

    The manual presents a program planning framework and teaching units for teaching dance and movement to severely and profoundly handicapped individuals. The planning framework contains four components: (1) aesthetic perception/multisensory integration; (2) creative expression; (3) dance heritage/historical and cultural; and (4) aesthetic…

  16. Validity of the Mania Subscale of the Diagnostic Assessment for the Severely Handicapped-II (DASH-II).

    Science.gov (United States)

    Matson, Johnny L.; Smiroldo, Brandi B.

    1997-01-01

    A study tested the validity of the Diagnostic Assessment for the Severely Handicapped-II (DASH-II) for determining the presence of mania (bipolar disorder) in 22 individuals with severe mental retardation. Results found the mania subscale to be internally consistent and able to be used to classify manic and control subjects accurately. (Author/CR)

  17. The relationship between structured and free play in the development of a mentally handicapped child: a case study.

    Science.gov (United States)

    Hewson, S; McConkey, R; Jeffree, D

    1980-01-01

    This case study provides an individual illustration of the work of the Parental Involvement Project. A key feature of the approach used was the structured play situation. Thus, the case study also serves to demonstrate the role of structured play, and its relation to free play, in the development of a young, mentally handicapped child.

  18. Sex difference in disability and handicap at five years of age in children born at very short gestation

    NARCIS (Netherlands)

    Verloove-Vanhorick, S.P.; Veen, S.; Ens-Dokkum, M.H.; Schreuder, A.M.; Brand, R.; Ruys, J.H.

    1994-01-01

    Objective. The objective of this study was to examine the relationship between sex and disabilities or handicaps at 5 years of age in infants born at less than 32 weeks gestation. Design. From the nationwide collaborative survey starting in 1983, including perinatal data obtained during routine

  19. Self-esteem at school and self-handicapping in childhood: comparison of groups with learning disabilities.

    Science.gov (United States)

    Alesi, Marianna; Rappo, Gaetano; Pepi, Annamaria

    2012-12-01

    Recent research has focused on the role of self-esteem and self-handicapping strategies in the school domain. Self-handicapping refers to maladaptive strategies employed by adults and children for protection and maintenance of positive school self esteem. In this study the self-esteem and the self-handicapping strategies of children with dyslexia, reading comprehension disabilities, and mathematical disabilities were compared to a control group with normal learning. There were 56 children whose mean age was 8 (23 girls, 33 boys), attending Grade 3 of primary school. These pupils were selected by scores on a battery of learning tests commonly used in Italy for assessment of learning disabilities. Analyses suggested these children with dyslexia, reading comprehension disabilities, and mathematical disabilities had lower ratings of self-esteem at school and employed more self-handicapping strategies than did children whose learning was normal. More research is required to identify and examine in depth the factors that promote adaptive strategies to cope with children's reading difficulties.

  20. Effectiveness of Meta-Cognitive Skills Training on Self-Handicapping and Self-Efficacy of Students

    Directory of Open Access Journals (Sweden)

    Shahrbanou Javidan

    2018-03-01

    Discussion: Findings of the present study suggest that meta-cognitive skills training- as an effective training program- could be used for decreasing students’ self-handicapping. But with regards to the effectiveness of meta-cognitive skills training on self-efficacy, it is revealed that more variables are involved, and it needs further investigation.

  1. Academic Self-Handicapping: Relationships with Learning Specific and General Self-Perceptions and Academic Performance over Time

    Science.gov (United States)

    Gadbois, Shannon A.; Sturgeon, Ryan D.

    2011-01-01

    Background: Academic self-handicapping (ASH) tendencies, strategies students employ that increase their chances of failure on assessments while protecting self-esteem, are correlated with classroom goal structures and to learners' general self-perceptions and learning strategies. In particular, greater ASH is related to poorer academic performance…

  2. A Multifaceted Program To Improve Self-Esteem and Social Skills while Reducing Anxiety in Emotionally Handicapped Middle School Students.

    Science.gov (United States)

    Poirier, Lynn

    A practicum was developed to increase self-esteem, to lower anxiety, and to improve social skills in 13 emotionally handicapped (EH) middle school boys. An additional objective was to provide parenting classes which focused on increasing parents' knowledge and skills in improving their children's self esteem. The 8-month multifaceted program…

  3. Do You Know a Child with a Handicap? Children with Handicaps Have a Right to an Education [and] Do You Know Someone with a Handicap? Individuals with Handicaps Have a Right to an Education = Conoce Usted a un Nino que Tiene Alguna Desventaja? Los Ninos con Desventajas Tienen Derecho a Recibir Educacion [and] Conoce Usted Alguna Persona que Tenga Alguna Desventaja? Las Personas que Tienen Desventajas Tienen Derecho a Recibir Educacion.

    Science.gov (United States)

    California State Dept. of Education, Sacramento. Div. of Special Education.

    Two advertisements and two brochures for the California Search and Serve program are presented in this excerpt from the California Search and Serve "Search Guidelines and Resource Manual." The materials are designed to promote community involvement in the identification of handicapped persons, from birth through age 21, so that they may…

  4. The Fuzzy and Compartment System Concept for the Communication System Taking Account of the Handicapped Situation

    Directory of Open Access Journals (Sweden)

    Masahiro Aruga

    2011-02-01

    Full Text Available In the previous papers the process of structuring the Life support system to consider the essential meaning of the ubiquitous system has been presented. There the Life support system is shown as it is synthesized from the Expanded EMR and on the basis of such an essential concept of the ubiquitous system as it is in the recovery of lost functions of ordinary persons. The Life support system has been described to be synthesized with embedding the communication system for the handicapped people as a module, and as such an example of the embedded comunication system as a module the "YUBITSUKIYI" system has been described. Considering the synthesis of the Life support system the transmission structure of information of this system has been needed to be studied, and there some concepts over the ordinary Shannon

  5. [Political-academic discourse and integration of handicapped people: from appearances to the senses].

    Science.gov (United States)

    de França, Inacia Sátiro; Pagliuca, Lorita Marlena; de Sousa, Rosiléa Alves

    2003-12-01

    Our aim was to analyze law no. 3.298/99 and course plans in undergraduate nursing programs in order to confirm the inclusion of the item for participation of nurses in the Handicapped People (HP) integration process. We read the plans of courses from four universities; identified the courses in common and distributed them according to the level of health care. The proposals of the law are universal, equal, and democratic; the plans of courses analyzed adopt most of the actions recommended by the Ministry of Health in order to prevent deficiencies. Nevertheless, academic practice exercises prevention/treatment of diseases, silencing concern over the insertion of nurse in the HP integration process.

  6. The self-serving function of hypochondriacal complaints: physical symptoms as self-handicapping strategies.

    Science.gov (United States)

    Smith, T W; Snyder, C R; Perkins, S C

    1983-04-01

    The present experiment tested the hypothesis that hypochondriacal individuals commonly use reports of physical illness and symptoms as a strategy to control attributions made about their performances in evaluative settings (i.e., self-handicapping strategies). Specifically, it was predicted that hypochondriacal individuals would report more recent physical illness and complaints and more current physical symptoms in an evaluative setting in which poor health could serve as an alternative explanation for poor performance than would either individuals in an evaluative setting in which poor health was precluded as an excuse or individuals in a nonevaluative setting. As predicted, results supported this self-protective pattern of complaints in a hypochondriacal sample but not in a nonhypochondriacal group. The self-protective role of hypochondriacal behavior is discussed in relation to other theory and research on the nature and treatment of hypochondriasis.

  7. Age and excuses for forgetting: self-handicapping versus damage-control strategies.

    Science.gov (United States)

    Erber, J T; Prager, I G

    2000-01-01

    Either before or after being interviewed for a volunteer position, a young or old protagonist (i.e., target) gave an excuse for forgetting. Study participants (i.e., perceivers) had a higher opinion of the target's memory, were more confident in the target's capability of performing memory-related tasks, and attributed the target's memory failures more to bad luck when the excuse was given after (damage-control strategy) rather than before (self-handicapping strategy) the interview. Moreover, the excuse given before the interview had no significant effect on perceivers' judgments when compared with data from an earlier study in which the target gave no excuse for forgetting. The present findings suggest that a damage-control strategy can ameliorate negative capability impressions.

  8. Physical-recreate activities to occupy the free time of handicaps children aged 6 to 11

    Directory of Open Access Journals (Sweden)

    Lizmary Feriz Otaño

    2013-08-01

    Full Text Available The research answers to the scholar age children’s necessity of Hermanos Cruz Community in Pinar del Río municipality. To verify the existence of a real problem about the necessity to occupy the free time o handicaps children, an initial diagnosis was carried out using different methods of investigation such as theoretical, empirical, and statistical and community intervention methods. There were consulted some specialists so as to gather the necessary information to validate the proposal, that contributes to insert the children in society as a way of relaxing and also promoting them health. The participative techniques are aimed to transform the group’s way of acting in the community. The proposed physical and recreate activities are integrating and take into account the children’s psychobiological necessities. The proposal was greatly accepted by Hermanos Cruz community and its results were considerably higher than those ones expected in the investigation.

  9. Validation of the Italian Version of the Dizziness Handicap Inventory, the Situational Vertigo Questionnaire, and the Activity-Specific Balance Confidence Scale for Peripheral and Central Vestibular Symptoms

    Directory of Open Access Journals (Sweden)

    Silvia Colnaghi

    2017-10-01

    Full Text Available Neurophysiological measurements of the vestibular function for diagnosis and follow-up evaluations provide an objective assessment, which, unfortunately, does not necessarily correlate with the patients’ self-feeling. The literature provides many questionnaires to assess the outcome of rehabilitation programs for disequilibrium, but only for the Dizziness Handicap Inventory (DHI is an Italian translation available, validated on a small group of patients suffering from a peripheral acute vertigo. We translated and validated the reliability and validity of the DHI, the Situational Vertigo Questionnaire (SVQ, and the Activities-Specific Balance Confidence Scale (ABC in 316 Italian patients complaining of dizziness due either to a peripheral or to a central vestibular deficit, or in whom vestibular signs were undetectable by means of instrumental testing or clinical evaluation. Cronbach’s coefficient alpha, the homogeneity index, and test–retest reproducibility, confirmed reliability of the Italian version of the three questionnaires. Validity was confirmed by correlation test between questionnaire scores. Correlations with clinical variables suggested that they can be used as a complementary tool for the assessment of vestibular symptoms. In conclusion, the Italian versions of DHI, SVQ, and ABC are reliable and valid questionnaires for assessing the impact of dizziness on the quality of life of Italian patients with peripheral or central vestibular deficit.

  10. A Comparison of Self-Reported Hearing Handicap and Audiometric Thresholds in Nursing Home Residents

    Directory of Open Access Journals (Sweden)

    Nematolla Rouhbakhsh

    2007-12-01

    Full Text Available Background and Aim: Self-reported and questionaire method for hearing impairment assessment allow us to study and to detect the invisible related issues, while They can not be done by traditional audiometry procedures. The purpose of this study is to compare measurement of hearing handicap using self-reported and staff version of NHHI and hearing thresholds in nursing home residents. Materials and Method: The study participants were 43 individuals, 23 males and 20 females, aged 45-95 years. Pure tone average were calculated after conventional Pure tone audiometry . the self- and staff- reported questionnaire were also fulfilled. Results: Nine (20.9% individuals have normal hearing, 6 (14% have slight, 10 (23.3% mild, 7 (16.3% moderate, 6 (16.3% moderate to severe, 4 (9.3% severe, and 1 (2.3% profound hearing loss. Mean score of self and of staff reported versions were 32.22 % +29.31 and 32.67% +30.98, respectively. According to Kruskal-wallis test, there were significant correlation between self-reported and hearing level and between staff-reported and hearing level. The Pierson coefficient variation test between self and staff-reported, and self-reported and hearing level, staff-reported and hearing level showed significant correlation. Conclusion: The NHHI self assessment associated with other equipments significantly improved the identification and assessment of adults and elderly hearing handicap in nursing home residents. According to the study condition, it may be concluded that the self and staff version of NHHI questionnaire are significantly identical and can be used instead.

  11. Using appreciative inquiry to help students identify strategies to overcome handicaps of their learning styles.

    Science.gov (United States)

    Kumar, Latha Rajendra; Chacko, Thomas Vengail

    2012-01-01

    In India, as in some other neighboring Asian countries, students and teachers are generally unaware of the differences in the learning styles among learners, which can handicap students with learning styles alien to the common teaching/learning modality within the institution. This study aims to find out whether making students aware of their learning styles and then using the Appreciative Inquiry approach to help them discover learning strategies that worked for them and others with similar learning styles within the institution made them perceive that this experience improved their learning and performance in exams. The visual, auditory, read-write, and kinesthetic (VARK) inventory of learning styles questionnaire was administered to all 100 first-year medical students of the Father Muller's Medical College in Mangalore India to make them aware of their individual learning styles. An Appreciate Inquiry intervention was administered to 62 student volunteers who were counseled about the different learning styles and their adaptive strategies. Pre and post intervention change in student's perception about usefulness of knowing learning styles on their learning, learning behavior, and performance in examinations was collected from the students using a prevalidated questionnaire. Post intervention mean scores showed a significant change (P learning style and discovering strategies that worked within the institutional environment. There was agreement among students that the intervention helped them become more confident in learning (84%), facilitating learning in general (100%), and in understanding concepts (100%). However, only 29% of the students agreed that the intervention has brought about their capability improvement in application of learning and 31% felt it improved their performance in exams. Appreciate Inquiry was perceived as useful in helping students discover learning strategies that work for different individual learning styles and sharing them within

  12. A cohort study of accidents occurring in mentally handicapped patients living in institutions

    Directory of Open Access Journals (Sweden)

    Muriel Alfonso

    2010-05-01

    Full Text Available Abstract Background Mentally handicapped patients who require extensive and generalised care and are resident in mental health institutions have certain characteristics that could mean that they suffer certain types of accidents. The aim of this study was to determine the number and type of accident-related injuries in this population in order to design appropriate preventative strategies. Methods Accident-related injuries in patients resident in six institutions in the north of Spain were recorded prospectively over a period of 21 months. The characteristics of these injuries were recorded in a database linked to another in which patient data were recorded. A logistic regression model employing the generalized estimating equation (GEE methodology was employed due to the repetition of patient accidents. Results There was one death due to foreign body aspiration into the airways. A total of 1,671 injuries were recorded, 0.5% of which were classified as serious, 10% moderate and 89.5% minor. The serious injuries involved fractures (6 and cuts (2, the moderate injuries mainly cuts (57%, bruising (18% and sprains (13%, and the minor injuries bruising (40%, cuts (35% and scratches (20%. Falls were the main cause of these injuries (25.2%. The variables associated with serious accidents were self-harm (OR = 1.18, non-collaborative behaviour (OR = 1.21 and inpatient (OR = 1.37. Conclusions Accidents in mentally handicapped patients occur in different ways compared to those in the general population. The majority of injuries found were minor (an average of 0.8 to 3.4 accidents per year, with falls being the most common cause. Patients with behavioural disorders undergoing treatment with neuroleptic agents were found to be a risk group, therefore this finding should be taken into consideration when establishing care groups.

  13. Psychometric properties of the Persian version of the Tinnitus Handicap Inventory (THI-P

    Directory of Open Access Journals (Sweden)

    Mir Mohammad Jalali

    2015-03-01

    Full Text Available Introduction: Tinnitus can have a significant effect on an individual’s quality of life, and is very difficult quantify. One of the most popular questionnaires used in this area is the Tinnitus Handicap Inventory (THI. The aim of this study was to determine the reliability and validity of a Persian translation of the Tinnitus Handicap Inventory (THI-P.   Materials and Methods: This prospective clinical study was performed in the Otolaryngology Department of Guilan University of Medical Sciences, Iran. A total of 102 patients aged 23–80 years with tinnitus completed the (THI-P. The patients were instructed to complete the Beck Depression Inventory (BDI and the State-Trait Anxiety Inventory (STAI. Audiometry was performed. Eight-five patients were asked to complete the THI-P for a second time 7–10 days after the initial interview. We assessed test–retest reliability and internal reliability of the THI-P. Validity was assessed by analyzing the THI-P of patients according to their age, tinnitus duration and psychological distress (BDI and STAI. A factor analysis was computed to verify if three subscales (functional, emotional, and catastrophic represented three distinct variables.   Results: Test–retest correlation coefficient scores were highly significant. The THI-P and its subscales showed good internal consistency reliability (α = 0.80 to 0.96. High-to-moderate correlations were observed between THI-P and psychological distress and tinnitus symptom ratings. A confirmatory factor analysis failed to validate the three subscales of THI, and high inter-correlations found between the subscales question whether they represent three distinct factors. Conclusion:  The results suggest that the THI-P is a reliable and valid tool which can be used in a clinical setting to quantify the impact of tinnitus on the quality of life of Iranian patients.

  14. Supplement: Commodity Index Report

    Data.gov (United States)

    Commodity Futures Trading Commission — Shows index traders in selected agricultural markets. These traders are drawn from the noncommercial and commercial categories. The noncommercial category includes...

  15. Indexing mergers and acquisitions

    OpenAIRE

    Gang, Jianhua; Guo, Jie (Michael); Hu, Nan; Li, Xi

    2017-01-01

    We measure the efficiency of mergers and acquisitions by putting forward an index (the ‘M&A Index’) based on stochastic frontier analysis. The M&A Index is calculated for each takeover deal and is standardized between 0 and 1. An acquisition with a higher index encompasses higher efficiency. We find that takeover bids with higher M&A Indices are more likely to succeed. Moreover, the M&A Index shows a strong and positive relation with the acquirers’ post-acquisition stock perfo...

  16. How do voice restoration methods affect the psychological status of patients after total laryngectomy?

    Science.gov (United States)

    Saltürk, Z; Arslanoğlu, A; Özdemir, E; Yıldırım, G; Aydoğdu, İ; Kumral, T L; Berkiten, G; Atar, Y; Uyar, Y

    2016-03-01

    This study investigated the relationship between psychological well-being and different voice rehabilitation methods in total laryngectomy patients. The study enrolled 96 patients who underwent total laryngectomy. The patients were divided into three groups according to the voice rehabilitation method used: esophageal speech (24 patients); a tracheoesophageal fistula and Provox 2 voice prosthesis (57 patients); or an electrolarynx (15 patients). The participants were asked to complete the Turkish version of the Voice Handicap Index-10 (VHI-10) to assess voice problems. They were also asked to complete the Turkish version of the Perceived Stress Scale (PSS), and the Hospital Anxiety and Depression Scale (HADS). The test scores of the three groups were compared statistically. Patients who used esophageal speech had a mean VHI-10 score of 10.25 ± 3.22 versus 19.42 ± 5.56 and 17.60 ± 1.92 for the tracheoesophageal fistula and Provox 2 and electrolarynx groups respectively, reflecting better perception of their voice. They also had a PSS score of 11.38 ± 3.92, indicating that they felt less stressed in comparison with the tracheoesophageal fistula and Provox 2 and electrolarynx groups, which scored 18.84 ± 5.50 and 16.20 ± 3.49 respectively. The HADS scores of the groups were not different, indicating that the patients' anxiety and depression status did not vary. Patients who used esophageal speech perceived less stress and were less handicapped by their voice.

  17. Analysis in indexing

    DEFF Research Database (Denmark)

    Mai, Jens Erik

    2005-01-01

    is presented as an alternative and the paper discusses how this approach includes a broader range of analyses and how it requires a new set of actions from using this approach; analysis of the domain, users and indexers. The paper concludes that the two-step procedure to indexing is insufficient to explain...

  18. Rethinking image indexing?

    DEFF Research Database (Denmark)

    Christensen, Hans Dam

    2017-01-01

    Hans Dam Christensen, ”Rethinking image indexing?”, in: Journal of the Association for Information Science and Technology, vol. 68, no. 7, 2017, 1782-1785......Hans Dam Christensen, ”Rethinking image indexing?”, in: Journal of the Association for Information Science and Technology, vol. 68, no. 7, 2017, 1782-1785...

  19. GRI Index 2017

    OpenAIRE

    World Bank

    2017-01-01

    This World Bank GRI Index 2017 provides an overview of sustainability considerations within the World Bank’s lending and analytical services as well as its corporate activities. This index of sustainability indicators has been prepared in accordance with the internationally recognized standard for sustainability reporting, the GRI Standards: Core option (https://www.globalreporting.org). T...

  20. 2016 GRI Index

    OpenAIRE

    World Bank

    2016-01-01

    This 2016 World Bank Global Reporting Initiative (GRI) Index provides an overview of sustainability considerations within the World Bank’s lending and analytical services as well as its corporate activities. This index of sustainability indicators has been prepared in accordance with the internationally recognized standard for sustainability reporting GRI guidelines (https://www.globalrepo...

  1. Global Ecosystem Restoration Index

    DEFF Research Database (Denmark)

    Fernandez, Miguel; Garcia, Monica; Fernandez, Nestor

    2015-01-01

    The Global ecosystem restoration index (GERI) is a composite index that integrates structural and functional aspects of the ecosystem restoration process. These elements are evaluated through a window that looks into a baseline for degraded ecosystems with the objective to assess restoration...

  2. EJSCREEN Supplementary Indexes 2015 Public

    Data.gov (United States)

    U.S. Environmental Protection Agency — There are 40 supplementary EJSCREEN indexes that are divided into 5 categories: EJ Index with supplementary demographic index, Supplementary EJ Index 1 with...

  3. JUSTIFICATION OF THE EXISTENCE OF PREPARATORY GROUPS IN SPECIAL SCOOLS FOR CHILDREN LIGHTLY HANDICAPPED

    Directory of Open Access Journals (Sweden)

    Aneta ANDONAKIS

    1997-03-01

    Full Text Available Researches about child’s intellectual development in the psychology has started in the 19th century and the first step has been made by Tiedemann in “ Observation of the development of the mental abilities of the children”. His work caused a great interest in the circles of doctors and psychologists. Their interpretation of intelligence was different, but the most acceptable is the performance of complicated activities for getting knowledge and skills and getting over the obstacles in the development of the person”.The social ability do not correspond with the intelligence. The two aspects are tested and a complete picture of their functioning can be seen. The developmental principle is determined from general to the separate as functionally connected.In the period when a child does not accept the higher level of intelligence and thinking , in relation to which are effectuated by sense-motor activities, than we say that a child is mentally handicapped. The widest approach of the educational system should be treated as a functional, institutional and organizational, that takes part in the realization of the social aims and tasks.Not getting into viewing of the curriculum's and programs for preparatory groups in the preeducational period, we may say that the justification for the existence of these group in the regular schools, is maturation of the perceptive motor coordination and learning. With the maturing the function of the "ego" is increasing.As a child adapts better he can learn better, and the maturity comes sooner. In this way these groups are justified.Mentally handicapped child has not the opportunity to attend an organized prepared education which provides:-forming of the speech, self-control, which can be achieved in the process of learning through a direct contact with other children;· regulation of the lateralization through re-education of the psycho-motor abilities, and in general neuro-motor experienced maturation

  4. Survival Words and Phrases for Professionals Who Work with Students Who Are Bilingual and Severely/Multiply Handicapped, and with Their Families.

    Science.gov (United States)

    Silberman, Rosanne K.; Correa, Vivian I.

    1989-01-01

    The paper offers a rationale for bilingual special education, provides suggestions for developing bilingual lessons for severely/multiply handicapped students, and includes a list of Spanish words and phrases used most frequently by students and their parents. (JDD)

  5. Political philosophy, ethnology, and time: a study of the notion of historical handicap

    Directory of Open Access Journals (Sweden)

    João Feres Jr

    2002-06-01

    Full Text Available This article starts by identifying the crucial importance of the notion of historical handicap for the present-day social sciences of Latin America. Such notion is not an original invention made by Latinamericanists. On the contrary, I demonstrate that the genealogy of the notion of historical handicap must be sought in the tradition of Western political philosophy. Such genealogy must take into account the way it was integrated into ethnological descriptions. When and how did the Other become the backward, the primitive? While this relation was secondary for ancient Greek thought, theories of historical development became the main source of ethnological categories in the modern era. Interestingly enough, this modern synthesis suited the practical purpose of justifying two successive waves of European imperialistic: the era of discoveries, and 19th century colonialism. The article concludes by raising questions about the present role and application of the social sciences.Esse artigo começa por identificar o papel central da noção de incapacidade histórica para a literatura de Latin American studies produzida no pós-guerra. Tal noção não foi criada pelos Latinoamericanistas contemporâneos. É possível identificar o embrião da noção de incapacidade histórica nos mitos primitivistas da antiguidade clássica e, a partir daí, examinar as várias maneiras com que ela foi recebida e rearticulada pela tradição filosófica ocidental. Esse estudo é feito tendo em vista a incorporação da noção de incapacidade histórica a teorias etnológicas. Quando e como o "outro" passou a ser visto como o "atrasado", o "primitivo"? Se na antiguidade clássica essa identificação era incompleta, na era moderna teorias de desenvolvimento histórico se tornaram a fonte principal de categorias etnológicas. É importante notar que a síntese moderna dessas teorias também serviram para justificar as aventuras imperialistas Européias: a era dos

  6. Mental health problems in adolescents with cochlear implants: Peer problems persist after controlling for additional handicaps

    Directory of Open Access Journals (Sweden)

    Maria eHuber

    2015-07-01

    Full Text Available The aims of the present multi-center study were to investigate the extent of mental health problems in adolescents with a hearing loss and cochlear implants (CIs in comparison to normal hearing (NH peers and to investigate possible relations between the extent of mental health problems of young CI users and hearing variables, such as age at implantation, or functional gain of CI. The survey included 140 adolescents with CI (mean age = 14.7, SD = 1.5 years and 140 NH adolescents (mean age = 14.8, SD = 1.4 years, their parents and teachers. Participants were matched by age, gender and social background. Within the CI group, 35 adolescents were identified as risk cases due to possible and manifest additional handicaps, and 11 adolescents were non-classifiable. Mental health problems were assessed with the Strengths and Difficulties Questionnaire (SDQ in the versions Self, Parent, and Teacher. The CI group showed significantly more Peer Problems than the NH group. When the CI group was split into a risk-group (35 risk cases and 11 non-classifiable persons and a non-risk group (n = 94, increased peer problems were perceived in both CI subgroups by adolescents themselves. However, no further differences between the CI non-risk group and the NH group were observed in any rater. The CI-risk group showed significantly more hyperactivity compared to the NH group and more hyperactivity and conduct problems compared to the CI non-risk group. Cluster analyses confirmed that there were significantly more adolescents with high problems in the CI-risk group compared to the CI non-risk group and the NH group. Adolescents with CI, who were able to understand speech in noise had significantly less difficulties compared to constricted CI users. Parents, teachers, and clinicians should be aware that CI users with additionally special needs may have mental health problems. However, peer problems were also experienced by CI adolescents without additional handicaps

  7. A new supersymmetric index

    International Nuclear Information System (INIS)

    Cecotti, S.; Fendley, P.; Intriligator, K.; Vafa, C.

    1992-01-01

    We show that Tr(-1) F F e -βH is an index for N = 2 supersymmetric theories in two dimensions, in the sense that it is independent of almost all deformations of the theory. This index is related to the geometry of the vacua (Berry's curvature) and satisfies an exact differential equation as a function of β. For integrable theories we can also compute the index thermodynamically, using the exact S-matrix. The equivalence of these two results implies a highly non-trivial equivalence of a set of coupled integral equations with these differential equations, among them Painleve III and the affine Toda equations. (orig.)

  8. The Performance-Perceptual Test (PPT) and its relationship to aided reported handicap and hearing aid satisfaction.

    Science.gov (United States)

    Saunders, Gabrielle H; Forsline, Anna

    2006-06-01

    Results of objective clinical tests (e.g., measures of speech understanding in noise) often conflict with subjective reports of hearing aid benefit and satisfaction. The Performance-Perceptual Test (PPT) is an outcome measure in which objective and subjective evaluations are made by using the same test materials, testing format, and unit of measurement (signal-to-noise ratio, S/N), permitting a direct comparison between measured and perceived ability to hear. Two variables are measured: a Performance Speech Reception Threshold in Noise (SRTN) for 50% correct performance and a Perceptual SRTN, which is the S/N at which listeners perceive that they can understand the speech material. A third variable is computed: the Performance-Perceptual Discrepancy (PPDIS); it is the difference between the Performance and Perceptual SRTNs and measures the extent to which listeners "misjudge" their hearing ability. Saunders et al. in 2004 examined the relation between PPT scores and unaided hearing handicap. In this publication, the relations between the PPT, residual aided handicap, and hearing aid satisfaction are described. Ninety-four individuals between the ages of 47 and 86 yr participated. All had symmetrical sensorineural hearing loss and had worn binaural hearing aids for at least 6 wk before participating. All subjects underwent routine audiological examination and completed the PPT, the Hearing Handicap Inventory for the Elderly/Adults (HHIE/A), and the Satisfaction for Amplification in Daily Life questionnaire. Sixty-five subjects attended one research visit for participation in this study, and 29 attended a second visit to complete the PPT a second time. Performance and Perceptual SRTN and PPDIS scores were normally distributed and showed excellent test-retest reliability. Aided SRTNs were significantly better than unaided SRTNs; aided and unaided PPDIS values did not differ. Stepwise multiple linear regression showed that the PPDIS, the Performance SRTN, and age were

  9. Clinical assessment of prognostic factors for long-term pain and handicap after whiplash injury: a 1-year prospective study

    DEFF Research Database (Denmark)

    Kasch, H; Qerama, E; Kongsted, Alice

    2008-01-01

    BACKGROUND AND PURPOSE: Physical mechanisms are the possible factors involved in the development and maintenance of long-term handicaps after acute whiplash injury. This study prospectively examined the role of active neck mobility, cervical and extra-cervical pains, as well as non-painful...... of non-painful complaints and active neck mobility [active cervical range of motion (CROM)]. All 458 high-risk patients and 230 low-risk patients received mailed questionnaires after 3, 6 and 12 months. Two examiners examined all high-risk patients (n = 458) and 41 consecutive low-risk patients at median...... complaints after a whiplash injury as predictors for subsequent handicap. METHODS: Consecutive acute whiplash patients (n = 688) were interviewed and examined by a study nurse after the median of 5 days after injury, and divided into a high- or a low-risk group by an algorithm based on pain intensity, number...

  10. Evaluation of The Effectiveness of Assertiveness Training for Physically Handicapped Adults on Body Image, Self-Esteem and Attitudes Directed to Themselves

    OpenAIRE

    Keser, İlkay; Ünsal Barlas, Gül

    2015-01-01

    Objective: To evaluate the effectiveness of assertiveness training for physically handicapped adolescents on the self-esteem and assertiveness ability. Method: The study sample consisted of 60 physically handicapped adolescents (30 study and 30 control groups) attending to Private Training and Rehabilitation Centers in Antalya Province. In the study, pre-test and post-test measurement methods were used to test the effectiveness of the assertiveness training program in both study group and con...

  11. Dementia and severity of parkinsonism determines the handicap of patients in late-stage Parkinson's disease: the Barcelona-Lisbon cohort.

    Science.gov (United States)

    Coelho, M; Marti, M J; Sampaio, C; Ferreira, J J; Valldeoriola, F; Rosa, M M; Tolosa, E

    2015-02-01

    Handicap has not been explored as a patient-centred outcome measure in Parkinson's disease (PD). The clinical features and medication use in late stages of PD (LS-PD) were reported previously. Handicap, medical conditions, use of healthcare resources and the impact of LS-PD upon caregivers were characterized in a cross-sectional study of LS-PD stages 4 or 5 of Hoehn and Yahr (H&Y). Handicap was measured using the London Handicap Scale (LHS: 0, maximal handicap; 1, no handicap). The mean LHS score in 50 patients was 0.33 (SD ±0.15). The presence of dementia, the Unified Parkinson's Disease Rating Scale part I score and the H&Y stage in 'off' independently predicted the LHS score (adjusted R(2) = 0.62; P = 0.000). Comorbidities and past medical conditions were frequent. Thirty-five patients lived at their house. Forty-five received unpaid care. Mean visits to the family doctor in the preceding 6 months were 2.2 (SD ±3.0) and to a neurologist 1.7 (SD ±1.0). Use of other health resources was low. Unpaid caregivers spent much time with patients and reported a high burden. Handicap could be measured in LS-PD and the LHS was easily completed by patients and caregivers. The high handicap in our cohort was mostly driven by the presence of dementia, behavioural complaints and the severity of non-dopaminergic motor features. Patients visited doctors infrequently and made low use of health resources, whilst unpaid caregivers reported a high burden. © 2014 EAN.

  12. A Study to Design a System to Identify Handicapped Family Members of Active Duty Soldiers at Fort Benning, Georgia

    Science.gov (United States)

    1982-05-01

    2 (June 1975): 341-351. 51 "Consumer Services for Handicapped People at Home." Physiotherapy , March 1981, 77. Feuerstein, et al. "Categories of...improve the level and quality of student and faculty research in the HCA Graduate Program, we are in the process of formalizing a three-way relationship...among our graduate faculty, pre- ceptors and graduate students , and the Health Care Studies Division (HCSD) of the Academy. In this regard, we believe

  13. Are anthropometric, flexibility, muscular strength, and endurance variables related to clubhead velocity in low- and high-handicap golfers?

    Science.gov (United States)

    Keogh, Justin W L; Marnewick, Michel C; Maulder, Peter S; Nortje, Jacques P; Hume, Patria A; Bradshaw, Elizabeth J

    2009-09-01

    The present study assessed the anthropometric profile (International Society for the Advancement of Kinanthropometry protocol), flexibility, muscular strength, and endurance of 20 male golfers. These data were collected in order to determine: a) the relationship between these kinanthropometric measures and clubhead velocity; and b) if these measures could distinguish low-handicap (LHG) and high-handicap (HHG) golfers. Ten LHG (handicap of 0.3 +/- 0.5) and 10 HHG (handicap of 20.3 +/- 2.4) performed 10 swings for maximum velocity and accuracy with their own 5-iron golf club at a wall-mounted target. LHG hit the target significantly more (115%) and had a 12% faster clubhead velocity than HHG (p bench press strength and longer (5%) upper am and total arm (4%) length and less (24%) right hip internal rotation than HHG (0.01 velocity (p bench press and hack squat strength as well as upper arm and total arm length also approaching significance (0.01 bench press strength and longer arms may therefore be at a competitive advantage, as these characteristics allow the production of greater clubhead velocity and resulting ball displacement. Such results have implications for golf talent identification programs and for the prescription and monitoring of golf conditioning programs. While golf conditioning programs may have many aims, specific trunk rotation exercises need to be included if increased clubhead velocity is the goal. Muscular hypertrophy development may not need to be emphasized as it could reduce golf performance by limiting range of motion and/or increasing moment of inertia.

  14. Dental treatment for handicapped patients: sedation vs general anesthesia and update of dental treatment in patients with different diseases

    OpenAIRE

    Corcuera Flores, José Ramón; Delgado Muñoz, José María; Ruiz Villandiego, José Cruz; Maura Solivellas, Isabel; Machuca Portillo, Guillermo

    2014-01-01

    Dental treatment on Handicapped Patients is often difficult because many people with a wide range of ages (from children to the elderly) with different pathologies that can affect the oral cavity and differ widely are included in this group. This situation creates some controversy, because according to pathology, each patient will be treated differently depending on collaboration, general health status, age or medication used to treat this pathologies. According to this situation we can opt f...

  15. Indexes to Volume 75

    Indian Academy of Sciences (India)

    SUBJECT INDEX. Mathematical .... A 10-Hz terawatt class Ti:sapphire laser system: Development and ... Indigenous development of a 2 kW RF-excited fast axial flow CO2 .... Polarized spectral features of human breast tissues through wavelet.

  16. Glycemic index and diabetes

    Science.gov (United States)

    ... Most snack foods Potatoes White rice Watermelon Meal Planning with the Glycemic Index When planning your meals: ... urac.org). URAC's accreditation program is an independent audit to verify that A.D.A.M. follows ...

  17. TOMS Absorbing Aerosol Index

    Data.gov (United States)

    Washington University St Louis — TOMS_AI_G is an aerosol related dataset derived from the Total Ozone Monitoring Satellite (TOMS) Sensor. The TOMS aerosol index arises from absorbing aerosols such...

  18. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 1034 ... Vol 49, No 2 (2007), African Index Medicus: Improving access to African ... insulin therapy initiation among patients with type 2 diabetes attending a ... Risk Factors Implicated in Diabetic Ketoacidosis (DKA), Abstract PDF.

  19. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 194 ... Journal Home > Advanced Search > Browse Title Index ... Vol 14, No 1 (2000), A functional categoriality of adjectives in ... Vol 1, No 1 (1987), Alienation and affirmation: The humanistic vision of Bessie Head, Abstract PDF.

  20. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 879 ... South African Journal of Higher Education. ... Browse Title Index ... in a USA school setting: Merging transition theory with a narrative approach, Abstract ... Citation analysis of theses and dissertations submitted at the ...

  1. Browse Title Index

    African Journals Online (AJOL)

    Items 601 - 650 of 879 ... South African Journal of Higher Education. ... Browse Title Index .... The challenge of thesis supervision in an art university, Abstract ... No 2 (2004), Robert Sternberg's mental self-government theory and its contribution to ...

  2. Palmer Drought Severity Index

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — PDSI from the Dai dataset. The Palmer Drought Severity Index (PDSI) is devised by Palmer (1965) to represent the severity of dry and wet spells over the U.S. based...

  3. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 346 ... Journal Home > Advanced Search > Browse Title Index ... and hygiene promotion services in Rungwe district, Tanzania, Abstract .... as seen in NIgerian teaching hospital: pattern and a simple classification, Abstract.

  4. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 437 ... Journal Home > Advanced Search > Browse Title Index ... prospects and realistic strategies to its implementation in Nigeria\\'s Institute of ... and Communication Technology (ICT) in information dissemination, Abstract.

  5. Browse Title Index

    African Journals Online (AJOL)

    Items 901 - 950 of 1355 ... Journal of Applied Sciences and Environmental Management. ... Journal Home > Advanced Search > Browse Title Index .... Vol 22, No 2 (2018), Performance evaluation of a locally fabricated sawdust fired oven for ...

  6. Browse Title Index

    African Journals Online (AJOL)

    Items 301 - 350 of 788 ... Journal Home > Advanced Search > Browse Title Index ... Vol 26, No 1 (2018), Gender differentials in the perception of .... Vol 25, No 1 (2017), Impact of total quality management on students' academic performance in ...

  7. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 465 ... Journal Home > Advanced Search > Browse Title Index ... and twinning data of an igbo kindred during the Nigerian Civil War, Abstract ... on laboratory estimations with special reference to clinical chemistry, Abstract.

  8. National Death Index

    Data.gov (United States)

    U.S. Department of Health & Human Services — The National Death Index (NDI) is a centralized database of death record information on file in state vital statistics offices. Working with these state offices, the...

  9. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 300 of 1260 ... Journal Home > Advanced Search > Browse Title Index ... Consumption of ammonia-nitrogen by aob in immobilized batch culture, Abstract PDF .... Vol 9, No 3S (2017): Special Issue, Design an automatic temperature ...

  10. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 294 ... Journal Home > Advanced Search > Browse Title Index. Log in or .... S Edwards, M Hlongwane, J Thwala, N Robinson ... Vol 16, No 1 (2017), Infancy of internet cafe: The substitute of ubuntu-padare pedagogy, Abstract.

  11. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 130 ... Journal Home > Advanced Search > Browse Title Index. Log in or ... using the technological pedagogical content knowledge(TPACK) framework, Abstract PDF ... Tamara N. Hrin, Dušica D. Milenković, Mirjana D. Segedinac.

  12. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 278 ... Journal Home > Advanced Search > Browse Title Index ... drie paradigmas beskou: 'n eenheid, of 'n veelheid van perspektiewe? ... Vol 45, No 1 (2011), Genre pedagogy in the mediation of socially-situated literacies ...

  13. Browse Title Index

    African Journals Online (AJOL)

    Items 551 - 600 of 879 ... Journal Home > Advanced Search > Browse Title Index ... A James, E Ralfe, L van Laren, N Ngcobo ... 1 (2011), Recognition of prior learning in promoting lifelong learning: A pedagogy of hope or a shattering of dreams?

  14. Browse Title Index

    African Journals Online (AJOL)

    Items 451 - 500 of 533 ... Journal Home > Advanced Search > Browse Title Index .... for past tense forms in Northern Sotho: verb stems with final 'm' and 'n', Abstract ... in an academic writing class: Implications for a dialogic pedagogy, Abstract.

  15. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 183 ... Journal Home > Advanced Search > Browse Title Index ... Vol 61 (2017), New interventions and sustainable solutions: .... Vol 35 (2011), Resurgence of tribal levies: Double taxation for the rural poor, Abstract PDF.

  16. Regional Snowfall Index (RSI)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NOAA's National Climatic Data Center is now producing the Regional Snowfall Index (RSI) for significant snowstorms that impact the eastern two thirds of the U.S. The...

  17. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 736 ... Journal Home > Advanced Search > Browse Title Index ... Vol 5 (2008), A Contagious Malady: The Human Quest for Truth through Religion, Abstract ... A Study of Politeness Strategies Used by the National University of ...

  18. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 414 ... Journal Home > Advanced Search > Browse Title Index. Log in or ... of an algebraic function for the permutation of truth table columns, Abstract ... appraisal and productivity levels in selected Nigerian universities, Abstract.

  19. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 879 ... Journal Home > Advanced Search > Browse Title Index ... Vol 20, No 4 (2006), Assessing academic potential for university admission: ... Vol 16, No 2 (2002), Book Review: Rethinking truth by Higgs, P & Smith, J, Details.

  20. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 165 ... Journal Home > Advanced Search > Browse Title Index ... Vol 43 (2011), Assessment of the Learning Commons takeoff at the University of ... the archive of South Africa's Truth and Reconciliation Commission, Abstract.

  1. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 644 ... Journal Home > Advanced Search > Browse Title Index. Log in or ... Ethics review n international health research: quality assurance or bureaucratic nightmare? Details ... Audit of Management of Open Fractures, Details PDF.

  2. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 449 ... Vol 1, No 3 (2012), Adult Functional Literacy Curriculum: Effective Strategy for Human ... and Exchange Rate Influence on the Nigerian Stock Market Index ... for the Stimulation and Attraction of Foreign Direct Investments ...

  3. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 98 ... Journal Home > Advanced Search > Browse Title Index ... model for the continued professionalisation of student affairs in Africa, Abstract PDF ... Vol 2, No 2 (2014), Book Review: How College Affects Students, A Third decade ...

  4. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 76 ... Journal Home > Advanced Search > Browse Title Index ... Vol 4, No 1 (2011), Automation of AutoCAD for Detailing of Reinforced .... Vol 10, No 1 (2017), Housing data base for sustainable housing provision, Abstract PDF.

  5. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 147 ... Journal Home > Advanced Search > Browse Title Index .... Library (TEEAL) Database among faculty members in Federal University, ... Vol 5, No 2 (2014), Effects of corporate culture on the implementation of automation in ...

  6. Browse Title Index

    African Journals Online (AJOL)

    Items 851 - 900 of 1255 ... Vol 16, No 4 (2010), Origin and generation mechanisms of ... Vol 13, No 4 (2007), Osmotic fragility index of HBAA red blood cells in the presence of ... (2004), Photovoltaic cells, efficiency and optimization, Abstract PDF.

  7. Browse Title Index

    African Journals Online (AJOL)

    Items 401 - 450 of 985 ... Vol 17 (2010), Flood Frequency Analysis of Ikpoba River ... and the corresponding Refractive Index in Uniaxial Crystals, Abstract ... Vol 8 (2004), Further on stokes expansions for the finite amplitude water waves, Abstract.

  8. Transportation Services Index

    Data.gov (United States)

    Department of Transportation — The TSI is a monthly measure of the volume of services performed by the for-hire transportation sector. The index covers the activities of for-hire freight carriers,...

  9. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 250 of 531 ... Journal Home > Advanced Search > Browse Title Index ... thermal conductivity and viscosity in a flat plate solar collector, Abstract PDF .... similarity method in unsteady two-dimensional MHD boundary layer on the body ...

  10. [Transcultural adaptation of an instrument to evaluate hearing handicap in workers with noise-induced hearing loss].

    Science.gov (United States)

    Holanda, Wanessa Tenório Gonçalves; de Lima, Maria Luiza Carvalho; Figueiroa, José Natal

    2011-01-01

    The noise-induced hearing loss (NIHL) is a chronic and irreversible disease resulting of the exposure to noise in high levels at work. Even in the beginning, this hearing loss can damage in many degrees the worker's quality of life. Before this study, there wasn't an instrument, in Portuguese, to evaluate the psychosocial disadvantages of workers with NIHL. The aim of this research was to make a transcultural adaptation of an especific instrument to evaluate the hearing handicap from the original language to Portuguese, and check the reliability and legitimacy. The selected instrument passed by a process of semantic equivalence that was conducted in five stages: translation, back translation, critical appraisal of the versions, pre-test and a final review by a multi-professional group to develop a consensual version of the instrument for current use in Brazil. The instrument called "Inabilities Scale and Hearing Handicap" had, in general, acceptable psychometric measures, considering the little size of the sample and the fact that workers' hearing loss weren't too significant. Therefore, the Portuguese version of this instrument needs to be further tested in a representative sample of Brazilian workers with NIHL to ratify its utility in order to evaluate hearing handicap in this population.

  11. The effect of spiritual intelligence instruction on the increasing spiritual intelligence and two components in Maybod adult physical handicaps

    Directory of Open Access Journals (Sweden)

    L Movahedi

    2017-01-01

    Full Text Available Abstract The purpose of this research was the effect of spiritual intelligence instruction on increasing spiritual intelligence’s Maybod adult handicaps in 2014. 28 female and male (7 men and 21 women adult handicaps participated in this research which was as done pretest quasi – experimental – intervention studing with control group. These people were chosen as purposeful sampling and set in two experimental and control group in equal numbers. After fulfilling pretest, two group were compared by T test and after ensuring of absence of significant difference between two group, In ten session (90 minutes, the experimental group were been taught spiritual intelligence and the control group didn’t have any teaching. Befor and after session, these two groups were been complete Abdollahzade spiritual intelligence test. The analysis of data did on one way covariance statistical analysis. The results showed the experimental group got significantly high scores in regard to control group of general spiritual intelligence, the underestsnding of the relation to universe sourceand spiritual life in emphasis of internal core. Regarding to findings, it results the spiritual intelligence instruction can on increase spiritual intelligence of handicaps.

  12. Revisiting play elements and self-handicapping in play: a comparative ethogram of five Old World monkey species.

    Science.gov (United States)

    Petrů, Milada; Spinka, Marek; Charvátová, Veronika; Lhota, Stanislav

    2009-08-01

    Play behavior has been viewed as a mixture of elements drawn from "serious" behavior, interspersed by ritualized play signals. Two other types of play behaviors have been overlooked: patterns that are dissimilar from any serious behavior and patterns with self-handicapping character, that is, those that put the animal into unnecessary disadvantageous positions or situations. Here the authors show that these 2 types of patterns can constitute a major part of play repertoire. From our own videorecordings and observations, we constructed play ethograms of 5 monkey species (Semnopithecus entellus, Erythrocebus patas, Chlorocebus pygerythrus, Cercopithecus neglectus, and Cercopithecus diana). The authors evaluated the self-handicapping character of each pattern and in Hanuman langurs also the (dis)similarity to serious behavior. Of the 74 patterns in the 5 species, 33 (45%) were judged to have a self-handicapping character. Of 48 patterns observed in langurs, 16 (33%) were totally dissimilar to any serious langur behavior known to us. The authors discuss the possibility that the different types of play elements may have different functions in play. Copyright 2009 APA, all rights reserved.

  13. Testing a model of antecedents and consequences of defensive pessimism and self-handicapping in school physical education.

    Science.gov (United States)

    Ntoumanis, Nikos; Taylor, Ian M; Standage, Martyn

    2010-12-01

    There has been very limited research on the use of self-worth protection strategies in the achievement context of school physical education (PE). Thus the aim of the present study was to examine some antecedents and consequences of defensive pessimism and self-handicapping. The sample comprised 534 British pupils (275 females, 259 males) recruited from two schools who responded to established questionnaires. Results of structural equation modelling analysis indicated that self-handicapping and defensive pessimism were positively predicted by fear of failure and negatively predicted by competence valuation. In addition, defensive pessimism was negatively predicted by physical self-concept. In turn, defensive pessimism negatively predicted enjoyment in PE and intentions to participate in future optional PE programmes. Self-handicapping did not predict enjoyment or intentions. Results from multi-sample structural equation modelling showed the specified model to be largely invariant across males and females. The findings indicate that although both strategies aim to protect one's self-worth, some of their antecedents and consequences in PE may differ.

  14. Lattice Index Coding

    OpenAIRE

    Natarajan, Lakshmi; Hong, Yi; Viterbo, Emanuele

    2014-01-01

    The index coding problem involves a sender with K messages to be transmitted across a broadcast channel, and a set of receivers each of which demands a subset of the K messages while having prior knowledge of a different subset as side information. We consider the specific case of noisy index coding where the broadcast channel is Gaussian and every receiver demands all the messages from the source. Instances of this communication problem arise in wireless relay networks, sensor networks, and ...

  15. The Influence of Sleep Disorders on Voice Quality.

    Science.gov (United States)

    Rocha, Bruna Rainho; Behlau, Mara

    2017-09-19

    To verify the influence of sleep quality on the voice. Descriptive and analytical cross-sectional study. Data were collected by an online or printed survey divided in three parts: (1) demographic data and vocal health aspects; (2) self-assessment of sleep and vocal quality, and the influence that sleep has on voice; and (3) sleep and voice self-assessment inventories-the Epworth Sleepiness Scale (ESS), the Pittsburgh Sleep Quality Index (PSQI), and the Voice Handicap Index reduced version (VHI-10). A total of 862 people were included (493 women, 369 men), with a mean age of 32 years old (maximum age of 79 and minimum age of 18 years old). The perception of the influence that sleep has on voice showed a difference (P influence a voice handicap are vocal self-assessment, ESS total score, and self-assessment of the influence that sleep has on voice. The absence of daytime sleepiness is a protective factor (odds ratio [OR] > 1) against perceived voice handicap; the presence of daytime sleepiness is a damaging factor (OR influences voice. Perceived poor sleep quality is related to perceived poor vocal quality. Individuals with a voice handicap observe a greater influence of sleep on voice than those without. Copyright © 2017 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  16. Investigating the feasibility of a BCI-driven robot-based writing agent for handicapped individuals

    Science.gov (United States)

    Syan, Chanan S.; Harnarinesingh, Randy E. S.; Beharry, Rishi

    2014-07-01

    Brain-Computer Interfaces (BCIs) predominantly employ output actuators such as virtual keyboards and wheelchair controllers to enable handicapped individuals to interact and communicate with their environment. However, BCI-based assistive technologies are limited in their application. There is minimal research geared towards granting disabled individuals the ability to communicate using written words. This is a drawback because involving a human attendant in writing tasks can entail a breach of personal privacy where the task entails sensitive and private information such as banking matters. BCI-driven robot-based writing however can provide a safeguard for user privacy where it is required. This study investigated the feasibility of a BCI-driven writing agent using the 3 degree-of- freedom Phantom Omnibot. A full alphanumerical English character set was developed and validated using a teach pendant program in MATLAB. The Omnibot was subsequently interfaced to a P300-based BCI. Three subjects utilised the BCI in the online context to communicate words to the writing robot over a Local Area Network (LAN). The average online letter-wise classification accuracy was 91.43%. The writing agent legibly constructed the communicated letters with minor errors in trajectory execution. The developed system therefore provided a feasible platform for BCI-based writing.

  17. A study on CT findings and electroencephalographic findings in severely handicapped children

    International Nuclear Information System (INIS)

    Nakashima, Masao; Nishimura, Masaaki; Kachi, Shozo; Sugimoto, Kimiyuki; Saito, Msahiko; Yamada, Shigeaki; Kameyama, Yoshio; Tanaka, Minoru; Hiraizumi, Yasuhisa.

    1987-01-01

    Sleep electroencephalographic (EEG) and computed tomographic (CT) features were examined in 40 institutionalized severely handicapped persons. Cranial CT appearance fell into five major types: (I) no abnormal findings (n=2), (II) generalized brain atrophy (n=16), (III) diffuse parenchymal disturbance (n=10), (IV) brain malformation (n=4), and (V) localized brain disturbance (n=8). In the I group, one person had normal EEG findings as well, but another person had the presence of focal spikes without spindles on EEG. Five of the II group had no abnormal EEG findings; ten had abnormality in basic waves and/or localized paroxysmal waves; and one had generalized spike-and-slow wave complex. All persons in the III group had flattening or disappearance of spindle waves. In the IV group, two persons with cerebral malformation and one with linear nevus sebaceous syndrome in association with hypoplasia of the cerebral hemisphere had abnormality in basic waves and localized paroxysmal waves. In the remaining one person with deficit of vermis cerebelli, there was no EEG abnormality. Among the last group of persons, there was no EEG abnormality corresponding to CT features. (Namekawa, K)

  18. Why electric utilities and affiliates are handicapped in a partly regulated and partly competitive environment

    Energy Technology Data Exchange (ETDEWEB)

    St.Marie, S.M.

    1999-11-01

    As the electric utility industry continues to go through the process of restructuring, utilities are finding themselves operating not only as regulated entities but also as firms that compete for customers and sales. Some services, including services associated with distribution, are being unbundled or peeled off from the core of operations and, where possible, are being opened to competition. But these partly regulated and partly competitive areas are treacherous for utilities and their affiliates, who will be handicapped in their competitive efforts and subject to constraints not placed on their competitors. There are good reasons why such difficulties should be expected. And there are guidelines for pricing and competitive positioning that can assist in avoiding the worst problems. The first step is to recognize the archetypes of the regulated electric distribution utility and the competitive firm. In plotting their deregulation strategies, utilities and their affiliates must recognize that they will continue to be disadvantaged by regulators who are more concerned with keeping them in check than freeing them to compete.

  19. Investigating the feasibility of a BCI-driven robot-based writing agent for handicapped individuals

    International Nuclear Information System (INIS)

    Syan, Chanan S; Harnarinesingh, Randy E S; Beharry, Rishi

    2014-01-01

    Brain-Computer Interfaces (BCIs) predominantly employ output actuators such as virtual keyboards and wheelchair controllers to enable handicapped individuals to interact and communicate with their environment. However, BCI-based assistive technologies are limited in their application. There is minimal research geared towards granting disabled individuals the ability to communicate using written words. This is a drawback because involving a human attendant in writing tasks can entail a breach of personal privacy where the task entails sensitive and private information such as banking matters. BCI-driven robot-based writing however can provide a safeguard for user privacy where it is required. This study investigated the feasibility of a BCI-driven writing agent using the 3 degree-of- freedom Phantom Omnibot. A full alphanumerical English character set was developed and validated using a teach pendant program in MATLAB. The Omnibot was subsequently interfaced to a P300-based BCI. Three subjects utilised the BCI in the online context to communicate words to the writing robot over a Local Area Network (LAN). The average online letter-wise classification accuracy was 91.43%. The writing agent legibly constructed the communicated letters with minor errors in trajectory execution. The developed system therefore provided a feasible platform for BCI-based writing

  20. French-Canadian translation and validation of four questionnaires assessing hearing impairment and handicap.

    Science.gov (United States)

    Vincent, Claude; Gagné, Jean-Pierre; Leroux, Tony; Clothier, Audrey; Larivière, Marianne; Dumont, Frédéric S; Gendron, Martine

    2017-04-01

    Questionnaires evaluating hearing impairment are available in English but there is a need for French standardised questionnaires for researchers as well as for audiologists and other clinicians. The objective of this study is to describe the translation and validation of four questionnaires that assess different aspects of hearing impairment and handicap among elders with hearing loss, by comparing the main score and psychometric evaluation of original and French-Canadian (FC) versions of the World Health Organization Disability Assessment Scale II (WHO-DAS II), the Screening Test for Hearing Problems (STHP), the Abbreviated Profile of Hearing Aid Benefit (APHAB) and the Measure of Audiologic Rehabilitation Self-Efficacy for Hearing Aids (MARS-HA). Vallerand method: translation and back-translation by two translators, revision by a committee of experts and pre-tested with five bilingual older participants. Participants (n = 29) were 65 years of age or older including 21 with hearing aids. The psychometric properties (internal consistency, temporal stability after four weeks) indicate good reliability for most of the translated questionnaires and their subscales, especially the WHO-DAS II. The translations in FC of two hearing loss and two hearing aid questionnaires were validated. It is recommended to pursue the demonstration for temporal stability for the STHP.

  1. Why electric utilities and affiliates are handicapped in a partly regulated and partly competitive environment

    International Nuclear Information System (INIS)

    St Marie, S.M.

    1999-01-01

    As the electric utility industry continues to go through the process of restructuring, utilities are finding themselves operating not only as regulated entities but also as firms that compete for customers and sales. Some services, including services associated with distribution, are being unbundled or peeled off from the core of operations and, where possible, are being opened to competition. But these partly regulated and partly competitive areas are treacherous for utilities and their affiliates, who will be handicapped in their competitive efforts and subject to constraints not placed on their competitors. There are good reasons why such difficulties should be expected. And there are guidelines for pricing and competitive positioning that can assist in avoiding the worst problems. The first step is to recognize the archetypes of the regulated electric distribution utility and the competitive firm. In plotting their deregulation strategies, utilities and their affiliates must recognize that they will continue to be disadvantaged by regulators who are more concerned with keeping them in check than freeing them to compete

  2. Emancipation trough the Artistic Experience and the Meaning of Handicap as Instance of Otherness

    Directory of Open Access Journals (Sweden)

    Robi Kroflič

    2014-03-01

    Full Text Available The key hypothesis of the article is that successful inter-mediation of art to vulnerable groups of people (including children depends on the correct identification of the nature of an artistic act and on the meaning that handicap—as an instance of otherness—has in the life of artists and spectators. A just access to the artistic experience is basically not the question of the distribution of artistic production (since if artistic object is principally accessible to all people, it will not reach vulnerable groups of spectators, but of ensuring artistic creativity and presentation. This presupposes a spectator as a competent being who is able to interact with the artistic object without our interpretative explanation and who is sensible to the instance of otherness (handicap is merely a specific form of otherness. The theory of emancipation from J. Ranciere, the theory of recognition from A. Honneth, and the theory of narration from P. Ricoeur and R. Kearney, as well as our experiences with a comprehensive inductive approach and artistic experience as one of its basic educational methods offer us a theoretical framework for such a model of art inter-mediation.

  3. Oral health profile of education and health professionals attending handicapped children

    Directory of Open Access Journals (Sweden)

    Pomarico Luciana

    2003-01-01

    Full Text Available The purpose of this study was to evaluate the knowledge and attitudes toward oral health of education and health professionals working in a children care program for handicapped children from 0 to 6 years of age, run by a public municipal institution in Rio de Janeiro. Using a printed questionnaire, 67 professionals (teachers, attendants and health professionals were interviewed. The results were compared to the children's oral hygiene habits, by directly observing their daily nursery routine. Although 97.0% said that oral health could play a part in general health, only 37.3% of the professionals answered correctly on this matter. As for methods for preventing caries, although 92.5% said that they were aware of them, only 17.9% went to the dentist for preventive treatment. Although the majority (81.3% indicated oral hygiene as a way of preventing caries, observation showed that this practice is not always put into effect in the program's day nursery. Regarding when to start toothbrushing in children, 75.0% of the teachers and 94.4% of the health professionals said that they were aware of the need to begin brushing before one year of age, although this reply was given by only 52.5% of the attendants (chi-square, p = 0.006. In view of these results, it was concluded that attitudes toward oral health were not always coherent with the knowledge that these professionals express.

  4. Design and evaluation of nonverbal sound-based input for those with motor handicapped.

    Science.gov (United States)

    Punyabukkana, Proadpran; Chanjaradwichai, Supadaech; Suchato, Atiwong

    2013-03-01

    Most personal computing interfaces rely on the users' ability to use their hand and arm movements to interact with on-screen graphical widgets via mainstream devices, including keyboards and mice. Without proper assistive devices, this style of input poses difficulties for motor-handicapped users. We propose a sound-based input scheme enabling users to operate Windows' Graphical User Interface by producing hums and fricatives through regular microphones. Hierarchically arranged menus are utilized so that only minimal numbers of different actions are required at a time. The proposed scheme was found to be accurate and capable of responding promptly compared to other sound-based schemes. Being able to select from multiple item-selecting modes helps reducing the average time duration needed for completing tasks in the test scenarios almost by half the time needed when the tasks were performed solely through cursor movements. Still, improvements on facilitating users to select the most appropriate modes for desired tasks should improve the overall usability of the proposed scheme.

  5. Sustainability index for Taipei

    International Nuclear Information System (INIS)

    Lee, Y.-J.; Huang Chingming

    2007-01-01

    Sustainability indicators are an effective means of determining whether a city is moving towards sustainable development (SD). After considering the characteristics of Taipei, Taiwan, discussions with experts, scholars and government departments and an exhaustive literature review, this study selected 51 sustainability indicators corresponding to the socio-economic characteristic of Taipei City. Such indicators should be regarded as a basis for assessing SD in Taipei City. The 51 indicators are classified into economic, social, environmental and institutional dimensions. Furthermore, statistical data is adopted to identify the trend of SD from 1994 to 2004. Moreover, the sustainability index is calculated for the four dimensions and for Taipei as a whole. Analysis results demonstrate that social and environmental indicators are moving towards SD, while economic and institutional dimensions are performing relatively poorly. However, since 2002, the economic sustainability index has gradually moved towards SD. Overall, the Taipei sustainability index indicates a gradual trend towards sustainable development during the past 11 years

  6. Calculate Your Body Mass Index

    Science.gov (United States)

    ... Can! ) Health Professional Resources Calculate Your Body Mass Index Body mass index (BMI) is a measure of body fat based ... Health Information Email Alerts Jobs and Careers Site Index About NHLBI National Institute of Health Department of ...

  7. The Cognitive Mobilization Index

    Directory of Open Access Journals (Sweden)

    Antonio Alaminos

    2012-01-01

    Full Text Available This article shows how the cognitive mobilization index, designed for use in observing potential political participation, can be used as an indicator of the political climate that a particular society is going through. Following a discussion of the theoretical elaborations (and their working definitions of the concept of cognitive mobilization, a longitudinal study of various European countries is used to consider the question of how political crises influence cognitive mobilization indexes and what effects they have on the political socialization process among the youngest cohorts.

  8. ParkIndex

    DEFF Research Database (Denmark)

    Kaczynski, Andrew T; Schipperijn, Jasper; Hipp, J Aaron

    2016-01-01

    using ArcGIS 9.3 and the Community Park Audit Tool. Four park summary variables - distance to nearest park, and the number of parks, amount of park space, and average park quality index within 1 mile were analyzed in relation to park use using logistic regression. Coefficients for significant park......, planners, and citizens to evaluate the potential for park use for a given area. Data used for developing ParkIndex were collected in 2010 in Kansas City, Missouri (KCMO). Adult study participants (n=891) reported whether they used a park within the past month, and all parks in KCMO were mapped and audited...

  9. Difference in peak weight transfer and timing based on golf handicap.

    Science.gov (United States)

    Queen, Robin M; Butler, Robert J; Dai, Boyi; Barnes, C Lowry

    2013-09-01

    Weight shift during the golf swing has been a topic of discussion among golf professionals; however, it is still unclear how weight shift varies in golfers of different performance levels. The main purpose of this study was to examine the following: (a) the changes in the peak ground reaction forces (GRF) and the timing of these events between high (HHCP) and low handicap (LHCP) golfers and (b) the differences between the leading and trailing legs. Twenty-eight male golfers were recruited and divided based on having an LHCP 9. Three-dimensional GRF peaks and the timing of the peaks were recorded bilaterally during a golf swing. The golf swing was divided into different phases: (a) address to the top of the backswing, (b) top of the backswing to ball contact, and (c) ball contact to the end of follow through. Repeated measures analyses of variance (α = 0.05) were completed for each study variable: the magnitude and the timing of peak vertical GRF, peak lateral GRF, and peak medial GRF (α = 0.05). The LHCP group had a greater transfer of vertical force from the trailing foot to the leading foot in phase 2 than the HHCP group. The LHCP group also demonstrated earlier timing of peak vertical force throughout the golf swing than the HHCP group. The LHCP and HHCP groups demonstrated different magnitudes of peak lateral force. The LHCP group had an earlier timing of peak lateral GRF in phase 2 and earlier timing of peak medial GRF in phases 1 and 2 than the HHCP group. In general, LHCP golfers demonstrated greater and earlier force generation than HHCP golfers. It may be relevant to consider both the magnitude of the forces and the timing of these events during golf-specific training to improve performance. These data reveal weight shifting differences that can be addressed by teaching professionals to help their students better understand weight transfer during the golf swing to optimize performance.

  10. [Relevance of a driving simulator in the assessment of handicapped individuals].

    Science.gov (United States)

    Carroz, A; Comte, P-A; Nicolo, D; Dériaz, O; Vuadens, P

    2008-06-01

    To evaluate the value of our driving simulator in deciding whether or not to allow patients with physical and/or cognitive deficits to resuming driving and to analyze whether or not the medical expert's final decision is based more on the results of the driving simulator than those of the neuropsychological examination. One hundred and twenty-three patients were evaluated with the driving simulator. Thirty-five of those with cognitive deficits also underwent a neuropsychological examination prior to the medical expert's decision on driving aptitude. In cases of uncertainty or disagreement, a driving assessment in real conditions was performed by a driving instructor. In cases of physical handicap, the medical expert's decision concurred with that of the occupational therapist. For brain-injured patients, there was a significant correlation between the neuropsychologist's opinion and that of the occupational therapist (kappa=0.33; P=0.01). However, the sensibility and specificity were only 55 and 80%, respectively. The correlation between an occupational therapy decision based on the driving simulator and that of the medical expert was very significant (kappa=0.81; Psensibility and specificity were 84 and 100%, respectively. In contrast, these values were lower (63 and 71%, respectively) for the correlation between the neuropsychologist's opinion and that of the medical expert. Our driving simulator enables the danger-free evaluation of driving aptitude. The results mirror an in situ assessment and are more sensitive than neuropsychological examination. In fact, the neuropsychologist's opinion often is more negative or uncertain with respect to the patient's real driving aptitude. When taking a decision on a patient's driving aptitude, the medical expert is more inclined to trust the results of the driving simulator.

  11. 2005 Environmental Sustainability Index (ESI)

    Data.gov (United States)

    National Aeronautics and Space Administration — The 2005 Environmental Sustainability Index (ESI) is a measure of overall progress towards environmental sustainability, developed for 146 countries. The index...

  12. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 391 ... Journal Home > Advanced Search > Browse Title Index ... Efficacy of four Rodenticides on the Ghanaian Market, Abstract ... Vol 2, No 1 (2000):, Determination of some wear elements in used car engine oil and oil filter ...

  13. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 46 of 46 ... Vol 4, No 1 (2015), Fiscal Federalism and Development In Nigeria, Abstract. Dorcas Akhere Odigwe, Stanley Aibieyi. Vol 1, No 1 (2011), Good Governance Analysing Performance of Economic Community of West African States and Southern African Development Community Members on Mo Ibrahim Index ...

  14. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 73 of 73 ... Journal Home > Advanced Search > Browse Title Index ... Vol 13 (2006), The ageing eye” functional changes from cradle to gray: A ... Vol 12 (2005), The evaluation of vision in children using monocular vision acuity and ...

  15. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 224 of 224 ... Vol 13, No 2 (2010), Spatial Analysis of Particle Size Distribution of Soils Formed on ... swelling index and moisture content of white and yellow garri in ... and Composition of Milk of West African Dwarf (Wad) Sheep Fed ...

  16. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 229 ... Browse Title Index ... Issue, Title. Vol 14, No 2 ... Vol 15, No 1 (2017), Qualitative and quantitative methods of suicide research in old age, Abstract PDF ... Vol 11, No 2 (2013), Simple Algorithm in the Management of Fetal ...

  17. Nitrate leaching index

    Science.gov (United States)

    The Nitrate Leaching Index is a rapid assessment tool that evaluates nitrate (NO3) leaching potential based on basic soil and climate information. It is the basis for many nutrient management planning efforts, but it has considerable limitations because of : 1) an oversimplification of the processes...

  18. Data Citation Index

    Directory of Open Access Journals (Sweden)

    Laura L. Pavlech

    2016-01-01

    Full Text Available Introduced by Thomson Reuters in 2012 as a, ‘‘Single point of access to quality research data from repositories across disciplines and around the world’’ [1], the Data Citation Index (DCI is a searchable collection of data sets and data studies from a select list of repositories.

  19. Indexing Moving Points

    DEFF Research Database (Denmark)

    Agarwal, Pankaj K.; Arge, Lars Allan; Erickson, Jeff

    2003-01-01

    We propose three indexing schemes for storing a set S of N points in the plane, each moving along a linear trajectory, so that any query of the following form can be answered quickly: Given a rectangle R and a real value t, report all K points of S that lie inside R at time t. We first present an...

  20. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 1215 ... Journal Home > Advanced Search > Browse Title Index. Log in or ... Vol 12, No 1 (2018), Analysis of the effects of frequent strikes on academic performance of students in universities in Nigeria: Edo State as a focal point, Abstract PDF ... Vol 6, No 1 (2012), Appraisal as a Determinant for Adequate ...