WorldWideScience

Sample records for handicap index vhi

  1. Voice Handicap Index (VHI in Persian Speaking Parkinson\\'s Disease Patients

    Directory of Open Access Journals (Sweden)

    Fatemeh Madjdinasab

    2014-04-01

    Full Text Available Objectives: “Voice” is affected more and sooner than other speech subsystems in Parkinson's Disease (PD. Voice Handicap Index (VHI is the most applicable subjective self-rating questionnaire in VD patients. The aim of this study was the investigation of Voice handicap in Iranian PD patients. Methods & Materials: This cross-sectional, analytical and non-interventional study was done on 50 (35 males, 15 females patients who reported a VD related to their PD. They were selected from thepatients referring to movement disorders’ clinic in Rasool Akram Hospital affiliated withTehran University of medical sciences, through easy sampling. VHI total score (VHIT and its domains (functional-VHIF, Emotional VHIE, Physical VHIP was assessed in all of participants and by gender segregation. Results: 83% of patients reported voice handicap. There wasn't any difference between VHIT and its mentioned 3 domains in both sexes. There is positive correlation between VHIT, VHIE and VHIF with age. VHIT and VHIF had a positive relationship with disease duration (DD. The males VHIT and the mentioned domains had positive correlations with DD. Conclusion: Most of Iranian PD patients feel handicap due to voice disorder caused by PD and their quality of life was affected by voice impairment. Increase in age and disease duration caused more voice disorder and reduced quality of life especially patients feel more handicaps in functional domain (VHIF. In addition, the males feel more handicap than females when DD develops.

  2. Correlation of the Voice Handicap Index-10 (VHI-10) and Voice-Related Quality of Life (V-RQOL) in patients with dysphonia.

    Science.gov (United States)

    Romak, Jonathan J; Orbelo, Diana M; Maragos, Nicolas E; Ekbom, Dale C

    2014-03-01

    This study examines the correlation between two voice-specific patient-reported outcome measures: the Voice Handicap Index-10 (VHI-10) and Voice-Related Quality of Life (V-RQOL). Retrospective chart review. Eight hundred four patients presenting to our voice clinic between May 2009 and August 2011. All patients completed the VHI-10 and V-RQOL in a single sitting. Correlation between the two scales was examined using Spearman rank analysis. Calculated VHI-10 score was derived from V-RQOL score by direct conversion equation and compared with measured VHI-10 score. Receiver Operating Characteristic (ROC) curves were derived for diagnostic groups. Spearman correlation coefficient between the VHI-10 and V-RQOL was -0.91 (P dysphonia (V-RQOL AUC = 0.536 [SE ± 0.026]; VHI-10 AUC = 0.508 [SE ± 0.26]; P = 0.018) groups, with the V-RQOL showing relatively greater sensitivity. The VHI-10 and V-RQOL are highly correlated. However, VHI-10 score cannot be calculated from V-RQOL score using the tested equation. The V-RQOL may be more sensitive than the VHI-10 in detecting the impact of presbyphonia and muscle tension dysphonia. Copyright © 2014 The Voice Foundation. Published by Mosby, Inc. All rights reserved.

  3. A comparison of the VHI, VHI-10, and V-RQOL for measuring the effect of botox therapy in adductor spasmodic dysphonia.

    Science.gov (United States)

    Morzaria, Sanjay; Damrose, Edward J

    2012-05-01

    Although disease-specific quality-of-life (QOL) instruments are an invaluable outcome measure in spasmodic dysphonia, there is no consensus on which QOL instrument should be used. To determine the responsiveness of the Voice Handicap Index (VHI), Voice Handicap Index-10 (VHI-10), and Voice-Related Quality of Life (V-RQOL) to the treatment effect of botulinum toxin (Botox) in adductor spasmodic dysphonia (ADSD). Stanford University Voice and Swallowing Center. Prospective case series (level of evidence=4). Consecutive ADSD patients with a stable Botox dose-response relationship were recruited prospectively. VHI, VHI-10, and V-RQOL scores were obtained pretreatment and during the middle third of the posttreatment injection cycle. Thrity-seven patients completed the follow-up. The average total Botox dose was 0.88 units. The average follow-up time after injection was 7.84 weeks. The pretreatment QOL scores reflected the burden of the disease. All the three instruments were highly correlated in subscale and total scores. After treatment, all three instruments showed significant improvement. The VHI, VHI-10, and V-RQOL all reflected the morbidity associated with ADSD and were significantly responsive to the effect of Botox therapy. The choice of instrument should be based on physician preference. Copyright © 2012 The Voice Foundation. Published by Mosby, Inc. All rights reserved.

  4. Aerodynamic findings and Voice Handicap Index in Parkinson's disease.

    Science.gov (United States)

    Motta, Sergio; Cesari, Ugo; Paternoster, Mariano; Motta, Giovanni; Orefice, Giuseppe

    2018-04-23

    To verify possible relations between vocal disability and aerodynamic measures in selected Parkinson's disease (PD) patients with low/moderate-grade dysphonia. Fifteen idiopathic dysphonic PD male patients were examined and compared with 15 euphonic subjects. Testing included the following measures: Voice Handicap Index (VHI), maximum phonation time (MPT), mean estimated subglottal pressure (MESGP), mean sound pressure level (MSPL), mean phonatory power (MPP), mean phonatory efficiency (MPE) and mean phonatory resistance (MPR). Statistical analysis showed: a significant reduction in MPR and MSPL in PD subjects compared to the healthy ones; a significant positive correlation between VHI score and MSPL, MPR, MPP, MESGP and a significant negative correlation between VHI and MTP within PD subjects. Test for multiple linear regression showed a significant correlation between VHI score, MPT, MPR and MSPL. A relationship between VHI and aerodynamic measures was shown in the present study. Compensatory mechanisms may aggravate vocal disability in PD subjects.

  5. [Voice disorders in female teachers assessed by Voice Handicap Index].

    Science.gov (United States)

    Niebudek-Bogusz, Ewa; Kuzańska, Anna; Woźnicka, Ewelina; Sliwińska-Kowalska, Mariola

    2007-01-01

    The aim of this study was to assess the application of Voice Handicap Index (VHI) in the diagnosis of occupational voice disorders in female teachers. The subjective assessment of voice by VHI was performed in fifty subjects with dysphonia diagnosed in laryngovideostroboscopic examination. The control group comprised 30 women whose jobs did not involve vocal effort. The results of the total VHI score and each of its subscales: functional, emotional and physical was significantly worse in the study group than in controls (p teachers estimated their own voice problems as a moderate disability, while 12% of them reported severe voice disability. However, all non-teachers assessed their voice problems as slight, their results ranged at the lowest level of VHI score. This study confirmed that VHI as a tool for self-assessment of voice can be a significant contribution to the diagnosis of occupational dysphonia.

  6. [Applicability of Voice Handicap Index to the evaluation of voice therapy effectiveness in teachers].

    Science.gov (United States)

    Niebudek-Bogusz, Ewa; Kuzańska, Anna; Błoch, Piotr; Domańska, Maja; Woźnicka, Ewelina; Politański, Piotr; Sliwińska-Kowalska, Mariola

    2007-01-01

    The aim of this study was to assess the applicability of Voice Handicap Index (VHI) to the evaluation of effectiveness of functional voice disorders treatment in teachers. The subjects were 45 female teachers with functional dysphonia who evaluated their voice problems according to the subjective VHI scale before and after phoniatric management. Group I (29 patients) were subjected to vocal training, whereas group II (16 patients) received only voice hygiene instructions. The results demonstrated that differences in the mean VHI score before and after phoniatric treatment were significantly higher in group 1 than in group II (p teacher's dysphonia.

  7. VHI-10 and SVHI-10 Differences in Singers' Self-perception of Dysphonia Severity.

    Science.gov (United States)

    Renk, Elizabeth; Sulica, Lucian; Grossman, Chad; Georges, Jenny; Murry, Thomas

    2017-05-01

    Previous investigations of the Voice Handicap Index (VHI)-10 in clinical practice noted that specific information relevant to singers was not forthcoming. Consequently, a second index, the Singing Voice Handicap Index (SVHI) as well as its shortened counterpart the SVHI-10, was developed. The purpose of this study was to directly compare the differences in scores between the VHI-10 and the SVHI-10 in a group of 50 singers. A retrospective chart review of 50 singers (26 women, 24 men) was performed between June 2014 and November 2014 at Weill Cornell Medical College, New York. Subjects completed both the VHI-10 and the SVHI-10 at their initial evaluation. The results from the VHI-10 and the SVHI-10 were then compared using paired t test and two-way analysis of variance. The SVHI-10 scores from the performers were significantly higher than those of the VHI-10 (P < 0.0001). The mean score on the VHI-10 was 12.1 compared with 20.4 on the SVHI-10 (maximum score for each questionnaire is 40). There were no significant gender differences when comparing the VHI-10 and the SVHI-10 on the overall scores or for individual items. The analysis of variance also found no significant gender difference (P = 0.865) and confirmed a significant difference between VHI-10 and SVHI-10 (P = 0.0003). Whereas singers may have general complaints about their voice, they also have specific complaints that relate only to their singing voice. Finding a significant difference between the scores of the VHI-10 and the SVHI-10 suggests the importance of assessing the singer's perception of voice severity using a tool that focuses on the singing voice. Copyright © 2017 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  8. Correlation between acoustic parameters and Voice Handicap Index in dysphonic teachers.

    Science.gov (United States)

    Niebudek-Bogusz, E; Woznicka, E; Zamyslowska-Szmytke, E; Sliwinska-Kowalska, M

    2010-01-01

    The aim of this study was to investigate the relationship between acoustic analysis and biopsychosocial implications of voice problems, evaluated by the Voice Handicap Index (VHI). The study comprised 120 female teachers with voice disorders, evaluated by videolaryngostroboscopy. 60.8% of this group were diagnosed as having functional dysphonia and 39.2% had dysphonia with benign vocal fold masses (nodules and polyps). The controls consisted of 30 euphonic women. The correlations between VHI and acoustic analysis were assessed in both groups using the Pearson correlation coefficient and regression analysis. In teachers, the total VHI score was over 5 times as high as in controls (p teachers, significant positive correlations were found between the total VHI score and the frequency perturbation parameters and amplitude perturbation parameters when both statistical methods were used. These acoustic parameters also significantly correlated with the score on the functional and emotional subscales, but rarely with the physical subscale of the VHI. The study revealed a significant relationship between the objective voice measurements and the VHI. The results confirmed that VHI can be a valuable tool for assessing biopsychosocial implications of occupational dysphonia and should be incorporated in multidimensional voice evaluation. (c) 2010 S. Karger AG, Basel.

  9. Validity and Reliability Study of Bahasa Malaysia Version of Voice Handicap Index-10.

    Science.gov (United States)

    Ong, Fei Ming; Husna Nik Hassan, Nik Fariza; Azman, Mawaddah; Sani, Abdullah; Mat Baki, Marina

    2018-05-21

    This study aimed to determine the validity and reliability of Bahasa Malaysia version of Voice Handicap Index-10 (mVHI-10). This cross-sectional study was carried out in the Otorhinolaryngology, Head and Neck Surgery Department of Universiti Kebangsaan Malaysia Medical Centre (UKMMC) from June 2015 to May 2016. The mVHI-10 was produced following a rigorous forward and backward translation. One hundred participants, including 50 healthy volunteers (17 male, 33 female) and 50 patients with voice disorders (26 male, 24 female), were recruited to complete the mVHI-10 before flexible laryngoscopic examinations and acoustic analysis. The mVHI-10 was repeated in 2 weeks via telephone interview or clinic visit. Its reliability and validity were assessed using interclass correlation. The test-retest reliability for total mVHI-10 and each item score was high, with the Cronbach alpha of >0.90. The total mVHI-10 score and domain scores were significantly higher (P Kaiser-Meyer-Olkin measure was 0.92, which depicted excellent construct validity. There was a significant positive correlation between the mVHI-10 score and jitter and shimmer result (P < 0.001). The present study showed good reliability and validity of the mVHI-10 when applied to both healthy volunteers and patients with voice disorders. We recommend the use of the mVHI-10 in daily clinical practice among Bahasa Malaysia-speaking population. Copyright © 2018 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  10. Long-term voice handicap index after type II thyroplasty using titanium bridges for adductor spasmodic dysphonia.

    Science.gov (United States)

    Sanuki, Tetsuji; Yumoto, Eiji; Kodama, Narihiro; Minoda, Ryosei; Kumai, Yoshihiko

    2014-06-01

    To determine the long-term functional outcomes of type II thyroplasty using titanium bridges for adductor spasmodic dysphonia (AdSD) by perceptual analysis using the Voice Handicap Index-10 (VHI-10) and by acoustic analysis. Fifteen patients with AdSD underwent type II thyroplasty using titanium brides between August 2006 and February 2011. VHI-10 scores, a patient-based survey that quantifies a patient's perception of his or her vocal handicap, were determined before and at least 2 years after surgery. Concurrent with the VHI-10 evaluation, acoustic parameters were assessed, including jitter, shimmer, harmonic-to-noise ratio (HNR), standard deviation of F0 (SDF0), and degree of voice breaks (DVB). The average follow-up interval was 30.1 months. No patient had strangulation of the voice, and all were satisfied with the voice postoperatively. In the perceptual analysis, the mean VHI-10 score improved significantly, from 26.7 to 4.1 two years after surgery. All patients had significantly improved each score of three different aspects of VHI-10, representing improved functional, physical, and emotional well-being. All acoustic parameters improved significantly 2 years after surgery. The treatment of AdSD with type II thyroplasty significantly improved the voice-related quality of life and acoustic parameters 2 years after surgery. The results of the study suggest that type II thyroplasty using titanium bridges provides long-term relief of vocal symptoms in patients with AdSD. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  11. A study of VHI scores and acoustic features in street vendors as occupational voice users.

    Science.gov (United States)

    Natour, Yaser S; Darawsheh, Wesam B; Bashiti, Sara; Wari, Majd; Taha, Juhayna; Odeh, Thair

    to investigate acoustic features of phonation and perception of voice handicap in street vendors. Eighty-eight participants (44 street vendors, 44 controls) were recruited. The mean age of the group was 38.9±16.0 years (range: 20-78 years). Scores of the Arabic version of the Voice Handicap Index (VHI-Arab) were used for analysis. Acoustic measures of fundamental frequency (F 0 ), jitter, shimmer, and signal-to-noise ratio (SNR) were also analyzed. Analysis showed a significant difference between street vendors and controls in the total score of the VHI-Arab (p<0.001) as well as scores of all three VHI-Arab subsections: functional (p<0.001), physical (p<0.001), and emotional (p=0.025). Weak correlations were found among all of the VHI scores and acoustic measures (-0.219≤ r≤0.355), except for SNR where a moderate negative correlations were found (r=-0.555; -0.4) between the VHI (physical and total) scores and SNR values. Significant differences also were found in F 0 , jitter, and SNR among specific subgroups of street vendors when stratified by weekly hours worked (p<0.05), and in jitter (p=0.39) when stratified by educational level. Perception of voice handicap and a possible effect on vocal quality in street vendors were noted. The effect of factors, namely work hours and educational level, on voice quality should be further studied. Copyright © 2017. Published by Elsevier Inc.

  12. [Comparison of VHI scores in teachers with voice disorders and the non-professional dysphonic population].

    Science.gov (United States)

    Kuzańska, Anna; Niebudek-Bogusz, Ewa; Woźnicka, Ewelina; Kopczyńska, Jerzy; Sliwińska-Kowalska, Mariola

    2009-01-01

    The aim of this study was to assess the application of Voice Handicap Index (VHI) in the diagnosis of occupational voice disorders in teachers as compared with the dysphonic non-teachers population. The subjective assessment of voice by VHI was performed in 105 teachers with dysphonia and 60 dysphonic subjects whose jobs did not involve vocal effort. The control group comprised 65 healthy individuals with normal voice. The results of total VHI score and each of its subscales, functional, emotional and physical, were significantly worse in the study groups (I and II) than in the control group (p teachers and 16% of non-teachers reported severe voice disability. All individuals in the control group assessed their voice problems as minor, their results fell within the range of the lowest level of VHI score. This study confirmed that VHI as a tool for self-assessment of voice can significantly contribute to the diagnosis of occupational and non-occupational dysphonia.

  13. Reliability and validity of the Korean version of Pediatric Voice Handicap Index: in school age children.

    Science.gov (United States)

    Park, Sung Shin; Kwon, Tack-Kyun; Choi, Seong Hee; Lee, Won Yong; Hong, Young Hye; Jeong, Nyun Gi; Sung, Myung-Whun; Kim, Kwang Hyun

    2013-01-01

    The aim of this study was to assess the reliability and validity of the Pediatric Voice Handicap Index (pVHI) for cross-cultural adaptation of the Korean version with school age children. The questionnaire was translated into Korean and was completed by 101 Korean parents who have children with or without disordered voice. The Korean version-pVHI scores were obtained with 60 parents of normal children and 41 parents who have children with voice problems. Content validity was verified by five experienced speech-language pathologists with clinical specialization in voice disorders. Internal consistency was calculated through Cronbach's α coefficient and test-retest reliability of the Korean version-pVHI score was determined using Pearson product-moment correlation coefficients. Mann-Whitney U test was used to compare GRBAS with the Korean version-pVHI scores between normal and dysphonia group. The relationship between the parent-reported the Korean version-pVHI total scores and perceptual ratings of voice quality from experts was investigated using Spearman correlation coefficients. The results showed that the Korean version-pVHI provided a high internal consistency (α=0.92) and test-retest reliability of its subscales: total (T) 0.97, functional (F) 0.90, physical (P) 0.95, emotional (E) 0.92. The Korean version-pVHI mean scores in normal group were 1.28 (T), 0.62 (F), 0.35 (P) and 0.32 (E), respectively whereas those of the Korean version-pVHI in children group with dysphonia were 23.13 (T), 8.90 (F), 9.54 (P) and 4.93 (E). Significant differences in the Korean version-pVHI (T, F, P, E) and perceptual evaluation (grade, rough, breathy) between normal and dysphonia group were revealed (PKorean version-pVHI parameters (T) and perceptual measures (G) was exhibited in children with dysphonia. The subjective Korean version-pVHI can be applicable and useful supplementary tool for evaluating parents' perception of their children's voice dysfunction, identifying

  14. Predictors of Choral Directors' Voice Handicap

    Science.gov (United States)

    Schwartz, Sandra

    2013-01-01

    Vocal demands of teaching are considerable and these challenges are greater for choral directors who depend on the voice as a musical and instructive instrument. The purpose of this study was to (1) examine choral directors' vocal condition using a modified Voice Handicap Index (VHI), and (2) determine the extent to which the major variables…

  15. Health-related quality of life in children with dysphonia and validation of the French Pediatric Voice Handicap Index.

    Science.gov (United States)

    Oddon, P A; Boucekine, M; Boyer, L; Triglia, J M; Nicollas, R

    2018-01-01

    voice disorders are common in the pediatric population and can negatively affect children's quality of life. The pediatric voice handicap Index (pVHI) is a valid instrument to assess parental perception of their children voice but it is not translated into French language. The aim of the present study was to adapt a French version of the pVHI and to evaluate its psychometric properties including construct validity, reliability, and some aspects of external validity. we performed a cross sectional study including 32 dysphonic children and 60 children with no history of voice problems between 3 and 12 years of age. The original pVHI was translated into French language according to forward-backward rules and then administered to parents or caregivers. Construct validity and internal consistency were explored using confirmatory factor analysis and Cronbach's alpha. The questionnaire was filled twice to assess test-retest reliability using the intra-class correlation coefficient. The external validity was explored by comparing the French pVHI total and subscales scores between dysphonic and asymptomatic children. Correlations between the French pVHI and both the perceptual GRBAS scale and the health-related quality of life (HRQOL) survey "Vécu et Santé Perçu de l'Adolescent et de l'Enfant" (VSP-Ap) were also performed. the structure of the French pVHI showed a good fit with excellent reliability (α = 0.929) and high test-retest reliability. Significant differences were found between the group of dysphonic children and the control group (p life in children with voice disorder. We recommend its use in the multidimensional protocols for assessing voice disorder in the pediatric population. Copyright © 2017. Published by Elsevier B.V.

  16. Muscular tension and body posture in relation to voice handicap and voice quality in teachers with persistent voice complaints.

    Science.gov (United States)

    Kooijman, P G C; de Jong, F I C R S; Oudes, M J; Huinck, W; van Acht, H; Graamans, K

    2005-01-01

    The aim of this study was to investigate the relationship between extrinsic laryngeal muscular hypertonicity and deviant body posture on the one hand and voice handicap and voice quality on the other hand in teachers with persistent voice complaints and a history of voice-related absenteeism. The study group consisted of 25 female teachers. A voice therapist assessed extrinsic laryngeal muscular tension and a physical therapist assessed body posture. The assessed parameters were clustered in categories. The parameters in the different categories represent the same function. Further a tension/posture index was created, which is the summation of the different parameters. The different parameters and the index were related to the Voice Handicap Index (VHI) and the Dysphonia Severity Index (DSI). The scores of the VHI and the individual parameters differ significantly except for the posterior weight bearing and tension of the sternocleidomastoid muscle. There was also a significant difference between the individual parameters and the DSI, except for tension of the cricothyroid muscle and posterior weight bearing. The score of the tension/posture index correlates significantly with both the VHI and the DSI. In a linear regression analysis, the combination of hypertonicity of the sternocleidomastoid, the geniohyoid muscles and posterior weight bearing is the most important predictor for a high voice handicap. The combination of hypertonicity of the geniohyoid muscle, posterior weight bearing, high position of the hyoid bone, hypertonicity of the cricothyroid muscle and anteroposition of the head is the most important predictor for a low DSI score. The results of this study show the higher the score of the index, the higher the score of the voice handicap and the worse the voice quality is. Moreover, the results are indicative for the importance of assessment of muscular tension and body posture in the diagnosis of voice disorders.

  17. The Effects of a Voice Education Program on VHI Scores of Elementary School Teachers.

    Science.gov (United States)

    Faham, Maryam; Ahmadi, Akram; Drinnan, Michael; Saadatmand, Najme; Fatahi, Elahe; Jalalipour, Maryam

    2016-11-01

    Teachers seem to be vulnerable to voice disorders because of excessive use of their voice. The purpose of this study was to investigate the effects of a voice education program on the Vocal Handicap Index (VHI) scores of elementary school teachers in the Persian education system. This was a semi-experimental study, performed in Shiraz public schools. Ten schools were selected on their similarity in number of students and teachers, and allocated at random to training or control groups. Sixty-one teachers in the training group and 66 teachers in the control group completed the VHI in the first week. Teachers in the trained group received voice education for 4 weeks, and then continued to follow the program for a further 4 weeks. The control group received no training. After 8 weeks, all subjects completed the questionnaire again. Compliance was good for all practices except "breathing exercises" and "using amplifiers" where it was exceptionally poor. Teachers in the training group improved significantly in total VHI score (from 14.2 to 6.8), whereas the control group showed a significant worsening (from 10.1 to 13.7). These effects were significant (P teachers, even without dysphonia, in the middle of their teaching. Such a program may have a place in the Persian education system. Copyright © 2016 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  18. A Comparative Study of the VHI-10 and the V-RQOL for Quality of Life Among Chinese Teachers With and Without Voice Disorders.

    Science.gov (United States)

    Lu, Dan; Wen, Bei; Yang, Hui; Chen, Fei; Liu, Jun; Xu, Yanan; Zheng, Yitao; Zhao, Yu; Zou, Jian; Wang, Haiyang

    2017-07-01

    To investigate the differences and correlation between the Voice Handicap Index-10 (VHI-10) and the Voice-Related Quality of Life (V-RQOL) in teachers in China with and without voice disorders. This is a cross-sectional descriptive analytical study. The participants were 864 teachers (569 women, 295 men) whose vocal cords were examined using a flexible nasofibrolaryngoscope. Questionnaire results were obtained for both the VHI-10 and the V-RQOL. Of the 864 participants, 409 teachers had no voice disorders and 455 teachers had voice disorders. The most common voice complaint was hoarseness (n = 298) and the most common throat complaint was globus pharyngis (n = 79) in teachers with voice disorders. Chronic laryngitis (n = 218) and polyps and nodules (n = 182) were the most frequent diagnoses in teachers with voice disorders. Significant differences were seen on the VHI-10 between teachers with and those without voice disorders (P teachers with voice disorders (P teachers. Teachers with voice disorders have poor voice-related quality of life, with more impairment seen among female than male teachers. Different groups of voice disorders have different effects on voice-related quality of life. A moderate correlation was found between the results of the VHI-10 and the V-RQOL. Copyright © 2017 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  19. Dicty_cDB: VHI141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHI141 (Link to dictyBase) - - - Contig-U15722-1 VHI141P (Link... to Original site) VHI141F 635 VHI141Z 922 VHI141P 1537 - - Show VHI141 Library VH (Link to library) Clone ID VHI141 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...LDCSTPNGTCDNNTGNCTCHNEHFGNSC EFTRCPLDCSTPNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHK...PNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHKCSTKHGICDNDSG

  20. Effect of intralaryngeal muscle synkinesis on perception of voice handicap in patients with unilateral vocal fold paralysis.

    Science.gov (United States)

    Lin, R Jun; Munin, Michael C; Rosen, Clark A; Smith, Libby J

    2017-07-01

    Intralaryngeal muscle synkinesis associated with unilateral vocal fold paralysis (UVFP) is thought to preserve thyroarytenoid-lateral cricoarytenoid muscle complex tone, resulting in a better voice despite the presence of vocal fold paralysis (VFP). This study compares voice handicap in patients with unilateral VFP (UVFP) with and without evidence of adductory synkinesis on laryngeal electromyography (LEMG). Retrospective review of LEMG data and Voice Handicap Index-10 (VHI-10) scores of patients diagnosed with permanent UVFP. LEMG was performed within 1 to 6 months post onset of UVFP. Patients were stratified into two groups: 1) recurrent laryngeal nerve (RLN) neuropathy with synkinesis and 2) RLN neuropathy without synkinesis. Synkinesis was diagnosed when the sniff to phonation maximum amplitude ratio was ≥0.65. VHI-10 scores at 6-month follow-up were recorded. Four hundred forty-nine patients with UVFP and who had an LEMG were reviewed. Eighty-three patients met the inclusion criteria, with 16 in group 1 and 67 in group 2. There was no significant difference between the groups with regard to age, timing of LEMG from onset of VFP, number of patients undergoing temporary vocal fold injection or use of off-label nimodipine. Average VHI-10 scores at 6 months post onset of VFP were 14.4 ± 10.6 for patients with LEMG-identified synkinesis (group 1) and 21.0 ± 10.1 for patients with no LEMG evidence of synkinesis (group 2). This was statistically significant (P = .02). Patients with unilateral vocal fold paralysis and LEMG evidence of laryngeal synkinesis are more likely to have less perceived voice handicap than those without synkinesis. 4. Laryngoscope, 127:1628-1632, 2017. © 2016 The American Laryngological, Rhinological and Otological Society, Inc.

  1. Determinants and Effects of Voice Disorders among Secondary School Teachers in Peninsular Malaysia Using a Validated Malay Version of VHI-10.

    Directory of Open Access Journals (Sweden)

    Foong Ming Moy

    Full Text Available To establish the prevalence of voice disorder using the Malay-Voice Handicap Index 10 (Malay-VHI-10 and to study the determinants, quality of life, depression, anxiety and stress associated with voice disorder among secondary school teachers in Peninsular Malaysia.This study was divided into two phases. Phase I tested the reliability of the Malay-VHI-10 while Phase II was a cross-sectional study with two-stage sampling. In Phase II, a self-administered questionnaire was used to collect socio-demographic and teaching characteristics, depression, anxiety and stress scale (Malay version of DASS-21; and health-related quality of life (Malay version of SF12-v2. Complex sample analysis was conducted using multivariate Poisson regression with robust variance.In Phase I, the Spearman correlation coefficient and Cronbach alpha for total VHI-10 score was 0.72 (p 11. Compared to Malays, a greater proportion of ethnic Chinese teachers reported voice disorder while ethnic Indian teachers were less likely to report this problem. There was a higher prevalence ratio (PR of voice disorder among single or divorced/widowed teachers. Teachers with voice disorder were more likely to report higher rates of absenteeism (PR: 1.70, 95% CI 1.33, 2.19, lower quality of life with lower SF12-v2 physical (0.98, 95% CI 0.96, 0.99 and mental (0.97, 95% CI 0.96, 0.98 component summary scales; and higher anxiety levels (1.04, 95% CI 1.02, 1.06.The Malay-VHI-10 is valid and reliable. Voice disorder was associated with increased absenteeism, marginally associated with reduced health-related quality of life as well as increased anxiety among teachers.

  2. Dicty_cDB: VHI285 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHI285 (Link to dictyBase) - - - Contig-U16073-1 - (Link to Or...iginal site) VHI285F 136 - - - - - - Show VHI285 Library VH (Link to library) Clone ID VHI285 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16073-1 Original site URL http://dictycdb.b... DNA Score E Sequences producing significant alignments: (bits) Value N ( BJ423035 ) Dict...yostelium discoideum cDNA clone:ddv47i22, 5' ... 72 2e-27 3 ( BJ419916 ) Dictyostelium discoideum cD

  3. The Barthel index as predictor of handicap in stroke survivors: a ...

    African Journals Online (AJOL)

    Results: After adjusting for other variables, the multivariable analysis showed that handicap in stroke is significantly associated with the Barthel index (p<0.05) and atrial fibrillation (p<0.05). Conclusion: Barthel index is an important predictor of handicap following stroke. Atrial fibrillation should also be considered in the ...

  4. Comparação dos escores dos protocolos QVV, IDV e PPAV em professores Comparison of V-RQOL, VHI and VAPP scores in teachers

    Directory of Open Access Journals (Sweden)

    Alessandra Sayuri Tutya

    2011-09-01

    Handicap Index and VAPP (Voice Activity and Participation Profile, and to analyze the correspondence of information obtained by these instruments. METHODS: Fourty six teachers with voice complaints that sought for speech-language pathology intervention and were diagnosed with behavioral dysphonia answered randomly the V-RQOL, VHI and VAPP questionnaires. RESULTS: Dysphonic teachers presented worse quality of life than the general dysphonic population on the V-RQOL. The VHI showed no significant handicap. On the VAPP, teachers had lower scores in the effects in social communication. The physical (VHI and physical functioning (V-RQOL domains were similar to each other. The VAPP provides information about aspects not contemplated by the other protocols; self-perception of the severity of dysphonia was correlated with all domains of the three protocols. The items with greatest impact on the V-RQOL were from the physical functioning domain, and, on the VHI, from the physical domain. On the VAPP, the two questions with greater occurrence were related to the effect of voice over emotion. Hence, for this population, it is suggested the use of the VAPP questionnaire, because it comprises aspects that the others don't; in addition, the V-RQOL should also be used, because it has fewer questions and more impact (total and emotional scores than the VHI. CONCLUSION: The protocols do not show the same information for dysphonic teachers. The physical functioning (V-RQOL and physical (VHI domains provide similar results, however social-emotional domain of the V-RQOL exhibited more evidently the impact of the voice disorder in dysphonic teachers than the VHI. The VAPP present information not contemplated by the other protocols.

  5. Connections between voice ergonomic risk factors and voice symptoms, voice handicap, and respiratory tract diseases.

    Science.gov (United States)

    Rantala, Leena M; Hakala, Suvi J; Holmqvist, Sofia; Sala, Eeva

    2012-11-01

    The aim of the study was to investigate the connections between voice ergonomic risk factors found in classrooms and voice-related problems in teachers. Voice ergonomic assessment was performed in 39 classrooms in 14 elementary schools by means of a Voice Ergonomic Assessment in Work Environment--Handbook and Checklist. The voice ergonomic risk factors assessed included working culture, noise, indoor air quality, working posture, stress, and access to a sound amplifier. Teachers from the above-mentioned classrooms reported their voice symptoms, respiratory tract diseases, and completed a Voice Handicap Index (VHI). The more voice ergonomic risk factors found in the classroom the higher were the teachers' total scores on voice symptoms and VHI. Stress was the factor that correlated most strongly with voice symptoms. Poor indoor air quality increased the occurrence of laryngitis. Voice ergonomics were poor in the classrooms studied and voice ergonomic risk factors affected the voice. It is important to convey information on voice ergonomics to education administrators and those responsible for school planning and taking care of school buildings. Copyright © 2012 The Voice Foundation. Published by Mosby, Inc. All rights reserved.

  6. Vocal handicap index in popular and erudite professional singers.

    Science.gov (United States)

    Loiola-Barreiro, Camila Miranda; Silva, Marta Assumpção de Andrada E

    To compare the voice handicap index of popular and erudite professional singers according to gender, age, professional experience time, and presence or absence of self-reported vocal complaints. One hundred thirty-two professional singers, 74 popular and 58 erudite, who responded to a questionnaire with regards to identification, age, gender, professional experience time in singing, musical genres (for popular singers), vocal classification (for erudite singers), presence of self-reported vocal complaints, and the specific protocols for popular (Modern Singing Handicap Index - MSHI) and erudite (Classical Singing Handicap Index - CSHI) singing. Higher proportion of women and higher incidence of vocal complaints were observed in the popular singers compared with the erudite singers. Most of the popular singers belonged to the genre of Brazilian Popular Music. Regarding the classification of erudite singers, there was greater participation of sopranos and tenors. No statistical differences were observed with respect to age and professional experience time between the groups. Comparison of the MSHI and CSHI scores showed no statistically significant difference between these scores and genre or age in both groups of singers. Professional experience time was related to the total score and the subscales disability and impairment in the MSHI, only for popular singers with vocal complaints. There was no correlation between these variables and the CSHI for erudite singers. The impact of vocal difficulty/problem interferes differently in these two musical genres when related to vocal complaint and professional experience time. The MSHI and CSHI protocols proved to be important tools not only for the identification of problems, but also for the understanding of how these individuals relate their voices with this occupational activity.

  7. Correlation between vocal tract symptoms and modern singing handicap index in church gospel singers.

    Science.gov (United States)

    Pinheiro, Joel; Silverio, Kelly Cristina Alves; Siqueira, Larissa Thaís Donalonso; Ramos, Janine Santos; Brasolotto, Alcione Ghedini; Zambon, Fabiana; Behlau, Mara

    2017-08-24

    To verify the correlation between vocal tract discomfort symptoms and perceived voice handicaps in gospel singers, analyzing possible differences according to gender. 100 gospel singers volunteered, 50 male and 50 female. All participants answered two questionnaires: Vocal Tract Discomfort (VTD) scale and the Modern Singing Handicap Index (MSHI) that investigates the vocal handicap perceived by singers, linking the results of both instruments (psinging. Female gospel singers present higher frequency and intensity of vocal tract discomfort symptoms, as well as higher voice handicap for singing than male gospel singers. The higher the frequency and intensity of the laryngeal symptoms, the higher the vocal handicap will be.

  8. Assessment of voice related quality of life and its correlation with socioeconomic status after total laryngectomy.

    Science.gov (United States)

    Agarwal, Sangeet Kumar; Gogia, Shweta; Agarwal, Alok; Agarwal, Rajiv; Mathur, Ajay Swaroop

    2015-10-01

    After total laryngectomy for laryngeal cancer, the major determinants of QOL is the patient's voice related quality of life (V-RQOL). The primary aim of this study was to assess the V-RQOL and impact of socioeconomic status over it in Indian population by using two validated scales [voice handicap index (VHI) and V-RQOL questionnaires]. Total 104 patients underwent total laryngectomy but 71 were eligible for study. Patients filled the VHI and V-RQOL questionnaires after completion of 1 year of usage of the TEP voice. The socioeconomic status of the patients was calculated according to various domains related to their life and were divided into lower and higher status. A total of 76.1% patients had VHI score between 0 to 30 (minimal voice handicap), 19.7% had score between 31 to 60 (moderate voice handicap) and only 4.2% patients had VHI score more than 61 (serious voice handicap). On V-RQOL scores, 16.9% patients had score between 10 to 15 (excellent), 40.8% patients, between 16 to 20 (very good), 22.5% patients, between 21 and 25 (good voice), 15.5% patients, between 26 and 30 (fair) and only 4.2% patients scored more than 30 with poor quality of voice. Patients with lower socioeconomic group had better V-RQOL than with high socioeconomic group. VHI and V-RQOL scores in our series were superior to other studies due to major population with lower socioeconomic status and better social support which exists in our society.

  9. Parents' Evaluations of Their Children's Dysphonia: The Mamas and the Papas.

    Science.gov (United States)

    Amir, Ofer; Wolf, Michael; Mick, Liron; Levi, Omer; Primov-Fever, Adi

    2015-07-01

    This study aimed to evaluate the validity and reliability of a Hebrew translation of the Pediatric Voice Handicap Index (pVHI). It also examined differences between mothers and fathers in evaluating their child's dysphonia. Observational design. The pVHI was first translated and adapted to Hebrew. The translated version was, then, administered to a group of 141 parents of children aged younger than 14 years. Fifty-eight parents had a dysphonic child, and 83 had a nondysphonic child. Based on the parents' responses to the pVHI, statistical analyses were performed, evaluating validity and reliability, as well as group differences. Following, a subset of the participants, in which only cases where the responses of both parents were available, was examined for evaluating differences between the responses of mothers (n = 46) and fathers (n = 46). Statistical analyses revealed high reliability of the Hebrew version of the pVHI (Cronbach alpha = .97). Parents of the dysphonic children rated their children significantly higher than parents of the nondysphonic group (P  0.05). The Hebrew version of the pVHI is a reliable tool for quantifying parents' perception of their child's voice handicap. Mothers of dysphonic children evaluate their children's voice handicap more severely than fathers, whereas both parents of nondysphonic children perform this evaluation similarly. Copyright © 2015 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  10. Cross-cultural Adaption and Validation of the Danish Voice Handicap Index

    DEFF Research Database (Denmark)

    Sorensen, Jesper Roed; Printz, Trine; Mehlum, Camilla Slot

    2018-01-01

    version of the VHI was used. Data from 208 patients with voice disorders of different etiology (neurogenic, functional, and structural) and a control group of 85 vocally healthy individuals were included. A test-retest reliability analysis of 42 patients and 45 control persons was performed. The internal...

  11. Objective Quantification of Pre-and Postphonosurgery Vocal Fold Vibratory Characteristics Using High-Speed Videoendoscopy and a Harmonic Waveform Model

    Science.gov (United States)

    Ikuma, Takeshi; Kunduk, Melda; McWhorter, Andrew J.

    2014-01-01

    Purpose: The model-based quantitative analysis of high-speed videoendoscopy (HSV) data at a low frame rate of 2,000 frames per second was assessed for its clinical adequacy. Stepwise regression was employed to evaluate the HSV parameters using harmonic models and their relationships to the Voice Handicap Index (VHI). Also, the model-based HSV…

  12. Utility approach to decision-making in extended T1 and limited T2 glottic carcinoma.

    Science.gov (United States)

    van Loon, Yda; Stiggelbout, Anne M; Hakkesteegt, Marieke M; Langeveld, Ton P M; de Jong, Rob J Baatenburg; Sjögren, Elisabeth V

    2017-04-01

    It is still undecided if endoscopic laser surgery or radiotherapy is the preferable treatment in extended T1 and limited T2 glottic tumors. Health utilities assessed from patients can aid in decision-making. Patients treated for extended T1 or limited T2 glottic carcinoma by laser surgery (n = 12) or radiotherapy (n = 14) assigned health utilities using a visual analog scale (VAS), time tradeoff (TTO) technique and scored their voice handicap using the Voice Handicap Index (VHI). VAS and TTO scores were slightly lower for the laser group compared to the radiotherapy group, however, not significantly so. The VHI showed a correlation with the VAS score, which was very low in both groups and can be considered (near) normal. Patients show no clear preference for the outcomes of laser surgery or radiotherapy from a quality of life (QOL) or voice handicap point of view. These data can now be incorporated into decision-making models. © 2017 Wiley Periodicals, Inc. Head Neck, 2017 © 2016 Wiley Periodicals, Inc. Head Neck 39: 779-785, 2017. © 2017 Wiley Periodicals, Inc.

  13. Does CPAP Affect Patient-Reported Voice Outcomes?

    Science.gov (United States)

    Hartke, Vance; Gillespie, Amanda; Smith, Libby J; Soose, Ryan J

    2018-04-01

    Upper aerodigestive tract symptoms are common in patients with obstructive sleep apnea (OSA). It remains unclear whether continuous positive airway pressure (CPAP) improves or worsens these otolaryngology symptoms. As therapy-related side effects limit CPAP adherence, this study aimed to determine if CPAP negatively affects voice, sinonasal, and reflux symptoms of the upper airway. Case series with planned data collection was performed at an academic otolaryngology sleep center. Newly diagnosed patients with OSA were evaluated before and 6 months after initiating CPAP therapy. Data collected included CPAP data download, Reflux Symptom Index (RSI), Epworth Sleepiness Scale (ESS), Voice Handicap Index 10 (VHI-10), Sino-Nasal Questionnaire (SNQ), and oral dryness visual analog scale (VAS). For the 11 CPAP-adherent participants, the RSI significantly improved with CPAP (mean RSI, 22.0-9.5; P = .002); however, the VAS, VHI-10, and SNQ did not change after 6 months of CPAP therapy. In a small sample size, patient-reported voice outcomes (VHI-10) and other upper aerodigestive tract symptoms did not worsen with CPAP; rather, CPAP therapy was associated with a reduction in reflux symptoms.

  14. A randomized controlled trial of stretch-and-flow voice therapy for muscle tension dysphonia.

    Science.gov (United States)

    Watts, Christopher R; Hamilton, Amy; Toles, Laura; Childs, Lesley; Mau, Ted

    2015-06-01

    To investigate the effect of stretch-and-flow voice therapy on vocal function and handicap. Randomized controlled trial. Participants with primary muscle tension dysphonia were randomly assigned to experimental or control groups. Experimental participants received vocal hygiene education followed by 6 weeks of stretch-and-flow voice therapy. Control participants received vocal hygiene education only. Outcome variables consisted of a measure of vocal handicap (Voice Handicap Index [VHI]), maximum phonation time, s/z ratio, and acoustic measures. All measures were obtained at baseline prior to treatment and within 2 weeks posttreatment or at the end of the control period. The pre- to posttreatment measurement change (delta Δ) was applied to statistical analyses. A multivariate analysis of variance revealed significant group differences in pre-to-post changes on measures of VHI, maximum phonation time, and cepstral peak prominence (CPP) in connected speech and vowels (P = 0.003, 0.013, 0.025, and 0.017 respectively), with a significant reduction of VHI (Cohen's d = 1.6), increase in maximum phonation time (Cohen's d = 1.2), increase of CPP in connected speech (Cohen's d = 1.2), and increase of CPP in vowels (Cohen's d = 1.1) in the experimental group compared to the control group. This preliminary small sample randomized controlled trial found significantly greater improvement in vocal handicap, maximum phonation time, and acoustic measures of vocal function after participants received stretch-and-flow voice therapy compared to participants receiving vocal hygiene education alone. Additional research incorporating larger samples will be needed to confirm and further investigate these findings. 1b. © 2015 The American Laryngological, Rhinological and Otological Society, Inc.

  15. Analysis of Agricultural Drought in East Java Using Vegetation Health Index

    OpenAIRE

    Amalo, Luisa Febrina; Hidayat, Rahmat; Sulma, Sayidah

    2018-01-01

    Drought is a natural hazard indicated by the decreasing of rainfall and water storage and impacting agricultural sector. Agricultural drought assessment has been used to monitor agricultural sustainability, particularly in East Java as national agricultural production center. Identification of drought characteristics –correlated with El Niño-Southern Oscillation, and agricultural impact on paddy fields and rice production using VHI (Vegetation Health Index) were conducted. VHI is produced by ...

  16. Dysphonia in nursing home and assisted living residents: prevalence and association with frailty.

    Science.gov (United States)

    G Nichols, Brent; Varadarajan, Varun; Bock, Jonathan M; Blumin, Joel H

    2015-01-01

    Previous studies of geriatric dysphonia prevalence have been limited to ambulatory outpatient and senior communities. Our goal was to identify prevalence of dysphonia in nursing home residents and assisted living residents and search for correlations between indices of dysphonia and indices of frailty. Prospective epidemiological survey. Residents of a vertically integrated senior care organization who were 65 or older and able to understand and complete the questionnaire were recruited to complete the voice handicap index 10 (VHI-10) to assess for dysphonia (VHI-10 > 10 = dysphonia) and Vulnerable Elders Survey 13 (VES-13), a validated instrument to assess for frailty (VES > 3 = frailty). A total of 119 residents were surveyed. Thirty-three percent of nursing home residents, and 25% of assisted living residents reported dysphonia with 29% of all respondents reporting dysphonia. The mean VHI-10 was 7.4, the median was 5, and the interquartile range was 2-12.5. There was a significant relationship between VHI-10 and VES-13 score (P = 0.029). There were no statistically significant relationships between frailty, age, or type of living and dysphonia or VHI-10. There is a high prevalence of voice dysfunction in assisted living and nursing home residents. The correlation between VHI-10 and VES-13 suggests that voice declines as frailty increases. Copyright © 2015 The Voice Foundation. All rights reserved.

  17. Validation of the Cepstral Spectral Index of Dysphonia (CSID) as a Screening Tool for Voice Disorders: Development of Clinical Cutoff Scores.

    Science.gov (United States)

    Awan, Shaheen N; Roy, Nelson; Zhang, Dong; Cohen, Seth M

    2016-03-01

    The purposes of this study were to (1) evaluate the performance of the Cepstral Spectral Index of Dysphonia (CSID--a multivariate estimate of dysphonia severity) as a potential screening tool for voice disorder identification and (2) identify potential clinical cutoff scores to classify voice-disordered cases versus controls. Subjects were 332 men and women (116 men, 216 women) comprised of subjects who presented to a physician with a voice-related complaint and a group of non-voice-related control subjects. Voice-disordered cases versus controls were initially defined via three reference standards: (1) auditory-perceptual judgment (dysphonia +/-); (2) Voice Handicap Index (VHI) score (VHI +/-); and (3) laryngoscopic description (laryngoscopic +/-). Speech samples were analyzed using the Analysis of Dysphonia in Speech and Voice program. Cepstral and spectral measures were combined into a CSID multivariate formula which estimated dysphonia severity for Rainbow Passage samples (i.e., the CSIDR). The ability of the CSIDR to accurately classify cases versus controls in relation to each reference standard was evaluated via a combination of logistic regression and receiver operating characteristic (ROC) analyses. The ability of the CSIDR to discriminate between cases and controls was represented by the "area under the ROC curve" (AUC). ROC classification of dysphonia-positive cases versus controls resulted in a strong AUC = 0.85. A CSIDR cutoff of ≈24 achieved the best balance between sensitivity and specificity, whereas a more liberal cutoff score of ≈19 resulted in higher sensitivity while maintaining respectable specificity which may be preferred for screening purposes. Weaker but adequate AUCs = 0.75 and 0.73 were observed for the classification of VHI-positive and laryngoscopic-positive cases versus controls, respectively. Logistic regression analyses indicated that subject age may be a significant covariate in the discrimination of dysphonia-positive and VHI

  18. Applicability of the Arabic version of Vocal Tract Discomfort Scale (VTDS) with student singers as professional voice users.

    Science.gov (United States)

    Darawsheh, Wesam B; Natour, Yaser S; Sada, Eve G

    2018-07-01

    This pilot study aimed to evaluate the internal consistency, convergent construct validity and criterion validity of Arabic version of the Vocal Tract Discomfort Scale (VTDS), and to investigate the correlation between the scores of the VTDS, the VHI and the acoustic measures of fundamental frequency (F0), shimmer, jitter and signal-to-noise ratio (SNR). A cross-sectional study where 97 participants participated (47 males and 50 females) (mean age 20.5 ± 2.1 years) (31 student singers and 66 other non-professional voice user students). Participants were without self-perceived voice disorders who completed the VTDS-Arab scale and the Voice Handicap Index (VHI-Arab), and recorded a vocal sample of/a:/at a comfortable level. A positive internal consistency that signifies reliability was confirmed by Cronbach's α = .884 and 0.874 for the VTDS-Arab frequency and severity subscales, respectively. A moderate positive correlation was found between the VTDS-Arab (frequency, severity, total) and the VHI-Arab total where values of Pearson's correlation coefficient were r= 0.459, 0.430 and 0.451, respectively. Weak correlations were found between all of the acoustic measures and the scores of the VTDS-Arab and VHI-Arab (total and subscales). The area under curve for the VTDS was AUC= 0.824, 0.804 and 0.817 for the VTDS frequency, VTDS severity and VTDS total, respectively. The VTDS-Arab is a valid and reliable tool in measuring vocal tract sensations and predicting the perception of vocal handicap in student singers and can be used to predict the vocal load among professional voice users.

  19. Superiority of resection over enucleation for schwannomas of the cervical vagus nerve: A retrospective cohort study of 22 consecutive patients.

    Science.gov (United States)

    Illuminati, Giulio; Pizzardi, Giulia; Minni, Antonio; Masci, Federica; Ciamberlano, Bernardo; Pasqua, Rocco; Calio, Francesco G; Vietri, Francesco

    2016-05-01

    Schwannoma of the cervical vagus nerve is rare. Treatment options include intracapsular enucleation and en bloc resection. The purpose of this study was to compare the outcomes of enucleation and resection in terms of postoperative mortality and morbidity, freedom from vocal cord palsy, freedom from local recurrence, quality-adjusted life-year (QALY) and vocal handicap index (VHI). Twentytwo consecutive patients were divided into two groups. Patients in group A (n = 9) underwent intracapsular enucleation, whereas patients in Group B (n = 13) underwent en bloc resection. Main endpoints of the study were postoperative mortality and morbidity, freedom from vocal cord palsy, freedom from local recurrence and quality of life. The quality of life after surgery was assessed according to the quality-adjusted life-year (QALY) EQ-5D-5L methodology, and calculation of the voice handicap index (VHI). Postoperative mortality was nil. Morbidity included 1 wound dehiscence in group A and 2 transitory dysphagias in group B. Freedom from vocal cord palsy was 22% in group A and zero in group B (p = 0.15). Operation-specific local recurrence rate was 33% (3/9 patients) in group A and nil in group B (0/23 patients) (p = 0.05). QALYs was 0.55 in group A and 0.54 in group B (p = 1.0). VHI was 23.77 in group A and 26.15 in group B (p = 1.00). Resection is superior to enucleation in terms of freedom from local recurrence. Functional results are comparable for both techniques. Copyright © 2016 IJS Publishing Group Ltd. Published by Elsevier Ltd. All rights reserved.

  20. Acoustic analysis with vocal loading test in occupational voice disorders: outcomes before and after voice therapy.

    Science.gov (United States)

    Niebudek-Bogusz, Ewa; Kotyło, Piotr; Politański, Piotr; Sliwińska-Kowalska, Mariola

    2008-01-01

    To assess the usefulness of acoustic analysis with vocal loading test for evaluating the treatment outcomes in occupational voice disorders. Fifty-one female teachers with dysphonia were examined (Voice Handicap Index--VHI, laryngovideostroboscopy and acoustic analysis with vocal loading) before and after treatment. The outcomes of teachers receiving vocal training (group I) were referred to outcomes of group II receiving only voice hygiene instructions. The results of subjective assessment (VHI score) and objective evaluation (acoustic analysis) improved more significantly in group I than in group II. The post-treatment examination revealed a decreased percentage of subjects with deteriorated jitter parameters after vocal loading, particularly in group I. Acoustic analysis with vocal loading test can be a helpful tool in the diagnosis and evaluation of treatment efficacy in occupational dysphonia.

  1. Using Trial Vocal Fold Injection to Select Vocal Fold Scar Patients Who May Benefit From More Durable Augmentation.

    Science.gov (United States)

    Carroll, Thomas L; Dezube, Aaron; Bauman, Laura A; Mallur, Pavan S

    2018-02-01

    Clinical indications for vocal fold injection augmentation (VFI) are expanding. Prior studies demonstrate the benefit of trial VFI for select causes of glottic insufficiency. No studies have examined trial VFI for glottic insufficiency resulting from true vocal fold (TVF) scar. Retrospective chart review of patients who underwent trial VFI for a dominant pathology of TVF scar causing dysphonia. Patients who subsequently underwent durable augmentation were identified. The primary study outcome was the difference in Voice Handicap Index-10 (VHI-10) score from pretrial VFI to post-durable augmentation. Twenty-eight patients underwent trial VFI for TVF scar, 22 of whom reported a positive response. Fifteen of 22 subjects who underwent durable augmentation had viable data for analysis. Mean VHI-10 improved from 26.9 to 18.6 ( P 5). A trial VFI is a potentially useful, low-risk procedure that appears to help the patient and clinician identify when global augmentation might improve the voice when vocal fold scar is present. Patients who reported successful trial VFI often demonstrated significant improvement in their VHI-10 after subsequent durable augmentation.

  2. Temporalis Fascia Transplantation for Sulcus Vocalis and Vocal Fold Scar: Long-Term Outcomes.

    Science.gov (United States)

    Karle, William E; Helman, Samuel N; Cooper, Amy; Zhang, Yuan; Pitman, Michael J

    2018-04-01

    Sulcus vocalis and vocal fold scar involve derangement of the superficial lamina propria of the vocal fold, which results in significant dysphonia. Many options exist for treatment, most of which have unsatisfactory and unpredictable outcomes. Autologous transplantation of temporalis fascia into the vocal fold (ATFV) has the potential to be a better treatment option, but long-term outcomes have not been well studied. Retrospective chart review and patient survey. Twenty-one patients diagnosed with vocal fold scar or sulcus vocalis and treated with ATFV with at least 1-year follow-up were included. Voice Handicap Index 10 (VHI-10) questionnaires were collected preoperatively and 6 months postoperatively. Patients were reached at the time of the study to complete another VHI-10 and a Likert scale survey. The mean decrease in VHI-10 scores between preoperation and 6 months postoperation was 8.35 ( P vocal fold for the treatment of vocal fold scar and sulcus vocalis is a safe surgery with good long-term outcomes and high patient satisfaction.

  3. Does CPAP treatment affect the voice?

    Science.gov (United States)

    Saylam, Güleser; Şahin, Mustafa; Demiral, Dilek; Bayır, Ömer; Yüceege, Melike Bağnu; Çadallı Tatar, Emel; Korkmaz, Mehmet Hakan

    2016-12-20

    The aim of this study was to investigate alterations in voice parameters among patients using continuous positive airway pressure (CPAP) for the treatment of obstructive sleep apnea syndrome. Patients with an indication for CPAP treatment without any voice problems and with normal laryngeal findings were included and voice parameters were evaluated before and 1 and 6 months after CPAP. Videolaryngostroboscopic findings, a self-rated scale (Voice Handicap Index-10, VHI-10), perceptual voice quality assessment (GRBAS: grade, roughness, breathiness, asthenia, strain), and acoustic parameters were compared. Data from 70 subjects (48 men and 22 women) with a mean age of 44.2 ± 6.0 years were evaluated. When compared with the pre-CPAP treatment period, there was a significant increase in the VHI-10 score after 1 month of treatment and in VHI- 10 and total GRBAS scores, jitter percent (P = 0.01), shimmer percent, noise-to-harmonic ratio, and voice turbulence index after 6 months of treatment. Vague negative effects on voice parameters after the first month of CPAP treatment became more evident after 6 months. We demonstrated nonsevere alterations in the voice quality of patients under CPAP treatment. Given that CPAP is a long-term treatment it is important to keep these alterations in mind.

  4. Long-term consequences of vocal fold hemorrhage.

    Science.gov (United States)

    Kerwin, Lewis J; Estes, Christine; Oromendia, Clara; Christos, Paul; Sulica, Lucian

    2017-04-01

    To assess the long-term impact of vocal fold hemorrhage (VFH) on vocal function and health, and compare these parameters to those in similar patients who have not had VFH. Retrospective cohort study. Patients with a history of VFH (N = 41) were characterized through a review of records and assessed by means of a survey for vocal health and professional functioning as well as the Voice Handicap Index-10 (VHI-10) and, if appropriate (n = 30, 73.2%), the Singing Voice Handicap Index (SVHI-10). They were compared to a group of demographically and occupationally similar patients without VFH (N = 25, 60.9%). Patients with multiple episodes of VFH (n = 9, 22.0%) were compared to patients with a single event. After a median of 41 months follow-up, patients with VFH had favorable vocal function assessment and low median VHI-10 and SVHI-10 scores (4 and 6, respectively), substantially similar to patients without VFH (VHI-10, P = .905 and SVHI 10, P =.991). The two groups showed similarly low rates of change in occupation (7.3%vs. 8.0%, P =.999). Patients with VFH were more likely to have missed days of work due to a voice problem. Analysis of patients with one versus multiple VFH episodes showed no differences, except patients with multiple episodes had significantly greater confidence in their ability to address future VFH. Contrary to commonly held belief, VFH appears to have no significant long-term impact on vocational stability, subjective voice quality, or perceptions of vocal function. Moreover, among those with VFH, recurrence seems only to diminish anxiety over this transient injury. 4 Laryngoscope, 127:900-906, 2017. © 2016 The American Laryngological, Rhinological and Otological Society, Inc.

  5. Quality of life, functional outcome, and voice handicap index in partial laryngectomy patients for early glottic cancer

    Directory of Open Access Journals (Sweden)

    Kandogan Tolga

    2005-05-01

    part 1. (p = 0. A statistically significant difference was also established between cordectomy and fronto-lateral laryngectomy groups, as well as between cordectomy and cricohyoidopexi groups in answers to the University of Washington- Quality of Life- Revised survey part 2. (p = 0,036 and p = 0.009, respectively. Cricohyoidopexi group has given the lowest scores and the cordectomy group has given the highest scores in three survey questions representing the quality of life, performances and new voices. These ranges are also consistent with the laryngeal tissue excised during surgery (cricohyoidopexi > fronto-lateral laryngectomy > cordectomy. There was no statistically significant difference between groups in Performance Status Scale for Head and Neck cancer patients instrument. The difference between the Voice Handicap Index and Voice Handicap Index (functional; Voice Handicap Index (physical and Voice Handicap Index (emotional scores in three patient groups was not significant either. All of the patients evaluated that their new voices have similar functional, physical and emotional impact on their life. Decanulation and oral feeding times of cricohyoidopexi and fronto-lateral laryngectomy patients are found to be significantly longer than cordectomy patients. Lastly, the removal of arytenoid does not have any significant adverse effects on the quality of life, the functional outcomes, or the quality of voice. Conclusion In the present study, all patients with early glottic cancer, treated with different surgical technics reported fairly good quality of life outcomes, functional results and voice qualities. This study also finds that the removal of arytenoid does not have any adverse effects on the quality of life and voice from the patients' point of view.

  6. Investigating the Effects of Glottal Stop Productions on Voice in Children With Cleft Palate Using Multidimensional Voice Assessment Methods.

    Science.gov (United States)

    Aydınlı, Fatma Esen; Özcebe, Esra; Kulak Kayıkçı, Maviş E; Yılmaz, Taner; Özgür, Fatma F

    2016-11-01

    The aim was to investigate the effects of glottal stop productions (GS) on voice in children with cleft palate using multidimensional voice assessment methods. This is a prospective case-control study. Children with repaired cleft palate (n = 34) who did not have any vocal fold lesions were separated into two groups based on the results of the articulation test. The glottal stop group (GSG) consisted of 17 children who had GS. The control group (CG) consisted of an equal number of age- and gender-matched children who did not have GS. The voice evaluation protocol included acoustic analysis, Pediatric Voice Handicap Index (pVHI), and perceptual analysis (Grade, Roughness, Breathiness, Asthenia, Strain method). The velopharyngeal statuses of the groups were compared using the nasopharyngoscopy and the nasometer. The total pVHI score and the subscales of the pVHI were found to be significantly higher in the GSG. The F0, jitter, and shimmer were found to be numerically higher in the GSG with the difference being statistically significant in jitter (P speech and language pathology intervention including voice therapy techniques. Copyright © 2016 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  7. Spasmodic dysphonia follow-up with videolaryngoscopy and voice spectrography during treatment with botulinum toxin.

    Science.gov (United States)

    Esposito, Marcello; Dubbioso, R; Apisa, P; Allocca, R; Santoro, L; Cesari, U

    2015-09-01

    Spasmodic dysphonia (SD) is a focal dystonia of laryngeal muscles seriously impairing quality of voice. Adductor SD (ADSD) is the most common presentation of this disorder that can be identified by specialized phoniatricians and neurologists firstly on a clinical evaluation and then confirmed by videolaryngoscopy (VL). Botulinum toxin (BTX) injection with electromyographic guidance in muscles around vocal cords is the most effective treatment. Voice Handicap Index (VHI) questionnaire is the main tool to assess dysphonia and response to treatment. Objective of this study is to perform VL and voice spectrography (VS) to confirm the efficacy of BTX injections over time. 13 patients with ADSD were studied with VHI, VL and VS before and after 4 consecutive treatment with onobotulinumtoxin-A. For each treatment vocal improvement was proved by a significant reduction of VHI score and increase of maximum time phonation and harmonic-to-noise ratio while VL showed the absence of spasm in most of patients. No change of the response to BTX was found between injections. This study supports the efficacy of the treatment of SD with BTX with objective measurements and suggests that the efficacy of recurring treatments is stable over time.

  8. Vocal outcome after endoscopic thyroarytenoid myoneurectomy in patients with adductor spasmodic dysphonia.

    Science.gov (United States)

    Gandhi, Sachin; Remacle, Marc; Mishra, Prasun; Desai, Vrushali

    2014-12-01

    Spasmodic dysphonia (SD) remains one of the most difficult of laryngeal pathologies to treat. With limited role for speech therapy, various surgical modalities have been tried with various success rates. The objective of the study is to report the results of vocal outcome after thyroarytenoid myoneurectomy in patients of adductor spasmodic dysphonia (ASD). 15 patients of ASD were selected. GRBAS, and voice handicap index (VHI) were used for perceptual evaluation of voice. Thyroarytenoid myoneurectomy was performed by vaporizing the muscular layer of the vocal fold with CO2 laser, at an intensity of 6 W with 1.2 mm diameter in scanner mode. Voice analysis was repeated at 12, 24 and 48 months follow-up. Preoperative GRBAS scores and VHI score of all the patients were poor. At 12 months 12/15 (80 %) patients having strain score of 0. There was marked improvement in VHI scores at 6 months. 10/15 (67 %) patients have been followed up for 24 months. 5/10 (50 %) patients have strain (S) value of 0. VHI scoring of 5/10 (50 %) patients was <30. Two of the four patients completed 48 months follow-up had a strain (S) value of 0, one patient has strain value of 1 and one patient had strain value of 2. 2/4 patients had VHI score of <30; one patient had that of 40. Trans-oral CO2 laser thyroarytenoid myoneurectomy shows significant long-term improvement in voice quality in terms of reduced speech brakes, effort and strain in voice.

  9. The Comparison of Thyroarytenoid Muscle Myectomy and Type II Thyroplasty for Spasmodic Dysphonia.

    Science.gov (United States)

    Nomoto, Masaki; Tokashiki, Ryoji; Hiramatsu, Hiroyuki; Konomi, Ujimoto; Motohashi, Rei; Sakurai, Eriko; Toyomura, Fumimasa; Ueda, Yuri; Inoue, Shun; Tsukahara, Kiyoaki; Suzuki, Mamoru

    2015-07-01

    Surgical treatments for adductor spasmodic dysphonia include bilateral thyroarytenoid muscle myectomy (TAM) and type II thyroplasty (TPII), both of which are commonly performed. The present study aimed to compare the effects of TAM and TPII. Retrospective study. Subjects were 30 and 35 patients who underwent TAM and TPII, between March 2008 and November 2012. Voice quality was evaluated based on "voice handicap index 10 (VHI10)" and auditory impressions before and 6 months after surgery using five parameters: "strangulation," "interruption," "tremor," "grade," and "breathiness." Comparison of the two procedures revealed significant improvements in VHI10, strangulation, interruption, and tremor, and a significant decline in breathiness after surgery. In particular, VHI10 was improved by more than six points in 90% of patients with TAM, and 96% with TPII. No significant difference was observed between the severities of two procedures preoperatively. Comparison of each postoperative score between the two procedures revealed that TAM significantly improved strangulation, interruption, and tremor, and significantly worsened breathiness, with no significant difference in VHI10. Scatter plots (x: preoperative scores; y: postoperative scores) and regression lines of evaluation items demonstrated that TAM is more effective than TPII in severe cases. Compared with TPII, TAM tends to improve strangulation, interruption, and tremor; however, it tends to worsen breathiness postoperatively. Postoperative VHI10 scores did not differ significantly between the two procedures. Given favorable improvement rates, both surgical procedures were considered effective. Copyright © 2015 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  10. Facilitating creativity in handicapped and non-handicapped children ...

    African Journals Online (AJOL)

    The prime objective of this paper is to create awareness on the presence of the handicapped in Nigeria and the need to facilitate creative potentials in handicapped and non-handicapped children. Various factors that could facilitate creativity and other factors that could inhibit creativity were discussed. The implications for ...

  11. Tooth-brushing intervention programme among children with mental handicap.

    Science.gov (United States)

    Stefanovska, E; Nakova, M; Radojkova-Nikolovska, V; Ristoska, S

    2010-01-01

    For realizing our study the supervised tooth-brushing program was carried out among 100 schoolchildren at the age of 9-12 and 13-16 years with low and moderate mental handicap in Skopje. To evaluate the results of six months intervention program, concentrated on encouragement of independent manual skills, OHI levels were detected by Green-Vermillion and CPITN index levels to characterize the gingival and periodontal health. For comparative analyzes of date-base OHI levels and after six months of intervention program, we detected that the mean date-base OHI index level for mentally handicaped children are 2.46, and at the end of the program (after six months) it was 0.73. CPITN index levels at the beginning and after six months of intervention programmed for mentally handicaped children in both age groups, also confirmed r statistical significance for this examined parameter, with evident reduction of CPITN mean levels from 2.11 to 0.95. Correlation among date-base OHI levels and levels at the end of our intervention program means high positive correlation between these index levels at the beginningand final examinations. This program gave promising results and was effective in reducing the plaque and gingivitis scores, so the key to long-term success of the program is to maintain the subjects' motivation to make oral hygiene a part of their daily routine and thus sustain this improvement (Tab. 1, Fig. 4, Ref. 12). Full Text (Free, PDF) www.bmj.sk.

  12. Validity and Reliability of the Persian Version of the Dysphagia Handicap Index (DHI).

    Science.gov (United States)

    Asadollahpour, Faezeh; Baghban, Kowsar; Asadi, Mozhgan

    2015-05-01

    The Dysphagia Handicap Index (DHI) is one of the instruments used for measuring a dysphagic patient's self-assessment. In some ways, it reflects the patient's quality of life. Although it has been recognized and widely applied in English speaking populations, it has not been used in its present forms in Persian speaking countries. The purpose of this study was to adapt a Persian version of the DHI and to evaluate its validity, consistency, and reliability in the Persian population with oropharyngeal dysphagia. Some stages for cross-cultural adaptation were performed, which consisted in translation, synthesis, back translation, review by an expert committee, and final proof reading. The generated Persian DHI was administered to 85 patients with oropharyngeal dysphagia and 89 control subjects at Zahedan city between May 2013 and August 2013. The patients and control subjects answered the same questionnaire 2 weeks later to verify the test-retest reliability. Internal consistency and test-retest reliability were evaluated. The results of the patients and the control group were compared. The Persian DHI showed good internal consistency (Cronbach's alpha coefficients range from 0.82 to 0.94). Also, good test-retest reliability was found for the total scores of the Persian DHI (r=0.89). There was a significant difference between the DHI scores of the control group and those of the oropharyngeal dysphagia group (P‹0.001). The Persian version of the DHI achieved Face and translation validity. This study demonstrated that the Persian DHI is a valid tool for self-assessment of the handicapping effects of dysphagia on the physical, functional, and emotional aspects of patient life and can be a useful tool for screening and treatment planning for the Persian-speaking dysphagic patients, regardless of the cause or the severity of the dysphagia.

  13. Validity and Reliability of the Persian Version of the Dysphagia Handicap Index (DHI

    Directory of Open Access Journals (Sweden)

    faezeh asadollahpour

    2015-05-01

    Full Text Available Introduction: The Dysphagia Handicap Index (DHI is one of the instruments used for measuring a dysphagic patient’s self-assessment. In some ways, it reflects the patient’s quality of life. Although it has been recognized and widely applied in English speaking populations, it has not been used in its present forms in Persian speaking countries. The purpose of this study was to adapt a Persian version of the DHI and to evaluate its validity, consistency, and reliability in the Persian population with oropharyngeal dysphagia.   Materials and Methods: Some stages for cross-cultural adaptation were performed, which consisted in translation, synthesis, back translation, review by an expert committee, and final proof reading. The generated Persian DHI was administered to 85 patients with oropharyngeal dysphagia and 89 control subjects at Zahedan city between May 2013 and August 2013. The patients and control subjects answered the same questionnaire 2 weeks later to verify the test-retest reliability. Internal consistency and test-retest reliability were evaluated. The results of the patients and the control group were compared.   Results: The Persian DHI showed good internal consistency (Cronbach’s alpha coefficients range from 0.82 to 0.94. Also, good test-retest reliability was found for the total scores of the Persian DHI (r=0.89. There was a significant difference between the DHI scores of the control group and those of the oropharyngeal dysphagia group (P‹0.001.   Conclusion:  The Persian version of the DHI achieved Face and translation validity. This study demonstrated that the Persian DHI is a valid tool for self-assessment of the handicapping effects of dysphagia on the physical, functional, and emotional aspects of patient life and can be a useful tool for screening and treatment planning for the Persian-speaking dysphagic patients, regardless of the cause or the severity of the dysphagia.

  14. Endoscopic laser thyroarytenoid myoneurectomy in patients with adductor spasmodic dysphonia: a pilot study on long-term outcome on voice quality.

    Science.gov (United States)

    Tsuji, Domingos Hiroshi; Takahashi, Marystella Tomoe; Imamura, Rui; Hachiya, Adriana; Sennes, Luiz Ubirajara

    2012-09-01

    Adductor spasmodic dysphonia (ADSD) is a focal laryngeal dystonia, which compromises greatly the quality of life of the patients involved. It is a severe vocal disorder characterized by spasms of laryngeal muscles during speech, producing phonatory breaks, forced, strained and strangled voice. Its symptoms result from involuntary and intermittent contractions of thyroarytenoid muscle during speech, which causes vocal fold to strain, pressing each vocal fold against the other and increasing glottic resistance. Botulinum toxin injection remains the gold-standard treatment. However, as injections should be repeated periodically leading to voice quality instability, a more definitive procedure would be desirable. In this pilot study we report the long-term vocal quality results of endoscopic laser thyroarytenoid myoneurectomy. Prospective study. Surgery was performed in 15 patients (11 females and four males), aged between 29 and 73 years, diagnosed with ADSD. Voice Handicap Index (VHI) was obtained before and after surgery (median 31 months postoperatively). A significant improvement in VHI was observed after surgery, as compared with baseline values (P=0.001). The median and interquartile range for preoperative VHI was 99 and 13, respectively and 24 and 42, for postoperative VHI. Subjective improvement of voice as assessed by the patients showed median improvement of 80%. Because long-term follow-up showed significant improvement of voice quality, this innovative surgical technique seems a satisfactory alternative treatment of ADSD patients who seek a definite improvement of their condition. Copyright © 2012 The Voice Foundation. Published by Mosby, Inc. All rights reserved.

  15. Disease-specific self-efficacy in spasmodic dysphonia patients.

    Science.gov (United States)

    Hu, Amanda; Isetti, Derek; Hillel, Allen D; Waugh, Patricia; Comstock, Bryan; Meyer, Tanya K

    2013-03-01

    Self-efficacy (SE) is an optimistic self-belief that one can perform a novel task. This concept involves empowerment, self-esteem, and adaptation to a stressful situation. SE is a strong predictor of health behaviors. Our objectives were to study SE in spasmodic dysphonia (SD) and to develop a disease-specific SE-SD scale. Prospective study. Academic hospital. Disease-specific SE-SD items were developed with laryngologists, speech pathologists, and SD patients. These items, General SE Scale, Voice Handicap Index-10 (VHI-10), Consensus Auditory Perceptual Evaluation of Voice (CAPE-V), and Hospital Anxiety and Depression Scale (HADS), were administered to SD patients who presented for botulinum toxin injections. One hundred forty-five SD patients (mean age 59.5 ± 13.6 years) had a general SE score (Cronbach's α = 0.894) of 33.4 ± 5.2 out of 40. This was negatively correlated with HADS-A (r = -0.42, P < 0.001) and HADS-D (r = -0.42, P < .001), but not correlated with VHI-10 (r = -0.098, P = .243) and CAPE-V (r = -0.047, P = .57). Factor analysis selected 8 items from the general SE scale and 5 disease-specific SE-SD items to generate a 13-item disease-specific SE-SD scale (Cronbach's α = 0.907). Disease-specific SE-SD score was 42.1 ± 6.9 out of 52 and was negatively correlated with VHI-10 (r = -0.19, P = .005), HADS-A (r = -0.43, P < .001), and HADS-D (r = -0.57, P < .001), but not correlated with CAPE-V (r = -0.024, P = .60). SD patients established on botulinum toxin injections have high degrees of general and disease-specific SE. Patients with higher SE-SD demonstrate lower vocal handicap and lower levels of anxiety and depression. A 13-item disease-specific SE-SD scale has been developed.

  16. The Influence of Sleep Disorders on Voice Quality.

    Science.gov (United States)

    Rocha, Bruna Rainho; Behlau, Mara

    2017-09-19

    To verify the influence of sleep quality on the voice. Descriptive and analytical cross-sectional study. Data were collected by an online or printed survey divided in three parts: (1) demographic data and vocal health aspects; (2) self-assessment of sleep and vocal quality, and the influence that sleep has on voice; and (3) sleep and voice self-assessment inventories-the Epworth Sleepiness Scale (ESS), the Pittsburgh Sleep Quality Index (PSQI), and the Voice Handicap Index reduced version (VHI-10). A total of 862 people were included (493 women, 369 men), with a mean age of 32 years old (maximum age of 79 and minimum age of 18 years old). The perception of the influence that sleep has on voice showed a difference (P influence a voice handicap are vocal self-assessment, ESS total score, and self-assessment of the influence that sleep has on voice. The absence of daytime sleepiness is a protective factor (odds ratio [OR] > 1) against perceived voice handicap; the presence of daytime sleepiness is a damaging factor (OR influences voice. Perceived poor sleep quality is related to perceived poor vocal quality. Individuals with a voice handicap observe a greater influence of sleep on voice than those without. Copyright © 2017 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  17. Multidisciplinary approach in the treatment of T1 glottic cancer. The role of patient preference in an homogenous patient population

    International Nuclear Information System (INIS)

    Dinapoli, Nicola; Parrilla, Claudio; Galli, Jacopo

    2010-01-01

    To compare oncological outcome and voice quality among a uniform and well-defined subset of patients with T1 glottic carcinoma. Patients, affected by laryngeal glottic carcinoma, treated by laser CO 2 surgery or radiotherapy, have been analyzed. Overall survival and disease-free survival were calculated. In order to verify differences in functional outcomes and voice quality, all patients were interviewed during their last follow-up visit during 2009 using the VHI (Voice Handicap Index) questionnaire. The data were analyzed using the MedCalc software. A total of 143 patients were analyzed: 73 underwent surgery and 70 underwent radiotherapy. No statistically significant differences were found between the two groups in terms of overall survival and disease-free survival; dividing patients into stages T1a and T1b also made no difference. In order to evaluate the differences in outcomes for surgery and radiotherapy, patients were interviewed using the VHI questionnaire. Better scores for each category in the VHI were found for patients receiving radiotherapy compared to surgery (physical: p = 0.0023; functional: p < 0.0001; environmental: p < 0.001). The median VHI score for radiotherapy patients was 4, while for surgical patients it was 18 (p < 0.0001). This study confirms the well-known knowledge that results from radiotherapy and surgery in early glottic cancer treatment are equivalent. Furthermore, the role of patient preference in the treatment modality choice and the value of a multidisciplinary approach for a detailed and multi-oriented discussion with the patient are outlined. (orig.)

  18. Multidisciplinary approach in the treatment of T1 glottic cancer. The role of patient preference in an homogenous patient population

    Energy Technology Data Exchange (ETDEWEB)

    Dinapoli, Nicola [Catholic Univ. of the Sacred Heart, Rome (Italy). Dept. of Radiation Oncology; Parrilla, Claudio; Galli, Jacopo [Catholic Univ. of the Sacred Heart, Rome (IT). Dept. of Otorhinolaryngoiatry] (and others)

    2010-11-15

    To compare oncological outcome and voice quality among a uniform and well-defined subset of patients with T1 glottic carcinoma. Patients, affected by laryngeal glottic carcinoma, treated by laser CO{sub 2} surgery or radiotherapy, have been analyzed. Overall survival and disease-free survival were calculated. In order to verify differences in functional outcomes and voice quality, all patients were interviewed during their last follow-up visit during 2009 using the VHI (Voice Handicap Index) questionnaire. The data were analyzed using the MedCalc software. A total of 143 patients were analyzed: 73 underwent surgery and 70 underwent radiotherapy. No statistically significant differences were found between the two groups in terms of overall survival and disease-free survival; dividing patients into stages T1a and T1b also made no difference. In order to evaluate the differences in outcomes for surgery and radiotherapy, patients were interviewed using the VHI questionnaire. Better scores for each category in the VHI were found for patients receiving radiotherapy compared to surgery (physical: p = 0.0023; functional: p < 0.0001; environmental: p < 0.001). The median VHI score for radiotherapy patients was 4, while for surgical patients it was 18 (p < 0.0001). This study confirms the well-known knowledge that results from radiotherapy and surgery in early glottic cancer treatment are equivalent. Furthermore, the role of patient preference in the treatment modality choice and the value of a multidisciplinary approach for a detailed and multi-oriented discussion with the patient are outlined. (orig.)

  19. Voice-related of quality of life after treatment for laryngeal cancer

    International Nuclear Information System (INIS)

    Oridate, Nobuhiko; Furuta, Yasushi; Homma, Akihiro; Suzuki, Seigo; Suzuki, Fumiyuki; Hatakeyama, Hiromitsu; Taki, Shigenari; Sakashita, Tomohiro; Fukuda, Satoshi

    2007-01-01

    There are many methods of treating laryngeal cancers: definitive irradiation with or without concurrent chemotherapy, endoscopic laser surgery, partial surgery techniques, and total laryngectomy. Few studies have been reported on vocal function and quality of life of patients after the definitive treatment for laryngeal cancer, using single voice related QOL measures. The aim of this study was to examine voice related QOL in patients treated with various modalities using a Voice-Related Quality of Life (V-RQOL) questionnaire as well as Voice Handicap Index-10 (VHI-10) questionnaire. Between August 2006 and May 2007, survey data on voice utilizing the V-RQOL and VHI-10 were obtained from a total of 130 patients who had received definitive treatment for laryngeal cancers with follow-up at the Hokkaido University Hospital, and who were alive with no evidence of malignancy at the time of survey. Mean V-RQOL scores of the patients who received radiation therapy (n=63), chemoradiotherapy (n=29), laser resection (n=14) and total laryngectomy (n=27) as the final treatment for laryngeal cancer were 92.6, 92.9, 85.5, and 68.4, respectively. Mean VHI-10 values were 2.87, 2.34, 5.43, and 11.26. Such measures of quality of life are important endpoints to help judge the overall effectiveness of treatment options for laryngeal cancers. (author)

  20. Vocal Function Exercises for Muscle Tension Dysphonia: Auditory-Perceptual Evaluation and Self-Assessment Rating.

    Science.gov (United States)

    Jafari, Narges; Salehi, Abolfazl; Izadi, Farzad; Talebian Moghadam, Saeed; Ebadi, Abbas; Dabirmoghadam, Payman; Faham, Maryam; Shahbazi, Mehdi

    2017-07-01

    Muscle tension dysphonia (MTD) is a functional dysphonia, which appears with an excessive tension in the intrinsic and extrinsic laryngeal musculatures. MTD can affect voice quality and quality of life. The purpose of the present study was to assess the effectiveness of vocal function exercises (VFEs) on perceptual and self-assessment ratings in a group of 15 subjects with MTD. The study comprised 15 subjects with MTD (8 men and 7 women, mean age 39.8 years, standard deviation 10.6, age range 24-62 years). All participants were native Persian speakers who underwent a 6-week course of VFEs. The Voice Handicap Index (VHI) (the self-assessment scale) and Grade, Roughness, Breathiness, Asthenia, Strain (GRBAS) scale (perceptual rating of voice quality) were used to compare pre- and post-VFEs. GRBAS data of patients before and after VFEs were compared using Wilcoxon signed-rank test, and VHI data of patients pre- and post-VFEs were compared using Student paired t test. These perceptual parameters showed a statistically significant improvement in subjects with MTD after voice therapy (significant at P self-assessment ratings measurements (with the VHI). As a result, the data provide evidence regarding the efficacy of VFEs in the treatment of patients with MTD. Copyright © 2017 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  1. Impact of Perioperative Voice Therapy on Outcomes in the Surgical Management of Vocal Fold Cysts.

    Science.gov (United States)

    Tibbetts, Kathleen M; Dominguez, Laura M; Simpson, C Blake

    2018-05-01

    Vocal fold cysts are benign mid-membranous lesions of the true vocal fold, classified as mucus retention or epidermal inclusion cysts. Treatment is surgical excision with or without postoperative voice therapy. A retrospective review was performed of the demographics, treatment approach, and outcomes of patients treated for vocal fold cysts between 2009 and 2014. Voice Handicap Index (VHI)-10 scores before and after treatment were compared using the Wilcoxon Rank-Sum test and the two-tailed Student's t test. Videostroboscopy examinations were reviewed for posttreatment changes in vibratory characteristics of the vocal folds. Twenty-five patients were identified, and one was excluded for incomplete records. Mean age was 41.9 years (66.7% female), and mean follow-up time was 5.58 months. Microflap excision was pursued by 21/24 (87.5%) patients, with 14 patients (58.3%) undergoing perioperative voice therapy. One cyst recurred. Two patients elected for observation, and their cysts persisted. VHI-10 decreased from 23.8 to 6.6 (P Vocal fold cysts impact mucosal wave and glottic closure. Surgical excision resulted in low rates of recurrence, and in improvement in the mucosal wave and VHI-10. Perioperative voice therapy did not offer a significant benefit. Mucus retention cysts were the majority, in contrast to other published studies. Copyright © 2018 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  2. How do voice restoration methods affect the psychological status of patients after total laryngectomy?

    Science.gov (United States)

    Saltürk, Z; Arslanoğlu, A; Özdemir, E; Yıldırım, G; Aydoğdu, İ; Kumral, T L; Berkiten, G; Atar, Y; Uyar, Y

    2016-03-01

    This study investigated the relationship between psychological well-being and different voice rehabilitation methods in total laryngectomy patients. The study enrolled 96 patients who underwent total laryngectomy. The patients were divided into three groups according to the voice rehabilitation method used: esophageal speech (24 patients); a tracheoesophageal fistula and Provox 2 voice prosthesis (57 patients); or an electrolarynx (15 patients). The participants were asked to complete the Turkish version of the Voice Handicap Index-10 (VHI-10) to assess voice problems. They were also asked to complete the Turkish version of the Perceived Stress Scale (PSS), and the Hospital Anxiety and Depression Scale (HADS). The test scores of the three groups were compared statistically. Patients who used esophageal speech had a mean VHI-10 score of 10.25 ± 3.22 versus 19.42 ± 5.56 and 17.60 ± 1.92 for the tracheoesophageal fistula and Provox 2 and electrolarynx groups respectively, reflecting better perception of their voice. They also had a PSS score of 11.38 ± 3.92, indicating that they felt less stressed in comparison with the tracheoesophageal fistula and Provox 2 and electrolarynx groups, which scored 18.84 ± 5.50 and 16.20 ± 3.49 respectively. The HADS scores of the groups were not different, indicating that the patients' anxiety and depression status did not vary. Patients who used esophageal speech perceived less stress and were less handicapped by their voice.

  3. Self-handicapping and burnout.

    Science.gov (United States)

    Akin, Ahmet

    2012-02-01

    Self-handicapping is a process containing strategies of externalization in which an individual can excuse failure and internalize success. This study investigated the relationship of self-handicapping with measures of burnout. The Self-handicapping Scale and the Maslach Burnout Inventory were administered to 309 university students. Self-handicapping was positively correlated to emotional exhaustion, lowered personal accomplishment, and depersonalization. A structural equation model fit the data well and accounted for 20% of the variance in emotional exhaustion, 14% in lowered personal accomplishment, and 10% in depersonalization.

  4. Voice deviation, dysphonia risk screening and quality of life in individuals with various laryngeal diagnoses

    Science.gov (United States)

    Nemr, Katia; Cota, Ariane; Tsuji, Domingos; Simões-Zenari, Marcia

    2018-01-01

    OBJECTIVES: To characterize the voice quality of individuals with dysphonia and to investigate possible correlations between the degree of voice deviation (D) and scores on the Dysphonia Risk Screening Protocol-General (DRSP), the Voice-Related Quality of Life (V-RQOL) measure and the Voice Handicap Index, short version (VHI-10). METHODS: The sample included 200 individuals with dysphonia. Following laryngoscopy, the participants completed the DRSP, the V-RQOL measure, and the VHI-10; subsequently, voice samples were recorded for auditory-perceptual and acoustic analyses. The correlation between the score for each questionnaire and the overall degree of vocal deviation was analyzed, as was the correlation among the scores for the three questionnaires. RESULTS: Most of the participants (62%) were female, and the mean age of the sample was 49 years. The most common laryngeal diagnosis was organic dysphonia (79.5%). The mean D was 59.54, and the predominance of roughness had a mean of 54.74. All the participants exhibited at least one abnormal acoustic aspect. The mean questionnaire scores were DRSP, 44.7; V-RQOL, 57.1; and VHI-10, 16. An inverse correlation was found between the V-RQOL score and D; however, a positive correlation was found between both the VHI-10 and DRSP scores and D. CONCLUSION: A predominance of adult women, organic dysphonia, moderate voice deviation, high dysphonia risk, and low to moderate quality of life impact characterized our sample. There were correlations between the scores of each of the three questionnaires and the degree of voice deviation. It should be noted that the DRSP monitored the degree of dysphonia severity, which reinforces its applicability for patients with different laryngeal diagnoses. PMID:29538494

  5. Costs of self-handicapping.

    Science.gov (United States)

    Zuckerman, Miron; Tsai, Fen-Fang

    2005-04-01

    Four studies examined the relation of trait self-handicapping with health-related measures. Study 1 showed that, over time, self-handicapping and maladjustment reinforce each other. Study 2 showed that self-handicappers reported a loss in competence satisfaction which, in turn, mediated the relation of self-handicapping with negative mood. Study 3 found that, over time, self-handicappers report an increase in substance use. Study 4 showed that self-handicappers reported a loss in intrinsic motivation for their jobs. It was suggested that people with unstable (or contingent) self-esteem use self-handicapping to bolster a fragile self-concept.

  6. Quality of life of patients with recurrent respiratory papillomatosis.

    Science.gov (United States)

    San Giorgi, Michel R M; Aaltonen, Leena-Maija; Rihkanen, Heikki; Tjon Pian Gi, Robin E A; van der Laan, Bernard F A M; Hoekstra-Weebers, Josette E H M; Dikkers, Frederik G

    2017-08-01

    Recurrent respiratory papillomatosis (RRP) is a disease with a high disease burden. Few studies have assessed quality of life (QoL) of RRP patients. This study compares QoL of these patients with controls. Associations between QoL and sociodemographic and illness-related factors are examined, as is uptake of psychosocial care and speech therapy. Prospective cross-sectional questionnaire research. Ninety-one RRP patients (response = 67%) from two university hospitals in the Netherlands and Finland completed the following patient reported outcome measures: (HADS), 15-dimensional health-related quality-of-life scale (15D), Voice Handicap Index (VHI) and the RAND 36-item health-related quality-of-life survey instrument (RAND-36) assessing health-related QoL and voice handicap, and they provided sociodemographic, illness-related, and allied healthcare use. Descriptive analyses, χ 2 tests, t tests, analysis of variance tests, and Pearson correlations were computed to describe the study population and to examine differences between groups. RRP patients had significantly higher mean scores on depression, health-related QoL (15D) and on voice problems (VHI), and significantly lower mean scores on anxiety than controls. Dutch patients had more pain and a decreased general health perception (RAND-36) than controls. Dutch patients and older patients were more depressed, women were more anxious, older patients had lower health-related QoL, and smoking was significantly associated with voice handicap. Patients who had received psychosocial care had significantly higher HADS-depression mean scores than patients who did not receive psychosocial care. Having RRP has significant effect on voice-related QoL and depression, but has no negative effect on anxiety and health-related QoL. Risk factors for decreased functioning are different than previously hypothesized by many authors. Prevention should be aimed at these risk factors. 4. Laryngoscope, 127:1826-1831, 2017. © 2016 The

  7. Biopsychosocial impact of the voice in relation to the psychological features in female student teachers.

    NARCIS (Netherlands)

    Meulenbroek, L.F.P.; Thomas, G.; Kooijman, P.G.C.; Jong, F.I.C.R.S. de

    2010-01-01

    OBJECTIVE: The aim of the study was to assess biopsychosocial impact of the voice in relation to the psychological features in female student teachers. METHODS: This research was a cross-sectional study in 755 student teachers using general questionnaires, the Voice Handicap Inventory (VHI), Type D

  8. "I know you self-handicapped last exam": gender differences in reactions to self-handicapping.

    Science.gov (United States)

    Hirt, Edward R; McCrea, Sean M; Boris, Hillary I

    2003-01-01

    Past research has shown that self-handicapping involves the trade-off of ability-related attributional benefits for interpersonal costs. Study 1 examined whether perceiver or target sex moderates impressions of self-handicapping targets. Although target sex was not an important factor, female perceivers were consistently more critical of behavioral self-handicappers. Two additional studies replicated this gender difference with variations of the handicap. Study 3 examined the motives inferred by perceivers and found that women not only view self-handicappers as more unmotivated but also report greater suspicion of self-handicapping motives; furthermore, these differences in perceived motives mediated sex differences in reactions to self-handicappers. Implications for the effectiveness of self-handicapping as an impression management strategy are discussed.

  9. Psychological effects of dysphonia in voice professionals.

    Science.gov (United States)

    Salturk, Ziya; Kumral, Tolgar Lutfi; Aydoğdu, Imran; Arslanoğlu, Ahmet; Berkiten, Güler; Yildirim, Güven; Uyar, Yavuz

    2015-08-01

    To evaluate the psychological effects of dysphonia in voice professionals compared to non-voice professionals and in both genders. Cross-sectional analysis. Forty-eight 48 voice professionals and 52 non-voice professionals with dysphonia were included in this study. All participants underwent a complete ear, nose, and throat examination and an evaluation for pathologies that might affect vocal quality. Participants were asked to complete the Turkish versions of the Voice Handicap Index-30 (VHI-30), Perceived Stress Scale (PSS), and the Hospital Anxiety and Depression Scale (HADS). HADS scores were evaluated as HADS-A (anxiety) and HADS-D (depression). Dysphonia status was evaluated by grade, roughness, breathiness, asthenia, and strain (GRBAS) scale perceptually. The results were compared statistically. Significant differences between the two groups were evident when the VHI-30 and PSS data were compared (P = .00001 and P = .00001, respectively). However, neither HADS score (HADS-A and HADS-D) differed between groups. An analysis of the scores in terms of sex revealed that females had significantly higher PSS scores (P = .006). The GRBAS scale revealed no difference between groups (P = .819, .931, .803, .655, and .803, respectively). No between-sex differences in the VHI-30 or HADS scores were evident We found that voice professionals and females experienced more stress and were more dissatisfied with their voices. 4. © 2015 The American Laryngological, Rhinological and Otological Society, Inc.

  10. The Effectiveness of the Comprehensive Voice Rehabilitation Program Compared With the Vocal Function Exercises Method in Behavioral Dysphonia: A Randomized Clinical Trial.

    Science.gov (United States)

    Pedrosa, Vanessa; Pontes, Antônio; Pontes, Paulo; Behlau, Mara; Peccin, Stella Maria

    2016-05-01

    To evaluate the effectiveness of the Comprehensive Voice Rehabilitation Program (CVRP) compared with Vocal Function Exercises (VFEs) to treat functional dysphonia. This is a randomized blinded clinical trial. Eighty voice professionals presented with voice complaints for more than 6 months with a functional dysphonia diagnosis. Subjects were randomized into two voice treatment groups: CVRP and VFE. The rehabilitation program consisted of six voice treatment sessions and three assessment sessions performed before, immediately after, and 1 month after treatment. The outcome measures were self-assessment protocols (Voice-Related Quality of Life [V-RQOL] and Voice Handicap Index [VHI]), perceptual evaluation of vocal quality, and a visual examination of the larynx, both blinded. The randomization process produced comparable groups in terms of age, gender, signs, and symptoms. Both groups had positive outcome measures. The CVRP effect size was 1.09 for the V-RQOL, 1.17 for the VHI, 0.79 for vocal perceptual evaluation, and 1.01 for larynx visual examination. The VFE effect size was 0.86 for the V-RQOL, 0.62 for the VHI, 0.48 for the vocal perceptual evaluation, and 0.51 for larynx visual examination. Only 10% of the patients were lost over the study. Both treatment programs were effective. The probability of a patient improving because of the CVRP treatment was similar to that of the VFE treatment. Copyright © 2016 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  11. The Role of Occupational Voice Demand and Patient-Rated Impairment in Predicting Voice Therapy Adherence.

    Science.gov (United States)

    Ebersole, Barbara; Soni, Resha S; Moran, Kathleen; Lango, Miriam; Devarajan, Karthik; Jamal, Nausheen

    2018-05-01

    Examine the relationship among the severity of patient-perceived voice impairment, perceptual dysphonia severity, occupational voice demand, and voice therapy adherence. Identify clinical predictors of increased risk for therapy nonadherence. A retrospective cohort study of patients presenting with a chief complaint of persistent dysphonia at an interdisciplinary voice center was done. The Voice Handicap Index-10 (VHI-10) and the Voice-Related Quality of Life (V-RQOL) survey scores, clinician rating of dysphonia severity using the Grade score from the Grade, Roughness Breathiness, Asthenia, and Strain scale, occupational voice demand, and patient demographics were tested for associations with therapy adherence, defined as completion of the treatment plan. Classification and Regression Tree (CART) analysis was performed to establish thresholds for nonadherence risk. Of 166 patients evaluated, 111 were recommended for voice therapy. The therapy nonadherence rate was 56%. Occupational voice demand category, VHI-10, and V-RQOL scores were the only factors significantly correlated with therapy adherence (P demand are significantly more likely to be nonadherent with therapy than those with high occupational voice demand (P 40 is a significant cutoff point for predicting therapy nonadherence (P demand and patient perception of impairment are significantly and independently correlated with therapy adherence. A VHI-10 score of ≤9 or a V-RQOL score of >40 is a significant cutoff point for predicting nonadherence risk. Copyright © 2018 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  12. Reliability and Validity of the Turkish Version of the Voice-Related Quality of Life Measure.

    Science.gov (United States)

    Tezcaner, Zahide Çiler; Aksoy, Songül

    2017-03-01

    This study aims to test the validity and reliability of the Turkish version of the Voice-Related Quality of Life (V-RQOL) questionnaire. This is a nonrandomized, prospective study with control group. The questionnaire was administered to 249 individuals-130 with vocal complaint and 119 without-with a mean age of 37.8 ± 12.3 years. The Turkish version of the Voice Handicap Index (VHI) and perceptual voice evaluation measures were also administered at 2-14 days for retest reliability. The instrument was submitted to validity and reliability evaluation. The V-RQOL measure showed a strong internal consistency and test-retest reliability; the Cronbach's alpha coefficient for the overall V-RQOL was 0.969, the physical functioning domain was 0.949, and the social-emotional domain was 0.940. In the test-retest reliability test, the overall V-RQOL was found to be 0.989. The construct validity of the V-RQOL was determined based on the strength and direction of its relation to the VHI and the perceptual voice evaluation measure. The higher the VHI level, the lower the physical functioning, social-emotional, and overall score levels of the V-RQOL (r = -0.927, r = -0.912, r = -0.944, respectively; P reliability and validity and may play a crucial role in evaluating Turkish-speaking patients with voice disorders. Copyright © 2017 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  13. Factors Associated With Patient-perceived Hoarseness in Spasmodic Dysphonia Patients.

    Science.gov (United States)

    Hu, Amanda; Hillel, Al; Meyer, Tanya

    2016-11-01

    The American Academy of Otolaryngology-Head and Neck Surgery Clinical Practice Guidelines on Hoarseness distinguishes between hoarseness, which is a symptom perceived by the patient, and dysphonia, which is a diagnosis made by the clinician. Our objective was to determine factors that are associated with patient-perceived hoarseness in spasmodic dysphonia (SD) patients. Retrospective study. Adductor SD patients who presented for botulinum toxin injections from September 2011 to June 2012 were recruited. The main outcome variable, Voice Handicap Index-10 (VHI-10), was used to quantify patient-perceived hoarseness. Clinical data, Hospital Anxiety and Depression Scale (HADS), and VHI-10 were collected. Clinician-perceived dysphonia was measured by a speech-language pathologist with Consensus Auditory Perceptual Evaluation of Voice (CAPE-V). Statistical analysis included univariate analyses and multiple linear regression. One hundred thirty-nine SD patients had VHI-10 score of 26.0 ± 7.2 (mean ± standard deviation), disease duration of 10.5 + 7.0 years, CAPE-V overall score of 43.2 ± 21.8, HADS anxiety score of 6.7 ± 3.8, and HADS depression score of 3.6 ± 2.8. In univariate analyses, there were positive correlations (P dysphonia are associated with higher levels of patient-perceived hoarseness in SD patients. Hoarseness is a very personal symptom. Multiple factors determine its self-perception. Copyright © 2016 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  14. Vocal Hygiene Habits and Vocal Handicap Among Conservatory Students of Classical Singing.

    Science.gov (United States)

    Achey, Meredith A; He, Mike Z; Akst, Lee M

    2016-03-01

    This study sought to assess classical singing students' compliance with vocal hygiene practices identified in the literature and to explore the relationship between self-reported vocal hygiene practice and self-reported singing voice handicap in this population. The primary hypothesis was that increased attention to commonly recommended vocal hygiene practices would correlate with reduced singing voice handicap. This is a cross-sectional, survey-based study. An anonymous survey assessing demographics, attention to 11 common vocal hygiene recommendations in both performance and nonperformance periods, and the Singing Voice Handicap Index 10 (SVHI-10) was distributed to classical singing teachers to be administered to their students at two major schools of music. Of the 215 surveys distributed, 108 were returned (50.2%), of which 4 were incomplete and discarded from analysis. Conservatory students of classical singing reported a moderate degree of vocal handicap (mean SVHI-10, 12; range, 0-29). Singers reported considering all 11 vocal hygiene factors more frequently when preparing for performances than when not preparing for performances. Of these, significant correlations with increased handicap were identified for consideration of stress reduction in nonperformance (P = 0.01) and performance periods (P = 0.02) and with decreased handicap for consideration of singing voice use in performance periods alone (P = 0.02). Conservatory students of classical singing report more assiduous attention to vocal hygiene practices when preparing for performances and report moderate degrees of vocal handicap overall. These students may have elevated risk for dysphonia and voice disorders which is not effectively addressed through common vocal hygiene recommendations alone. Copyright © 2016 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  15. Citizens and Handicaps.

    Science.gov (United States)

    Thomas, Stanley B., Jr.

    In a speech delivered at the National Easter Seal Society's Annual Convention (1974), the author discusses progress toward full citizenship for the handicapped focusing on the roles of the Department of Health, Education, and Welfare (DHEW) and the Office for the Handicapped, Constitutional guarantees of equal rights for all citizens, and national…

  16. Self-handicapping status, claimed self-handicaps and reduced practice effort following success and failure feedback.

    Science.gov (United States)

    Thompson, T; Richardson, A

    2001-03-01

    Self-handicapping involves the strategic establishment of an impediment or obstacle to success prior to a performance situation which thereby provides a convenient excuse for poor performance. The study sought to establish that relative to low trait self-handicappers, high trait self-handicappers exposed to failure in an intellectually evaluative situation will (a) pre-emptively claim more handicaps, and (b) behaviourally self-handicap through reduced practice effort, and (c) report greater anxiety and negative affect relative to low trait self-handicappers. Participants were 72 undergraduate students, divided equally between high and low self-handicapping groups. This study utilised a 2 (self-handicapping status: high, low) x 3 (performance feedback: fail, low task importance; fail, high task importance; success) between-subjects factorial design to investigate claimed and behavioural self-handicapping through reduced practice effort. This was done by manipulating performance outcome and perceived task importance. Relative to low trait self-handicappers, high trait high self-handicappers claimed more handicaps and engaged in greater behavioural self-handicapping following failure when working on tasks that were described as potentially diagnostic of low ability. While low self-handicappers internalised their success more than their failure in the high task importance condition, high self-handicappers were undifferentiated in their attributions across performance conditions. Greater anxiety and greater negative affect were also characteristic of high self-handicappers. The study highlights the self-protective benefit of self-handicapping in sparing the individual from conclusions of low ability, and the failure of high self-handicappers to fully internalise their success. These elements and the role of uncertain estimates of ability are discussed in considering implications for intervention.

  17. Low trait self-control predicts self-handicapping.

    Science.gov (United States)

    Uysal, Ahmet; Knee, C Raymond

    2012-02-01

    Past research has shown that self-handicapping stems from uncertainty about one's ability and self-presentational concerns. The present studies suggest that low dispositional self-control is also associated with self-handicapping. In 3 studies (N = 289), the association between self-control and self-handicapping was tested. Self-control was operationalized as trait self-control, whereas self-handicapping was operationalized as trait self-handicapping in Study 1 (N = 160), self-reported self-handicapping in Study 2 (N = 74), and behavioral self-handicapping in Study 3 (N = 55). In all 3 studies, hierarchical regression analyses revealed that low self-control predicts self-handicapping, independent of self-esteem, self-doubt, social desirability, and gender. © 2012 The Authors. Journal of Personality © 2012, Wiley Periodicals, Inc.

  18. Learning Handicapped and Nonlearning Handicapped Female Juvenile Offenders: Educational and Criminal Profiles.

    Science.gov (United States)

    Fejes-Mendoza, Kathy E.; Rutherford, Robert B., Jr.

    1987-01-01

    Interviews with 30 female juvenile offenders were conducted to (1) describe their educational and criminal backgrounds and (2) describe a subgroup of learning handicapped juvenile female offenders. Nearly one third had received special education services prior to their incarceration with additional offenders diagnosed as handicapped upon entry…

  19. Teaching the Handicapped Imagination.

    Science.gov (United States)

    Sloane, Sarah

    1983-01-01

    The article describes exercises in drama and creative writing to broaden the imaginations of visually handicapped children through stories and poems with a nonvisual imagery. Examples of stories and poems written specifically for the visually handicapped are included. (Author/CL)

  20. Phonomicrosurgery in Vocal Fold Nodules: Quantification of Outcomes in Professional and Non-Professional Voice Users.

    Science.gov (United States)

    Caffier, Philipp P; Salmen, Tatjana; Ermakova, Tatiana; Forbes, Eleanor; Ko, Seo-Rin; Song, Wen; Gross, Manfred; Nawka, Tadeus

    2017-12-01

    There are few data demonstrating the specific extent to which surgical intervention for vocal fold nodules (VFN) improves vocal function in professional (PVU) and non-professional voice users (NVU). The objective of this study was to compare and quantify results after phonomicrosurgery for VFN in these patient groups. In a prospective clinical study, surgery was performed via microlaryngoscopy in 37 female patients with chronic VFN manifestations (38±12 yrs, mean±SD). Pre- and postoperative evaluations of treatment efficacy comprised videolaryngostroboscopy, auditory-perceptual voice assessment, voice range profile (VRP), acoustic-aerodynamic analysis, and voice handicap index (VHI-9i). The dysphonia severity index (DSI) was compared with the vocal extent measure (VEM). PVU (n=24) and NVU (n=13) showed comparable laryngeal findings and levels of suffering (VHI-9i 16±7 vs 17±8), but PVU had a better pretherapeutic vocal range (26.8±7.4 vs 17.7±5.1 semitones, p<0.001) and vocal capacity (VEM 106±18 vs 74±29, p<0.01). Three months postoperatively, all patients had straight vocal fold edges, complete glottal closure, and recovered mucosal wave propagation. The mean VHI-9i score decreased by 8±6 points. DSI increased from 4.0±2.4 to 5.5±2.4, and VEM from 95±27 to 108±23 (p<0.001). Both parameters correlated significantly (rs=0.82). The average vocal range increased by 4.1±5.3 semitones, and the mean speaking pitch lowered by 0.5±1.4 semitones. These results confirm that phonomicrosurgery for VFN is a safe therapy for voice improvement in both PVU and NVU who do not respond to voice therapy alone. Top-level artistic capabilities in PVU were restored, but numeric changes of most vocal parameters were considerably larger in NVU.

  1. Orthodontics for mentally handicapped patients [Orthodontie bij pati�nten met een verstandelijke handicap

    NARCIS (Netherlands)

    Remmelink, H.J.

    2006-01-01

    The mentally handicapped exhibit a 3 times higher incidence of malocclusions and related functional problems than the general population. In contrast there is little available literature relating to the orthodontic treatment of handicapped patients. Based on published articles on orthodontic

  2. Aurally Handicapped -- Research; A Selective Bibliography. Exceptional Child Bibliography Series No. 625.

    Science.gov (United States)

    Council for Exceptional Children, Reston, VA. Information Center on Exceptional Children.

    The selected bibliography of research on aurally handicapped children contains approximately 95 abstracts with indexing information explained to be drawn from the computer file of abstracts representing the Council for Exceptional Children Information Center's complete holdings as of August, 1972. Abstracts are said to be chosen using the criteria…

  3. Anatomical correlates of self-handicapping tendency.

    Science.gov (United States)

    Takeuchi, Hikaru; Taki, Yasuyuki; Nouchi, Rui; Hashizume, Hiroshi; Sekiguchi, Atsushi; Kotozaki, Yuka; Nakagawa, Seishu; Miyauchi, Carlos M; Sassa, Yuko; Kawashima, Ryuta

    2013-04-01

    Self-handicaps are obstacles created (or claimed) by individuals in anticipation of failure. Despite the vast amount of psychological research on self-handicapping tendency, the neural mechanisms underlying individual differences in self-handicapping tendency in young and healthy subjects are unknown. We used voxel-based morphometry (VBM) and a questionnaire to measure individual self-handicapping tendency, and we investigated the association between regional gray matter volume (rGMV) and self-handicapping tendency across the brain in healthy young adult (mean age, 21.3 years; standard deviation - SD = 1.9) men (n = 94) and women (n = 91). We discovered that higher individual self-handicapping tendency was associated with larger rGMV in the subgenual cingulate gyrus (sgCG). A wide range of previous studies showed (a) the opposite pattern is seen in the association between rGMV in the sgCG and depression and (b) this area is active when negative emotions are suppressed. The present results suggest that the sgCG is also involved in self-handicapping, which is a behavior thought to be engaged in the protection of self-esteem. Copyright © 2013 Elsevier Ltd. All rights reserved.

  4. The Self-Handicapping Phenomenon.

    Science.gov (United States)

    Ferguson, Janet M.; Dorman, Jeffrey

    2002-01-01

    Asserts that self-handicapping students protect their self-images by deliberately not trying to achieve for fear of trying hard, failing anyway, and appearing "dumb." Surveys of high school students examined three areas of students' perceptions (self-handicapping, academic self-efficacy, and classroom environment). The correlation…

  5. Impacto na qualidade vocal da miectomia parcial e neurectomia endoscópica do músculo tireoaritenóideo em paciente com disfonia espasmódica de adução Impact in vocal quality in partial myectomy and neurectomy endoscopic of thyroarytenoid muscle in patients with adductor spasmodic dysphonia

    Directory of Open Access Journals (Sweden)

    Domingos Hiroshi Tsuji

    2006-04-01

    Full Text Available A disfonia espasmódica de adução é um distúrbio vocal grave, caracterizado por espasmos dos músculos laríngeos durante a fonação, produzindo voz quebrada, tensa, forçada e estrangulada. Seus sintomas decorrem da contração intermitente e involuntária dos músculos tireoaritenóideos durante a fonação, o que resulta em pregas vocais tensas, pressionadas uma contra a outra, e no aumento da resistência glótica. OBJETIVO: Apresentar os resultados preliminares do impacto na qualidade vocal da cirurgia de Neurectomia do ramo tireoaritenóideo do laríngeo inferior, via endoscópica, associada à miectomia parcial do músculo tireoaritenóideo com laser de CO2. MATERIAL E MÉTODO: A cirurgia foi realizada em 7 pacientes (6 mulheres e 1 homem, com idades variando entre 22 e 75 anos, com diagnóstico de disfonia espasmódica de adução. Os pacientes foram submetidos ao VHI (Voice Handicap Index no pré e pós-operatório. RESULTEDOS E CONCLUSÃO: A melhora vocal foi conseguida em todos os pacientes estudados não ocorrendo deterioração da qualidade vocal ao longo do período pós-operatório. Houve uma diferença evidente no VHI antes e após a cirurgia. Essa técnica cirúrgica mostrou-se eficaz e inovadora no tratamento da disfonia espasmódica de adução.Impact in vocal quality in partial myectomy and neurectomy endoscopic of thyroarytenoid muscle in patients with adductor spasmodic dysphonia the adductor spasmodic dysphonia is a severe vocal disorder characterized by muscle laryngeal spasms during speech, producing phonatory breaks, forced, strained and strangled voice. Its symptoms come from involuntary and intermittent contractions of thyroarytenoid muscle during speech, which causes vocal fold strain, pressed one against another and increased glottic resistance. AIM: report the results in the impact in vocal quality in neurectomy of the thyroarytenoid branch of the inferior laryngeal nerve by endoscopic route associated with

  6. Handicap questionnaires: what do they assess?

    NARCIS (Netherlands)

    Cardol, M.; Brandsma, J. W.; de Groot, I. J.; van den Bos, G. A.; de Haan, R. J.; de Jong, B. A.

    1999-01-01

    There is an increasing need to get insight into the social and societal impact of chronic conditions on a person's life, i.e. person-perceived handicap. The purpose of this study is to report how current handicap questionnaires assess handicap. A literature search using both Medline and the database

  7. Handicapping: the effects of its source and frequency.

    Science.gov (United States)

    McElroy, James C; Crant, J Michael

    2008-07-01

    Using a sample of 246 working adults, the authors created a 2 x 2 x 2 experimental design to isolate the influence of performance outcome, source of handicapping, and frequency of handicapping on reactions to handicapping in organizations. Dependent measures were observers' allocations of credit/blame, interpersonal affect, and the perceived credibility of the explanation. Results showed direct effects on observer impressions for all 3 independent variables, along with a significant Source x Frequency interaction. Handicapping information presented by others yielded more favorable observer impressions than did self-handicapping, and frequent handicapping decreased observer impressions. The least credible handicapping strategy was multiple self-handicaps. A significant 3-way interaction showed that source and frequency affected perceived credibility differently, depending upon whether actual performance was a success or a failure.

  8. Voice Outcomes of Adults Diagnosed with Pediatric Vocal Fold Nodules and Impact of Speech Therapy.

    Science.gov (United States)

    Song, Brian H; Merchant, Maqdooda; Schloegel, Luke

    2017-11-01

    Objective To evaluate the voice outcomes of adults diagnosed with vocal fold nodules (VFNs) as children and to assess the impact of speech therapy on long-term voice outcomes. Study Design Prospective cohort study. Setting Large health care system. Subjects and Methods Subjects diagnosed with VFNs as children between the years 1996 and 2008 were identified within a medical record database of a large health care system. Included subjects were 3 to 12 years old at the time of diagnosis, had a documented laryngeal examination within 90 days of diagnosis, and were ≥18 years as of December 31, 2014. Qualified subjects were contacted by telephone and administered the Vocal Handicap Index-10 (VHI-10) and a 15-item questionnaire inquiring for confounding factors. Results A total of 155 subjects were included, with a mean age of 21.4 years (range, 18-29). The male:female ratio was 2.3:1. Mean VHI-10 score for the entire cohort was 5.4. Mean VHI-10 scores did not differ between those who received speech therapy (6.1) and those who did not (4.5; P = .08). Both groups were similar with respect to confounding risk factors that can contribute to dysphonia, although the no-therapy group had a disproportionately higher number of subjects who consumed >10 alcoholic drinks per week ( P = .01). Conclusion The majority of adults with VFNs as children will achieve a close-to-normal voice quality when they reach adulthood. In our cohort, speech therapy did not appear to have an impact on the long-term voice outcomes.

  9. Frontal Anterior Laryngectomy with Epiglottic Reconstruction (Tucker’s Operation: Oncologic and Functional Results

    Directory of Open Access Journals (Sweden)

    Recep Yağız

    2012-03-01

    Full Text Available Objective: To evaluate functional and oncological results of patients who were treated with frontal anterior laryngectomy with epiglottic reconstruction (Tucker’s operation.Material and Methods: From September 1985 to November 2009, 58 patients whose early glottic carcinomas were operated on with Tucker’s operation. The time of decannulation, nasogastric tube removal, hospitalization and oncological results were analyzed. Acoustic analysis and Voice Handicap Index (VHI were used to evaluate vocal function.Results: The mean time for decannulation and nasogastric tube removal were 11.8±7.6 and 15.4±4.4 days, respectively. The mean duration of hospital stay was 19.3±6.1 days. It was found that early decannulation significantly reduced patient decannulation and hospitalization time. The 5-year overall and cause-specific actuarial survival rates were 81.5% and 96.9%, respectively. The 10-year overall and cause-specific survival rates were 67% and 92.3%, respectively. The 5-year local and nodal control rates were 95.4% and 95.2%, respectively. The mean values for jitter, shimmer and noise-to-harmonic ratio were 8.10±5.59%, 16.60±5.81% and 0.51±0.23, respectively, and these scores showed a significant increase. Total VHI score and subscale scores except VHI-emotional noted that patients had a mild level of vocal disability. Conclusion: Tucker’s operation is one of the preferred techniques in the treatment of early glottic carcinoma with its high oncologic success rate and satisfactory functional results.

  10. Vocal Parameters and Self-Perception in Individuals With Adductor Spasmodic Dysphonia.

    Science.gov (United States)

    Rojas, Gleidy Vannesa E; Ricz, Hilton; Tumas, Vitor; Rodrigues, Guilherme R; Toscano, Patrícia; Aguiar-Ricz, Lílian

    2017-05-01

    The study aimed to compare and correlate perceptual-auditory analysis of vocal parameters and self-perception in individuals with adductor spasmodic dysphonia before and after the application of botulinum toxin. This is a prospective cohort study. Sixteen individuals with a diagnosis of adductor spasmodic dysphonia were submitted to the application of botulinum toxin in the thyroarytenoid muscle, to the recording of a voice signal, and to the Voice Handicap Index (VHI) questionnaire before the application and at two time points after application. Two judges performed a perceptual-auditory analysis of eight vocal parameters with the aid of the Praat software for the visualization of narrow band spectrography, pitch, and intensity contour. Comparison of the vocal parameters before toxin application and on the first return revealed a reduction of oscillation intensity (P = 0.002), voice breaks (P = 0.002), and vocal tremor (P = 0.002). The same parameters increased on the second return. The degree of severity, strained-strangled voice, roughness, breathiness, and asthenia was unchanged. The total score and the emotional domain score of the VHI were reduced on the first return. There was a moderate correlation between the degree of voice severity and the total VHI score before application and on the second return, and a weak correlation on the first return. Perceptual-auditory analysis and self-perception proved to be efficient in the recognition of vocal changes and of the vocal impact on individuals with adductor spasmodic dysphonia under treatment with botulinum toxin, permitting the quantitation of changes along time. Copyright © 2017. Published by Elsevier Inc.

  11. Review of the Studies on Self-Handicapping

    OpenAIRE

    伊藤, 忠弘

    1992-01-01

    Since Jones & Berglas (1978) presented the conception of self-handicapping, a lot of empirical research on self-handicapping was reported. Some reseachers drew a distinction between ""acquired"" (or ""behavioral"") self-handicapping such as drug ingestion, alcohol consumption, effort reduction, and choosing a difficult task, and ""claimed"" (or ""self-reported"") self-handicapping such as verbal claim to be ill, socially anxious, test anxious, or in a bad mood. This paper reviewed these studi...

  12. Emotionally Handicapped Pupils: Developing Appropriate Educational Programs.

    Science.gov (United States)

    North Carolina State Dept. of Public Instruction, Raleigh. Div. for Exceptional Children.

    The document is designed to assist local school systems as they plan, develop, and improve programs for emotionally handicapped students. Sections cover the following areas: definition of emotionally handicapped students; pre-planninq for emotionally handicapped programs; identification, referral, screening, assessment, and placement; service…

  13. Estimating MCC System Dryness Index using the Vineyard Water Indicator

    Directory of Open Access Journals (Sweden)

    Conceição Marco Antônio Fonseca

    2016-01-01

    Full Text Available The Dryness Index (DI is one of the three Geoviticulture Multicriteria Climatic Classification System (MCC System indices and its calculation is based on a soil water balance approach. However, other climatic indices can be used for the same purpose. One of them is the Vineyard Water Indicator (VWI that represents the ratio between the total rainfall and the vineyard water requirement during the productive period of the culture. When compared to DI, the VWI presents a simpler calculation methodology. Therefore, the aim of the present study was to establish a model to estimate DI based on VWI values. Climate data of 80 winegrowing regions in 18 countries were used. Four regression models were evaluated: linear, quadratic, logarithmic and the Mitscherlich model. Real and simulated data were compared using the confidence coefficient (c that corresponds to the product of the correlation coefficient (r by the exactness coefficient (d. The best fit was obtained employing the quadratic model and DI can be calculated using the following equation: DI = −363.84 VWI2+ 834.47 VWI – 257.17 (R2 = 0.93, for VHI <0.905. For VHI values equal to or greater than 0.905, DI is constant and equal to 200.

  14. Office-Based Autologous Fat Injection Laryngoplasty for Glottic Insufficiency in Patients Under 50 Years Old.

    Science.gov (United States)

    Hu, Hao-Chun; Hung, Yi-Ting; Lin, Shu-Yi; Tung, Tao-Hsin; Chang, Shyue-Yih

    2018-04-17

    We sought to determine the outcomes of office-based autologous fat injection laryngoplasty in the treatment of patients under 50 years old with glottic insufficiency but without neurological problems or acquired organic lesions in the vocal fold. We conducted a retrospective chart review of consecutive patients under 50 years of age who underwent office-based autologous fat injection laryngoplasty for glottic insufficiency. None of the patients presented neurological problems or acquired organic lesions in the vocal fold. Videolaryngostroboscopic data, objective voice assessment, perceptual measurements of vocal quality, and subjective ratings of voice quality were evaluated before and after treatment. The 23 patients (7 men and 16 women) in this study presented significant improvements in phonatory function in terms of maximum phonation time, jitter, grade, asthenia, and Voice Handicap Index-10 (VHI-10) values at 3 months. Significant improvements in terms of jitter, noise-to-harmonic ratio, grade, roughness, breathiness, asthenia, and the VHI-10 values were also observed at 6 months. Glottic insufficiency in younger patients without neurological problems or acquired organic lesions in the vocal fold can be treated effectively using office-based autologous fat injection laryngoplasty. Significant improvements in phonatory function were observed even 6 months after surgery. Copyright © 2018 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  15. Single Vocal Cord Irradiation: Image Guided Intensity Modulated Hypofractionated Radiation Therapy for T1a Glottic Cancer: Early Clinical Results

    Energy Technology Data Exchange (ETDEWEB)

    Al-Mamgani, Abrahim, E-mail: a.almamgani@nki.nl [Department of Radiation Oncology – Erasmus MC Cancer Institute, University Medical Center Rotterdam, Rotterdam (Netherlands); Kwa, Stefan L.S.; Tans, Lisa; Moring, Michael; Fransen, Dennie; Mehilal, Robert; Verduijn, Gerda M. [Department of Radiation Oncology – Erasmus MC Cancer Institute, University Medical Center Rotterdam, Rotterdam (Netherlands); Baatenburg de Jong, Rob J. [Department of Otolaryngology and Head and Neck Surgery – Erasmus MC, University Medical Center Rotterdam, Rotterdam (Netherlands); Heijmen, Ben J.M.; Levendag, Peter C. [Department of Radiation Oncology – Erasmus MC Cancer Institute, University Medical Center Rotterdam, Rotterdam (Netherlands)

    2015-10-01

    Purpose: To report, from a retrospective analysis of prospectively collected data, on the feasibility, outcome, toxicity, and voice-handicap index (VHI) of patients with T1a glottic cancer treated by a novel intensity modulated radiation therapy technique developed at our institution to treat only the involved vocal cord: single vocal cord irradiation (SVCI). Methods and Materials: Thirty patients with T1a glottic cancer were treated by means of SVCI. Dose prescription was set to 16 × 3.63 Gy (total dose 58.08 Gy). The clinical target volume was the entire vocal cord. Setup verification was done by means of an online correction protocol using cone beam computed tomography. Data for voice quality assessment were collected prospectively at baseline, end of treatment, and 4, 6, and 12 weeks and 6, 12, and 18 months after treatment using VHI questionnaires. Results: After a median follow-up of 30 months (range, 7-50 months), the 2-year local control and overall survival rates were 100% and 90% because no single local recurrence was reported and 3 patients died because of comorbidity. All patients have completed the intended treatment schedule; no treatment interruptions and no grade 3 acute toxicity were reported. Grade 2 acute dermatitis or dysphagia was reported in only 5 patients (17%). No serious late toxicity was reported; only 1 patient developed temporary grade 2 laryngeal edema, and responded to a short-course of corticosteroid. The VHI improved significantly, from 33.5 at baseline to 9.5 and 10 at 6 weeks and 18 months, respectively (P<.001). The control group, treated to the whole larynx, had comparable local control rates (92.2% vs 100%, P=.24) but more acute toxicity (66% vs 17%, P<.0001) and higher VHI scores (23.8 and 16.7 at 6 weeks and 18 months, respectively, P<.0001). Conclusion: Single vocal cord irradiation is feasible and resulted in maximal local control rate at 2 years. The deterioration in VHI scores was slight and temporary and

  16. Handicap og beskæftigelse i 2006

    DEFF Research Database (Denmark)

    Høgelund, Jan; Larsen, Brian; Kløft Schademan, Helle

    Denne rapport giver ny viden om beskæftigelsessituationen for personer med handicap. Den viser, at personer med handicap er lige så tilfredse med deres arbejde, som personer uden handicap, og at de oplever at de har de samme jobkrav og de samme muligheder for indflydelse og udvikling, og de har s...

  17. Enhancing the prediction of self-handicapping.

    Science.gov (United States)

    Harris, R N; Snyder, C R; Higgins, R L; Schrag, J L

    1986-12-01

    Levels of test anxiety, Type A and Type B coronary-prone behavior, fear of failure, and covert self-esteem were studied as predictors of self-handicapping performance attributions for college women who were placed in either a high- (N = 49) or low- (N = 49) evaluative test or task situation. We hypothesized that test anxiety. Type A or Type B level, and their interaction would account for reliable variance in the prediction of self-handicapping. However, we also theorized that underlying high fear of failure and low covert self-esteem would explain the self-handicapping claims of test-anxious and Type A subjects. The results indicated that only high levels of test anxiety and high levels of covert self-esteem were related to women's self-handicapping attributions.

  18. Telecommunication for the Physically Handicapped.

    Science.gov (United States)

    Cunningham, Pat; Gose, Joan

    The paper examines the uses of telecommunication for physically handicapped students. Basic equipment, including a modem and keyboard interface, are described. The types and uses of computer bulletin boards are also described. Among benefits of telecommunications for physically handicapped students noted in the paper are social prestige,…

  19. Sexual Adjustment in the Handicapped

    Science.gov (United States)

    Glass, Dorothea D.; Padrone, Frank J.

    1978-01-01

    Major topics discussed include introduction and background of the growing recognition of sexual feelings and concerns of the handicapped, attitudes and assumptions resulting from lack of information for both the handicapped and the various disciplines that serve them, medical and psychological aspects of sexual response, and services for the…

  20. Examining the relationship between authenticity and self-handicapping.

    Science.gov (United States)

    Akin, Ahmet; Akin, Umran

    2014-12-01

    Self-handicapping includes strategies of externalization in which people excuse failure and internalize success, but which also prevents them from behaving in an authentic way. The goal was to investigate the relation of authenticity with self-handicapping. The study was conducted with 366 university students (176 men, 190 women; M age = 20.2 yr.). Participants completed the Turkish version of the Authenticity Scale and the Self-handicapping Scale. Self-handicapping was correlated positively with two factors of authenticity, accepting external influence and self-alienation, and negatively with the authentic living factor. A multiple regression analysis indicated that self-handicapping was predicted positively by self-alienation and accepting external influence and negatively by authentic living, accounting for 21% of the variance collectively. These results demonstrated the negative association of authenticity with self-handicapping.

  1. Working with Handicapped Art Students.

    Science.gov (United States)

    Silver, Rawley A.

    Presented at the 1979 National Art Education Association Convention on the arts in special education, the paper focuses on studies of the aesthetic and therapeutic use of special art procedures with handicapped students. The art education needs of handicapped students are briefly discussed, along with the impact and implications of new…

  2. Laterality of cerebral hemispheres on CT scan and gross motor function in severely handicapped children

    Energy Technology Data Exchange (ETDEWEB)

    Iwasaki, Nobuaki; Hamano, Kenzo; Nakamoto, Natsue; Okada, Yusuke [Tsukuba Univ., Ibaraki (Japan); Takeya, Toshiki

    1997-06-01

    The relation between brain damage and gross motor function in severely handicapped children (spastic type) was studied. The subjects were fifteen cases with laterality in their cerebral hemisphere CT scans (laterality group) and 28 cases with no laterality (control group). All cases were divided into four groups according to the level of gross motor function. The grade of brain damage was estimated based on CT scan analysis using the following parameters and index: maximum frontal extracerebral space (ES), maximum width of Sylvian fissure (SY), Evans` ratio, and cella media index. In the laterality group, the parameters and index were measured for both cerebral hemispheres, respectively. In the more severely disturbed hemisphere of the laterality group, ES and SY were significantly enlarged compared with those of the cases with the same level of motor function in the control group (p<0.01). In the less severely disturbed hemisphere of the laterality group, the ES, SY, Evans` ratio and cell media index were not significantly enlarged compared to cases with the same level of motor function as the control group. These findings may indicate that gross motor function of severely handicapped children is closely related to the less severely disturbed cerebral hemisphere. (author)

  3. Laterality of cerebral hemispheres on CT scan and gross motor function in severely handicapped children

    International Nuclear Information System (INIS)

    Iwasaki, Nobuaki; Hamano, Kenzo; Nakamoto, Natsue; Okada, Yusuke; Takeya, Toshiki.

    1997-01-01

    The relation between brain damage and gross motor function in severely handicapped children (spastic type) was studied. The subjects were fifteen cases with laterality in their cerebral hemisphere CT scans (laterality group) and 28 cases with no laterality (control group). All cases were divided into four groups according to the level of gross motor function. The grade of brain damage was estimated based on CT scan analysis using the following parameters and index: maximum frontal extracerebral space (ES), maximum width of Sylvian fissure (SY), Evans' ratio, and cella media index. In the laterality group, the parameters and index were measured for both cerebral hemispheres, respectively. In the more severely disturbed hemisphere of the laterality group, ES and SY were significantly enlarged compared with those of the cases with the same level of motor function in the control group (p<0.01). In the less severely disturbed hemisphere of the laterality group, the ES, SY, Evans' ratio and cell media index were not significantly enlarged compared to cases with the same level of motor function as the control group. These findings may indicate that gross motor function of severely handicapped children is closely related to the less severely disturbed cerebral hemisphere. (author)

  4. Academic Self-Handicapping and Achievement Goals: A Further Examination.

    Science.gov (United States)

    Midgley, Carol; Urdan, Tim

    2001-01-01

    This study extends previous research on the relations among students' personal achievement goals, perceptions of the classroom goal structure, and reports of the use of self-handicapping strategies. Surveys, specific to the math domain, were given to 484 7th-grade students in nine middle schools. Personal performance-avoid goals positively predicted handicapping, whereas personal performance-approach goals did not. Personal task goals negatively predicted handicapping. Perceptions of a performance goal structure positively predicted handicapping, and perceptions of a task goal structure negatively predicted handicapping, independent of personal goals. Median splits used to examine multiple goal profiles revealed that students high in performance-avoid goals used handicapping more than did those low in performance-avoid goals regardless of the level of task goals. Students low in performance-avoid goals and high in task goals handicapped less than those low in both goals. Level of performance-approach goals had little effect on the relation between task goals and handicapping. Copyright 2001 Academic Press.

  5. Prevalence and Severity of Dysphonia in Patients with Cystic Fibrosis: A Pilot Study.

    Science.gov (United States)

    Willis, John; Michael, Deirdre D; Boyer, Holly; Misono, Stephanie

    2015-07-01

    To assess the prevalence and severity of dysphonia in patients with cystic fibrosis sinusitis. We hypothesized that patients with CF sinusitis, compared with 2 control groups, would have higher self-reported prevalence of dysphonia and greater severity of dysphonia, according to patient-reported outcome measures as well as auditory-perceptual evaluation by expert listeners. Cross-sectional comparative pilot study. Academic tertiary care clinic. Analysis included 37 study participants: 17 patients with CF sinusitis, 10 healthy individuals, and 10 patients with non-CF sinusitis. All participants completed the 10-item Voice Handicap Index (VHI-10) questionnaire and provided voice samples. On all samples, 6 blinded speech-language pathologists independently performed auditory-perceptual evaluation, using Consensus Auditory-Perceptual Evaluation of Voice. To assess severity of sinonasal symptoms, we used the 20-item Sinonasal Outcome Test (SNOT-20). Standard parametric and nonparametric statistical analysis was performed. The differences between the 3 groups in prevalence of abnormal VHI-10 scores were not statistically significant. SNOT-20 scores were similar in the 2 sinusitis patient groups. VHI-10 scores were highest in patients with CF sinusitis, intermediate in patients with non-CF sinusitis, and lowest in healthy individuals (P = .005). Auditory-perceptual evaluation demonstrated greater overall severity of dysphonia in patients with CF sinusitis compared with the 2 control groups (P = .0005). Cystic fibrosis sinusitis appeared to be associated with worse vocal function as measured by patient self-report as well as auditory-perceptual evaluation of voice compared with patients with non-CF sinusitis and healthy controls. Further investigation in this area is warranted. © American Academy of Otolaryngology—Head and Neck Surgery Foundation 2015.

  6. Acoustic Analysis of Soccer Fans in Acute Phonotrauma After the Match.

    Science.gov (United States)

    Pinarbasli, Mehmet Ozgur; Kaya, Ercan; Ozudogru, Erkan; Gurbuz, Melek Kezban; Colak, Ertugrul; Aksoy, Mehmet Akif; Birdane, Leman; Guney, Fatma Ozgur

    2017-11-13

    Acute phonotrauma is the result of sound production by shouting or straining one's voice. In this study, we aimed to investigate the acute changes in the vocal folds and voices of soccer fans who voluntarily applied to our clinic after the soccer match where they engaged in acute phonotrauma. There are no other studies in the literature conducted on a similar sample group. This is a case-control study. Videolaryngostroboscopic (VLS) examination, acoustic voice analysis, and Voice Handicap Index (VHI) questionnaire were performed on 29 voluntary soccer fans included to the study before the match and at the first hour after the match. The values obtained were compared statistically with each other and with 29 control groups without voice pathology. The jitter, shimmer, and normalized noise energy values measured after the match increased significantly statistically compared with the pre-match level, but harmonic noise ratio value decreased significantly (P < 0.05). VHI scores increased significantly after the match according to the pre-match scores (P < 0.05). In the VLS examinations, there was no difference in the images before and after the match. It has been concluded that people who are using their voices loudly and intensely by shouting during the match are exposed to sound changes after the match, and if this situation becomes persistent, it may cause permanent voice pathologies. It is thought that VHI and acoustic voice analysis should be done together with VLS for diagnosis and follow-up of voice changes for which the VLS examination alone is not sufficient. Copyright © 2017 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  7. Personality traits, age and sex as predictors for self-handicapping tendency

    Directory of Open Access Journals (Sweden)

    Čolović Petar

    2009-01-01

    Full Text Available Self-handicapping is one of the strategies people use when facing potential failure. Paper presents new scale for assessing self-handicapping tendency as relatively stable trait, as well as its relations with personality traits, sex and age. Self-handicapping questionnaire and shortened form of Zuckerman-Kuhlman Personality Questionnaire were administered to 230 participants of both sexes, age 18 to 59. Confirmatory factor analysis shows that model with four latent dimensions, encompassed by a higher-order latent dimension, fits the data well. Those lower order dimensions correspond to originally created scales: External handicaps in interpersonal area, Internal handicaps in interpersonal area, Internal handicaps in achievement area and External handicaps in achievement area. Results of MANCOVA shows that Neuroticism is predictor of all dimensions of self- handicapping. Impulsive sensation seeking predicts choice of external handicaps in interpersonal area, as well as internal handicaps in achievement area. Latter is predicted also by low Activity. Younger subjects show significantly higher tendency to use internal handicaps, and men in general show more self-handicapping tendency than women, except in choosing internal handicaps in achievement area, where sex shows no significant effect.

  8. Educational assistance to students with physical handicaps

    Directory of Open Access Journals (Sweden)

    Anselmo Vázquez Vázquez

    2015-03-01

    Full Text Available The present study was developed with the aim of determining the state of educational attention to students with handicaps. The Methods used are: General dialectical, Historic and logical and Systemic, Observation, Interview and Survey. As sample were taken 20 teachers and 100% of the students with handicaps from the faculty. Results: The educational assistance to students with ha ndi caps is being given empirically , regulations and guidelines from the Higher Ministry of Education related to handicaps are not known; There is scarce knowledge about the characteristics of handicaps and needs of guidance for effective learning. It recog nizes the importance of providing necessary resources for inclusion in the Higher Education.

  9. 28 CFR 41.31 - Handicapped person.

    Science.gov (United States)

    2010-07-01

    ... Persons § 41.31 Handicapped person. (a) Handicapped person means any person who has a physical or mental...: (1) Physical or mental impairment means: (i) Any physiological disorder or condition, cosmetic... disorder, such as mental retardation, organic brain syndrome, emotional or mental illness, and specific...

  10. [A study on vowel duration and word length of adductor spasmodic dysphonia].

    Science.gov (United States)

    Chen, Zhipeng; Ge, Pingjiang

    2016-03-01

    To understand the vowel duration and statement reading of the adductor spasmodic dysphonia (ADSD) patients compared with their normal controls, and provide ideas for clinical diagnosis and treatment. Twenty-nine ADSD patients were included in the research, with 31 normal controls. All subjects filled in form voice handicap index (VHI) by themselves. Maximum phonetic time (MPT) and maximum loudness phonetic time(MLPT) were tested on /a/ sound for all patients. Also, all the patients were required to read aloud a standard mandarin assay named , duration were measured with Praat5. 0 software after sounds were collected. A one-way t-test was performed to compare spasmodic group with control group on VHI, MPT, MLPT and duration for reading standard sentences. Pearson/Spearman correlation was tested. Result: The VHI of the 29 ADSD patients is 89±12, and their normal controls 15±16, indicating that the VHI in ADSD group is significantly higher than in the control group(P<0. 01). The MPT of the ADSD group is(16. 9±9. 8 s), and the control group is (25. 3±10.0)s, indicating that MPT in the ADSD group is significantly shorter than the control group(P<0. 01). The MLPT of the ADSD group is (15.7±7. 6)s, and the control group is (26. 5±11. 4)s, indicating that MLPT in the ADSD group is significantly shorter than the control group (P<0. 01). The duration of standard sentence reading of the ADSD group is (55.0±14. 2)s, and the control group is (37. 8±4. 8)s, indicating that the duration of standard sentence reading in the ADSD group is significantly longer than the control group (P<0. 01). Correlation analysis showed that MPT and MLPT are related within the ADSD group(r=0. 697,P< 0.01), other indexes being tested have no significant correlations. The voice disorder condition of the ADSD patients is significantly worse than normal people. Their pronunciations on continuous vowels are not lasting compared with normal people. In the meantime, their ability to read sentences

  11. The London handicap scale: a re-evaluation of its validity using standard scoring and simple summation

    OpenAIRE

    Jenkinson, C.; Mant, J.; Carter, J.; Wade, D.; Winner, S.

    2000-01-01

    OBJECTIVE—To assess the validity of the London handicap scale (LHS) using a simple unweighted scoring system compared with traditional weighted scoring
METHODS—323 patients admitted to hospital with acute stroke were followed up by interview 6 months after their stroke as part of a trial looking at the impact of a family support organiser. Outcome measures included the six item LHS, the Dartmouth COOP charts, the Frenchay activities index, the Barthel index, and the hospital...

  12. Arts for the Handicapped Child. Why?

    Science.gov (United States)

    National Committee, Arts for the Handicapped, Washington, DC.

    Presented is a collection of case studies by therapists, educators, artists, parents, and recreation leaders, dealing with the arts as learning experiences for handicapped children. Each of the ten articles records the positive effects of arts experiences (dance, art, music, drama) on the growth and development of a particular handicapped child or…

  13. Voice restoration following total laryngectomy by tracheoesophageal prosthesis: Effect on patients' quality of life and voice handicap in Jordan

    Directory of Open Access Journals (Sweden)

    Wreikat Mahmoud M

    2008-03-01

    Full Text Available Abstract Background Little has been reported about the impact of tracheoesophageal (TE speech on individuals in the Middle East where the procedure has been gaining in popularity. After total laryngectomy, individuals in Europe and North America have rated their quality of life as being lower than non-laryngectomized individuals. The purpose of this study was to evaluate changes in quality of life and degree of voice handicap reported by laryngectomized speakers from Jordan before and after establishment of TE speech. Methods Twelve male Jordanian laryngectomees completed the University of Michigan Head & Neck Quality of Life instrument and the Voice Handicap Index pre- and post-TE puncture. Results All subjects showed significant improvements in their quality of life following successful prosthetic voice restoration. In addition, voice handicap scores were significantly reduced from pre- to post-TE puncture. Conclusion Tracheoesophageal speech significantly improved the quality of life and limited the voice handicap imposed by total laryngectomy. This method of voice restoration has been used for a number of years in other countries and now appears to be a viable alternative within Jordan.

  14. Academic self-handicapping and their correlates in adolescence

    Directory of Open Access Journals (Sweden)

    Cocoradă, E.

    2011-01-01

    Full Text Available The self-handicapping has been examined as a self-protectivestrategy, used by adults and young, males and females, in different situations assessed as threatening for the positive self-esteem. The purpose of this study is to explore the relations between self-handicapping and some variables relevant in the academic field as learning motivation, academic results, selfesteem. Age and gender are the criteria of our analysis. The results suggestthe males and later adolescents (males and females self-handicap more that the females and the young adolescents. Self-esteem and some components of learning motivation are the variables that influence self-handicapping at significant levels.

  15. Self-Handicapping Behavior: A Critical Review of Empirical Research.

    Science.gov (United States)

    Carsrud, Robert Steven

    Since the identification of self-handicapping strategies in 1978, considerable attention has been paid to this phenomenon. Self-handicapping is a strategy for discounting ability attributions for probable failure while augmenting ability attributions for possible success. Behavioral self-handicaps are conceptually distinct from self-reported…

  16. CO2 laser-assisted microsurgery for intracordal cysts: technique and results of 49 patients.

    Science.gov (United States)

    Matar, Nayla; Amoussa, Kassira; Verduyckt, Ingrid; Nollevaux, Marie-Cecile; Jamart, Jacques; Lawson, Georges; Remacle, Marc

    2010-12-01

    Microsurgery for intracordal cysts is a challenging procedure, because cysts are close to the vocal ligament and the risk of inducing a scar is high. In this retrospective study, our experience with the CO(2)-laser scanning system (Acublade(®)) is reported on 49 patients. There were 41% epidermoid cysts and 59% mucous retention cysts. A quarter of the patients presented with bilateral cystic lesions and 59% had a contralateral lesion other than a cyst. The cyst was removed after a minimicroflap. It was dissected away from the lamina propria and the epithelium. Collagen was injected intraoperatively if the glottal gap was considered important. The epithelium was redraped using Tissucol (Baxter, Vienna, Austria). The mean follow-up time was 160 days. We noted a statistically significant improvement in the grade of the dysphonia according to Hirano's perceptual scale (G pre = 2, G post = 1, p = 0.002); the Vocal Handicap Index (VHI pre = 51, VHI post = 28, p = 0.001) and the maximal phonation time in milliseconds (MPT pre = 11, 1 MPT post = 12.7, p = 0.033) in all the patients. In the professional voice subgroup (20/49 patients), there was a significant improvement in the frequency range (FR pre = 310 Hz, FR post = 434 Hz, p = 0.001). The CO(2)-laser scanning system is reliable in the treatment of intracordal cysts.

  17. Inflammatory reaction to hyaluronic acid: A newly described complication in vocal fold augmentation.

    Science.gov (United States)

    Dominguez, Laura M; Tibbetts, Kathleen M; Simpson, C Blake

    2017-02-01

    To establish the rate of inflammatory reaction to hyaluronic acid (HA) in vocal fold injection augmentation, determine the most common presenting signs and symptoms, and propose an etiology. Retrospective chart review. Patients injected with HA over a 5-year period were reviewed to identify those who had a postoperative inflammatory reaction. Medical records were reviewed for patient demographic information, subjective complaints, Voice Handicap Index-10 (VHI-10) scores, medical intervention, and resolution time. Videolaryngostroboscopy examinations were also evaluated. A total of 186 patients (245 vocal folds) were injected with HA over a 5-year period, with a postoperative inflammatory reaction rate of 3.8%. The most common complaints in these patients were odynophagia, dysphonia, and dyspnea with vocal fold erythema, edema, and loss of pliability on videolaryngostroboscopy. All patients were treated with corticosteroids. Return of vocal fold vibration ranged from 3 weeks to 26 months, with VHI-10 scores normalizing in 50% of patients. This reaction may be a form of hypersensitivity related to small amounts of protein linked to HA. Alternatively, extravascular compression from the HA could lead to venous congestion of the vocal fold. The possibility of equipment contamination is also being investigated. Further studies are needed to determine the etiology and best treatment. 4 Laryngoscope, 2016 127:445-449, 2017. © 2016 The American Laryngological, Rhinological and Otological Society, Inc.

  18. Growth motivation as a moderator of behavioral self-handicapping in women.

    Science.gov (United States)

    Brown, Christina M; Park, Sun W; Folger, Susan F

    2012-01-01

    Behavioral self-handicapping is a strategy used to protect attributions about ability. People behaviorally self-handicap by creating an obstacle to their success so failure is attributed to the obstacle instead of to their ability. Although past research has observed behavioral self-handicapping exclusively in men, the current research revealed a moderator of behavioral self-handicapping in women: growth motivation, which reflects the desire to develop one's abilities and learn from failure. Participants (N = 100) completed a test purportedly predictive of successful careers and relationships, and some were given failure feedback about their performance. Participants could behaviorally self-handicap by choosing to complete another test in a performance-impairing environment. Although men self-handicapped more overall, women self-handicapped more after failure when they were low in growth motivation. These results highlight a novel moderator of behavioral self-handicapping in women.

  19. Self-reported versus behavioral self-handicapping: empirical evidence for a theoretical distinction.

    Science.gov (United States)

    Hirt, E R; Deppe, R K; Gordon, L J

    1991-12-01

    The present study was an investigation of how Ss would respond when given 2 self-handicapping options, 1 behavioral (withdrawal of practice effort) and 1 self-reported (reporting high levels of stress). Ss anticipating a diagnostic test of intellectual ability were given different instructions regarding the effects of stress and practice on test performance. Ss were told that (a) stress only, (b) practice only, (c) both stress and practice, or (d) neither stress nor practice affected test scores. Ss were then given the opportunity to self-report a handicap on a stress inventory and to behaviorally self-handicap by failing to practice before the test. High self-handicapping men and women showed evidence of self-reported handicapping, but only high self-handicapping men behaviorally self-handicapped. However, when both self-handicaps were viable, both high self-handicapping men and women preferred the self-reported over the behavioral self-handicap.

  20. The Relationship Between Academic Identity and Self-Handicapping

    OpenAIRE

    Carlisle, Brandon Lamare

    2015-01-01

    The purpose of the present dissertation was to examine whether, and how, behavioral academic self-handicapping and claimed academic self-handicapping differentially relate to the academic identity statuses (i.e., achieved, diffused, moratorium, and foreclosed). Self-handicapping has been defined as creating or claiming obstacles to performance in order to enhance the ability to externalize failure and internalize success. Academic identity status involves a student’s decision to attend colleg...

  1. A Comparison of the Long-term Health Related Quality of Life and Handicap of Stroke Patients in Mainland China and Hong Kong

    Directory of Open Access Journals (Sweden)

    T Kwok

    2010-01-01

    Full Text Available Purpose To compare health related quality of life (HRQOL and handicap of stroke survivors in Hong Kong (HK and Chengdu (CD in Mainland China. Method Fifty-four pairs of first ever stroke patients in CD and in HK matched by age, sex and Modified Barthel Index (MBI were interviewed using a structured questionnaire at 16–36 months after stroke. HRQOL and handicap outcomes were evaluated by the Chinese version of the Short-Form Health Survey (SF-36 and London Handicap Scale (LHS respectively. Results Compared to stroke patients in CD, HK subjects reported significantly greater handicap, especially in the occupation domain. HK subjects also had significantly lower HRQOL Z scores in domains of role limitations due to emotional or physical problems, and bodily pain. CD subjects had more social support, but had more difficulties in meeting medical costs, and were less likely to have regular medical follow-up and dysphagia symptom. After adjusting for social and health related factors, the site differences in handicap and the role limitation (physical domain of SF36 became insignificant. Conclusions CD stroke survivors had better scores in HRQOL and fewer handicaps than their counterparts in HK, because of social and health related factors.

  2. Self-Handicapping and Its Impact on Mental Health

    Directory of Open Access Journals (Sweden)

    Yeter Sinem Uzar Ozcetin

    2016-06-01

    Full Text Available Self handicapping is characterized by experiencing anxiety at succeeding a mission although the person has the capacity to fulfill the assignment or duty. It describes one's showing tendency to link own failures to problems in own performance instead of own abilities to protect oneself from the possibility of failure. When individuals care about performance much but doubt about success, they display self-handicapping strategies to protect their self. Self-handicappers try to protect their self by internalizing successes and externalizing failures. This strategies help them feel well in both successes and failures. Self-handicapping becomes a trait of personality in time and the individual begins to use it continuously as a negative coping mechanism to protect his/her self and to avoid failures. These actions eliminates the capability of rational thinking and prevents solution of the problems as a result of irrational interpretations. Self-handicapping causes the decrease of life satisfaction and motivation, and causes the increase of maladaptation, negative mood, somatic symptoms and alcohol-drug abuse. As a conclusion, self-handicapping hinders performance and this negative performance influences adaptation and psychological well-being. The most essential approach to prevent occurrence of self-handicapping behaviours is empowerment of the self. [Psikiyatride Guncel Yaklasimlar - Current Approaches in Psychiatry 2016; 8(2: 145-154

  3. Excuses, Excuses: Self-Handicapping in an Australian Adolescent Sample.

    Science.gov (United States)

    Warner, Suzanne; Moore, Susan

    2004-01-01

    The purpose of the present study was to examine gender differences in the self-handicapping tendencies of a sample of 337 Australian school attending adolescents, who were aged between 15 and 19 years. Self-handicapping, as measured by the shortened Self-Handicapping Scale, was examined in relation to self-esteem, performance attributions, coping…

  4. Academic Goals and Self-Handicapping Strategies in University Students.

    Science.gov (United States)

    Ferradás, María del Mar; Freire, Carlos; Valle, Antonio; Núñez, José Carlos

    2016-05-23

    In highly competitive settings like university, the fear of failure leads some students to protect their self-worth using self-handicapping strategies. The present investigation examines to what extent academic goals are related to those tactics in university students. Specifically, MANCOVA was applied to estimate statistical differences linked to behavioral and claimed self-handicapping strategies according to the level (high/medium/low) of four types of academic goal (achievement approach, achievement avoidance, mastery approach, and work avoidance). Degree, year in school, and gender were entered as covariates. 940 students (86.5% women) from University of A Coruña (M = 20.44; SD = 1.73) participated. Results show that: (a) both behavioral and claimed self-handicapping are promoted by ego-oriented goals (achievement avoidance, F(2, 937) = 23.56, p self-handicapping (F(2, 937) = 9.09, p self-handicapping; and (c) mastery approach goals are significantly, negatively related to both types of self-handicapping (F(2, 937) = 20.09, p < .001, η p 2 = .041). Psychological and educational implications of the findings are discussed.

  5. Disability and handicap among elderly Singaporeans.

    Science.gov (United States)

    Yadav, S S

    2001-08-01

    Singapore's elderly population has been growing rapidly and is expected to constitute more than 25 percent of the total population by the year 2030. The ageing process brings with it a host of health problems. Here the question arises--Are the increasing years of life going to create a high proportion of sick and disabled elderly people, or a rich human resource of healthy senior citizens? Since more women are living longer than men, who would face a higher risk of disability and handicap? These questions are yet to be answered in Singapore. This paper seeks answers to these questions. The study is based on a sample survey of 1209 elderly Singaporeans living in Kampong Glam, Kreta Ayer and Bukit Merah parliamentary constituencies which have some of the highest proportions of the aged population. The results revealed that more than half of the aged had a disability and the rate of disability was significantly higher among the women as compared to the men. More than one-third of the elderly had a handicap and the rate of handicap among the women was twice as much as that among the men. Severity of handicap was directly correlated with age.

  6. Combining Voice Therapy and Physical Therapy: A Novel Approach to Treating Muscle Tension Dysphonia

    Science.gov (United States)

    Craig, Jennifer; Tomlinson, Carey; Stevens, Kristin; Kotagal, Kiran; Fornadley, Judith; Jacobson, Barbara; Garrett, C. Gaelyn; Francis, David O.

    2015-01-01

    Objective This study investigated the role of a specialized physical therapy program for muscle tension dysphonia patients as an adjunct to standard of care voice therapy. Study Design Retrospective Cohort Study Methods Adult MTD patients seen between 2007 and 2012 were identified from the clinical database. They were prescribed voice therapy and, if concomitant neck pain, adjunctive physical therapy. In a pragmatic observational cohort design, patients underwent one of four potential treatment approaches: voice therapy alone (VT), voice therapy and physical therapy (VT+PT), physical therapy alone (PT), or incomplete/no treatment. Voice handicap outcomes were compared between treatment approaches. Results Of 153 patients meeting criteria (Median age 48 years, 68% female, and 30% had fibromyalgia, chronic pain, chronic fatigue, depression, and/or anxiety), there was a similar distribution of patients with moderate or severe pre-treatment VHI scores across treatment groups (VT 45.5%, VT+PT 43.8%, PT 50%, no treatment 59.1%; p=0.45). Patients treated with VT alone had significantly greater median improvement in VHI than those not treated: 10-point vs. 2-point (p=0.02). Interestingly, median VHI improvement in patients with baseline moderate-severe VHI scores was no different between VT (10), VT+PT (8) and PT alone (10; p=0.99). Conclusions Findings show voice therapy to be an effective approach to treating MTD. Importantly, other treatment modalities incorporating physical therapy had a similar, albeit not significant, improvement in VHI. This preliminary study suggests that physical therapy techniques may have a role in the treatment of a subset of MTD patients. Larger, comparative studies are needed to better characterize the role of physical therapy in this population. PMID:26012419

  7. Non-Discriminatory Psychological Assessment of the Handicapped.

    Science.gov (United States)

    Phelps, William R.

    In 1979 the National Research Council established a panel to study testing of handicapped people for selection and placement purposes in educational and employment settings. The study involved the review of relevant literature, solicitation of pertinent information from organizations representing handicapped persons and from professionals involved…

  8. Desvantagem vocal em cantores de igreja Vocal handicap of church singers

    Directory of Open Access Journals (Sweden)

    Tatiane Prestes

    2012-10-01

    containing questions about self-perception of singing and vocal practices and the protocol Modern Singing Handicap Index (MSHI, composed by 30 questions regarding disability, handicap, and defect. We performed a screening for perceptual classification of adapted or changed voices, and measured the degrees of change. RESULTS: the total average score was 23 points in the MSHI. The highest subscale scores obtained were "defect" (10.9, followed by "disability" (7.6 and "handicap" (4.5, with the difference between them (p = 0.001. Singers who have never passed through singing lesson had higher scores in the "handicap" (p = 0.003. The higher was the score of MSHI, the score given by singers in relation to their own voice sank (p = 0.046. Participants with altered voice quality had higher scores on handicap and disability subscales and on total domination of MSHI when compared with those who have adapted vocal quality (p = 0.012, p = 0.049 and p = 0.015, respectively. Moreover, the greater is the degree of voice alteration, increased scores were related to disability subscale (p = 0.022. CONCLUSION: church singers have major vocal handicap. When you have voice disorders, this handicap is even greater. The higher is the degree of voice alteration, the greater are the limitations regarding the singing voice. Vocal singing lessons seem to minimize the handicap.

  9. A motivational analysis of defensive pessimism and self-handicapping.

    Science.gov (United States)

    Elliot, Andrew J; Church, Marcy A

    2003-06-01

    Two studies examined motivational influences on and correlates of defensive pessimism and self-handicapping and investigated the relationship between these two cognitive strategies and performance attainment. The findings indicated that defensive pessimism and self-handicapping have similar motivational profiles, with the primary difference being that self-handicapping represents the absence of approach motivation in the achievement domain, as well as the presence of avoidance motivation. Self-handicapping, but not defensive pessimism, was shown to undermine performance-attainment, and performance-avoidance goals were validated as mediators of this negative relationship. Issues regarding the functional nature of the two cognitive strategies are discussed.

  10. Self-Esteem, Achievement Goals, and Self-Handicapping in College Physical Education.

    Science.gov (United States)

    Chen, Zuosong; Sun, Kaihong; Wang, Kun

    2017-01-01

    This study aims to investigate the relationships among self-esteem, achievement goals, and self-handicapping and the potential mediating role of achievement goals in the relationship between self-esteem and self-handicapping in college physical education. The participants were 320 Chinese college students. Three validated scales were employed to assess participants' self-esteem, achievement goals, and self-handicapping in college physical education. Results showed that self-esteem had a negative effect on self-handicapping. Self-esteem had a positive effect on mastery goals, but had a negative effect on performance-avoidance goals. Mastery goals had a negative effect and performance-avoidance goals had a positive effect on self-handicapping. Moreover, mastery goals and performance-avoidance goals partially mediated the relationship between self-esteem and self-handicapping, and self-esteem had both direct and indirect effects on self-handicapping in college physical education. The findings indicate that improving individual's self-esteem and promoting mastery goals while reducing performance-avoidance goals may be relevant strategies to reduce self-handicapping in college physical education.

  11. Euthanasia of Severely Handicapped Infants: Ethical Issues.

    Science.gov (United States)

    Cohen, Libby

    Ethical decisions are involved in life and death decisions for severely handicapped infants. Although it has become common practice for physicians not to treat severely handicapped infants, the ethical considerations involved in euthanasia are complex. A review of the literature reveals that concerns center around the quality of life of the…

  12. 13 CFR 113.3-3 - Structural accommodations for handicapped clients.

    Science.gov (United States)

    2010-01-01

    ... handicapped clients. 113.3-3 Section 113.3-3 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION... ADMINISTRATOR General Provisions § 113.3-3 Structural accommodations for handicapped clients. (a) Existing... by handicapped clients. Where structural changes are necessary to make the recipient's goods or...

  13. [Physical handicapped, economic practices and matrimonial strategies in Senegal].

    Science.gov (United States)

    Fassin, D

    1991-01-01

    Social relations around the handicapped are generally presented in terms of economic dependence and social inadaptation. This point of view leads to give greater importance, especially in Africa, to studying the way in which group and society help the physically or mentally ill. Actually, this approach does not give a complete account about the real situation of the handicapped in social relations of production and reproduction. From a series of in-depth interviews conducted in handicapped families of the suburbs of Dakar, two aspects are analyzed: the economic role of the handicapped, through the circulation of the product of his begging in his household or through the exploitation of his work as apprentice in a workshop; and his value on the marriage market, where invalid persons are given without dowry if they are women, and must pay a much more important amount if they are men. The social situation of the handicapped thus is not only a matter of assistance or charity, but as well of strategies that the handicapped and above all his circle implement in order to take advantage of the stigma or on the contrary try to erase it.

  14. Trait self-esteem and claimed self-handicapping motives in sports situations.

    Science.gov (United States)

    Finez, Lucie; Berjot, Sophie; Rosnet, Elisabeth; Cleveland, Christena; Tice, Dianne M

    2012-12-01

    We examined the relationship between physical self-esteem and claimed self-handicapping among athletes by taking motives into consideration. In Study 1, 99 athletes were asked to report their tendency to engage in claimed self-handicapping for self-protective and self-enhancement motives (trait measures). Low self-esteem athletes reported a higher tendency to engage in claimed self-handicapping for these two motives compared with high self-esteem athletes. Neither low nor high self-esteem athletes reported a preference for one motive over the other. In Study 2, 107 athletes participated in a test that was ostensibly designed to assess high physical abilities - and thus to encourage self-handicapping for self-enhancement motives (success-meaningful condition) - or to assess low physical abilities, and thus to encourage self-handicapping for self-protective motives (failure-meaningful condition). Before starting the test, athletes were given the opportunity to claim handicaps that could impair their performance. Low self-esteem athletes claimed more handicaps than high self-esteem athletes in both conditions. Findings suggest that low physical self-esteem athletes engage more in claimed handicapping regardless of motives, relative to high physical self-esteem athletes.

  15. The effects of self-handicapping on attributions and perceived judo competence.

    Science.gov (United States)

    Greenlees, Iain; Jones, Simon; Holder, Tim; Thelwell, Richard

    2006-03-01

    The aim of this study was to examine hypotheses derived from Jones and Berglas's (1978) self-handicapping model. It was hypothesized that individuals using many self-handicaps would use more internal attributions and report greater gains in perceived judo ability following success than individuals using few self-handicaps. In addition, it was hypothesized that individuals using many self-handicaps would use more external attributions and report less reduction in perceived judo ability following failure. Fifty-three judo players completed measures of trait self-handicapping, situational self-handicapping and a measure of perceived judo ability before competition. Following competition, the participants completed the Causal Dimension Scale II and the measure of perceived judo ability for a second time. Analyses of variance revealed that high self-handicappers attributed failure to more external factors than low self-handicappers. It was also found that high self-handicappers reported less of a reduction in perceived judo ability following failure than low self-handicappers. The findings therefore provide support for the potential short-term benefits of self-handicapping in sport, although further research is required to examine the long-term implications of using self-handicaps.

  16. Handicapped Litigation: A Review of Significant Decisions.

    Science.gov (United States)

    Bowen, John W.

    Since 1979 many courts have handed down rulings in favor of handicapped children under the Education of the Handicapped Act. This twentieth chapter in a book on school law summarizes these cases. In "Kruelle v. Biggs," the court ruled that a school district must provide residential placement free of charge if such placement is necessary…

  17. Antroduodenal motility in neurologically handicapped children with feeding intolerance

    Directory of Open Access Journals (Sweden)

    Werlin Steven L

    2004-09-01

    Full Text Available Abstract Background Dysphagia and feeding intolerance are common in neurologically handicapped children. The aim is to determine the etiologies of feeding intolerance in neurologically handicapped children who are intolerant of tube feedings. Methods Eighteen neurologically handicapped children, followed in the Tube Feeding Clinic at the Children's Hospital of Wisconsin who were intolerant of gastrostomy feedings. The charts of these 18 patients were reviewed. Past medical history, diagnoses, history of fundoplication and results of various tests of gastrointestinal function including barium contrast radiography, endoscopy and antroduodenal manometry were documented. Results Five of 11 children had abnormal barium upper gastrointestinal series. Seven of 14 had abnormal liquid phase gastric emptying tests. Two of 16 had esophagitis on endoscopy. All 18 children had abnormal antroduodenal motility. Conclusions In neurologically handicapped children foregut dysmotility may be more common than is generally recognized and can explain many of the upper gastrointestinal symptoms in neurologically handicapped children.

  18. The Special Needs of Prison Inmates with Handicaps: An Assessment.

    Science.gov (United States)

    Veneziano, Louis; And Others

    1987-01-01

    Surveyed 45 workers in correctional agencies to examine number of handicapped inmates and types of programs provided to them. Found that most prison systems had identified some handicapped inmates. Variety of programs were offered to inmates, many systems did not have specialized treatment for handicapped. Found need for evaluation and treatment…

  19. Honig v. Doe: the suspension and expulsion of handicapped students.

    Science.gov (United States)

    Yell, M L

    1989-09-01

    Public Law 94-142 provides for a free appropriate public education for all handicapped children, but does not address the issue of disciplining handicapped students. The result has been confusion and uncertainty, particularly concerning expulsion and suspension. The courts have been forced into this vacuum, acting as arbiters. The Supreme Court's ruling in Honig v. Doe will help to delineate the proper role of educators in the suspension and expulsion of handicapped students. This article examines that role and offers recommendations for school policies regarding the discipline of handicapped students.

  20. Factors related to tinnitus and hyperacusis handicap in older people.

    Science.gov (United States)

    Aazh, Hashir; Lammaing, Karen; Moore, Brian C J

    2017-09-01

    The aim was to assess factors related to tinnitus and hyperacusis handicap in older people. Retrospective cross-sectional. Data were gathered for 184 patients with an average age of 69 years. Tinnitus handicap as measured via the Tinnitus Handicap Inventory (THI) was significantly predicted by tinnitus annoyance as measured via the visual analogue scale (VAS) (regression coefficient, b = 2.9, p tinnitus on the patient's life as measured via the VAS (b = 3.9, p tinnitus annoyance significantly predicts tinnitus handicap, it is important to explore factors associated with annoyance that may be useful in designing appropriate rehabilitative interventions aimed at reducing tinnitus handicap in older people. Future studies should explore whether hyperacusis and insomnia in older people with tinnitus need to be managed in conjunction with treatment for depression.

  1. An Assessment of the Self-Protective Function of Self-Handicapping.

    Science.gov (United States)

    Steinhauer, Annie; And Others

    Self-handicapping is the phenomenon of setting oneself up to fail a feared evaluation task to protect a sense of self-worth. A study examined whether individuals self-handicap to protect a general or global perception of themselves or to protect perceptions of competence in the specific domain being evaluated. Handicapping behaviors related to…

  2. Vocal quality in university teachers: a pilot study.

    Science.gov (United States)

    D'haeseleer, E; Claeys, S; Wuyts, F; Van Lierde, K M

    2009-01-01

    The main purpose of this study was to determine the vocal quality of 20 male and 9 female university teachers using a multi-parameter approach. Secondly, the effect of an academic lecture on the voice profiles of the university teachers was measured. All groups underwent subjective voice evaluations (perceptual evaluation, Voice Handicap Index, anamnesis of vocal complaints and vocal abuse) and objective voice evaluations (aerodynamic and acoustic parameters, vocal performance, and the Dysphonia Severity Index). The same voice assessment was performed after an academic lecture with a mean length of one and a half hours. The mean DSI score was + 2.2 for the male teachers and + 4.0 for the female teachers. The mean VHI score was 13. Perceptually, all voice parameters were rated as normal. The questionnaire revealed a relatively high amount of vocal abuse. No changes in the objective vocal parameters were found after the lecture. Perceptually, however, the voices of the university teachers were significantly less instable after the lecture. Although no negative changes in objective vocal quality were observed, 48% of the university teachers experienced subjective vocal changes. The authors concluded that university teachers are professional voice users with good vocal quality who suffer no handicapping effect from possible voice disorders. No important changes in the vocal profile after a teaching activity of one and a half hours were found, despite the high prevalence of voice complaints.

  3. Implicit theory of athletic ability and self-handicapping in college students.

    Science.gov (United States)

    Chen, Lung Hung; Chen, Mei-Yen; Lin, Meng-Shyan; Kee, Ying Hwa; Kuo, Chin Fang; Shui, Shang-Hsueh

    2008-10-01

    Self-handicapping is a maladaptive behavior which undermines students' achievements, but the antecedents of self-handicapping are not well studied in physical education. The aim was to examine the relations of implicit theory of abilities and self-handicapping in physical education. 264 college students, whose mean age was 20.3 yr. (SD = 1.7), completed the Conceptions of the Nature of Athletic Ability Questionnaire-2 and Self-handicapping Scale for Sport. Analysis indicated entity beliefs positively predicted reduced effort and making excuses. Also, incremental beliefs negatively predicted reduced effort. Results are discussed in terms of implicit theory of ability and self-handicapping. Directions for research and implications are stated.

  4. Effect of maternal education on the rate of childhood handicap.

    Science.gov (United States)

    Shawky, S; Milaat, W M; Abalkhail, B A; Soliman, N K

    2001-01-01

    The objectives of this study were to determine the relation between maternal education and various maternal risk factors, identify the impact of maternal education on the risk of childhood handicap and estimate the proportion of childhood handicap that can be prevented by maternal education. Data was collected from all married women attending the two major maternity and child hospitals in Jeddah during April 1999. Women with at least one living child were interviewed for sociodemographic factors and having at least one handicapped child. The risk of having a handicapped child and the population attributable risk percent were calculated. Some potential risk factors are dominant in our society as approximately 30% of women did not attend school and 84% did not work. Consanguineous marriages accounted for about 43%. Pre-marriage counseling was limited as only 10% of women counseled before marriage. The proportion of unemployment and consanguineous marriages decreased significantly by increase in maternal education level. Conversely, the proportion of women reporting pre-marriage counseling increased significantly by increase in maternal education level. Approximately, 7% of women reported having at least one handicapped child. The risk of having a handicapped child showed a significant sharp decline with increase in maternal education level. At least 25% of childhood handicap can be prevented by achieving female primary education and up to half of cases can be prevented if mothers finish their intermediate education. Female education plays a major role in child health. The results of this study suggest investment in female education, which would have substantial positive effects in reducing incidence of childhood handicap in Jeddah.

  5. Academic Self-Handicapping and Achievement: A Meta-Analysis

    Science.gov (United States)

    Schwinger, Malte; Wirthwein, Linda; Lemmer, Gunnar; Steinmayr, Ricarda

    2014-01-01

    Self-handicapping represents a frequently used strategy for regulating the threat to self-esteem elicited by the fear of failing in academic achievement settings. Several studies have documented negative associations between self-handicapping and different educational outcomes, inter alia academic achievement. However, studies on the relation…

  6. Translation, validity, and reliability of a persian version of the iowa tinnitus handicap questionnaire.

    Science.gov (United States)

    Arian Nahad, Homa; Rouzbahani, Masomeh; Jarollahi, Farnoush; Jalaie, Shohreh; Pourbakht, Akram; Mokrian, Helnaz; Mahdi, Parvane; Amali, Amin; Nodin Zadeh, Abdolmajid

    2014-04-01

    Tinnitus is a common otologic symptom that can seriously affect a patient's quality of life. The purpose of the present study was to translate and validate the Iowa Tinnitus Handicap Questionnaire (THQ) into the Persian language, and to make it applicable as a tool for determining the effects of tinnitus on a patient's life. The main version of the THQ was translated into the Persian language. The agreed Persian version was administered to 150 tinnitus patients. The validity of the Persian THQ was evaluated and internal reliability was confirmed using Cronbach's α-coefficient. Finally, the effect of independent variables such as age, mean patient threshold, gender, and duration of tinnitus were considered in order to determine the psychometric properties of tinnitus. After an exact translation process, the Persian THQ was found to exhibit face validity. In terms of content validity, content validity index in total questionnaire was 0.93. Further, in structural validity measurements, intermediate correlation with annoyance from tinnitus (r=0.49), low correlation with duration of tinnitus (r=0.34) and high correlation with the Tinnitus Handicap Inventory (THI) questionnaire (r=0.84) were demonstrated. Additionally, a negligible effect of gender and age was noted on degree of tinnitus handicap (P= 0.754, P= 0.573, respectively). In the internal reliability assessment for Factors 1, 2, 3, and the whole questionnaire, Cronbach`s α-coefficient was 0.95, 0.92, 0.25 and 0.88, respectively. The Persian version of the Iowa THQ demonstrates high validity and reliability and can be used for the determination of tinnitus handicap and for following-up in the intervention process in Persian tinnitus patients.

  7. Handicap, Architecture & Design

    DEFF Research Database (Denmark)

    1996-01-01

    Cd-rommen er et visuelt projekteringsværktøj for byggeriets parter. Den viser nogle af de problemer mennesker med handicap har ved at færdes i de fysiske omgivelser, men peger også mulige løsninger for at gøre omgivelserne tilgængelige for alle....

  8. Causal uncertainty, claimed and behavioural self-handicapping.

    Science.gov (United States)

    Thompson, Ted; Hepburn, Jonathan

    2003-06-01

    Causal uncertainty beliefs involve doubts about the causes of events, and arise as a consequence of non-contingent evaluative feedback: feedback that leaves the individual uncertain about the causes of his or her achievement outcomes. Individuals high in causal uncertainty are frequently unable to confidently attribute their achievement outcomes, experience anxiety in achievement situations and as a consequence are likely to engage in self-handicapping behaviour. Accordingly, we sought to establish links between trait causal uncertainty, claimed and behavioural self-handicapping. Participants were N=72 undergraduate students divided equally between high and low causally uncertain groups. We used a 2 (causal uncertainty status: high, low) x 3 (performance feedback condition: success, non-contingent success, non-contingent failure) between-subjects factorial design to examine the effects of causal uncertainty on achievement behaviour. Following performance feedback, participants completed 20 single-solution anagrams and 12 remote associate tasks serving as performance measures, and 16 unicursal tasks to assess practice effort. Participants also completed measures of claimed handicaps, state anxiety and attributions. Relative to low causally uncertain participants, high causally uncertain participants claimed more handicaps prior to performance on the anagrams and remote associates, reported higher anxiety, attributed their failure to internal, stable factors, and reduced practice effort on the unicursal tasks, evident in fewer unicursal tasks solved. These findings confirm links between trait causal uncertainty and claimed and behavioural self-handicapping, highlighting the need for educators to facilitate means by which students can achieve surety in the manner in which they attribute the causes of their achievement outcomes.

  9. Influence of neural monitoring during thyroid surgery on nerve integrity and postoperative vocal function.

    Science.gov (United States)

    Engelsman, A F; Warhurst, S; Fraser, S; Novakovic, D; Sidhu, S B

    2018-06-01

    Integrity of the recurrent laryngeal nerve (RLN) and the external branch of the superior laryngeal nerve (EBSLN) can be checked by intraoperative nerve monitoring (IONM) after visualization. The aim of this study was to determine the prevalence and nature of voice dysfunction following thyroid surgery with routine IONM. Thyroidectomies were performed with routine division of strap muscles and nerve monitoring to confirm integrity of the RLN and EBSLN following dissection. Patients were assessed for vocal function before surgery and at 1 and 3 months after operation. Assessment included use of the Voice Handicap Index (VHI) 10, maximum phonation time, fundamental frequency, pitch range, harmonic to noise ratio, cepstral peak prominence and smoothed cepstral peak prominence. A total of 172 nerves at risk were analysed in 102 consecutive patients undergoing elective thyroid surgery. In 23·3 per cent of EBSLNs and 0·6 per cent of RLNs nerve identification required the assistance of IONM in addition to visualization. Nerve integrity was confirmed during surgery for 98·8 per cent of EBSLNs and 98·3 per cent of RLNs. There were no differences between preoperative and postoperative VHI-10 scores. Acoustic voice assessment showed small changes in maximum phonation time at 1 and 3 months after surgery. Where there is routine division of strap muscles, thyroidectomy using nerve monitoring confirmation of RLN and EBSLN function following dissection results in no clinically significant voice change.

  10. Vocational Reintegration of Handicapped Workers with Assistive Devices

    Science.gov (United States)

    Cooper, N. E.

    1977-01-01

    Two approaches to vocational reintegration of handicapped workers are described: (1) adapting the disabled to the working environment through treatment, therapy, counseling, selective placement, and prostheses, and (2) adapting the working environment to particular handicaps, with the assistive device fitted to the machine or tool rather than to…

  11. The Dance Within: A Pilot Project in Dance for the Handicapped and Teaching Dance for the Handicapped: A Curriculum Guide.

    Science.gov (United States)

    Michigan Dance Association, Lansing.

    The Michigan Dance Association's Dance Project for the Handicapped is the subject of the two pamphlets that make up this document. The first pamphlet, "The Dance Within," describes the history, nature and goals of the Jackson Pilot Project, the first handicapped dance program in Michigan; it also offers suggestions on how to set up similar…

  12. [Respiratory handicap. Recognition, evaluation and social benefits].

    Science.gov (United States)

    Marsac, J; Pujet, J C

    1983-01-01

    The medico-social aspects of respiratory handicap pose some perplexing problems, notably in their recognition, rigorous evaluation and in the granting of social security benefits. The clinical and respiratory function data should be standardised and classified according to type and significance of respiratory disease and also according to the degree of co-operation and understanding of the patient. The respiratory handicap should be evaluated after considering the functional disability engendered by the disorder and their socio-professional repercussions. The abnormality in the lungs should be measured by resting tests; the degree of disability by exercise studies; the socio-professional handicap by ergonometric tests to assess the scale of the demands and requirements of family and social and professional life, indeed the cultural and economic style of the individual concerned. Such combined studies would enable recognition of severe chronic respiratory handicap leading to decisions for exemption certificates, such as cases of severe respiratory failure in patients requiring supplementary treatment for oxygen therapy or assisted ventilation. The benefits and grants offered to those with respiratory handicaps would involve a number of rights relating to: care, work, costs of replacement of workers in the event of prolonged sick leave or the benefits of an invalidity pension. There will be other allowances such as invalidity cards, lodging special studies and other rights particularly relating to lodging and special equipment. The present scale is difficult to use both because of its lack of specificity and its ill-chosen terminology. For better balance between the handicap and the benefits offered, a common and more flexible system, with a printed table should be at hand for the doctor to use for certain decisions: long term illness, period of invalidity or early retirement because of medical incapacity. Within each table a sub-section should exist to allow for

  13. Re-Examining the Effects of Noncontingent Success on Self-Handicapping Behaviour

    Science.gov (United States)

    Thompson, T.

    2004-01-01

    Background: Self-handicapping refers to the practice on the part of certain individuals to handicap their performance when poor performance is likely to reveal low ability. Noncontingent success (feedback that is inflated relative to performance) is more likely to promote self-handicapping behaviour than noncontingent failure (failure feedback…

  14. The Role of Classroom Goal Structure in Students' Use of Self-Handicapping Strategies.

    Science.gov (United States)

    Urdan, Tim; Midgley, Carol; Anderman, Eric M.

    1998-01-01

    Surveyed 656 fifth graders on their use of self-handicapping strategies and examined predictors of self-handicapping. Boys used handicapping more than girls did, and grade point average and perceived academic competence were negatively related to handicapping. Ability goal structure and teaching practices highlighting relative ability were…

  15. Handicapped Infants and Euthanasia: A Challenge to Our Advocacy.

    Science.gov (United States)

    Smith, J. David

    1985-01-01

    The issue of pediatric euthanasia for handicapped newborns is examined and contrasting viewpoints emphasizing the quality and the sanctity of life are considered. The author asserts that advocacy for handicapped children involves decisions regarding the euthanasia question. (CL)

  16. EARLY TREATMENT OF HANDICAPPED CHILDREN-ESPECIALLY OF MENTALLY HANDICAPPED

    Directory of Open Access Journals (Sweden)

    Peter SKUBER

    1997-06-01

    Full Text Available In my discussion about the early treatment, I am going to point out three important matters:1. Open public health serviceThe deliveries are made at hospitals and the health service is the first to detect and treat children who are disturbed in their development. It also supervisor pregnancies. Upon the delivery, the screening test is used to analyze the risk delivery. At the beginning, the treatment is individual.2. Group (5-8 children in regular kindergartenThe transition of the child from the clinical treatment to the kindergarten is the result of an agreement between the team of experts both from the health institutes and pedagogical field of activity working in this way also when the child is in the nursery.The group of 5-8 handicapped children is now under the supervision of a nursery teacher having been to obtain special pedagogical education.3. Seminars of parentsThe state unity of associations providing for handicapped, in cooperation with local associations, organizes seminars lasting several days for parents and children.The purpose of the seminars is first of all helping parents in solving their emotional problems and also informing them on numerous issues appearing in connection with their child and themselves.

  17. Fear of failure and self-handicapping in college physical education.

    Science.gov (United States)

    Chen, Lung Hung; Chen, Mei-Yen; Lin, Meng-Shyan; Kee, Ying Hwa; Shui, Shang-Hsueh

    2009-12-01

    The purpose of this study was to examine the relationship between fear of failure and self-handicapping within the context of physical education. Participants were 103 college freshmen enrolled in aerobic dance physical education classes in Taiwan. They completed the Performance Failure Appraisal Inventory and Self-Handicapping Scale for Sport 3 mo. after entering the class. Hierarchical regression indicated that scores on fear of failure predicted self-handicapping scores.

  18. Some Costs of Caring at Home for an Intellectually Handicapped Child.

    Science.gov (United States)

    Chetwynd, Jane

    1985-01-01

    Household expenditure patterns of families in the general population were compared with those of 91 families caring for an intellectually handicapped child. Results indicated that handicapped child families spent on average $NZ17 per week more on household items and $NZ7 a week on items related to care of the handicapped child. (Author/CL)

  19. Inter-relationship of intelligence-quotient and self-concept with dental caries amongst socially handicapped orphan children.

    Science.gov (United States)

    Virk, Pks; Jain, R L; Pathak, A; Sharma, U; Rajput, J S

    2012-01-01

    India has been the focus of many health surveys among normal, physically, and mentally handicapped children. However, the data, concerning oral health conditions of socially handicapped children living in orphanages, are scanty. To study the effect of parental inadequacy, environmental deprivation, and emotional disturbances on dental caries through intelligence quotient (IQ) and self-concept in orphan children and also to co-relate dental caries with different levels of IQ and self-concept. The study was carried out amongst socially handicapped children living in orphanages. 100 children in the age group of 10-14 years from orphanages were selected. Malin's Intelligence Scale for Indian Children (MISIC) was used to assess the intelligence quotient; self-concept questionnaire to assess self-concept of the child and recording of dental caries status of children was done as per WHO Index (1997). To assess the relationship of dental caries with IQ, student's unpaired t-test was used and; to find the relationship between self-concept and dental caries, Karl-Pearson's coefficient of co-relation was applied. the children in orphanages had a lower IQ and high caries experience but had an above average self-concept. There was also no co-relation between dental caries and self-concept. Orphan children, being socially handicapped, are at an increased risk for dental caries due to a lower IQ level, parental deprivation, and institutionalization. Moreover, lack of co-relation between dental caries and self-concept could be explained by the fact that dental caries is a lifelong process whereas different dimensions of self-concept are in a state of constant flux.

  20. Frequency of Divorce Among Parents of Handicapped Children.

    Science.gov (United States)

    Shufeit, Lawrence J.; Wurster, Stanley R.

    Seventy-six parents of handicapped children were surveyed to compare the frequency of divorce in the sample population to that of the U.S. population. A research review revealed that the first-born child causes extensive to severe crises in the parents' marital relationship; that the presence of a child with a handicapping condition causes a…

  1. "Euthanasia" of Persons with Severe Handicaps: Refuting the Rationalizations.

    Science.gov (United States)

    Lusthaus, Evelyn

    1985-01-01

    The article examines two common rationalizations for euthanasia of persons with severe handicaps and presents arguments to refute them. The article calls for parents, professionals, and friends of persons with severe handicaps to be vocal in refuting euthanasia and its rationales. (Author/CL)

  2. The Knowledge of Nurses and Midwives Related to Mentally-Handicapped Children

    Directory of Open Access Journals (Sweden)

    Hatice Yildirim Sari

    2008-04-01

    Full Text Available AIM/BACKGROUND: The purpose of this research is to determine the knowledge of nurses and midwives who are working at primary health care services. METHODS: The information regarding the research has been given to the nurses and midwives working at primary health centers of Manisa, and 70 nurses and midwives have accepted to attend the research. In collecting the data, two questionnaire forms prepared by the researchers have been used and these forms are composed of two parts. In the first part of the questionnaire, there are questions about the sociodemografhic characteristics of midwives and nurses; in the second one the questions are related to the symptoms and causes of mental-handicap and the attempts regarding the mentally-handicapped child and his family. RESULTS: The nurses and midwives have stated that the most important cause of mental handicap is marriages among relatives (92.9%. and that in a situation of not being able to fullfill mental motor skills in relation to age, they suspect mental handicap (90%. They have also stated that they mostly have or can have difficulty in communucating with the mentally-handicapped child (64%. CONCLUSION: As a result, the nurses and midwives have adequate knowledge about the causes and symptoms of mental handicap. On the other hand, their knowledge regarding the services to be planned in care of mentally-handicapped children is limited. At the primary health care services, educational studies can be planned in order to give better health service for mentally-handicapped individuals. [TAF Prev Med Bull 2008; 7(2.000: 127-132

  3. Personal, interpersonal, and situational influences on behavioral self-handicapping.

    Science.gov (United States)

    Brown, Christina M; Kimble, Charles E

    2009-12-01

    This study explored the combined effects of personal factors (participant sex), interpersonal factors (experimenter sex), and situational factors (performance feedback) on two forms of behavioral self-handicapping. Participants received non-contingent success or failure feedback concerning their performance on a novel ability and were given the opportunity to self-handicap before performing again. Behavioral self-handicapping took the form of (a) exerting less practice effort (practice) or (b) choosing a performance-debilitating tape (choice). Men practiced least after failure feedback and chose a debilitating tape if they were interacting with a female experimenter. Generally, across all participants in both choice and practice conditions, high performance concern and the presence of a male experimenter led to the most self-handicapping. Results are interpreted in terms of self-presentational concerns that emphasize a desire to impress or an awareness of the female or male experimenter's acceptance of self-handicappers.

  4. Underachievers' Cognitive and Behavioral Strategies--Self-Handicapping at School.

    Science.gov (United States)

    Nurmi, Jari-Erik; And Others

    1995-01-01

    Two studies with a total of 153 junior and senior high-school students and vocational students in Finland investigated whether underachievers applied a self-handicapping or learned-helplessness strategy in achievement contexts. Underachievers seemed to apply a self-handicapping strategy rather than a learned-helplessness approach. (SLD)

  5. Personal Integration Resources of Mentally Handicapped Teenagers into Society

    Science.gov (United States)

    Konovalova, Natalia

    2016-01-01

    The paper deals with the issues concerning the study of mentally handicapped teenagers' integrative potential within modernisation of contemporary Russian education. The research is concentrated on the study of personal and social determinants influencing the readiness of mentally handicapped students to be integrated into the environment.…

  6. Train in vain: the role of the self in claimed self-handicapping strategies.

    Science.gov (United States)

    Finez, Lucie; Sherman, David K

    2012-10-01

    Two field studies investigate the role of self in the tendency of athletes to engage in claimed handicapping strategies during training (anticipatively claiming that handicaps may interfere with their performance). Study 1 tested the relationship between trait self-esteem and athletes' engagement in claimed self-handicapping. As hypothesized, low physical self-esteem athletes claimed more handicaps than high physical self-esteem athletes. For stronger evidence for the causal role of the self, Study 2 tested whether securing athletes' self-worth through self-affirmation would lead to decreased claimed self-handicapping by using a mixed model design that allows for both between-subjects (affirmation vs. control condition) and within-subject comparisons (before vs. after self-affirmation intervention). Self-affirmed athletes had decreased levels of claimed self-handicapping. Studies 1 and 2 also demonstrate that athletes engage in claimed self-handicapping during training, which could have deleterious effects on subsequent performance. Discussion centers on theoretical implications and applications for coaches, sport teachers, and sport psychologists.

  7. Use of vegetation health data for estimation of aus rice yield in bangladesh.

    Science.gov (United States)

    Rahman, Atiqur; Roytman, Leonid; Krakauer, Nir Y; Nizamuddin, Mohammad; Goldberg, Mitch

    2009-01-01

    Rice is a vital staple crop for Bangladesh and surrounding countries, with interannual variation in yields depending on climatic conditions. We compared Bangladesh yield of aus rice, one of the main varieties grown, from official agricultural statistics with Vegetation Health (VH) Indices [Vegetation Condition Index (VCI), Temperature Condition Index (TCI) and Vegetation Health Index (VHI)] computed from Advanced Very High Resolution Radiometer (AVHRR) data covering a period of 15 years (1991-2005). A strong correlation was found between aus rice yield and VCI and VHI during the critical period of aus rice development that occurs during March-April (weeks 8-13 of the year), several months in advance of the rice harvest. Stepwise principal component regression (PCR) was used to construct a model to predict yield as a function of critical-period VHI. The model reduced the yield prediction error variance by 62% compared with a prediction of average yield for each year. Remote sensing is a valuable tool for estimating rice yields well in advance of harvest and at a low cost.

  8. Use of Vegetation Health Data for Estimation of Aus Rice Yield in Bangladesh

    Directory of Open Access Journals (Sweden)

    Mohammad Nizamuddin

    2009-04-01

    Full Text Available Rice is a vital staple crop for Bangladesh and surrounding countries, with interannual variation in yields depending on climatic conditions. We compared Bangladesh yield of aus rice, one of the main varieties grown, from official agricultural statistics with Vegetation Health (VH Indices [Vegetation Condition Index (VCI, Temperature Condition Index (TCI and Vegetation Health Index (VHI] computed from Advanced Very High Resolution Radiometer (AVHRR data covering a period of 15 years (1991–2005. A strong correlation was found between aus rice yield and VCI and VHI during the critical period of aus rice development that occurs during March-April (weeks 8–13 of the year, several months in advance of the rice harvest. Stepwise principal component regression (PCR was used to construct a model to predict yield as a function of critical-period VHI. The model reduced the yield prediction error variance by 62% compared with a prediction of average yield for each year. Remote sensing is a valuable tool for estimating rice yields well in advance of harvest and at a low cost.

  9. Handicap principle implies emergence of dimorphic ornaments.

    Science.gov (United States)

    Clifton, Sara M; Braun, Rosemary I; Abrams, Daniel M

    2016-11-30

    Species spanning the animal kingdom have evolved extravagant and costly ornaments to attract mating partners. Zahavi's handicap principle offers an elegant explanation for this: ornaments signal individual quality, and must be costly to ensure honest signalling, making mate selection more efficient. Here, we incorporate the assumptions of the handicap principle into a mathematical model and show that they are sufficient to explain the heretofore puzzling observation of bimodally distributed ornament sizes in a variety of species. © 2016 The Author(s).

  10. Self-Handicapping by Task Choice: An Attribute Ambiguity Analysis.

    Science.gov (United States)

    Handelsman, Mitchell M.; And Others

    Self-handicapping strategies are behaviors or choices of performance settings which allow people to maintain self-esteem by avoiding negative self-relevant attributions. People will behave in such a way that accurate, nonambiguous attributions about their performance cannot be made. Research on self-handicapping has focused on clinically relevant…

  11. Horticultural therapy--aspects of land use for the mentally handicapped. A system of planning for the requirements of the mentally handicapped gardener.

    Science.gov (United States)

    Spurgeon, T; Underhill, C

    1979-01-01

    An increasing number of facilities for the mentally handicapped use horticulture, agriculture and gardening in their training programmes. This paper contains a review of: (1) some aspects of land use as a medium for leisure, rehabilitation, therapy and training for the mentally handicapped, (2) employment, both sheltered and open, in land use as reflected in a recent survey, (3) the variety of knowledge available through the medium of land use. The main emphasis of the paper deals with: (1) the need for planning, (2) a suggested planning system that assists the instructor in understanding the requirements of the mentally handicapped gardener when he approaches a given job, (3) some problems peculiar to land use work with the mentally handicapped. In conclusion the authors briefly examine: (1) the need for assessment, (2) the need to distinguish between production and training, (3) suggestions towards an expansion of the planning system to take in other areas of the horticultural unit than were originally described, (4) social activities connected with the horticultural activities described, (5) the hierarchy identified through the use of a particular planning system.

  12. Discipline in the Public Schools: A Dual Standard for Handicapped and Nonhandicapped Students?

    Science.gov (United States)

    Simon, Sue G.

    1984-01-01

    Federal regulation protects handicapped students' education against unwarranted interruption without specifying procedures for disciplining handicapped students. This article reviews court decisions in disciplinary cases and provides procedural guidelines to follow in disciplining handicapped students. (MD)

  13. SYNCHRONIC DISTANCE EDUCATION FROM THE PERSPECTIVE OF A HANDICAPPED PERSON

    Directory of Open Access Journals (Sweden)

    Hasan KARAL

    2011-04-01

    Full Text Available Nowadays knowledge and communication technologies are developing rapidly and changing people’s lives. With the help of the developing technologies, people can access knowledge independent of time and place and distance education technologies offer handicapped students a range of opportunities in order that they may access a better level of education. By defining perceptions related to the distance education of a physically handicapped student engaged in a program of synchrony distance education at Karadeniz Technical University to throw a fresh light on this topic. Due to the nature research problem, phenomenology, one of qualitative research patterns, was used in this study which has a qualitative character. In this study, because it was intended to present a handicapped person’s thoughts related to distance education, semi-structured interview, one of qualitative data collection techniques was thought to be the most appropriate data collection instrument. The sampling of the research included the handicapped student receiving courses by synchrony distance education in Karadeniz Technical University, two friends of the student following the same course and the assistant in the course environment. The interviews were recorded with a video camera, a transcript of each of the interviews was prepared and the data was analyzed scientifically. In the light of the research findings, it was decided that the synchrony distance education environment helped handicapped person feel more secure and relaxed and for his handicap not to be noticed by others. In addition, without the lecturers’ feeling of compassion, it presented handicapped student with an opportunity to prove himself. Also, because the courses classes? were recorded in this environment, students could review the content of the class in their own time and this process could be repeated, thus the students could learn at their own speed.

  14. The Multiply Handicapped Child.

    Science.gov (United States)

    Wolf, James M., Ed.; Anderson, Robert M., Ed.

    Articles presented in the area of the medical and educational challenge of the multiply handicapped child are an overview of the problem, the increasing challenge, congenital malformations, children whose mothers had rubella, prematurity and deafness, the epidemiology of reproductive casualty, and new education for old problems. Discussions of…

  15. A home-centered instructional communication strategy for severely handicapped children.

    Science.gov (United States)

    Wulz, S V; Hall, M K; Klein, M D

    1983-02-01

    Family involvement is an essential element of language intervention with severely handicapped children for several reasons. First, the parent-child interaction is the focus of normal language development, and can be a powerful impetus in language learning for handicapped children. Second, limited generalization and maintenance of skills often occur when they are acquired in environments that do not also teach the appropriate use of skills. Third, parents can be successful intervention agents and may generalize their skills to other interactions with their child. Training conducted in the home must be compatible with that environment: it should involve only those skills that are of immediate use in the home. The Instructional Communication Strategy described herein represents such a program. It is a synthesis of training strategies used with normal and handicapped children, and is applicable regardless of child's level of functioning, age, or handicapping condition. This training model involves considerable modification in the role of speech-language pathologists dealing with the severely handicapped. The professional's skills are best utilized for assessment, program development, monitoring progress, and training specialized skills. The parents provide most of the direct training; however, professionals are also utilized for the child's maximum benefit.

  16. Psychological distress longitudinally mediates the effect of vertigo symptoms on vertigo-related handicap.

    Science.gov (United States)

    Probst, Thomas; Dinkel, Andreas; Schmid-Mühlbauer, Gabriele; Radziej, Katharina; Limburg, Karina; Pieh, Christoph; Lahmann, Claas

    2017-02-01

    Vertigo symptoms can lead to more or less vertigo-related handicap. This longitudinal study investigated whether depression, anxiety, and/or somatization mediate the relationship between vertigo symptoms and vertigo-related handicap. N=111 patients with vertigo/dizziness provided complete data on the following measures: Vertigo symptoms at baseline, depression at 6-month follow-up, anxiety at 6-month follow-up, somatization at 6-month follow-up, and vertigo handicap at 12-month follow-up. Mediation analyses with bootstrapping were performed to investigate the mediating role of anxiety, depression, and somatization in the relationship between vertigo symptoms and vertigo-related handicap. When the mediating role of anxiety, depression, and somatization was evaluated separately from each other in single mediation models, the effect vertigo symptoms at baseline exerted on vertigo-related handicap at 12-month follow-up was significantly mediated by depression at 6-month follow-up (pvertigo symptoms at baseline on vertigo-related handicap at 12-month follow-up (pvertigo symptoms lead to vertigo-related handicap. Copyright © 2016 Elsevier Inc. All rights reserved.

  17. Mortality of mentally handicapped patients after mass inter-hospital ...

    African Journals Online (AJOL)

    1990-08-18

    Aug 18, 1990 ... handicapped group the death rate was as high as 58,5/1 000 because it was an older population. In our patients we observed that in spite of the preparation before transfer, and the improved facilities and nursing care afterwards, there was an increase in the death rate of mentally handicapped patients after ...

  18. Implications of Self-Handicapping Strategies for Academic Achievement: A Reconceptualization.

    Science.gov (United States)

    Murray, Carolyn B.; Warden, M. Robert

    1992-01-01

    Presents questionnaire results concerning self-handicapping, course-related expectancies, and study habits. Reports that self-handicappers were more likely than others to make external and unstable attributions. Concludes that the underlying cognitive mechanism of self-handicapping strategies is a defensive attributional pattern that protects an…

  19. Laryngeal manual therapy palpatory evaluation scale: A preliminary study to examine its usefulness in diagnosis of occupational dysphonia

    Directory of Open Access Journals (Sweden)

    Ewelina Woźnicka

    2017-04-01

    Full Text Available Background: The aim of this study has been to assess the larynx and soft tissue around the vocal tract in a group of people with healthy voice, and in a group of patients with occupational dysphonia using the new laryngeal manual therapy palpatory evaluation scale (LMTPE. Material and Methods: The examinations were performed in a study (dysphonic group of professional voice users who had developed voice disorders (N = 51 and in the control group of normophonic subjects (N = 50. All the participants underwent perceptual voice assessment and examination by means of the LMTPE scale. Additionally, phoniatric examination including VHI (Voice Handicap Index questionnaire, GRBAS (the Grade of hoarseness, Roughness, Breathiness, Asthenic, Strained perceptual evaluation, maximum phonation time (MPT measurement and videostroboscopy was performed in the study group. Results: The comparison of the LMTPE total score showed that the results of the study group were significantly poorer than those of controls (p < 0.001. In the study group, correlations were found between the LMTPE results and the VHI scores (p < 0.05, perceptual evaluation by the GRBAS (p < 0.05 and the objective parameter MPT (p < 0.05. Conclusions: The study has proven that the LMTPE scale is characterized by the high score of Cronbach’s α ratio estimating the reliability of the test. The results have confirmed that the LMTPE scale seems to be a valuable tool, useful in diagnostics of occupational dysphonia, particularly of hyperfunction origin. Med Pr 2017;68(2:179–188

  20. Self-assessment and readiness for change in dysphonic patients.

    Science.gov (United States)

    Lopes, Leonardo Wanderley; Vilela, Eveline Gonçalves

    2016-07-04

    To examine whether there is an association between vocal self-assessment and readiness for change in dysphonic patients. 151 patients with vocal complaints and diagnosis of dysphonia, between 18 and 65 years of age, 47 men and 104 women treated at the voice clinic of a public institution participated in the study. Four self-assessment instruments were applied, including the Voice-Related Quality of Life (V-RQOL), the Voice Handicap Index (VHI) and the Voice Symptom Scale (VoiSS), and the use of URICA-VOICE instrument to verify the patients stage of readiness for change. All instruments were applied immediately before the start of vocal therapy. The variables were correlated and compared using inferential statistics. Most patients were in the contemplation stage (76.2%, n = 115), 22 (14.6%) were in the pre-contemplation stage and 14 (9.3%) in the action stage. There was a negative correlation between the score in URICA-VOICE and the socio-emotional domain and total score V-RQOL. There was a positive correlation between the score URICA-VOICE and full social, emotional and functional VHI, as well as between the score URICA-VOICE and full fields, limitation and emotional VoiSS. Only the social-emotional domain V-RQOL and emotional in VoiSS values showed statistically significant differences between the motivational stages. There is association between vocal self-assessment and readiness for change in dysphonic patients. Patients with major impact on quality of life in voice in V-RQOL and higher frequency of vocal symptoms mentioned in the VoiSS show greater readiness for change.

  1. Evaluation of voice acoustic parameters related to the vocal-loading test in professionally active teachers with dysphonia.

    Science.gov (United States)

    Niebudek-Bogusz, Ewa; Kotyło, Piotr; Sliwińska-Kowalska, Mariola

    2007-01-01

    Teachers are at risk of developing voice disorders. A clinical battery of vocal function tests should include non-invasive and accurate measurements. The quantitative methods (e.g., voice acoustic analysis) make it possible to objectively evaluate voice efficiency and outcomes of dysphonia treatment. To identify possible signs of vocal fatigue, acoustic waveform perturbations during sustained phonation were measured before and after the vocal-loading test in 51 professionally active female teachers with functional voice disorders, using IRIS software. All the participants were also subjected to laryngological/phoniatric examination involving videostroboscopy combined with self-estimation by voice handicap index (VHI)-based scale. The phoniatric examination revealed glottal insufficiency with bowed vocal folds in 35.2%, soft vocal nodules in 31.4%, and hyperfunctional dysphonia with a tendency towards vestibular phonation in 19.6% of the patients. In the VHI scale, 66% of the female teachers estimated their own voice problems as moderate disability. An acoustic analysis performed after the vocal-loading test showed an increased rate of abnormal frequency perturbation parameters (pitch perturbation quotient (Jitter), relative average perturbation (RAP), and pitch period perturbation quotient (PPQ)) compared to the pre-test outcomes. The same was true of pitch-intensity contour of vowel /a:/, an indication of voice instability during sustained phonation. The recorded impairments of voice acoustic parameters related to vocal loading provide further evidence of dysphonia. The voice acoustic analysis performed before and after the vocal-loading test can significantly contribute to objective voice examinations useful in diagnosis of dysphonia among teachers.

  2. Botulinum toxin treatment of false vocal folds in adductor spasmodic dysphonia: Functional outcomes.

    Science.gov (United States)

    Simpson, C Blake; Lee, Christopher T; Hatcher, Jeanne L; Michalek, Joel

    2016-01-01

    Supraglottic injection of botulinum toxin (Botox) has been described as an effective treatment for adductor spasmodic dysphonia (ADSD). Anecdotal evidence suggests that the patients have little to no breathiness after injection, but no formal longitudinal studies have been carried out to date. The purpose of this study was to examine the voice outcomes in patients with ADSD after supraglottic Botox injection. Retrospective case series. Patients with ADSD who were treated with supraglottic Botox injections completed a qualitative self-evaluation of voice function after injection using the percentage of normal function (PNF) scale, a validated, quantitative scale from 0% (no function) to 100% (normal function). Posttreatment voice improvement after injection was determined using a Voice Handicap Index-10 (VHI-10) questionnaire. A total of 198 supraglottic injections were performed between July 2011 and October 2014. Twenty-five questionnaires were completed. Mean postinjection PNF was 95.0% ± 8.4% and was significantly increased from the preinjection mean PNF (62.5%) ± 22.6% (P < 0.001). The mean best VHI-10 for all injections was 7.23. In 19 of 25 patients (76%), there was no reduction in PNF in the early postinjection period. In the remaining six patients (24%), the decline in mean vocal function was 9.2%. Supraglottic Botox injection is an effective treatment for ADSD. Postinjection voice is significantly improved, and the majority of patients do not experience breathy voice/decline in vocal function after injection. © 2015 The American Laryngological, Rhinological and Otological Society, Inc.

  3. Relations between female students' personality traits and reported handicaps to rhythmic gymnastics performance.

    Science.gov (United States)

    Ferrand, Claude; Champely, Stephane; Brunel, Philippe C

    2005-04-01

    The present study evaluated the relative contributions of Self-esteem, Trait anxiety, and Public Self-consciousness to self-handicapping on a sex-typed task, within a specific academic sport context. Prior to the competitive examination used to recruit French Physical Education Teachers, female sport students (N = 74) were asked to list and rate on a 7-point scale handicaps which could be disruptive to their Rhythmic Gymnastics performance. Self-esteem did not account for significant variance in any category of handicaps. Trait Anxiety was negatively related to handicaps related to Rhythmic Gymnastics and to Social and Work Commitments. Public Self-consciousness was significantly related to endorsement of Friends and Family Commitments handicaps. These results were discussed in relation to the literature.

  4. [Psychosocial adjustment of the handicapped child--possibilities and problems of rehabilitation].

    Science.gov (United States)

    Eulitz, R

    1989-01-01

    A successful childhood is to be striven after particularly for a handicapped child. Habilitation and rehabilitation, only carefully adapted to one another referring to medical specialties in colaboration with the family, may rise to the demand of the individuality of every one handicapped child. On prior conditions children with chiefly physical handicaps may be integrated into the polytechnical secondary school providing general education in the home town. The total-body examination of these children remains to be the basis for all paediatric actions.

  5. The Impact of Handicapping Conditions on Consumer Attitudes in Families.

    Science.gov (United States)

    Collins, Eleanor M.; And Others

    The report summarizes results of a study of attitudes of 222 undergraduate university students (University of Minnesota, Duluth) toward financial decisions involving a family member with a handicap. The Situational Attitude Scale--Handicapped Family Consumer (which assesses attitudes toward parental expenditure of money for siblings or…

  6. Self-Assessed Hearing Handicap in Older Adults with Poorer-than-Predicted Speech Recognition in Noise

    Science.gov (United States)

    Eckert, Mark A.; Matthews, Lois J.; Dubno, Judy R.

    2017-01-01

    Purpose: Even older adults with relatively mild hearing loss report hearing handicap, suggesting that hearing handicap is not completely explained by reduced speech audibility. Method: We examined the extent to which self-assessed ratings of hearing handicap using the Hearing Handicap Inventory for the Elderly (HHIE; Ventry & Weinstein, 1982)…

  7. DESIGN OF CITY BUS LIFT FOR THE HANDICAPPEDS

    Directory of Open Access Journals (Sweden)

    K. Turgut GÜRSEL

    2003-03-01

    Full Text Available Although the technological developments, the handicappeds do not take part sufficiently in the social and economic life, because buildings, road construction features and means of the transport are not suitable for them. In this study, a lift for handicappeds was designed, that is supposed to be installed to the middle door of city buses. The lift, whose installation should require a few changes at the bus, is driven by a hydraulic system from the street to the level of the bus floor and vice-versa. In the work, at first a construction was developed in accordance with the dimensions of the middle door of a city bus. After determining of dimensions of all elements, a hydraulic mechanism was constructed, that raises the handicapped, its wheelchair and the platform. Furthermore the construction of the elements of the system were determined, and its proofs of strength analysis were indicated

  8. Siblings of the Handicapped: A Literature Review for School Psychologists.

    Science.gov (United States)

    Hannah, Mary Elizabeth; Midlarsky, Elizabeth

    1985-01-01

    Siblings of handicapped children may have adjustment problems associated with increased family responsibilities, increased parental expectations, and perceived parental neglect in favor of the disabled sibling. Problems may be related to socioeconomic status; family size; age, sex, and birth order of the sibling; and severity of the handicap. (GDC)

  9. Comparison of Nursing Home Hearing Handicap Index with Audiological Findings: A Presbycusis Study

    Directory of Open Access Journals (Sweden)

    M. H. Nilforoush

    2012-01-01

    Full Text Available Hearing evaluation usually includes hearing threshold assessment, middle ear function, and word recognition tests that lead to an accurate result of peripheral and central auditory system. However, they have some limitations because they cannot fully encompass all aspects of hearing loss problems. Using self-assessment approach, via a questionnaire or telephone survey, is one of the easiest methods to study hearing loss in population. In this research, 60 nursing home residents (27 females and 33 males ranging from 55 to 85 years with a mean age of were studied via completing self-assessment questionnaire by the elderly cases (NHHI self-version and the other one was filled by the nursing home personnel (NHHI staff-version. The effects of the hearing loss level on the self- and staff-version scores indicated that there is a significant relationship between self- and staff-version with hearing loss levels ( in male and female. Results from this study demonstrate the usefulness of NHHI questionnaire for evaluating hearing handicap of aged people and it may be a useful adjunct in setting up treatment and determining proper care.

  10. Disciplining handicapped students: legal issues in light of Honig v. Doe.

    Science.gov (United States)

    Bartlett, L

    1989-01-01

    Court decisions interpreting the effect of the education for All Handicapped children Act on traditional forms of public school discipline have raised many question. This article reviews these decisions and confirms that most forms of minor disciplinary remedies remain available to educators so long as they are also used with nonhandicapped students. However, many legal problems arise with expulsion and long-term, or indefinite, suspensions of handicapped students, especially in the light of the recent Supreme court ruling regarding the expulsion of handicapped students.

  11. Consumer Education for the Mentally Handicapped

    Science.gov (United States)

    Alperstein, Neil M.

    1977-01-01

    Discusses community placement of mentally handicapped people and remedial procedures for encouraging independent decision making and behavior. Intertwines this behavior change with an alternative method of consumer education. (Author/RK)

  12. Consequences of self-handicapping: effects on coping, academic performance, and adjustment.

    Science.gov (United States)

    Zuckerman, M; Kieffer, S C; Knee, C R

    1998-06-01

    Self-handicappers erect impediments to performance to protect their self-esteem. The impediments may interfere with the ability to do well and, as such, may result in poor adjustment. Using a longitudinal design, the present studies examined prospective effects of self-handicapping on coping, academic performance, and several adjustment-related variables (e.g., self-esteem). It was found that, compared to low self-handicappers, high self-handicappers reported higher usage of coping strategies implying withdrawal and negative focus. High self-handicappers performed less well academically, an effect that was mediated in part by poor study habits. Finally, high self-handicapping resulted in poorer adjustment over time, and poorer adjustment resulted in higher self-handicapping over time. These relations are consistent with the idea of a vicious cycle in which self-handicapping and poor adjustment reinforce one another.

  13. Evaluation of attitudes of university students for handicapped individuals

    Directory of Open Access Journals (Sweden)

    Özkan Zekiye

    2017-01-01

    Full Text Available Education has an important role in humans’ behaviours. Undergraduate education has headed among factors that influence maturation period before vocational lifes of individuals. The purpose of this study is to determine whether attitudes of university students for handicapped individuals differ according to some variables. This study which was carried out in screening model was done with 1167 people including 646 females 521 males who maintain their education at faculties taking initial teacher training in 2016 spring term at Yuzuncu Yil University. As data collection tool, Attitude Scale for Being Educated of Handicapped Individuals and Personal Information Form, which was developed by Kosterilioglu [12], was used. As statistical method, Duncan’s multiple range test was used in determining different groups following one-wat analysis of variance. Among these variables, pearson coefficients of correlation were calculated separately in groups in determining relation. In determining relationship between groups and categorical variables , chi square test was used. In calculations, value of p was taken as 0,05 and SPSS statistic program was used for calculations. While point average of attitudes of male students , who maintain their educations at Yuzuncu Yil University, for handicapped people was ascertained as 54.27±23.54, point average of attitudes of female students was determined as 55.86±26.34. A significant difference between male and female students according to gender variable was not seen in attitudes for being educated of handicapped individuals (P>0,05. It was observed that attitudes for being educated of handicapped individuals in starting and end of undergraduate term were higher than intermediate classes (P<0,01. Although a significant difference in kind of high schools from which students graduated was not seen, attitudes of graduates from science and sport high schools were found higher than graduates from other high schools

  14. Equine Therapy for Handicapped Students.

    Science.gov (United States)

    Minner, Sam; And Others

    1983-01-01

    Four aspects in planning a therapeutic horsemanship program for handicapped individuals are considered: training instructors, obtaining the needed horses and equipment, identifying the participants, and implementing the program and developing a curriculum. An example of a horsemanship program begun in Kentucky is offered. (CL)

  15. [22q11.2 deletion: handicap-related problems and coping strategies of primary caregivers].

    Science.gov (United States)

    Briegel, Wolfgang; Schneider, Marco; Schwab, K Otfried

    2009-11-01

    To investigate handicap-related problems of children and adolescents with 22q11.2 deletion syndrome and their primary caregivers' coping strategies. Primary caregivers of 153 subjects aged 2-16 years were anonymously asked to fill out questionnaires, e.g., the Handicap Related Problems for Parents Inventory. Primary caregivers of 96 subjects (53 males, 43 females; mean age: 7;0 [2;1-16;11] years) sent back questionnaires. Patient's behaviour and discipline were the most important handicap-related problems. Significant correlations could be found between the patient's age and his/her relationship with the primary caregiver (rho=0.228; p=.029) and other family members (rho=0.293; p=.004). Compared to other parents of physically handicapped children or those with multiple handicaps, these parents did not experience increased stress. The more the coping strategies "self-fulfillment" and "intensification of partnership" were used, the lower parental stress was (p=.012, p=.025, respectively). "Focusing on the handicapped child" was positively correlated with high parental stress (p=.000). With regard to parental stress and coping strategies, primary caregivers of children and adolescents with 22q11.2 deletion do not significantly differ from other parents of physically handicapped children. As handicap-related family problems increase with the patient's age, a growing need for counseling, especially for aspects of parenting and discipline, and for treatment can be presumed.

  16. Correlations between self-handicapping and self-defeating personality.

    Science.gov (United States)

    Schill, T; Morales, J; Beyler, J; Tatter, T; Swigert, L

    1991-10-01

    In this study scores on Strube's self-handicapping scale were correlated with scores on Schill's self-defeating personality scale. Berglas believes there are subtypes of self-defeating personality and that his concept of self-handicapping should be correlated with the three criteria which represent a self-protective component of self-defeating personality. Some support for Berglas' proposition was found, particularly for men. However, correlations with other components of self-defeating personality suggest the criteria thought to be self-protective may need to be reconsidered.

  17. Psychology and the Handicapped Child.

    Science.gov (United States)

    Sherrick, Carl E., Ed.; And Others

    Reviewed in seven author contributed chapters are findings of experimental psychology relevant to the education of handicapped children in the areas of sensory processes, visual perception, memory, cognition and language development, sustained attention and impulse control, and personality and social development. Noted in an introductory chapter…

  18. Treatment of Orally Handicapped Edentulous Older Adults Using Dental Implants.

    Science.gov (United States)

    Zahedi, Charles

    2016-07-01

    The oral handicap of complete edentulism is the terminal outcome of a multifactorial process involving biological factors and patient-related factors. Fully edentulous orally handicapped older adults have been neglected because removable acrylic dentures have been the classic therapy for complete edentulism but are only rehabilitative, not therapeutic. Not replacing missing teeth with stable dentures could prevent adequate food intake. Osseointegrated endosseous implants used as a therapeutic adjunct can reduce the problem of long-term bone resorption to less than 0.1 mm per year. Implant-borne prostheses substantially increase the overall health and quality of life of orally handicapped fully edentulous older adults. Copyright © 2016 Elsevier Inc. All rights reserved.

  19. The role of uncertain self-esteem in self-handicapping.

    Science.gov (United States)

    Harris, R N; Snyder, C R

    1986-08-01

    In this article, the hypothesis that some individuals confronted with an intellectual evaluation use a lack of preparation as a "self-handicapping" strategy (Jones & Berglas, 1978) was studied. Sex and both level and certainty of self-esteem were examined in regard to the self-handicapping strategy of lack of effort. Subjects were 54 men and 54 women, certain and uncertain, high and low self-esteem college students, who believed that the experiment was designed to update local norms for a nonverbal test of intellectual ability. After subjects' level of state anxiety was assessed, they were instructed in the benefits of practicing for the evaluation. Subsequently, subjects' state anxiety and preparatory efforts (the primary dependent variables) were measured. Subjects' practice, self-protective attributions, and related affect supported a self-handicapping interpretation for uncertain males but not for uncertain females.

  20. Relative contributions of self-efficacy, self-regulation, and self-handicapping in predicting student procrastination.

    Science.gov (United States)

    Strunk, Kamden K; Steele, Misty R

    2011-12-01

    The relative contributions of self-efficacy, self-regulation, and self-handicapping student procrastination were explored. College undergraduate participants (N = 138; 40 men, 97 women, one not reporting sex) filled out the Procrastination Scale, the Self-Handicapping Scale-Short Form, and the Self-regulation and Self-handicapping scales of the Motivated Strategies for Learning Questionnaire. A hierarchical regression of the above measures indicated that self-efficacy, self-regulation, and self-handicapping all predicted scores on the Procrastination Scale, but self-regulation fully accounted for the predictive power of self-efficacy. The results suggested self-regulation and self-handicapping predict procrastination independently. These findings are discussed in relation to the literature on the concept of "self-efficacy for self-regulation" and its use in the field of procrastination research.

  1. Handicaps No Hindrance with Horses

    Science.gov (United States)

    Seeley, Colleen

    1974-01-01

    A horseback riding program, sponsored by 4-H members for handicapped children in Michigan's Genesse County, has proven physically and emotionally veneficial for the children. All therapeutic exercises were performed with the approval of the child's physician and therapist. Plans for expanding the program are being considered. (AG)

  2. Modeling Agricultural Crop Production in China using AVHRR-based Vegetation Health Indices

    Science.gov (United States)

    Yang, B.; Kogan, F.; Guo, W.; Zhiyuan, P.; Xianfeng, J.

    Weather related crop losses have always been a concern for farmers On a wider scale it has always influenced decision of Governments traders and other policy makers for the purpose of balanced food supplies trade and distribution of aid to the nations in need Therefore national policy and decision makers are giving increasing importance to early assessment of crop losses in response to weather fluctuations This presentation emphasizes utility of AVHRR-based Vegetation health index VHI for early warning of drought-related losses of agricultural production in China The VHI is a three-channel index characterizing greenness vigor and temperature of land surface which can be used as proxy for estimation of how healthy and potentially productive could be vegetation China is the largest in the world producer of grain including wheat and rice and cotton In the major agricultural areas China s crop production is very dependent on weather The VHI being a proxy indicator of weather impact on vegetation showed some correlation with productivity of agricultural crops during the critical period of their development The periods of the strongest correlation were investigated and used to build regression models where crop yield deviation from technological trend was accepted as a dependent and VHI as independent variables The models were developed for several major crops including wheat corn and soybeans

  3. Is Being Gifted a Social Handicap?

    Science.gov (United States)

    Coleman, Laurence J.; Cross, Tracy L.

    1988-01-01

    Interviews with 15 gifted/talented adolescents indicated that many of them experienced giftedness as a social handicap. Some students coped with this by managing information about themselves to minimize their visibility as gifted students to others. (Author/JDD)

  4. Psychosocial Environment and Student Self-Handicapping in Secondary School Mathematics Classes: A Cross-National Study.

    Science.gov (United States)

    Dorman, Jeffrey P.; Adams, Joan E.; Ferguson, Janet M.

    2002-01-01

    Presents an investigation of the relationship between classroom environment and self-handicapping in Australian, Canadian, and British secondary schools. Explores student perceptions of classroom environment, self-handicapping, and academic efficacy. Reports that classroom environment scales accounted for variance in self-handicapping beyond what…

  5. Signal modulation as a mechanism for handicap disposal

    Science.gov (United States)

    Gavassa, Sat; Silva, Ana C.; Gonzalez, Emmanuel; Stoddard, Philip K.

    2012-01-01

    Signal honesty may be compromised when heightened competition provides incentive for signal exaggeration. Some degree of honesty might be maintained by intrinsic handicap costs on signalling or through imposition of extrinsic costs, such as social punishment of low quality cheaters. Thus, theory predicts a delicate balance between signal enhancement and signal reliability that varies with degree of social competition, handicap cost, and social cost. We investigated whether male sexual signals of the electric fish Brachyhypopomus gauderio would become less reliable predictors of body length when competition provides incentives for males to boost electric signal amplitude. As expected, social competition under natural field conditions and in controlled lab experiments drove males to enhance their signals. However, signal enhancement improved the reliability of the information conveyed by the signal, as revealed in the tightening of the relationship between signal amplitude and body length. Signal augmentation in male B. gauderio was independent of body length, and thus appeared not to be curtailed through punishment of low quality (small) individuals. Rather, all individuals boosted their signals under high competition, but those whose signals were farthest from the predicted value under low competition boosted signal amplitude the most. By elimination, intrinsic handicap cost of signal production, rather than extrinsic social cost, appears to be the basis for the unexpected reinforcement of electric signal honesty under social competition. Signal modulation may provide its greatest advantage to the signaller as a mechanism for handicap disposal under low competition rather than as a mechanism for exaggeration of quality under high competition. PMID:22665940

  6. Demographic and audiological factors as predictors of hearing handicap

    Directory of Open Access Journals (Sweden)

    Leposavić Ljubica

    2006-01-01

    Full Text Available INTRODUCTION Currently available evidence reveals comparatively few studies of psychological effects of hearing impairments, in spite of the fact that clinicians have for a long time been aware of a connection between the acquired hearing impairment and mental disorders. They are focused on the investigation of dysfunction in general. Thus, three domains of the auditory imbalance may be distinguished: disorder, disability and handicap. 'Handicap', according to the definition of the World Health Organization, is a hindrance in an individual that results from an impairment or disability and represents psychological response of the individual to the impairment. OBJECTIVE Validation of acquired hearing impairment as a risk factor of psychical disorders as well as an analysis of relation of some demographic factors (sex, age, education and audiological factors (degree and duration of the impairment with the frequency of hearing handicap. METHOD MMPI-201 has been applied in 60 subjects affected with otosclerosis, potential candidates for stapedectomy, before and after the surgery. RESULTS Individuals with acquired hearing impairment manifest more frequent disorders of psychical functioning in comparison with general population, while demographic and audiometric parameters did not correlate with acquired hearing handicap. CONCLUSION It may be assumed that the very recognition of demographic and audio-logical factors can not help much in the understanding of the psychological stress associated with hearing impairment.

  7. Treatment Efficacy of Electromyography versus Fiberscopy-Guided Botulinum Toxin Injection in Adductor Spasmodic Dysphonia Patients: A Prospective Comparative Study

    Science.gov (United States)

    Kim, Jae Wook; Park, Jae Hong; Park, Ki Nam; Lee, Seung Won

    2014-01-01

    Introduction. This study prospectively evaluates and compares the treatment efficacy of botulinum toxin injection under electromyography guidance (EMG group) and percutaneous botulinum toxin injection under flexible fiberscopic guidance (fiberscopy group). Methods. Thirty patients with adductor spasmodic dysphonia (ADSD), who had never received treatment, were randomly allocated into EMG- or fiberscopy-guided botulinum toxin injections between March 2008 and February 2010. We assessed acoustic and aerodynamic voice parameters, and the voice handicap index (VHI) before injection and at 1, 3, and 6 months after injection. Results. The mean total dosage of botulinum toxin was similar for both groups: 1.7 ± 0.5 U for the EMG group and 1.8 ± 0.4 U for the fiberscopy group (P > 0.05). There were no significant differences in outcomes between the two groups in either the duration of effectiveness or complications such as breathy voice and aspiration. Conclusion. Botulinum toxin injection under fiberscopic guidance is a viable alternative to EMG-guided botulinum toxin injection for the treatment of adductor spasmodic dysphonia when EMG equipment is unavailable. PMID:25383369

  8. The Effect of Septoplasty on Voice Performance in Patients With Severe and Mild Nasal Septal Deviation.

    Science.gov (United States)

    Atan, Doğan; Özcan, Kürşat Murat; Gürbüz, Ayşe Betül Topak; Dere, Hüseyin

    2016-07-01

    The authors aimed to analyze the effect of septoplasty, performed in 2 groups with different grades of nasal septal deviation (NSD), on voice performance. A total of 43 patients who had septoplasty due to NSD and were included in the study. The study groups were divided into 2 groups as groups A and B. The patients in group A had severe NSD, and 1 of the nasal cavity was obstructed totally or near totally. In group B, the NSD narrowed the nasal passage, and the deviation was not severe. The voice performance was analyzed preoperatively, and 1 month after surgery with both objective and subjective methods. Objective analysis included acoustic voice analysis, and measurement of F0, jitter %, shimmer %. Preoperative and postoperative F0, jitter %, shimmer %, and Voice Handicap Index-30 (VHI-30) were compared in groups A and B. F0 showed a statistically significant improvement after surgery in group A (P performed for severe NSD obstructing nasal lumen totally or near totally results in significant improvements in the voice performance.

  9. Treatment Efficacy of Electromyography versus Fiberscopy-Guided Botulinum Toxin Injection in Adductor Spasmodic Dysphonia Patients: A Prospective Comparative Study

    Directory of Open Access Journals (Sweden)

    Jae Wook Kim

    2014-01-01

    Full Text Available Introduction. This study prospectively evaluates and compares the treatment efficacy of botulinum toxin injection under electromyography guidance (EMG group and percutaneous botulinum toxin injection under flexible fiberscopic guidance (fiberscopy group. Methods. Thirty patients with adductor spasmodic dysphonia (ADSD, who had never received treatment, were randomly allocated into EMG- or fiberscopy-guided botulinum toxin injections between March 2008 and February 2010. We assessed acoustic and aerodynamic voice parameters, and the voice handicap index (VHI before injection and at 1, 3, and 6 months after injection. Results. The mean total dosage of botulinum toxin was similar for both groups: 1.7 ± 0.5 U for the EMG group and 1.8 ± 0.4 U for the fiberscopy group (P>0.05. There were no significant differences in outcomes between the two groups in either the duration of effectiveness or complications such as breathy voice and aspiration. Conclusion. Botulinum toxin injection under fiberscopic guidance is a viable alternative to EMG-guided botulinum toxin injection for the treatment of adductor spasmodic dysphonia when EMG equipment is unavailable.

  10. Treatment efficacy of electromyography versus fiberscopy-guided botulinum toxin injection in adductor spasmodic dysphonia patients: a prospective comparative study.

    Science.gov (United States)

    Kim, Jae Wook; Park, Jae Hong; Park, Ki Nam; Lee, Seung Won

    2014-01-01

    This study prospectively evaluates and compares the treatment efficacy of botulinum toxin injection under electromyography guidance (EMG group) and percutaneous botulinum toxin injection under flexible fiberscopic guidance (fiberscopy group). Thirty patients with adductor spasmodic dysphonia (ADSD), who had never received treatment, were randomly allocated into EMG- or fiberscopy-guided botulinum toxin injections between March 2008 and February 2010. We assessed acoustic and aerodynamic voice parameters, and the voice handicap index (VHI) before injection and at 1, 3, and 6 months after injection. The mean total dosage of botulinum toxin was similar for both groups: 1.7 ± 0.5 U for the EMG group and 1.8 ± 0.4 U for the fiberscopy group (P > 0.05). There were no significant differences in outcomes between the two groups in either the duration of effectiveness or complications such as breathy voice and aspiration. Botulinum toxin injection under fiberscopic guidance is a viable alternative to EMG-guided botulinum toxin injection for the treatment of adductor spasmodic dysphonia when EMG equipment is unavailable.

  11. Development of Self-Handicapping Tendencies.

    Science.gov (United States)

    Kimble, Charles; Kimble, Emily A.; Croy, Nan A.

    1998-01-01

    Determines when U.S. children begin to self-handicap, that is, to reduce preparation effort before evaluations. Finds that the high-self-esteem third graders acted adaptively by practicing more for the evaluation task, while the high-self-esteem sixth graders prepared more only if they had been reminded of their personal resources beforehand. (CMK)

  12. Benefits for handicapped children

    CERN Multimedia

    2003-01-01

    The introduction of long-term care benefits within the CERN Health Insurance Scheme requires the coordination of the benefits foreseen for handicapped children. Measures were adopted by the Management following the recommendation made by the Standing Concertation Committee on 26 March 2003. A document clarifying these measures is available on the Web at the following address: http://humanresources.web.cern.ch/humanresources/external/soc/Social_affairs/social_affairs.asp Social Affairs Service 74201

  13. Manual Therapy and Exercise to Improve Outcomes in Patients With Muscle Tension Dysphonia: A Case Series

    Science.gov (United States)

    Archer, Kristin R.

    2015-01-01

    Background and Purpose Muscle tension dysphonia (MTD), a common voice disorder that is not commonly referred for physical therapy intervention, is characterized by excessive muscle recruitment, resulting in incorrect vibratory patterns of vocal folds and an alteration in voice production. This case series was conducted to determine whether physical therapy including manual therapy, exercise, and stress management education would be beneficial to this population by reducing excess muscle tension. Case Description Nine patients with MTD completed a minimum of 9 sessions of the intervention. Patient-reported outcomes of pain, function, and quality of life were assessed at baseline and the conclusion of treatment. The outcome measures were the numeric rating scale (NRS), Patient-Specific Functional Scale (PSFS), and Voice Handicap Index (VHI). Cervical and jaw range of motion also were assessed at baseline and postintervention using standard goniometric measurements. Outcomes Eight of the patients had no pain after treatment. All 9 of the patients demonstrated an improvement in PSFS score, with 7 patients exceeding a clinically meaningful improvement at the conclusion of the intervention. Three of the patients also had a clinically meaningful change in VHI scores. All 9 of the patients demonstrated improvement in cervical flexion and lateral flexion and jaw opening, whereas 8 patients improved in cervical extension and rotation postintervention. Discussion The findings suggest that physical therapists can feasibly implement an intervention to improve outcomes in patients with MTD. However, a randomized clinical trial is needed to confirm the results of this case series and the efficacy of the intervention. A clinical implication is the expansion of physical therapy to include referrals from voice centers for the treatment of MTD. PMID:25256740

  14. Contralateral Vocal Fold Reactive Lesions: Nomenclature, Treatment Choice, and Outcome.

    Science.gov (United States)

    Koss, Shira L; Kidwai, Sarah M; Pitman, Michael J

    2016-06-01

    Contralateral reactive lesions (RLs) represent a distinct entity among benign bilateral vocal fold (VF) lesions. Lack of uniform nomenclature and a myriad of surgical options have hampered attempts to develop treatment guidelines. The objective of this study is to better define RLs and their prognosis, through the development of a standard nomenclature, with an aim to guide treatment and delineate the role of phonosurgery. Case series with chart review. Tertiary care center. Analysis was performed on patients with Current Procedural Terminology code 31545. Operative reports with a primary lesion and contralateral RL were included. Outcomes included the Voice Handicap Index-10 (VHI-10) and GRBAS (grade, roughness, breathiness, asthenia, and strain) scale, lesion persistence/recurrence, mucosal wave, and edge character based on blinded videostroboscopy review. A nomenclature was developed based on intraoperative RLs (n = 30), defined by lesion consistency (fibrous or polypoid) and relationship to normal VF edge (gradual or steep). Reactive lesion treatment included no intervention, excision, potassium titanyl phosphate laser, steroid injection, or a combination thereof. Observations included the following: inconsistent treatment modalities were employed, excision of RLs did not yield better outcomes, fibrous RLs were more likely to persist and polypoid lesions more likely to recur, gradual lesions were more likely to remain disease free, and most treatments showed improved mucosal wave, VHI-10, and GRBAS. Reactive lesions have not been well classified, and treatments are based on subjective intraoperative decision making with unpredictable outcomes. The nomenclature proposed will allow for a better definition of the RL and provide a framework for future research to identify optimal treatment. © American Academy of Otolaryngology—Head and Neck Surgery Foundation 2016.

  15. Comparison of long-term voice outcomes after vocal fold augmentation using autologous fat injection by direct microlaryngoscopy versus office-based calcium hydroxylapatite injection.

    Science.gov (United States)

    Zeleník, Karol; Walderová, Radana; Kučová, Hana; Jančatová, Debora; Komínek, Pavel

    2017-08-01

    The objective is to compare the long-term voice outcomes of vocal fold augmentation (VFA) using autologous fat injection via direct microlaryngoscopy versus office-based calcium hydroxylapatite (CaHA) injection. Patients with glottal insufficiency and a gap no greater than 3 mm caused by unilateral vocal fold paralysis or vocal fold atrophy were prospectively recruited to the study from September 2012 to September 2015. From September 2012 to May 2014, VFA was only performed using autologous fat via direct microlaryngoscopy under general anesthesia (N = 14). From May 2014 to September 2015, VFA was performed as an office-based procedure using a transoral approach to inject CaHA (N = 17). Videolaryngostroboscopic evaluation, subjective satisfaction with voice, voice handicap index (VHI), and maximal phonation time (MPT) were analyzed pre-injection and 12 months after VFA. A total of 31 patients were analyzed. One year after VFA, 67.8% of the patients were satisfied with their voice, with no significant difference between groups (P = 0.247). The mean improvement in VHI in the autologous fat group was 31.6 ± 16.82 versus 35 ± 27.24 in the CaHA group (P = 0.664). MPT improvement was also similar in the two groups: 5.5 ± 2.52 for the autologous fat group versus 6.0 ± 3.98 for the CaHA group (P = 0.823). Both autologous fat injection via direct microlaryngoscopy and office-based CaHA injection have good long-term results. There were no differences in the treatment results of the two procedures 1 year after injection.

  16. Self-Handicapping in School Physical Education: The Influence of the Motivational Climate

    Science.gov (United States)

    Standage, Martyn; Treasure, Darren C.; Hooper, Katherine; Kuczka, Kendy

    2007-01-01

    Background: Self-handicapping is an attribution-related process whereby individuals create performance impediments/excuses to protect self-worth in socially evaluative environments. Thus, the prevailing motivational climate would appear to be an important factor when attempting to understand the situational self-handicapping process within school…

  17. The Relationship between High School Mathematics Classroom Environment and Student Self-Handicapping.

    Science.gov (United States)

    Dorman, Jeffrey P.; Adams, Joan E.; Ferguson, Janet M.

    Classroom environment research investigating the relationship between classroom environment and self-handicapping was conducted in Australian, Canadian, and British high schools. A sample of 3,602 students from 29 schools responded to a questionnaire that assessed student perceptions of classroom environment, self-handicapping, and academic…

  18. The role of the different aspects of academic motivation and competitiveness in explaining self-handicapping

    Directory of Open Access Journals (Sweden)

    Damjan Šimek

    2010-05-01

    Full Text Available In the present research on self-handicapping, the goal was to examine the role of different types of academic motivation according to the level of self-determination. Since the existing research on self-handicapping has examined only the role of interpersonal competition, we also aimed to explore the role of different kinds of competition, i.e., the role of the reasons that motivate people to participate in competition, and the role of the reasons for the avoidance of competition. 748 high school students participated in the study. Regarding the role of academic motivation in self-handicapping the prevailing role of amotivation stood out. Intrinsic motivation predicted self-handicapping negatively, but extrinsic motivation proved to be a positive predictor. The factor structure of the Academic Motivation Scale only enabled differentiation of the reasons for education on the level of three basic types. With regard to the role of the different dimensions of competitiveness in self-handicapping, results show that those denoted by fear of failure and self-worth protection proved to be more characteristic of self-handicapping than those defined by a high valuation of the importance of quality of task accomplishment. Among others, our research suggests that by diverting students away from hypercompetitive values, functionality of self-handicapping can be decreased.

  19. Laryngeal assessment by videolaryngostroboscopy in patients with rheumatoid arthritis.

    Science.gov (United States)

    Gómez-Puerta, José A; Cisternas, Ariel; Hernández, M Victoria; Ruiz-Esquide, Virginia; Vilaseca, Isabel; Sanmartí, Raimon

    2014-01-01

    To evaluate the larynx involvement in patients with rheumatoid arthritis (RA) in a clinical setting and correlate with the different clinical features related to more aggressive disease. Cross-sectional study including 36 consecutive patients with RA. Reflux symptoms were evaluated by the Reflux Symptom Index (RSI) and vocal cord impairment by the Voice Handicap Index-10 (VHI-10). Laryngeal involvement was done by videolaryngostroboscopy (VLS). The mean age was 56,3 ± 14 years with a mean disease duration of 2,6 ± 3,1 years (range 0-16 years). Voice use was considered as professional users in 33%. Twenty-four (67%) out of 36 patients had abnormal findings of VLS. One patient had larynx nodules (bamboo nodules). Eleven patients (31%) were diagnosed with muscle tension dysphonia, and there were symptoms and signs of pharyngeal-laryngeal reflux in 23 (64%) patients. No signs of cricoarytenoid joint impairment was found. Organic larynx involvement was uncommon in patients with RA. However symptoms and signs of pharyngeal-laryngeal reflux were seen in around 60% of patients. There was no correlation between the clinical phenotype, severity of disease, immunological profile or treatment with VLS findings. Copyright © 2013 Elsevier España, S.L. All rights reserved.

  20. Therapeutic Intervention for the Physically Handicapped

    Science.gov (United States)

    Spillios, James; Janzen, Henry L.

    1978-01-01

    The need for training counselors specifically for intervention with the physically handicapped is the major focus of this article. Definitions of disabilities, rehabilitation and emotional factors are stressed as important variables in physical and psychotherapeutic treatment. The authors review some of the psychological aspects in counseling the…

  1. Development of bladder control in mentally handicapped children

    Directory of Open Access Journals (Sweden)

    Bruschini Homero

    2003-01-01

    Full Text Available PURPOSE:To analyze the role of mental handicap as a possible source of lack of development of bladder control and to find out the chance of continence to advise future patients. MATERIALS AND METHODS: The parents and relatives of 100 consecutive mentally handicapped patients were inquired by a personal interview. Questions included the age when they stopped using diapers, enuretic events, frequency, urgency and leakage episodes, urinary infections. Etiology of their mental problem was unknown in 34, perinatal anoxia in 17, Down syndrome in 15, phenylketonuria in 18 and others minors causes. The grade of mental deficiency were profound in 1, severe in 10, moderate in 39, mild in 33 and normal inferior value in 17. The age varied from 7 to 37 years old, with an average of 14 by the time of the interview, comprising 60 males and 40 females. RESULTS: All profound and severe patients presented leakage episodes regardless of the age. The mild and normal inferior value acquired progressive urinary control with aging, and 33% still remain with urinary symptoms above 16 years old. Urinary infection was similar in males and females, around 29%. The most committed group presented less urinary infections. The etiology of the mental handicap was not correlated to the incidence of urinary leakage. CONCLUSIONS: The lack of bladder control was correlated to the grade of mental handicap. In severe and profound groups, the expectancy of control is disappointing. In the less compromised groups, there is a delay in bladder training, with achievement of control in 2/3 after 16 years of age. Those in the normal inferior value have a chance of postponed urinary control, easily misdiagnosed by normal urological interviews.

  2. Voice-controlled Internet Browsing for Motor-handicapped Users

    DEFF Research Database (Denmark)

    Brøndsted, Tom; Aaskoven, Erik

    2006-01-01

    The public-funded project "Indtal" ("Speak-it") has succeeded in developing a Danish voice-controlled utility for internet browsing targeting motor-handicapped users having difficulties using a standard keyboard and/or a standard mouse. The system has been designed and implemented in collaboration...... with an advisory board of motor-handicapped (potential) end-users and underlies a number of a priori defined design criteria: learnability and memorability rather than naturalness, minimal need for maintenance after release, support for "all" web standards (not just HTML conforming to certain "recommendations......"), independency of the language on the websites being browsed, etc. These criteria have lead to a primarily message-driven system interacting with an existing browser on the end users' systems...

  3. Rehabilitation and Care of the Handicapped.

    Science.gov (United States)

    Engberg, Eugenie; And Others

    An overview of services to help the handicapped is given in light of the characteristics of social conditions and social development in Denmark, and the history of rehabilitative care is examined. Information is given on the following areas: legislative, organization and financing; the national health service; the general education of handicapped…

  4. Self-handicapping and intrinsic motivation: buffering intrinsic motivation from the threat of failure.

    Science.gov (United States)

    Deppe, R K; Harackiewicz, J M

    1996-04-01

    High and low self-handicappers (as measured by E. E. Jones & F. Rhodewalt's [1982] Self-Handicapping Scale) were asked to play a game of pinball (in a competitive or noncompetitive setting) after they had practices as much as they wanted on a related task (thus, not practicing could have served as a self-handicap). High self-handicappers who did not practice much became more involved in the game and subsequently reported enjoying the game more than high self-handicappers who practiced a lot. Furthermore, the effects on enjoyment were mediated by task involvement, suggesting that the protection afforded by self-handicapping affects intrinsic motivation by allowing the individual to become absorbed in the activity instead of focusing on performance concerns. Individuals who self-handicap may be providing themselves with the "breathing room" they need to become absorbed in an activity and to experience the activity as enjoyable.

  5. KI-Aikido for Handicapped Students at Leeward Community College: Theory and Practice.

    Science.gov (United States)

    MacGugan, Kirk

    In an effort to provide physical education instruction for handicapped students, Leeward Community College implemented, on a pilot basis, a non-credit course in KI-Aikido, an oriental martial art which combines theory and exercise toward the goal of controlling the body through the power of the mind. The course, offered to both handicapped and…

  6. Causes of blindness in blind unit of the school for the handicapped ...

    African Journals Online (AJOL)

    To describe the causes of blindness in pupils and staff in the blind unit of the School for the Handicapped in Kwara State. 2. To identify problems in the blind school and initiate intervention. All the blind or visually challenged people in the blind unit of the school for the handicapped were interviewed and examined using a ...

  7. Self-esteem, self-conscious emotions, resilience, trait anxiety and their relation to self-handicapping tendencies

    OpenAIRE

    Török, Lilla; Szabó, Zsolt Péter; Boda-Ujlaky, Judit

    2014-01-01

    Jones and Berglas (1978) define self-handicapping as any action or choice of performance setting that enhances the opportunity to externalize (or excuse) failure and to internalize (reasonably accept credit for) success (p. 406). The present study examined the role of potential precursors in the self-handicapping process. A total of 626 undergraduates from various Hungarian universities completed measures of dispositional self-handicapping, self-esteem, self-conscious emotions, trait anxiety,...

  8. Social distance and behavioral attributes of developmentally handicapped and normal children.

    Science.gov (United States)

    Sherman, L W; Burgess, D E

    1985-12-01

    20 behavioral attributes predicting social distance were examined among 101 junior high school students in six classrooms. The sample included 8 developmentally handicapped students, of whom at least one of each was mainstreamed into each classroom. Subjects were predominantly white, middle-class, suburban midwesterners. A sociometric nomination measure was used to obtain behavioral attribute profiles of the students which were then used to predict a psychometric measure of social distance. Handicapped students were not more socially distant than their normal peers. Factor analysis of the 20 behavioral attributes yielded four factors, three of which were significant predictors of classroom social distance, accounting for better than half the variance in social distance. These were described as Incompetent/Unassertive, Positive/Active/Assertive, and Passive/Unassertive. Social rejection in mainstreamed classrooms is more a function of perceived behavioral attributes than the label developmentally handicapped.

  9. 13 CFR 113.3-1 - Consideration of race, color, religion, sex, marital status, handicap, or national origin.

    Science.gov (United States)

    2010-01-01

    ..., religion, sex, marital status, handicap, or national origin. 113.3-1 Section 113.3-1 Business Credit and... of race, color, religion, sex, marital status, handicap, or national origin. (a) This regulation does not prohibit the consideration of race, color, religion, sex, marital status, handicap, or national...

  10. Music Communication, Projection and Analogy of Handicapped Children in Music Therapy

    OpenAIRE

    Lipský, Matěj

    2014-01-01

    /Abstract Music Communication, Projection and Analogy of Handicapped Children in Music Therapy Presented work takes an interest in music contents produced by handicapped children attending music therapy sessions. The contents of music were gained from the children by the method of improvisation, particularly by "concert technique". In the theoretical part we present philosophical background for the music therapy in a field of special education and research. This background thought we have fou...

  11. Telecommunications: A New Horizon for the Handicapped.

    Science.gov (United States)

    Cunningham, Pat; Gose, Joan

    The paper describes a computer bulletin board program operated by physically handicapped high school students. Through the bulletin board system, resource people have been contacted, students' written communication and interpersonal relationships have been strengthened, and professional contact has been strengthened. Administrative implications…

  12. Academic Self-Handicapping: The Role of Self-Concept Clarity and Students' Learning Strategies

    Science.gov (United States)

    Thomas, Cathy R.; Gadbois, Shannon A.

    2007-01-01

    Background: Self-handicapping is linked to students' personal motivations, classroom goal structure, academic outcomes, global self-esteem and certainty of self-esteem. Academic self-handicapping has yet to be studied with respect to students' consistency in self-description and their description of themselves as learners. Aims: This study…

  13. Minimizing Teacher Stress. Structuring Positive Interactions for Handicapped and Nonhandicapped Children in Physical Education.

    Science.gov (United States)

    Colvin, Nola R.; And Others

    1982-01-01

    Components of an integrated physical education program, which consists of handicapped and nonhandicapped students, include: (1) activities that promote interaction among all students; (2) strategies that place handicapped and nonhandicapped students together; and (3) reinforcement of cooperative behavior. (CJ)

  14. An Evolutionary Comparison of the Handicap Principle and Hybrid Equilibrium Theories of Signaling

    Science.gov (United States)

    Kane, Patrick; Zollman, Kevin J. S.

    2015-01-01

    The handicap principle has come under significant challenge both from empirical studies and from theoretical work. As a result, a number of alternative explanations for honest signaling have been proposed. This paper compares the evolutionary plausibility of one such alternative, the “hybrid equilibrium,” to the handicap principle. We utilize computer simulations to compare these two theories as they are instantiated in Maynard Smith’s Sir Philip Sidney game. We conclude that, when both types of communication are possible, evolution is unlikely to lead to handicap signaling and is far more likely to result in the partially honest signaling predicted by hybrid equilibrium theory. PMID:26348617

  15. The natural environment and human development: implications for handicapped children in urban settings

    Science.gov (United States)

    Dennis A. Vinton; Donald E. Hawkins

    1977-01-01

    This review of literature is intended to promote awareness of the needs of the 15 percent of the nation's children and youth who are afflicted with some form of handicap. It is imperative that those who design children's programs that utilize natural environments understand the special problems of handicapped children.

  16. Predicting Academic Self-Handicapping in Different Age Groups: The Role of Personal Achievement Goals and Social Goals

    Science.gov (United States)

    Leondari, Angeliki; Gonida, Eleftheria

    2007-01-01

    Background: Academic self-handicapping refers to the use of impediments to successful performance on academic tasks. Previous studies have shown that it is related to personal achievement goals. A performance goal orientation is a positive predictor of self-handicapping, whereas a task goal orientation is unrelated to self-handicapping. Aims: The…

  17. Self-Handicapping, Defensive Pessimism, and Goal Orientation: A Qualitative Study of University Students.

    Science.gov (United States)

    Martin, Andrew J.; Marsh, Herbert W.; Williamson, Alan; Debus, Raymond L.

    2003-01-01

    Interviews with university students selected as high or low in either self-handicapping or defensive pessimism identified personal perspectives on the nature of self-handicapping and defensive pessimism, the perceived reasons why they engage in these strategies and the perceived advantages that follow from them, and the extent to which ego goals…

  18. Flexible parents: joint effects of handicapping and brood size manipulation on female parental care in Nicrophorus vespilloides.

    Science.gov (United States)

    Ratz, Tom; Smiseth, Per T

    2018-02-22

    Parental care is highly variable, reflecting that parents make flexible decisions in response to variation in the cost of care to themselves and the benefit to their offspring. Much of the evidence that parents respond to such variation derives from handicapping and brood size manipulations, the separate effects of which are well understood. However, little is known about their joint effects. Here, we fill this gap by conducting a joint handicapping and brood size manipulation in the burying beetle Nicrophorus vespilloides. We handicapped half of the females by attaching a lead weight to their pronotum, leaving the remaining females as controls. We also manipulated brood size by providing each female with 5, 20 or 40 larvae. In contrast to what we predicted, handicapped females spent more time provisioning food than controls. We also found that handicapped females spent more time consuming carrion. Furthermore, handicapped females spent a similar amount of time consuming carrion regardless of brood size, whereas controls spent more time consuming carrion as brood increased. Females spent more time provisioning food towards larger broods, and females were more likely to engage in carrion consumption when caring for larger broods. We conclude that females respond to both handicapping and brood size manipulations, but these responses are largely independent of each other. Overall, our results suggest that handicapping might lead to a higher investment into current reproduction and that it might be associated with compensatory responses that negate the detrimental impact of higher cost of care in handicapped parents. © 2018 Crown copyright. Journal of Evolutionary Biology © 2018 European Society For Evolutionary Biology This article is published with the permission of the Controller of HMSO and the Queen’s Printer for Scotland. Note: some government agencies may require additional wording and acknowledgement.

  19. An Island Flap Technique for Laryngeal Intracordal Mucous Retention Cysts

    Directory of Open Access Journals (Sweden)

    Farzad Izadi

    2015-09-01

    Full Text Available Introduction: Mucous retention cysts are a subtype of intracordal vocal cysts that may occur spontaneously or may be associated with poor vocal hygiene, and which require optimal treatment. The objective of this study was to present a new laser-assisted microsurgery technique for treating intracordal mucous retention cysts and to describe the final outcomes.   Materials and Methods: In this prospective study, we assessed the pre-operative and post-operative acoustic analysis, maximum phonation time (MPT, and voice handicap index (VHI of four patients with a diagnosis of mucous retention cyst. The island flap technique was applied to all patients without any complications. In this procedure, we favored the super-pulse mode using a 2-W power CO2 laser to remove the medial wall of the cyst, before clearing away the lateral wall margins of the cyst using repeat-pulse mode and a 2-W power CO2 laser. Indeed, we maintained the underlying epithelium and lamina propria, including the island flap attached to the vocal ligament.   Results: There was a statistically significant improvement in the MPT (pre-op,11.05 s; post-op,15.85 s; P=0.002 and the VHI (pre-operative, 72/120; post-operative,27/120; P=0.001 in all patients. Moreover, jitter and shimmer were refined after surgery, but there was no statistically significant relationship between pre-operative and post-operative data (P=0.071 (P=0.622. In the follow-up period (median, 150 days, there was no report of recurrence or mucosal stiffness.   Conclusion:  The island flap procedure in association with CO2 laser microsurgery appears to be a safe and effective treatment option for intracordal mucous retention cysts, but needs further investigation to allow comparison with other methods.

  20. An Island Flap Technique for Laryngeal Intracordal Mucous Retention Cysts.

    Science.gov (United States)

    Izadi, Farzad; Ghanbari, Hadi; Zahedi, Sahar; Pousti, Behzad; Maleki Delarestaghi, Mojtaba; Salehi, Abolfazl

    2015-09-01

    Mucous retention cysts are a subtype of intracordal vocal cysts that may occur spontaneously or may be associated with poor vocal hygiene, and which require optimal treatment. The objective of this study was to present a new laser-assisted microsurgery technique for treating intracordal mucous retention cysts and to describe the final outcomes. In this prospective study, we assessed the pre-operative and post-operative acoustic analysis, maximum phonation time (MPT), and voice handicap index (VHI) of four patients with a diagnosis of mucous retention cyst. The island flap technique was applied to all patients without any complications. In this procedure, we favored the super-pulse mode using a 2-W power CO2 laser to remove the medial wall of the cyst, before clearing away the lateral wall margins of the cyst using repeat-pulse mode and a 2-W power CO2 laser. Indeed, we maintained the underlying epithelium and lamina propria, including the island flap attached to the vocal ligament. There was a statistically significant improvement in the MPT (pre-op,11.05 s; post-op,15.85 s; P=0.002) and the VHI (pre-operative, 72/120; post-operative,27/120; P=0.001) in all patients. Moreover, jitter and shimmer were refined after surgery, but there was no statistically significant relationship between pre-operative and post-operative data (P=0.071) (P=0.622). In the follow-up period (median, 150 days), there was no report of recurrence or mucosal stiffness. The island flap procedure in association with CO2 laser microsurgery appears to be a safe and effective treatment option for intracordal mucous retention cysts, but needs further investigation to allow comparison with other methods.

  1. Assessment of the influence of osteopathic myofascial techniques on normalization of the vocal tract functions in patients with occupational dysphonia.

    Science.gov (United States)

    Marszałek, Sławomir; Niebudek-Bogusz, Ewa; Woźnicka, Ewelina; Malińska, Joanna; Golusiński, Wojciech; Śliwińska-Kowalska, Mariola

    2012-06-01

    Occupational voice disorders are accompanied by increased tension of the external laryngeal muscle which changes the position of the larynx and consequently disturbs the conditions of functioning of the vocal tract. The aim of the study is to assess the use of osteopathic procedures in the diagnosis and treatment of occupational dysphonia. Study subjects included 40 teachers with chronic diseases of the voice organ (38 women and 2 men) aged from 39 to 59 (mean age: 48.25). Before and after the voice therapy the osteopathic examination according to Libermann's protocol was performed as well as phoniatric examination including laryngovideostroboscopy (LVSS), assessment of the maximum phonation time (MPT) and the Voice Handicap Index (VHI) score. The voice therapy, scheduled and supervised by a laryngologist-phoniatrician and conducted by a speech-language pathologist, was supplemented with osteopathic myofascial rehabilitation of the larynx. The chi-square McNemar test and non-parametric Wilcoxon matched pairs test were applied in the statistical assessment. The applied interdisciplinary treatment including osteopathic and vocal therapy resulted in a statistically significant decrease in tenderness of muscles raising the larynx (cricothyroid ligament, sternocleidomastoid muscles, and pharyngeal constrictor muscles) and in lowering the tonus (geniohyoid muscles, pharyngeal constrictor muscles and sternocleidomastoid muscles). A significant improvement was also observed in the case of dysfunction of the cricothyroid joint examined during glissando and yawning, as well as in asymmetry of the thyrohyoid apparatus. Moreover, the therapy resulted in significantly better normalization of the head position and better control of the centre of gravity of the body. Statistically significant post-therapy improvement was observed in the phoniatric examination, including VHI scores, MPT results and parameters of videostroboscopic examination. The use of osteopathic therapy helps

  2. Voice amplification for primary school teachers with voice disorders: a randomized clinical trial.

    Science.gov (United States)

    Bovo, Roberto; Trevisi, Patrizia; Emanuelli, Enzo; Martini, Alessandro

    2013-06-01

    Several studies have demonstrated a high prevalence of voice disorders in teachers, together with the personal, professional and economical consequences of the problem. Good primary prevention should be based on 3 aspects: 1) amelioration of classroom acoustics, 2) voice care programs for future professional voice users, including teachers and 3) classroom or portable amplification systems. The aim of the study was to assess the benefit obtained from the use of portable amplification systems by female primary school teachers in their occupational setting. Forty female primary school teachers attended a course about professional voice care, which comprised two theoretical lectures, each 60 min long. Thereafter, they were randomized into 2 groups: the teachers of the first group were asked to use a portable vocal amplifier for 3 months, till the end of school-year. The other 20 teachers were part of the control group, matched for age and years of employment. All subjects had a grade 1 of dysphonia with no significant organic lesion of the vocal folds. Most teachers of the experimental group used the amplifier consistently for the whole duration of the experiment and found it very useful in reducing the symptoms of vocal fatigue. In fact, after 3 months, Voice Handicap Index (VHI) scores in "course + amplifier" group demonstrated a significant amelioration (p = 0.003). The perceptual grade of dysphonia also improved significantly (p = 0.0005). The same parameters changed favourably also in the "course only" group, but the results were not statistically significant (p = 0.4 for VHI and p = 0.03 for perceptual grade). In teachers, and particularly in those with a constitutional weak voice and/or those who are prone to vocal fold pathology, vocal amplifiers may be an effective and low-cost intervention to decrease potentially damaging vocal loads and may represent a necessary form of prevention.

  3. Analysis of vocal and swallowing functions after horizontal glottectomy.

    Science.gov (United States)

    Topaloğlu, İlhan; Bal, Muhlis; Salturk, Ziya; Berkiten, Güler; Atar, Yavuz

    2016-08-01

    We conducted a cross-sectional study to assess vocal and swallowing functions after horizontal glottectomy. Our study population was made up of 22 men aged 45 to 72 years (mean: 58.3) who underwent horizontal glottectomy and completed at least 1 year of follow-up. To compare postoperative results, 20 similarly aged men were included as a control group; all glottectomy patients and all controls were smokers. We used three methods-acoustic and aerodynamic voice analyses, the GRBAS (grade, roughness, breathiness, asthenicity, and strain) scale, and the voice handicap index-30 (VHI-30)-to assess vocal function objectively, perceptually, and subjectively, respectively. We also assessed swallowing function objectively by fiberoptic endoscopic evaluation of swallowing (FEES) and subjectively with the M.D. Anderson dysphagia inventory (MDADI). The 22 patients were also subcategorized into three groups according to the extent of their arytenoid cartilage resection, and their outcomes were compared. Acoustic and aerodynamic analyses showed that the mean maximum phonation time was significantly shorter and the fundamental frequency was significantly lower in the glottectomy group than in the controls (p = 0.001 for both), and that the mean jitter and shimmer values and the mean harmonics-to-noise ratio were all significantly higher (p = 0.001 for all); there were no significant differences among the three arytenoid subgroups. Self-assessments revealed that there were no statistically significant differences among the three subgroups in GRBAS scale scores except for the breathiness score (p = 0.045), which was lower in the arytenoid preservation subgroup than in the total resection subgroup; there were no statistically significant differences among the three subgroups in VHI-30 scores. Finally, swallow testing found no statistically significant differences in FEES scores or MDADI scores. We conclude that horizontal glottectomy caused a deterioration in vocal function, but

  4. Grief elaboration in families with handicapped member.

    Science.gov (United States)

    Calandra, C; Finocchiaro, G; Raciti, L; Alberti, A

    1992-01-01

    Families with handicapped member seem to follow the same five stages (rejection and isolation, anger, dealing with the problem, depression, acceptance) of Kubler-Ross grief elaboration theory while dealing with the narcissistic wound of a handicapped child. Some of these families show a block in one of the stages. The effort of psychotherapy is to remove the block and let them reach the last stage. In this paper families under systemic psychotherapeutic treatment are analyzed, who had in common the birth of a child with low or modest invalidating signs and psychotic or autistic features. The families structure did not show the characteristics of a psychotic family. Nevertheless either one or both parents ignored the evidence of their child disease and they built a "disease-incongrous" wait around the child, trying to push away the painful reality. The authors explain the importance of this approach for the improvement of the autistic traits.

  5. The impact of self-handicapping strategies use on the impression formation

    OpenAIRE

    Hip-Fabek, Irena

    2006-01-01

    Self-handicapping is usually defined as any claim, action or choice of performance setting that enhances the opportunity to externalize (or excuse) failure and to internalize (accept credit for) success. The purpose of this study was to examine the impact of using different self-handicapping strategies on formation of the impression about the person. We collected data from 365 participants, whose task was to read a story about the person who failed on the task delegated to him/her, and to app...

  6. The psychometric properties of the Tinnitus Handicap Questionnaire in a Dutch-speaking population.

    Science.gov (United States)

    Vanneste, S; To, W T; De Ridder, D

    2011-02-01

    The aim of the study is to translate and validate the tinnitus handicap questionnaire (THQ) for a Dutch-speaking population. The factor structure of the questionnaire, the reliability and the validity is determined. Furthermore, a statistical comparison with the original English version of the tinnitus handicap questionnaire is performed. We assessed 101 patients at the Tinnitus Research Initiative clinic of Antwerp University Hospital. Twenty-seven Dutch items from the tinnitus handicap questionnaire by Kuk et al. [(1990), Ear Hear11:434-45.] were obtained by the process of translation and back translation. The factor structure, internal consistency, was evaluated using Cronbach's alpha coefficient and item correlations were used to confirm reliability. The construct validity was confirmed with a visual analogue scale for loudness and distress, awareness, annoyance, the Tinnitus Questionnaire (TQ), the mini-Tinnitus Questionnaire, the Hospital Anxiety and Depression Scale (HADS), the Beck Depression Inventory (BDI) and the Profile of Mood State (POMS), ensuring that this new instrument measures the tinnitus handicap. This study demonstrates that the Dutch version of the tinnitus handicap questionnaire is a reliable (Cronbach's alpha coefficient α = 0.93) and valid measure of self-perceived tinnitus-related distress [with visual analogue scale for loudness (r = 0.39) and distress (r =0.45), awareness (r = 0.39), annoyance (r = 0.57), the Tinnitus Questionnaire (r = 0.82), the mini-Tinnitus Questionnaire (r = 0.79), the Hospital Anxiety and Depression Scale (r = 0.62) and the Beck Depression Inventory (r = 0.32)]. The psychometric properties are in line with previous findings on the English version with regard to reliability and validity. However, the items in the subscales differ from the English version. While the English version has three subscales, our version has only two subscales. Yet, the English version reports that for the three factors, there is a low

  7. The handicapped child: psychological effects of parental, marital, and sibling relationships.

    Science.gov (United States)

    Fisman, S; Wolf, L

    1991-03-01

    Although the nature and severity of a handicapping condition are not the sole determinants of family functioning, the presence of a child with a pervasive developmental disorder has a significant effect on family members. Maternal mental health suffers, and the resulting depression affects her role as mother and marriage partner. Unlike other handicapping conditions with obvious physical stigmata, the invisible handicap of the autistic child and the frequent delay in diagnosis contribute to the mother's self-doubt about her parental competence. While the impact on paternal psychological health is less, the fathers of autistic children are nevertheless highly stressed and appear to be particularly vulnerable to the stress generated by these difficult children. Living within this family climate, the risks for emotional and behavioral problems for siblings must be evaluated, along with their intrinsic strengths, to plan preventive interventions for these children. Effective work with these families requires an understanding of the evolution of family system problems and their dynamic and reciprocal interaction over time.

  8. Reducing Truancy in Students with Mild Handicaps.

    Science.gov (United States)

    Hess, Albert M.; And Others

    1990-01-01

    Contingency contracting and group counseling were provided to 26 mildly to moderately handicapped middle school students with high rates of truancy. Subjects exhibited attendance gains after treatment; gains were not maintained at followup but attendance rates were still higher than the rates of control students. Measures of academic performance…

  9. ATTITUDES OF HEALTHY CHILDREN PARENTS TOWARDS HANDICAPPED CHILDREN AT THE PRE-SCHOOL AGE

    Directory of Open Access Journals (Sweden)

    Ruzica KERAMICIEVA

    1997-03-01

    Full Text Available Since the 1970-ties, in the USA and Western and Eastern Europe, the model of segregated education has been abandoned, and nowadays the handicapped children attend regular schools all together with other healthy pupils. This , so called Integrative Pedagogy, proceeds from the mental hygiene aspects according to which the restrictive environment in special schools has not been a favorable one for the development of those children.The integrational process of these children in preschool institutions and schools has rather been difficult due to a number of reasons. As one of them, already mentioned and found in literature , has been the negative attitude of non-handicapped children parents towards those handicapped in their development.The problem of this research is to check and test the attitude of healthy children parents towards handicapped children at preschool age. This research shall also tend to analyze the origin of the such attitudes i. e. , whether they have been a result of an insufficient information and ignorance of the obstacles during development, or been produced by imitation of the environment, or due to an empathy, or even because of the fear that “ such a thing better never enter their home”, etc.We sincerely believe that, revealing the above parents’ attitudes and their origin, would certainly bring finding ways of their successful socialization and making the integrational process of handicapped children with their normal mates in preschool institutions easier.

  10. Suitability Assessment of Satellite-Derived Drought Indices for Mongolian Grassland

    Directory of Open Access Journals (Sweden)

    Sheng Chang

    2017-06-01

    Full Text Available In Mongolia, drought is a major natural disaster that can influence and devastate large regions, reduce livestock production, cause economic damage, and accelerate desertification in association with destructive human activities. The objective of this article is to determine the optimal satellite-derived drought indices for accurate and real-time expression of grassland drought in Mongolia. Firstly, an adaptability analysis was performed by comparing nine remote sensing-derived drought indices with reference indicators obtained from field observations using several methods (correlation, consistency percentage (CP, and time-space analysis. The reference information included environmental data, vegetation growth status, and region drought-affected (RDA information at diverse scales (pixel, county, and region for three types of land cover (forest steppe, steppe, and desert steppe. Second, a meteorological index (PED, a normalized biomass (NorBio reference indicator, and the RDA-based drought CP method were adopted for describing Mongolian drought. Our results show that in forest steppe regions the normalized difference water index (NDWI is most sensitive to NorBio (maximum correlation coefficient (MAX_R: up to 0.92 and RDA (maximum CP is 87%, and is most consistent with RDA spatial distribution. The vegetation health index (VHI and temperature condition index (TCI are most correlated with the PED index (MAX_R: 0.75 and soil moisture (MAX_R: 0.58, respectively. In steppe regions, the NDWI is most closely related to soil moisture (MAX_R: 0.69 and the VHI is most related to the PED (MAX_R: 0.76, NorBio (MCC: 0.95, and RDA data (maximum CP is 89%, exhibiting the most consistency with RDA spatial distribution. In desert steppe areas, the vegetation condition index (VCI correlates best with NorBio (MAX_R: 0.92, soil moisture (MAX_R: 0.61, and RDA spatial distribution, while TCI correlates best with the PED (MAX_R: 0.75 and the RDA data (maximum CP is 79

  11. Sexuality and the Developmentally Handicapped: Health Education Strategies.

    Science.gov (United States)

    Martin, Mary-Lou; Forchuk, Cheryl

    1987-01-01

    The article describes a sex education program for small groups of developmentally handicapped adolescents and young adults which includes information on and discussion of body parts, acceptable social behavior, assertiveness, birth control, and sexually transmitted diseases. (Author/JW)

  12. Self-handicapping and obesity: is there a sympathetic audience out there?

    Science.gov (United States)

    Schill, T; Beyler, J; Wehr, J; Swigert, L; Tatter, T

    1991-06-01

    After reading a case description of a 20-year-old woman, subjects attributed her personal shortcomings to her weight rather than to herself per se. In particular, people who scored higher on a measure of self-handicapping were even more likely to attribute shortcomings to a person's weight and excuse or overlook them. A person who attributes shortcomings to being overweight will very likely find a sympathetic audience. These results support the suggestion by Baumeister, Kahn, and Tice (1990) that obesity can be a self-handicapping strategy.

  13. Employment of Handicapped People in Leisure Occupations.

    Science.gov (United States)

    Compton, David M.; Vinton, Dennis A.

    In response to the need for up-to-date information on employment opportunities for handicapped people in the leisure occupations, a national survey was conducted to determine both existing levels of employment and employer practices. The survey was sent to 500 agencies and businesses representing four leisure occupational subclusters: travel,…

  14. Some Personality Characteristics of Self-Handicapping Behavior.

    Science.gov (United States)

    Levey, Cathy A.

    Based on a modification of Berglas and Jones' (1978) design, conditions of contingent and noncontingent success and failure were manipulated to determine when and why individuals choose to adopt self-handicapping strategies. Male undergraduates (N=76) were informed that they were participating in a study investigating the effects of music on…

  15. Formation en TIC destinée aux personnes handicapées en ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Formation en TIC destinée aux personnes handicapées en Amérique latine. En Amérique latine et dans les Caraïbes, les personnes handicapées représentent environ 10 % de la population. La population de cette région affiche des taux de pauvreté et de chômage élevés; assurer des moyens de subsistance décents aux ...

  16. Mixité sociale : les handicapés dans la société britannique 

    Directory of Open Access Journals (Sweden)

    Marie-Hélène Adveille

    2007-11-01

    Full Text Available Depuis la seconde moitié du XXe siècle le regard porté sur la place des handicapés dans la société, a changé de manière significative. Les personnes en situation de handicap qui n’étaient souvent vues auparavant que comme les bénéficiaires d’une aide charitable, ont acquis, grâce à l’action de nombreuses organisations, le droit d’être reconnues comme des individus devant jouir des mêmes droits que les personnes ordinaires. Cependant, bien que des changements aient été opérés dans la perception que les valides ont des handicapés, il n’en demeure pas moins que les personnes en situation de handicap sont toujours confrontées à de nombreux problèmes dans leur vie de tous les jours. La société a fait des progrès pour ce qui est des aides qu’elle apporte aux handicapés moteurs, en instituant par exemple qu’ils puissent avoir accès aux bâtiments publics ainsi qu’aux moyens de transport urbain, ferroviaire, aérien. Les difficultés des handicapés sensoriels (vue, ouie sont prises en compte, avec la mise en place, par exemple, des signaux sonores dans la cité, en favorisant la présence de chiens d’aveugle. Cependant l’accès aux droits fondamentaux de ceux qui présentent des handicaps mentaux (intellectuels et/ou psychiques est encore peu développé. C’est donc sur la politique d’intégration et d’inclusion dans la vie ordinaire des personnes présentant des handicaps intellectuels que portera principalement cette étude. Nous aborderons en premier lieu la législation mise en œuvre pour favoriser leur insertion dans la société britannique, puis nous étudierons la façon dont les enfants sont intégrés dans le système scolaire. Enfin, les arguments qui soulignent l’intérêt que peut revêtir une intégration réussie pour l’adulte et pour la société seront examinés.The way in which the disabled were viewed underwent significant changes in the second half of the 20th century

  17. Singing in groups for Parkinson's disease (SING-PD): a pilot study of group singing therapy for PD-related voice/speech disorders.

    Science.gov (United States)

    Shih, Ludy C; Piel, Jordan; Warren, Amanda; Kraics, Lauren; Silver, Althea; Vanderhorst, Veronique; Simon, David K; Tarsy, Daniel

    2012-06-01

    Parkinson's disease related speech and voice impairment have significant impact on quality of life measures. LSVT(®)LOUD voice and speech therapy (Lee Silverman Voice Therapy) has demonstrated scientific efficacy and clinical effectiveness, but musically based voice and speech therapy has been underexplored as a potentially useful method of rehabilitation. We undertook a pilot, open-label study of a group-based singing intervention, consisting of twelve 90-min weekly sessions led by a voice and speech therapist/singing instructor. The primary outcome measure of vocal loudness as measured by sound pressure level (SPL) at 50 cm during connected speech was not significantly different one week after the intervention or at 13 weeks after the intervention. A number of secondary measures reflecting pitch range, phonation time and maximum loudness also were unchanged. Voice related quality of life (VRQOL) and voice handicap index (VHI) also were unchanged. This study suggests that a group singing therapy intervention at this intensity and frequency does not result in significant improvement in objective and subject-rated measures of voice and speech impairment. Copyright © 2012 Elsevier Ltd. All rights reserved.

  18. Web thickness determines the therapeutic effect of endoscopic keel placement on anterior glottic web.

    Science.gov (United States)

    Chen, Jian; Shi, Fang; Chen, Min; Yang, Yue; Cheng, Lei; Wu, Haitao

    2017-10-01

    This work is a retrospective analysis to investigate the critical risk factor for the therapeutic effect of endoscopic keel placement on anterior glottic web. Altogether, 36 patients with anterior glottic web undergoing endoscopic lysis and silicone keel placement were enrolled. Their voice qualities were evaluated using the voice handicap index-10 (VHI-10) questionnaire, and improved significantly 3 months after surgery (21.53 ± 3.89 vs 9.81 ± 6.68, P web recurrence during the at least 1-year follow-up. Therefore, patients were classified according to the Cohen classification or web thickness, and the recurrence rates were compared. The distribution of recurrence rates for Cohen type 1 ~ 4 were 28.6, 16.7, 33.3, and 40%, respectively. The difference was not statistically significant (P = 0.461). When classified by web thickness, only 2 of 27 (7.41%) thin type cases relapsed whereas 8 of 9 (88.9%) cases in the thick group reformed webs (P web thickness rather than the Cohen grades. Endoscopic lysis and keel placement is only effective for cases with thin glottic webs. Patients with thick webs should be treated by other means.

  19. Drought Risk Identification: Early Warning System of Seasonal Agrometeorological Drought

    Science.gov (United States)

    Dalecios, Nicolas; Spyropoulos, Nicos V.; Tarquis, Ana M.

    2014-05-01

    By considering drought as a hazard, drought types are classified into three categories, namely meteorological or climatological, agrometeorological or agricultural and hydrological drought and as a fourth class the socioeconomic impacts can be considered. This paper addresses agrometeorological drought affecting agriculture within the risk management framework. Risk management consists of risk assessment, as well as a feedback on the adopted risk reduction measures. And risk assessment comprises three distinct steps, namely risk identification, risk estimation and risk evaluation. This paper deals with the quantification and monitoring of agrometeorological drought, which constitute part of risk identification. For the quantitative assessment of agrometeorological or agricultural drought, as well as the computation of spatiotemporal features, one of the most reliable and widely used indices is applied, namely the Vegetation Health Index (VHI). The computation of VHI is based on satellite data of temperature and the Normalized Difference Vegetation Index (NDVI). The spatiotemporal features of drought, which are extracted from VHI are: areal extent, onset and end time, duration and severity. In this paper, a 20-year (1981-2001) time series of NOAA/AVHRR satellite data is used, where monthly images of VHI are extracted. Application is implemented in Thessaly, which is the major agricultural region of Greece characterized by vulnerable and drought-prone agriculture. The results show that every year there is a seasonal agrometeorological drought with a gradual increase in the areal extent and severity with peaks appearing usually during the summer. Drought monitoring is conducted by monthly remotely sensed VHI images. Drought early warning is developed using empirical relationships of severity and areal extent. In particular, two second-order polynomials are fitted, one for low and the other for high severity drought, respectively. The two fitted curves offer a seasonal

  20. [Comparison of cepstral coefficients to other voice evaluation parameters in patients with occupational dysphonia].

    Science.gov (United States)

    Niebudek-Bogusz, Ewa; Strumiłło, Paweł; Wiktorowicz, Justyna; Sliwińska-Kowalska, Mariola

    2013-01-01

    BACKGROUND Special consideration has recently been given to cepstral analysis with mel-frequency cepstral coefficients (MFCCs). The aim of this study was to assess the applicability of MFCCs in acoustic analysis for diagnosing occupational dysphonia in comparison to subjective and objective parameters of voice evaluation. The study comprised 2 groups, one of 55 female teachers (mean age: 45 years) with occupational dysphonia confirmed by videostroboscopy and 40 female controls with normal voice (mean age: 43 years). The acoustic samples involving sustained vowels "a" and four standardized sentences were analyzed by computed analysis of MFCCs. The results were compared to acoustic parameters of jitter and shimmer groups, noise to harmonic ratio, Yanagihara index evaluating the grade of hoarseness, the aerodynamic parameter: maximum phonation time and also subjective parameters: GRBAS perceptual scale and Voice Handicap Index (VHI). The compared results revealed differences between the study and control groups, significant for MFCC2, MFCC3, MFCC5, MFCC6, MFCC8, MFCC10, particularly for MFCC6 (p teachers correlated with all eight objective parameters, also showed the significant relation with perceptual voice feature A (asthenity) of subjective scale GRBAS, characteristic of weak tired voice. The cepstral analysis with mel frequency cepstral coefficients is a promising tool for evaluating occupational voice disorders, capable of reflecting the perceptual voice features better than other methods of acoustic analysis.

  1. Motivation and future temporal orientation: a test of the self-handicapping hypothesis.

    Science.gov (United States)

    Lennings, C J

    1999-06-01

    Self-handicapping motivation refers to the likelihood a person will project personal ambition into the future, make a pessimistic judgement, and then mobilise effort in the present to avoid an anticipated negative outcome. It should, therefore, be a correlate of future time perspective. This study showed for a sample of 120 first-year students that, whilst future time perspective did strongly predict scores on a measure of self-handicapping motivation, neither variable was a useful predictor of outcome.

  2. Selecting and Ranking Cost Research Projects

    Science.gov (United States)

    1993-09-01

    Model (STACM) Enhancements Automated Cost Estimating Integrated Tools ( ACEIT ) Libraries BM/C 3 GEP Engineering and Cost BM/C 3 EP Engineering and Cost...50K NOM VHI 0.02635481 STACM ENHANCEMENTS NOM អK NOM VHI 0.02468682 ACEIT LIBRARIES VHI 50-IOOK HI VHI 0.06357704 GEP ENGRG. & COST VHI 100-150K VHl...0.02505922 SCATS LOW អK NOM VIII 0.02468682 PICES SUPPORT NOM 50-100K NOM VlIl 0.02455186 ACEIT SUPPORT VIII 50-100K VHI VHI 0.08208244 GUARDIAN

  3. Aquatics for the Handicapped--A Review of Literature.

    Science.gov (United States)

    Christie, Irene

    1985-01-01

    The author reviews the literature on aquatic activity for the disabled, discussing the physical, physiological, psychological, and sociological benefits of swimming and water safety activities. Unique properties of water and legal requirements regarding physical education of the handicapped, specifically citing the development of skills in…

  4. Handicapped Students in the Danish Educational System.

    Science.gov (United States)

    Ministry of Education, Copenhagen (Denmark).

    The educational policy of Denmark and the educational system which has evolved from this policy are described. The policy states that everyone has a right to the same access to education and training, regardless of sex, social origins, geographic origins, and physical or mental handicap; and all public education is free of charge from the age of 5…

  5. Self-esteem at school and self-handicapping in childhood: comparison of groups with learning disabilities.

    Science.gov (United States)

    Alesi, Marianna; Rappo, Gaetano; Pepi, Annamaria

    2012-12-01

    Recent research has focused on the role of self-esteem and self-handicapping strategies in the school domain. Self-handicapping refers to maladaptive strategies employed by adults and children for protection and maintenance of positive school self esteem. In this study the self-esteem and the self-handicapping strategies of children with dyslexia, reading comprehension disabilities, and mathematical disabilities were compared to a control group with normal learning. There were 56 children whose mean age was 8 (23 girls, 33 boys), attending Grade 3 of primary school. These pupils were selected by scores on a battery of learning tests commonly used in Italy for assessment of learning disabilities. Analyses suggested these children with dyslexia, reading comprehension disabilities, and mathematical disabilities had lower ratings of self-esteem at school and employed more self-handicapping strategies than did children whose learning was normal. More research is required to identify and examine in depth the factors that promote adaptive strategies to cope with children's reading difficulties.

  6. Methodology for the identification, evaluation and prioritization of market handicaps which prevent the implementation of Demand Response: Application to European electricity markets

    International Nuclear Information System (INIS)

    Alcázar-Ortega, Manuel; Calpe, Carmen; Theisen, Thomas; Carbonell-Carretero, José Francisco

    2015-01-01

    This paper presents a methodology for the identification, analysis and comparative assessment of the handicaps which nowadays prevent the higher implementation of Demand Response (DR) in the electricity market. Its application provides a hierarchical organization of handicaps from the most critical to the less critical and then, from the easiest to the most difficult to overcome. This makes possible to determine which barriers would be a priority, which may indicate the direction of regulatory changes to properly address these handicaps and so, stimulating a higher participation of the demand side in electricity markets. After applying the methodology to three European countries, 34 handicaps have been identified, analyzing which of these handicaps affect such stakeholders as grid operators, retailers and customers and how these stakeholders are affected. For each handicap, the criticality and difficulty to overcome the different handicaps have been studied, based on detailed information coming from personal interviews to experts representing the different stakeholders in the electricity trading chain. Regulatory barriers have been identified as the most critical and difficult to overcome. Together with regulatory changes, the promotion of aggregators and the training of customers on DR applications are some of the most significant initiatives. - Highlights: • Market handicaps prevent the application of Demand Response in electricity markets. • A methodology to identify and organize such market handicaps has been developed. • The evaluation and quantification of criticality and difficulty to overcome is done. • A hierarchical list prioritizing handicaps to be addressed is obtained. • Market handicaps of three European countries were evaluated through this methodology.

  7. When a High Distinction Isn't Good Enough: A Review of Perfectionism and Self-Handicapping

    Science.gov (United States)

    Kearns, Hugh; Forbes, Angus; Gardiner, Maria; Marshall, Kelly

    2008-01-01

    This paper addresses two problems which are common amongst university students, namely perfectionism and self-handicapping. Perfectionism deals with setting unreasonably high standards for one's own performance, while self-handicapping behaviours provide a possible excuse for poor performance, for example putting tasks off until the last minute.…

  8. Common Vocational Training Project for the Handicapped (CVTPH).

    Science.gov (United States)

    Amritmahal, Ananda; Mehta, J. M.

    1987-01-01

    A project of the Poona (India) District Leprosy Committee offers training in the industrial sector to leprosy patients, orthopedically handicapped individuals, and socioeconomically disadvantaged individuals, under a common roof. The project aims to combat the leprosy stigma and to aid rehabilitation by making the trainees economically…

  9. Use of Vegetation Health Data for Estimation of Aus Rice Yield in Bangladesh

    OpenAIRE

    Rahman, Atiqur; Roytman, Leonid; Krakauer, Nir Y.; Nizamuddin, Mohammad; Goldberg, Mitch

    2009-01-01

    Rice is a vital staple crop for Bangladesh and surrounding countries, with interannual variation in yields depending on climatic conditions. We compared Bangladesh yield of aus rice, one of the main varieties grown, from official agricultural statistics with Vegetation Health (VH) Indices [Vegetation Condition Index (VCI), Temperature Condition Index (TCI) and Vegetation Health Index (VHI)] computed from Advanced Very High Resolution Radiometer (AVHRR) data covering a period of 15 years (1991...

  10. Dementia and severity of parkinsonism determines the handicap of patients in late-stage Parkinson's disease: the Barcelona-Lisbon cohort.

    Science.gov (United States)

    Coelho, M; Marti, M J; Sampaio, C; Ferreira, J J; Valldeoriola, F; Rosa, M M; Tolosa, E

    2015-02-01

    Handicap has not been explored as a patient-centred outcome measure in Parkinson's disease (PD). The clinical features and medication use in late stages of PD (LS-PD) were reported previously. Handicap, medical conditions, use of healthcare resources and the impact of LS-PD upon caregivers were characterized in a cross-sectional study of LS-PD stages 4 or 5 of Hoehn and Yahr (H&Y). Handicap was measured using the London Handicap Scale (LHS: 0, maximal handicap; 1, no handicap). The mean LHS score in 50 patients was 0.33 (SD ±0.15). The presence of dementia, the Unified Parkinson's Disease Rating Scale part I score and the H&Y stage in 'off' independently predicted the LHS score (adjusted R(2) = 0.62; P = 0.000). Comorbidities and past medical conditions were frequent. Thirty-five patients lived at their house. Forty-five received unpaid care. Mean visits to the family doctor in the preceding 6 months were 2.2 (SD ±3.0) and to a neurologist 1.7 (SD ±1.0). Use of other health resources was low. Unpaid caregivers spent much time with patients and reported a high burden. Handicap could be measured in LS-PD and the LHS was easily completed by patients and caregivers. The high handicap in our cohort was mostly driven by the presence of dementia, behavioural complaints and the severity of non-dopaminergic motor features. Patients visited doctors infrequently and made low use of health resources, whilst unpaid caregivers reported a high burden. © 2014 EAN.

  11. Aerobic energy expenditure of handicapped children after training

    NARCIS (Netherlands)

    Dresen, M. H.; de Groot, G.; Mesa Menor, J. R.; Bouman, L. N.

    1985-01-01

    The effect is reported of a 10-week physical training program, consisting of three sessions with a total duration of two hours weekly, on the physical work capacity and efficiency of physically handicapped children aged 8 to 14 years. The program for the experimental group (n = 6) was an

  12. Employers' Attitudes toward Employing People with Mental Handicap.

    Science.gov (United States)

    Tse, John W. L.

    1993-01-01

    A survey of 66 Hong Kong companies and factories identified factors affecting employers' decisions to hire workers with mental handicaps. The five most important factors were emotional problems and personalities of workers, workers' ability to perform the job, availability of low-level jobs, productivity of workers, and possible special…

  13. Selective nontreatment of handicapped newborns: a critical essay.

    Science.gov (United States)

    Kohrman, A F

    1985-01-01

    The neonatal intensive care unit is the site of some of the most dramatic technology, complex decision-making and costly activity in the current range of medical institutions. Thus, the decisions made there are particularly visible, and of concern to a society which has increasingly scrutinized and challenged medical practices. Questions of marginal utility and cost-benefit relationships are becoming increasingly prominent. These concerns are heightened by the social and political tensions over issues of the time of initiation of life, quality of life, and assurances of equity for those less well off or handicapped from birth. Robert Weir's book, Selective Nontreatment of Handicapped Newborns, successfully summarizes the current dilemmas and identifies areas of uncertainty and lack of knowledge which cloud the decision-making processes. The book reviews the positions of the major protagonists of the last several years; inevitably, their positions will undergo continuous evolution in response to new data and vigorous political and public policy activity. Weir appropriately identifies the difficulty in arriving at an accurate prognosis as an important and prominent problem in decision-making about defective newborns. The population of surviving, compromised newborns is relatively unfamiliar and their problems remain largely unstudied. Weir's discussion of the desirability of the establishment of Infant Care Review Committees in those institutions which care for defective and handicapped newborns thoughtfully concludes that such committees are, on the balance, desirable. As experience accumulates with Infant Care Review Committees, they should serve the positive purpose of generating open discussion of legitimate disagreements. These committees will provide a forum in which decision-makers can disclose uncertainty, consider alternatives, and receive counsel.(ABSTRACT TRUNCATED AT 250 WORDS)

  14. The relation of vocal fold lesions and voice quality to voice handicap and psychosomatic well-being

    NARCIS (Netherlands)

    Smits, R.; Marres, H.A.; de Jong, F.

    2012-01-01

    BACKGROUND: Voice disorders have a multifactorial genesis and may be present in various ways. They can cause a significant communication handicap and impaired quality of life. OBJECTIVE: To assess the effect of vocal fold lesions and voice quality on voice handicap and psychosomatic well-being.

  15. Hearing Handicap and Speech Recognition Correlate With Self-Reported Listening Effort and Fatigue.

    Science.gov (United States)

    Alhanbali, Sara; Dawes, Piers; Lloyd, Simon; Munro, Kevin J

    To investigate the correlations between hearing handicap, speech recognition, listening effort, and fatigue. Eighty-four adults with hearing loss (65 to 85 years) completed three self-report questionnaires: the Fatigue Assessment Scale, the Effort Assessment Scale, and the Hearing Handicap Inventory for Elderly. Audiometric assessment included pure-tone audiometry and speech recognition in noise. There was a significant positive correlation between handicap and fatigue (r = 0.39, p speech recognition and fatigue (r = 0.22, p speech recognition both correlate with self-reported listening effort and fatigue, which is consistent with a model of listening effort and fatigue where perceived difficulty is related to sustained effort and fatigue for unrewarding tasks over which the listener has low control. A clinical implication is that encouraging clients to recognize and focus on the pleasure and positive experiences of listening may result in greater satisfaction and benefit from hearing aid use.

  16. Handicaps for the large scale commercial application of micropropagation.

    NARCIS (Netherlands)

    Pierik, R.L.M.

    1988-01-01

    In the last 10 years micropropagation has shown a spectacular development. However, at present the widespread use of micropropagation is handicapped by the following facts: Frequently mutations occur, particularly when applying the adventitious bud technique and callus systems. Basic knowledge

  17. [Combined hepatitis A/B vaccination: evaluation of a vaccination schedule in facilities for handicapped people].

    Science.gov (United States)

    Wolters, B; Müller, T; Ross, R S; Kundt, R; Roggendorf, M; Roggendorf, H

    2014-02-01

    People with mental and physical disabilities have a higher risk of infection with hepatitis viruses. Studies conducted so far show contradictory results on the success of vaccination in this population. These people live and work under special conditions and sometimes have immune defects. We investigated the antibody response after combined vaccination against hepatitis A and B in facilities for handicapped people in the city of Essen/Germany. Antibodies were determined in people with disabilities (n=949) and also in social workers taking care of handicapped people (n=115). Protective antibodies against hepatitis A were detected in 98.9% in people with disabilities and social workers. The seroconversion rate against hepatitis B in handicapped people was 90.2% and was comparable to the seroconversion rate in social workers (91.3%). Re-vaccinations were offered to all people with anti-HBs titres below 100 IU/L (28% of handicapped and 23.5% of social workers). In the group of low responders in handicapped people about 50% developed anti-HBs concentration above 100 IU/L. Non-responders showed 30-40% seroconversion rate after re-vaccination. Based on this study we would recommend serological tests about 4-8 weeks after vaccination to confirm seroconversion. By this procedure people who need a booster vaccination will be recognized and non-responders should be offered another HBV vaccination. In about 20% of the non-responders included in this study HBs antigen was detected. © Georg Thieme Verlag KG Stuttgart · New York.

  18. [Handicapped patients and leisure sports--a chance for social integration].

    Science.gov (United States)

    Wilhelm, U

    2000-10-01

    Organizing leisure time in an active way with lots of experiences is getting more and more important in western society. Accordingly, sports activities and travelling as well as their combination, holiday sports activities, are in great demand. A general idea of the literature in that field with regard to the possibilities and difficulties of handicapped persons is that holiday sports activities are considered apt to offer outstanding prerequisites for handicapped and nonhandicapped people getting closer to each other. Starting out on this basis, this survey is mainly dedicated to the following questions: What is the situation for handicapped persons in holiday sports activities? Is holiday sporting in a position to meet the expectations of social integration, and to what extent? A questionnaire about these items was answered by wheelchair users, making it clear, on the one hand, that there are hardly any offers for disabled people to take part in holiday sporting activities. On the other hand, the survey confirms that holiday sports activities are well suited to answer major demands of the integration issue, i.e., communication and interaction as well as other factors conducive to social integration. Subsequently, the author formulates the request that access to and participation in holiday sporting activities be made easier for disabled people so that greater use can be made of these special opportunities for social integration.

  19. Tendency to self-handicapping in the situation of expected failure

    Directory of Open Access Journals (Sweden)

    Smederevac-Stokić Snežana

    2003-01-01

    Full Text Available The basic objective of this research is to determine what type of self-handicapping strategies subjects will use when they face potential failure, under the condition that they have the possibility of strategy choice. Another research objective is directed to the research of relation between the selected self-handicapping strategy and personality characteristics. 120 student of the second and third year of the Department of psychology, University of Novi Sad has been taken into sample. In the first research stage, all students administrated a series of personality self-report tests. In the second experiment stage, the participants were divided into four groups, on the basis of two criteria: the solvability of intelligence test tasks and the presence of hampering factors during task solving. The research results show that there are at least two types of self-handicapping strategies. One type is used by the majority of people when found in the situation where potential failure is expected. It refers to searching for alibis in external circumstances and it is probably the reflection of sound tendencies of facing possible consequences of information on one’s own incompetence. Another type of strategies presents consistent behaviour pattern, determined by the higher degree of adverse affectivity and negative image of oneself, and it is manifested in the use of poor psychophysical condition as the alibi for failure.

  20. Curricular Guidelines for Dental Hygiene Care for the Handicapped.

    Science.gov (United States)

    Journal of Dental Education, 1984

    1984-01-01

    The American Association of Dental Schools' guidelines for dental hygiene curriculum cover the scope and definitions of care for the handicapped, interrelationships between disciplines and courses, a curriculum overview, primary educational goals, prerequisites, a core content outline, specific behavioral objectives, sequencing, faculty, and…

  1. Horticulture for Secondary Level Handicapped Adolescents: The Cherokee County Model.

    Science.gov (United States)

    Frith, Greg H.; And Others

    1981-01-01

    The Cherokee County (Alabama) horticulture training program provides 40 mildly mentally retarded adolescents with vocational training in a marketable skills. The broad spectrum of vocational skills makes horticulture ideal for the handicapped. (DB)

  2. The social representation about handicapped students in inclusive education: the view of children

    Directory of Open Access Journals (Sweden)

    Karina Mendonça Vasconcellos

    2011-12-01

    Full Text Available Historically excluded, handicapped people have been socially included through new standards guided by egalitarian principles. The Social Representation Theory, which studies how the common sense builds “theories” about relevant objects, was used to answer how this situation affects children socially and psychologically in inclusive schools. We use a multimethodological approach with free associations, drawings and focus groups to study the social representations of 39 third and fourth grade students about their handicapped colleagues, all the children being from a state school in Recife, Pernambuco. The data were submitted to content analysis and analysis using the EVOC software, and the results indicate that handicapped children are seen as people limited by a temporary or permanent shortage or disability; they learn differently from others and disrupt classes; they require constant care and protection; they are allowed to join the group, but not to be part of it. The group seems to be outlining the contours of otherness, which shows a representation under construction.

  3. International Religion Indexes: Government Regulation, Government Favoritism, and Social Regulation of Religion*

    Science.gov (United States)

    Grim, Brian J.; Finke, Roger

    2014-01-01

    The study of religion is severely handicapped by a lack of adequate cross-national data. Despite the prominence of religion in international events and recent theoretical models pointing to the consequences of regulating religion, cross-national research on religion has been lacking. We strive to fill this void by developing measurement models and indexes for government regulation, government favoritism, and social regulation of religion. The indexes rely on data from an extensive coding of the 2003 International Religious Freedom Report for 196 countries and territories. Using a series of tests to evaluate the new data and indexes, we find that the measures developed are highly reliable and valid. The three indexes will allow researchers and others to measure the government’s subsidy and regulation of religion as well as the restrictions placed on religion by social and cultural forces beyond the state. PMID:25484633

  4. Sex differences in claimed and behavioral self-handicapping and ADHD symptomatology in emerging adults.

    Science.gov (United States)

    Jaconis, Maryanne; Boyd, Stephen J; Hartung, Cynthia M; McCrea, Sean M; Lefler, Elizabeth K; Canu, Will H

    2016-12-01

    Although the research is clear that boys with ADHD have higher symptomatology and impairment than girls with ADHD, for adults the research is mixed. Some studies suggest no sex differences, whereas others suggest that women might have higher symptomatology and impairment. The present study examined sex differences in ADHD symptomatology and impairment, and the possible role of claimed and behavioral self-handicapping as an explanation for any differences. Claimed self-handicapping (CSH) involves reports of performance-inhibiting conditions, whereas behavioral self-handicapping (BSH) involves reporting more objective, intentional acts that could undermine performance. College students (N = 699) completed an online study. Sex differences were found for hyperactivity such that women reported higher levels, but not for inattention or impairment. The test of the indirect effect of sex through CSH was significant, suggesting that higher levels of CSH in women were associated with elevated ADHD symptoms and impairment. The test of the indirect effect of sex through BSH was also significant, suggesting that higher levels of BSH in men are associated with elevated symptoms of ADHD and impairment. These data extend the literature by suggesting that self-handicapping might at least partially explain differential self-reporting of ADHD symptoms and impairment in emerging adults across the sexes.

  5. TOWARD DEVELOPMENT OF INSTITUTIONAL PROTECTION, REHABILITATUION OF HANDICAPPED PEOPLE IN MACEDONIA (basis for furtherer studies

    Directory of Open Access Journals (Sweden)

    Ljupco AJDINSKI

    2000-12-01

    Full Text Available This work gives an detailed review of the basic issues of development of protection and rehabilitation of handicapped people in Macedonia with data especially for the period pf the last five decades.A plentitude of documentary materials proved to be important starting assumption for further historical studies on protection and rehabilitation of handicapped people in the Republic of Macedonia.

  6. Object permanence development in infants with motor handicaps.

    Science.gov (United States)

    Fetters, L

    1981-03-01

    This study was an investigation of the effects of a motor handicap on the development of object permanence in the young child. Motor abilities were evaluated for 12 infants aged 13 to 29 months. Based on this evaluation, the children were described as manipulators or nonmanipulators in reference to their upper extremity skills. Their stage of object permanence was assessed using traditional and nontraditional assessments. Heart rate and visual tracking were recorded during the nontraditional assessment. Heart rate did not significantly relate to visual fixation or search response. There was, however, a significant difference (p less than .02) between stage achievement with traditional testing and age-appropriate levels. There was no significant difference between the nontraditional assessment and the age-appropriate levels. In addition, there was no significant difference in the development of object permanence between infants described as manipulators and those described as nonmanipulators. The last two findings suggest that infants with motor handicaps may develop object permanence at the expected ages, according to a nontraditional assessment.

  7. Developmental Trampoline Activities for Individuals with Multiple Handicapping Conditions.

    Science.gov (United States)

    Thomas, Bill

    1979-01-01

    The use of trampoline activities with multiple handicapped students is discussed. Management considerations in safety are noted, and developmental trampoline skills are listed beginning with bouncing for stimulation. Progression to limited independence and finally independent jumping is described. The position statement of the American Alliance…

  8. Self-Handicapping and Defensive Pessimism: Exploring a Model of Predictors and Outcomes from a Self-Protection Perspective.

    Science.gov (United States)

    Martin, Andrew J.; Marsh, Herbert W.; Debus, Raymond L.

    2001-01-01

    Examines self-handicapping and defensive pessimism, the factors that predict these strategies, and the associations between these strategies and a variety of academic outcomes. Findings reveal that task orientation negatively predicts both self-handicapping and defensive expectations and positively predicts reflectivity. Students high in…

  9. Effects of Handicap and Job Characteristics on Selection Evaluations.

    Science.gov (United States)

    Rose, Gerald L.; Brief, Arthur P.

    1979-01-01

    Business administration students evaluated a hypothetical job applicant who was either an amputee, an epileptic, or "normal." The hypothetical job openings varied as to levels of supervisory responsibility and public contact. With some noted exceptions, the handicapped applicants were evaluated no differently than the normal applicants.…

  10. Associations between Students' Perceptions of Mathematics Classroom Environment and Self-Handicapping in Australian and Canadian High Schools

    Science.gov (United States)

    Dorman, Jeffrey P.; Ferguson, Janet M.

    2004-01-01

    Research investigating the relationship between classroom environment and self-handicapping was conducted in Australian and Canadian high schools. A sample of 2,006 students responded to a questionnaire that assessed student perceptions of classroom environment and self-handicapping. Simple and multiple correlational analyses showed that classroom…

  11. Comparison of Irrational Believes between Mothers of Severe or Profound Mentally Handicapped Children with Healthy Children Mothers

    Directory of Open Access Journals (Sweden)

    Behrouz Hivadi

    2007-10-01

    Full Text Available Objective: The purpose of present research was the comparison of mothers irrational believes with severe or profound mentally handicapped child and mothers with normal child from 6 to14 years old in Tehran city. Materials & Methods: This study was an analytical, cross – sectional and comparative (case – control research. From mothers with severe or profound mentally handicapped child who had refered to Tehran welfare services centers, 80 mothers were selected by regular randomized sampling from two rehabilitation centers and 80 mothers with normal child were selected for peering with the group of testimonial from schools areas of east, west, south, north and center of Tehran, through multi - stage cluster sampling in for variables of: age of mothers, educational levels, the location of living and the number of children. They answered to questionnaire of irrational believes of jons (IBT. Analysis of data was done by descriptive and infringing statistics methods (Independent T test, U Mann Whitney, Chi-square and fisher. Results: The findings showed that: there are significantly differences in total irrational believes and irrational believes of blame proneness, frustration reactive, anxious over concern, problem avoiding and dependency, perfectionism between two groups of mothers (P<0/05. There was no significant difference in irrational believes between mothers who had mental handicap daughter and mothers who had mental handicap son (P=0/314. There was no significantly difference between two groups of mothers in four believes of demand for approval (P=0/737, high-self expectation (P=0/126, emotional irresponsibility (P=0/727, helplessness for change (p=0/283. Conclusion: Irrational believes and many its sub scales. In mothers of severe or profound mental handicap children were more than mothers with normal child. But believes of demand for approval, high self expectation, emotional irresponsibility, helplessness for change in mothers with

  12. Psychosomatic symptoms in medical outpatients: an investigation of self-handicapping theory.

    Science.gov (United States)

    Organista, P B; Miranda, J

    1991-01-01

    Investigated self-handicapping theory as it relates to somatization in medical patients. We predicted that medical outpatients (N = 113) would report psychosomatic symptoms in response to events that threaten their self-esteem. As predicted, results of hierarchical multiple regression indicated that high-perfectionism patients reported somatic symptoms positively related to the number of events that jeopardize their sense of accomplishment, whereas low-perfectionism patients' somatic symptoms were not related to these events (p = .005). Contrary to prediction, high-dependency patients did not differ significantly from low-dependency patients in the relationship of somatic symptoms and events that threatened their interpersonal relationships (p = .115). Implications of these findings and the utility of self-handicapping theory for predicting somatization in medical patients are discussed.

  13. Children's experiences of war: handicapped children in England during the Second World War.

    Science.gov (United States)

    Wheatcroft, Sue

    2008-01-01

    The experiences of children during the Second World War have attracted considerable attention, both scholarly and popular. Not all children however, have received equal attention. Handicapped children are conspicuous by their absence from all types of literature, both on evacuation and on children's experiences of the Second World War. This article restores these children to the story of wartime England and assesses their experiences. It examines the plans that were made for their evacuation and how they were carried out, and compares their lives, both individually and institutionally (i.e. in the various types of 'special' school) with those who, for various reasons, were not evacuated. It also compares their experiences, to a lesser degree, with those of their non-handicapped counterparts. The article argues that for many handicapped children it was a positive experience but one which depended on specific aspects, such as the attitudes of the authorities and of the general public, and perhaps more importantly, the attitudes and quality of the teaching and nursing staff, who were responsible for the children on a daily basis.

  14. Tactile mouse generating velvet hand illusion on human palm

    Directory of Open Access Journals (Sweden)

    Nadar Rajaei

    2016-09-01

    Full Text Available To enhance virtual reality (VR generated by tactile displays, we have focused on a novel tactile illusion, called the Velvet Hand Illusion (VHI. In VHI, moving two parallel wires back and forth between the two hands leads humans to perceive a velvet-like surface between their hands. In earlier studies, we revealed that the intensity of VHI could be controlled by a ratio (r/D, where r and D are the wire stroke and wire distance, respectively. According to these findings, we investigate in this study whether a common tactile display is able to produce VHI, and whether the ratio can also control VHI intensity. We prepare a dot-matrix display as a tactile display in which moving one line of the display’s pins is considered as a wire pattern. We investigate the VHI intensity with regard to changing the stroke r and the line distance D using paired comparison. Experimental results show that the VHI intensity is increased or decreased by changing r and D. We conclude that VHI can be created by the tactile display, and the intensity of VHI is controlled by changing the ratio of r/D.

  15. New Directions in Vocational Education for the Handicapped: Implications for Research and Development. Occasional Paper No. 35.

    Science.gov (United States)

    Martin, Edwin

    The history of educational programming for the handicapped has unfortunately been one of quiet discrimination. This pattern has come from the evolution of an isolation-based society. Society is moving increasingly toward the human and equity-based treatment of disabled people. Reflecting some court decisions, the Education of the Handicapped Act…

  16. Assessment of Self-Recognition in Young Children with Handicaps.

    Science.gov (United States)

    Kelley, Michael F.; And Others

    1988-01-01

    Thirty young children with handicaps were assessed on five self-recognition mirror tasks. The set of tasks formed a reproducible scale, indicating that these tasks are an appropriate measure of self-recognition in this population. Data analysis suggested that stage of self-recognition is positively and significantly related to cognitive…

  17. Workshops for the Handicapped; An Annotated Bibliography - No. 6.

    Science.gov (United States)

    Perkins, Dorothy C., Comp.; And Others

    An annotated bibliography of workshops for the handicapped covers the literature on work programs for the period July, 1968 through June, 1969. One hundred and fifty four publications were reviewed; the number of articles on administration, management, and planning of facilities and programs has increased since the last edition. (Author/RJ)

  18. Self-handicapping, excuse making, and counterfactual thinking: consequences for self-esteem and future motivation.

    Science.gov (United States)

    McCrea, Sean M

    2008-08-01

    Researchers interested in counterfactual thinking have often found that upward counterfactual thoughts lead to increased motivation to improve in the future, although at the cost of increased negative affect. The present studies suggest that because upward counterfactual thoughts indicate reasons for a poor performance, they can also serve as excuses. In this case, upward counterfactual thoughts should result in more positive self-esteem and reduced future motivation. Five studies demonstrated these effects in the context of self-handicapping. First, upward counterfactual thinking was increased in the presence of a self-handicap. Second, upward counterfactual thoughts indicating the presence of a self-handicap protected self-esteem following failure. Finally, upward counterfactual thoughts that protect self-esteem reduced preparation for a subsequent performance as well as performance itself. These findings suggest that the consequences of upward counterfactuals for affect and motivation are moderated by the goals of the individual as well as the content of the thoughts. (c) 2008 APA, all rights reserved

  19. Multidimensional effects of voice therapy in patients affected by unilateral vocal fold paralysis due to cancer.

    Science.gov (United States)

    Barcelos, Camila Barbosa; Silveira, Paula Angélica Lorenzon; Guedes, Renata Lígia Vieira; Gonçalves, Aline Nogueira; Slobodticov, Luciana Dall'Agnol Siqueira; Angelis, Elisabete Carrara-de

    2017-08-24

    Patients with unilateral vocal fold paralysis may demonstrate different degrees of voice perturbation depending on the position of the paralyzed vocal fold. Understanding the effectiveness of voice therapy in this population may be an important coefficient to define the therapeutic approach. To evaluate the voice therapy effectiveness in the short, medium and long-term in patients with unilateral vocal fold paralysis and determine the risk factors for voice rehabilitation failure. Prospective study with 61 patients affected by unilateral vocal fold paralysis enrolled. Each subject had voice therapy with an experienced speech pathologist twice a week. A multidimensional assessment protocol was used pre-treatment and in three different times after voice treatment initiation: short-term (1-3 months), medium-term (4-6 months) and long-term (12 months); it included videoendoscopy, maximum phonation time, GRBASI scale, acoustic voice analysis and the portuguese version of the voice handicap index. Multiple comparisons for GRBASI scale and VHI revealed statistically significant differences, except between medium and long term (pvocal improvement over time with stabilization results after 6 months (medium term). From the 28 patients with permanent unilateral vocal fold paralysis, 18 (69.2%) reached complete glottal closure following vocal therapy (p=0.001). The logistic regression method indicated that the Jitter entered the final model as a risk factor for partial improvement. For every unit of increased jitter, there was an increase of 0.1% (1.001) of the chance for partial improvement, which means an increase on no full improvement chance during rehabilitation. Vocal rehabilitation improves perceptual and acoustic voice parameters and voice handicap index, besides favor glottal closure in patients with unilateral vocal fold paralysis. The results were also permanent during the period of 1 year. The Jitter value, when elevated, is a risk factor for the voice therapy

  20. The Use of WISC-R Subtest Scatter in the Identification of Intellectually Gifted Handicapped Children: An Inappropriate Task?

    Science.gov (United States)

    Brown, Scott W.

    1984-01-01

    The paper discusses issues involved in the identification of gifted handicapped children, reviewing several research studies that attempted to define a specific configuration of Wechsler Intelligence Scale for Children-Revised subtest scores indicative of handicapped children possessing intellectual gifts. The author concludes that profiles and…

  1. [Golf handicap score is a suitable scale for monitoring rehabilitation after apoplexia cerebri].

    Science.gov (United States)

    Jensen, Per; Meden, Per; Knudsen, Lars V; Knudsen, G M; Thomsen, Carsten; Feng, Ling; Pinborg, Lars H

    2015-12-21

    A 67-year-old male was examined nine, 35 and 135 days after stroke using conventional stroke scales, 18 holes of golf, functional MRI (fist closures) and translocator protein imaging of microglial function in the brain using single photon emission computed tomography. The data showed that the over 100-year-old golf handicap scale is better suited for quantifying recovery after stroke than conventional stroke assessment scales, which are prone to ceiling effect. We suggest that rating with golf handicap should be used more widely in stroke research, and we find it tremendously important that these new findings are published before Christmas.

  2. The EU Offshore Safety Directive and its potential effects. Opportunity or handicap?; Die EU Offshore Safety Directive und ihre moeglichen Auswirkungen. Chance oder Handicap?

    Energy Technology Data Exchange (ETDEWEB)

    Schwiederowski, Claudia [RWE Dea AG, Hamburg (Germany)

    2014-07-01

    The purpose of the EU Offshore Safety Directive, which took effect on 18 July 2013, is to define minimum requirements for the prevention of severe accidents in connection with offshore crude oil or natural gas activities of any kind and the containment of the follow-on effects of such accidents. This is without question a logical consequence of the offshore incidents seen around the globe over the past decades. An interesting question in this context is for whom the EU Offshore Safety Directive has become an opportunity and for whom a handicap. [German] Ziel der am 18. Juli 2013 in Kraft getretenen EU Offshore Safety Direktive ist die Festlegung von Mindestanforderungen fuer die Verhinderung schwerer Unfaelle bei Offshore-Erdoel- bzw. - Erdgasaktivitaeten und die Begrenzung etwaiger Unfallfolgen. Nach den weltweiten Offshore- Ereignissen der vergangenen Jahrzehnte ist dies ohne Zweifel eine logische Entwicklung. Nun stellt sich die Frage: Fuer wen entwickelt sich die EU Offshore Safety Directive zur Chance, fuer wen zum Handicap?.

  3. The performance-perceptual test and its relationship to unaided reported handicap.

    Science.gov (United States)

    Saunders, Gabrielle H; Forsline, Anna; Fausti, Stephen A

    2004-04-01

    Measurement of hearing aid outcomes is necessary for demonstration of treatment efficacy, third-party payment, and cost-benefit analysis. Outcomes are usually measured with hearing-related questionnaires and/or tests of speech recognition. However, results from these two types of test often conflict. In this paper, we provide data from a new test measure, known as the Performance-Perceptual Test (PPT), in which subjective and performance aspects of hearing in noise are measured using the same test materials and procedures. A Performance Speech Reception Threshold (SRTN) and a Perceptual SRTN are measured using the Hearing In Noise Test materials and adaptive procedure. A third variable, the discrepancy between these two SRTNs, is also computed. It measures the accuracy with which subjects assess their own hearing ability and is referred to as the Performance-Perceptual Discrepancy (PPDIS). One hundred seven subjects between 24 and 83 yr of age took part. Thirty-three subjects had normal hearing, while the remaining seventy-four had symmetrical sensorineural hearing loss. Of the subjects with impaired hearing, 24 wore hearing aids and 50 did not. All subjects underwent routine audiological examination and completed the PPT and the Hearing Handicap Inventory for the Elderly/Adults on two occasions, between 1 and 2 wk apart. The PPT was conducted for unaided listening with the masker level set to 50, 65, and 80 dB SPL. PPT data show that the subjects with normal hearing have significantly better Performance and Perceptual SRTNs at each test level than the subjects with impaired hearing but that PPDIS values do not differ between the groups. Test-retest reliability for the PPT is excellent (r-values > 0.93 for all conditions). Stepwise multiple regression analysis showed that the Performance SRTN, the PPDIS, and age explain 40% of the variance in reported handicap (Hearing Handicap Inventory for the Elderly/Adults scores). More specifically, poorer performance

  4. Occupational Opportunities for the Physically Handicapped. Part B. Manual.

    Science.gov (United States)

    Uthe, Elaine F.

    This manual presents the master lists of 206 job titles of 167 different Dictionary of Occupational Titles (DOT) code numbers which were held by physically handicapped graduates/completers of vocational programs as determined by a business and industry survey and graduate followup. (The project itself is reported in CE 026 163; survey and followup…

  5. Medical Considerations for Multiple-Handicapped Children in the Public Schools

    Science.gov (United States)

    Bryan, Elizabeth; And Others

    1978-01-01

    The authors discuss concerns and practical suggestions involved in the education of multiply handicapped children in the following problem areas: first aid, emergency care and disaster planning; sanitation; environment; safety in routine and supplemental activities; therapy procedures; and staff protection, training, orientation, and special…

  6. 2001: Employment Odyssey or Opportunity for Persons with Handicapping Conditions?

    Science.gov (United States)

    Linari, Ronald F.; Belmont, Robert M.

    1986-01-01

    Implications of trends in population, families, communications, automation, the environment, and employment changes are noted for the training and employment of handicapped persons. The need for emphasis in vocational education on generalizability, job readiness and vocational adjustment skills, and job analysis is stressed. (CL)

  7. Social Interpersonal Skills of Handicapped and Nonhandicapped Adults at Work

    OpenAIRE

    Lignugaris/Kraft, Benjamin; Rule, S.; Salzberg, Charles L.; Stowitschek, J. J.

    1986-01-01

    The pattern and content of social interactions of successful handicapped and nonhandicapped employees were observed in two employment settings. Data suggest that both groups were active social interactants who frequently worked cooperatively, yet interacted relatively infrequently with their supervisors. Implications for future research are discussed.

  8. 49 CFR Appendix A to Part 609 - Elderly and Handicapped

    Science.gov (United States)

    2010-10-01

    ... capabilities, are unable without special facilities or special planning or design to utilize mass... planning, facilities, or design. However, deafness is recognized as a handicap in the Department of Transportation's ADA regulation, and applicants for Section 5 assistance are encouraged to include the deaf as...

  9. Seroprevalence of hepatitis B and C virus in two institutions caring for mentally handicapped adults.

    OpenAIRE

    Cramp, M E; Grundy, H C; Perinpanayagam, R M; Barnado, D E

    1996-01-01

    Hepatitis B virus infection is common in institutions caring for the mentally handicapped. Hepatitis B virus and hepatitis C virus share routes of transmission but the prevalence of hepatitis C virus infection in this population is unknown. We have tested 101 patients from two institutions in South-East England caring for adults with mental handicap for the presence of hepatitis C antibody, hepatitis B core antibody, and if necessary hepatitis B surface antigen. None tested positive for hepat...

  10. The assessment of the impact of anorexia nervosa on the vocal apparatus in adolescent girls - A preliminary report.

    Science.gov (United States)

    Maciejewska, Barbara; Rajewska-Rager, Aleksandra; Maciejewska-Szaniec, Zofia; Michalak, Michał; Rajewski, Andrzej; Wiskirska-Woźnica, Bożena

    2016-06-01

    Chronic undernourishment in the course of anorexia nervosa leads to various metabolic and hormonal changes, which translates to the impaired functioning of the majority of systems and internal organs. The impact of eating disorders on the condition of the vocal apparatus has been described in the literature; nevertheless, it concerns mainly bulimia nervosa. assessment of the vocal apparatus in adolescent girls diagnosed with anorexia nervosa from the point of view of possible influence on the function and structure of the larynx, low body mass accompanying anorexia, as well as energy deficiency, hormonal and emotional disturbances. The research included 41 girls aged 12-19 years, diagnosed with anorexia, who were assessed for the condition of the vocal apparatus, using the perceptual assessment of voice according to GRBAS scale, videolarynostroboscopy, acoustic assessment, and voice self-assessment in Jacobson's VHI scale (voice handicap index). The perceptual assessment of voice using the GRBAS scale revealed that changes in voice were mainly weak, asthenic in nature (70.73%) and there was also the feature of puffing perceived in voice (41.46%). In voice self-assessment with the use of VHI, most subjects seemed to point to changes of voice self-perception in emotional subscale (68%). Videolaryngostroboscopy revealed some features of functional disturbances of voice in more than half of subjects, mainly in the form of hyperfunctional dysphonia (31.78%). The maximal phonation time was significantly shorter, in proportion to duration of the primary disease. In the acoustic analysis, the decrease in the basic frequency F0 and narrowing of the voice scale were observed. 55% of older, post-adolescent patients presented with the structure of the larynx that was inappropriate for their age. These results might indicate that anorexia nervosa could have led to the structural and functional changes in the vocal apparatus. Such disturbances may be explained by the hormonal

  11. Life Experience of Patients With Unilateral Vocal Fold Paralysis.

    Science.gov (United States)

    Francis, David O; Sherman, Ariel E; Hovis, Kristen L; Bonnet, Kemberlee; Schlundt, David; Garrett, C Gaelyn; Davies, Louise

    2018-05-01

    Clinicians and patients benefit when they have a clear understanding of how medical conditions influence patients' life experiences. Patients' perspectives on life with unilateral vocal fold paralysis have not been well described. To promote patient-centered care by characterizing the patient experiences of living with unilateral vocal fold paralysis. This study used mixed methods: surveys using the voice and dysphagia handicap indexes (VHI and DHI) and semistructured interviews with adults with unilateral vocal cord paralysis recruited from a tertiary voice center. Recorded interviews were transcribed, coded using a hierarchical coding system, and analyzed using an iterative inductive-deductive approach. Symptom domains of the patient experience. In 36 patients (26 [72%] were female, and the median age and interquartile range [IQR] were 63 years [48-68 years]; median interview duration, 42 minutes), median VHI and DHI scores were 96 (IQR, 77-108) and 55.5 (IQR, 35-89) at the time of interviews, respectively. Frustration, isolation, fear, and altered self-identity were primary themes permeating patients' experiences. Frustrations related to limitations in communication, employment, and the medical system. Sources of fear included a loss of control, fear of further dysfunction or permanent disability, concern for health consequences (eg, aspiration pneumonia), and/or an inability to call for help in emergency situations. These experiences were modified by the following factors: resilience, self-efficacy, perceived sense of control, and social support systems. Effects of unilateral vocal fold paralysis extend beyond impaired voice and other somatic symptoms. Awareness of the extent to which these patients experience frustration, isolation, fear, and altered self-identity is important. A patient-centered approach to optimizing unilateral vocal fold paralysis treatment is enhanced by an understanding of both the physical dimension of this condition and how patients

  12. Middle frontal horizontal partial laryngectomy (MFHPL: a treatment for stage T1b squamous cell carcinoma of the glottic larynx involving anterior vocal commissure.

    Directory of Open Access Journals (Sweden)

    Wen-bin Lei

    Full Text Available OBJECTIVE: The therapeutic effect of middle frontal horizontal partial laryngectomy (MFHPL in treating stage T1b squamous cell carcinoma of the glottic larynx involving anterior vocal commissure (AVC was compared with that of the anterior frontolateral vertical partial laryngectomy (AFVPL. The feasibility and practical significance of MFHPL in clinical application was discussed in the present study. METHODS: From January 1996 to January 2010, a total of 65 patients diagnosed with stage T1bN0M0 glottic laryngeal cancer were treated with MFHPL or AFVPL. The postoperative complications, glottic reconstruction, recurrence rate, voice quality and survival rates were evaluated and compared between two treatments. RESULTS: AFVPL and MFHPL were performed in 34 and 31 patients, respectively. Flexible fiberoptic laryngoscopy revealed that in the MFHPL-treated patients the reconstructed glottis was spacious and symmetric. In contrast, AFVPL treatment resulted in irregular glottic area with poor symmetry and tubular glottis. The incidence of postoperative laryngeal stenosis significantly differed between the MFHPL- and AFVPL-treated groups (P = 0.025. No significant difference was detected in the 3- and 5-year overall- or tumor-free survival rates between two treatments. The Voice Handicap Index (VHI and maximum phonation time (MPT after surgery were 51.0±12.99 and 12.42±3.44 sec in the AFVPL-treated group; while in the MFHPL-treated patients they were 31.81±7.48 and 7.65±1.98 sec, respectively. Both differences in VHI (P = 0.012 and MPT (P = 0.024 were significant between two treatments. CONCLUSIONS: MFHPL was comparable to AFVPL with respect to postoperative complications, recurrence rate and survival rates, but possessed advantages over AFVPL in terms of the incidence of laryngeal stenosis and voice quality. Our study indicated that MFHPL has a potential value in clinical practice of treating stage T1b squamous cell carcinoma of the

  13. Voice amplification for primary school teachers with voice disorders: A randomized clinical trial

    Directory of Open Access Journals (Sweden)

    Roberto Bovo

    2013-06-01

    Full Text Available Objectives: Several studies have demonstrated a high prevalence of voice disorders in teachers, together with the personal, professional and economical consequences of the problem. Good primary prevention should be based on 3 aspects: 1 amelioration of classroom acoustics, 2 voice care programs for future professional voice users, including teachers and 3 classroom or portable amplification systems. The aim of the study was to assess the benefit obtained from the use of portable amplification systems by female primary school teachers in their occupational setting. Materials and Methods: Forty female primary school teachers attended a course about professional voice care, which comprised two theoretical lectures, each 60 min long. Thereafter, they were randomized into 2 groups: the teachers of the first group were asked to use a portable vocal amplifier for 3 months, till the end of school-year. The other 20 teachers were part of the control group, matched for age and years of employment. All subjects had a grade 1 of dysphonia with no significant organic lesion of the vocal folds. Results: Most teachers of the experimental group used the amplifier consistently for the whole duration of the experiment and found it very useful in reducing the symptoms of vocal fatigue. In fact, after 3 months, Voice Handicap Index (VHI scores in "course + amplifier" group demonstrated a significant amelioration (p = 0.003. The perceptual grade of dysphonia also improved significantly (p = 0.0005. The same parameters changed favourably also in the "course only" group, but the results were not statistically significant (p = 0.4 for VHI and p = 0.03 for perceptual grade. Conclusions: In teachers, and particularly in those with a constitutional weak voice and/or those who are prone to vocal fold pathology, vocal amplifiers may be an effective and low-cost intervention to decrease potentially damaging vocal loads and may represent a necessary form of prevention.

  14. Creating aesthetically resonant environments for the handicapped, elderly and rehabilitation: Sweden

    DEFF Research Database (Denmark)

    Brooks, Tony; Hasselblad, Stefan

    2005-01-01

    CARE HERE (Creating Aesthetically Resonant Environments for the Handicapped, Elderly and Rehabilitation) was realised as a full European IST (Information Society Technologies) project, involving adults and children with learning disability, PMLD (Profound and Multiple Learning Disability...

  15. Behavioral and physiological responses to male handicap in chick-rearing black-legged kittiwakes

    Science.gov (United States)

    Leclaire, S.; Bourret, V.; Wagner, R.H.; Hatch, Shyla A.; Helfenstein, F.; Chastel, O.; Danchin, E.

    2011-01-01

    Parental investment entails a trade-off between the benefits of effort in current offspring and the costs to future reproduction. Long-lived species are predicted to be reluctant to increase parental effort to avoid affecting their survival. We tested this hypothesis in black-legged kittiwakes Rissa tridactyla by clipping flight feathers of experimental males at the beginning of the chick-rearing period. We analyzed the consequences of this handicap on feeding and attendance behavior, body condition, integument coloration, and circulating levels of corticosterone and prolactin in handicapped males and their mates in comparison to unmanipulated controls. Chicks in both groups were compared in terms of aggressive behavior, growth, and mortality. Handicapped males lost more mass, had less bright integuments, and attended the nest less often than controls. Nevertheless, they fed their chicks at the same rate and had similar corticosterone and prolactin levels. Compared with control females, females mated with handicapped males showed a lower provisioning rate and higher nest attendance in the first days after manipulation. Their lower feeding rate probably triggered the increased sibling aggression and mortality observed in experimental broods. Our findings suggest that experimental females adaptively adjusted their effort to their mate's perceived quality or that their provisioning was constrained by their higher nest attendance. Overall, our results suggest that kittiwake males can decrease their condition for the sake of their chicks, which seems to contradict the hypothesis that kittiwakes should be reluctant to increase parental effort to avoid affecting their survival. ?? 2011 The Author. Published by Oxford University Press on behalf of the International Society for Behavioral Ecology. All rights reserved.

  16. Early Intervention and the Integration of Handicapped and Nonhandicapped Children.

    Science.gov (United States)

    Guralnick, Michael J.

    This collection of 11 articles focuses on integrating handicapped and nonhandicapped children in preschool programs. Article 1 presents arguments for preschool integration. Article 2 discusses research on peer interaction and mixed-age socialization. Article 3 advocates a behavior analysis and operant conditioning approach to studying and…

  17. Assessing Transition Service for Handicapped Youth: A Cooperative Interagency Approach.

    Science.gov (United States)

    Stodden, Robert A.; Boone, Rosalie

    1987-01-01

    The article presents a cooperative interagency approach for assessing effectiveness of programs and services to facilitate the transition of handicapped students from school to adult community living. Features of the model include cooperative planning at the policy level, implementation level, and direct service level; and collaboration by state…

  18. Prevention of Self-Handicapping--The Protective Function of Mastery Goals

    Science.gov (United States)

    Schwinger, Malte; Stiensmeier-Pelster, Joachim

    2011-01-01

    Drawing on modern diathesis-stress theories which suggest a multiplicative approach to determine one's personal vulnerability status, we posit that the degree of an individual's vulnerability for using self-handicapping strategies in case of self-threatening events depends on the interaction between different vulnerability and protective factors.…

  19. Attitudes of Preschool Teachers toward the Integration of Handicapped Children.

    Science.gov (United States)

    Dyson, Lily L.; Kubo, H. Richard

    Forty-six supervisors and teachers were surveyed regarding their attitudes toward integration of handicapped children in a regular preschool program, the helpfulness of supportive services, and the necessary conditions for the integration of their programs. Findings showed that the majority of teachers were in favor of integration and supportive…

  20. The Relationship Between Attitudes Toward the Handicapped and Nonverbal Behavior with Educators of Special Needs Students: An Exploratory Study.

    Science.gov (United States)

    Stodden, Robert A.; And Others

    Examined were the relationships between attitudes toward the handicapped and nonverbal behavior of 60 special education teachers involved in inservice or preservice coursework. Ss were administered the Attitudes Toward Handicapped Individuals (ATHI) Scale and the Nonverbal Behavior Characteristics Scale (NBCS). Analysis of the data indicated a…

  1. Comprehensive Social Service Programs for Handicapped Citizens through Title XX.

    Science.gov (United States)

    Roten, Shelby Jean

    Reviewed are present and potential services and social programs for handicapped children in Mississippi through purchase of service contracts under Title XX of the Social Security Act. Sections cover the following topics: background and purpose of Title XX which gives states greater control over social service programs, planning state supported…

  2. Predictors of Middle School Students' Use of Self- Handicapping Strategies.

    Science.gov (United States)

    Midgley, Carol; Urdan, Tim

    1995-01-01

    By procrastinating, allowing others to keep them from studying, deliberately not trying, and using other "self-handicapping" strategies, students can convey that those circumstances, rather than lack of ability, are the reasons for subsequent poor performance. Survey data from 256 eighth-grade students indicated that boys use those strategies more…

  3. Late onset polio sequelae : Disabilities and handicaps in a population-based cohort of the 1956 poliomyelitis outbreak in The Netherlands

    NARCIS (Netherlands)

    Ivanyi, Barbara; Nollet, E; Redekop, WK; De Haan, R; Wohlgemuht, M; van Wijngaarden, JK; de Visser, Marianne

    Objective: To investigate the prevalence of new neuromuscular symptoms, disabilities, and handicaps in a group of polio survivors. Design: A self-constructed health questionnaire about neuromuscular complaints and disability and handicap levels during the stable period after recovery from polio and

  4. Late onset polio sequelae: disabilities and handicaps in a population-based cohort of the 1956 poliomyelitis outbreak in The Netherlands

    NARCIS (Netherlands)

    Ivanyi, B.; Nollet, F.; Redekop, W. K.; de Haan, R.; Wohlgemuht, M.; van Wijngaarden, J. K.; de Visser, M.

    1999-01-01

    OBJECTIVE: To investigate the prevalence of new neuromuscular symptoms, disabilities, and handicaps in a group of polio survivors. DESIGN: A self-constructed health questionnaire about neuromuscular complaints and disability and handicap levels during the stable period after recovery from polio and

  5. Improving Learning Tasks for Mentally Handicapped People Using AmI Environments Based on Cyber-Physical Systems

    Directory of Open Access Journals (Sweden)

    Diego Martín

    2018-01-01

    Full Text Available A prototype to improve learning tasks for mentally handicapped people is shown in this research paper using ambient intelligence techniques and based on cyber-physical systems. The whole system is composed of a worktable, a cyber-glove (both with several RFID and NFC detection zones, and an AmI software application for modeling and workflow guidance. A case study was carried out by the authors where sixteen mentally handicapped people and 3 trainers were involved in the experiment. The experiment consisted in the execution of several memorization tasks of movements of objects using the approach presented in this paper. The results obtained were very interesting, indicating that this kind of solutions are feasible and allow the learning of complex tasks to some types of mentally handicapped people. In addition, at the end of the paper are presented some lessons learned after performing the experimentation.

  6. Game Plans for Victors: New Skills for Severely Handicapped Children.

    Science.gov (United States)

    Schoen, Sharon; And Others

    The paper describes an approach in which games were planned to provide instruction for three severely handicapped children (5-6 years old) with few leisure, social, or academic skills and many aberrant behaviors. The first of two games involved a language program to teach verbal interactions, picture identification, and picture matching. The…

  7. Self-Esteem of Gifted, Normal, and Mild Mentally Handicapped Children.

    Science.gov (United States)

    Chiu, Lian-Hwang

    1990-01-01

    Administered Coopersmith Self-Esteem Inventory (SEI) Form B to elementary school students (N=450) identified as gifted, normal, and mild mentally handicapped (MiMH). Results indicated that both the gifted and normal children had significantly higher self-esteem than did the MiMH children, but there were no differences between gifted and normal…

  8. Achievement goals, self-handicapping, and performance: a 2 x 2 achievement goal perspective.

    Science.gov (United States)

    Ntoumanis, Nikos; Thøgersen-Ntoumani, Cecilie; Smith, Alison L

    2009-11-01

    Elliot and colleagues (2006) examined the effects of experimentally induced achievement goals, proposed by the trichotomous model, on self-handicapping and performance in physical education. Our study replicated and extended the work of Elliot et al. by experimentally promoting all four goals proposed by the 2 x 2 model (Elliot & McGregor, 2001), measuring the participants' own situational achievement goals, using a relatively novel task, and testing the participants in a group setting. We used a randomized experimental design with four conditions that aimed to induce one of the four goals advanced by the 2 x 2 model. The participants (n = 138) were undergraduates who engaged in a dart-throwing task. The results pertaining to self-handicapping partly replicated Elliot and colleagues' findings by showing that experimentally promoted performance-avoidance goals resulted in less practice. In contrast, the promotion of mastery-avoidance goals did not result in less practice compared with either of the approach goals. Dart-throwing performance did not differ among the four goal conditions. Personal achievement goals did not moderate the effects of experimentally induced goals on self-handicapping and performance. The extent to which mastery-avoidance goals are maladaptive is discussed, as well as the interplay between personal and experimentally induced goals.

  9. Military Families with Handicapped Children: The Reassignment Problem

    Science.gov (United States)

    1981-02-01

    of them ( education service center, Lub- bock Medical facilities , Lubbock State School, psychiatric facilities , etc.) 18. Additional comments: Rapidly...Attached DD ) AN 73 1473 EDITION OF I NOV6GS IS OBSOLETE UNCL 23 Oct 81 8 1 10 2oc 0 6 2 !CURITY CLASSIFICATION OF THIS PAGE (I7,n Data Entered) AIR WAR...COLLEGE AIR UNIVERSITY Report No. MS107-81 MILITARY FAMILIES WITH HANDICAPPED CHILDREN: THE REASSIGNMENT PROBLEM (A (WiDE TO SPECIAL EDUCATION AVAILABLE

  10. The Performance-Perceptual Test (PPT) and its relationship to aided reported handicap and hearing aid satisfaction.

    Science.gov (United States)

    Saunders, Gabrielle H; Forsline, Anna

    2006-06-01

    Results of objective clinical tests (e.g., measures of speech understanding in noise) often conflict with subjective reports of hearing aid benefit and satisfaction. The Performance-Perceptual Test (PPT) is an outcome measure in which objective and subjective evaluations are made by using the same test materials, testing format, and unit of measurement (signal-to-noise ratio, S/N), permitting a direct comparison between measured and perceived ability to hear. Two variables are measured: a Performance Speech Reception Threshold in Noise (SRTN) for 50% correct performance and a Perceptual SRTN, which is the S/N at which listeners perceive that they can understand the speech material. A third variable is computed: the Performance-Perceptual Discrepancy (PPDIS); it is the difference between the Performance and Perceptual SRTNs and measures the extent to which listeners "misjudge" their hearing ability. Saunders et al. in 2004 examined the relation between PPT scores and unaided hearing handicap. In this publication, the relations between the PPT, residual aided handicap, and hearing aid satisfaction are described. Ninety-four individuals between the ages of 47 and 86 yr participated. All had symmetrical sensorineural hearing loss and had worn binaural hearing aids for at least 6 wk before participating. All subjects underwent routine audiological examination and completed the PPT, the Hearing Handicap Inventory for the Elderly/Adults (HHIE/A), and the Satisfaction for Amplification in Daily Life questionnaire. Sixty-five subjects attended one research visit for participation in this study, and 29 attended a second visit to complete the PPT a second time. Performance and Perceptual SRTN and PPDIS scores were normally distributed and showed excellent test-retest reliability. Aided SRTNs were significantly better than unaided SRTNs; aided and unaided PPDIS values did not differ. Stepwise multiple linear regression showed that the PPDIS, the Performance SRTN, and age were

  11. The Effect of Colour Psychodynamic Environment on the Psychophysiological and Behavioural Reactions of Severely Handicapped Children. Effects of Colour/Light Changes on Severely Handicapped Children.

    Science.gov (United States)

    Wohlfarth, H.; Sam, C.

    The effects of varied lighting and coloring in the classroom environment were examined on the behavior of seven severely handicapped 8 to 11 year olds with behavior problems. Analysis of changes in systolic blood pressure indicated that Ss were more comfortable and relaxed in the experimental room (in which the fluorescent lights were replaced by…

  12. Guidelines for Assessing Job-Related Social Skills of Mildly Handicapped Students.

    Science.gov (United States)

    Bullis, Michael; Foss, Gilbert

    1986-01-01

    Effective assessment of job-related social skills of mildly handicapped workers should consider three components of social competence: context, cognition, and performance. A comprehensive profile of social competence is best obtained through use of several assessment tools, such as: rating scales; role play; problem-solving tests; applied…

  13. Cost Accounting and Accountability for Early Education Programs for Handicapped Children.

    Science.gov (United States)

    Gingold, William

    The paper offers some basic information for making decisions about allocating and accounting for resources provided to young handicapped children. Sections address the following topics: reasons for costing, audiences for cost accounting and accountability information, and a process for cost accounting and accountability (defining cost categories,…

  14. Integrating Severely Handicapped Learners: Potential Teacher Liability in Community Based Programs.

    Science.gov (United States)

    Brady, Michael P.; Dennis, H. Floyd

    1984-01-01

    The paper examines elements of negligence and other legal concerns in view of the evolving trend to educate severely handicapped persons in integrated, community based settings. Duty, care, risk, and appropriate placement and instruction are discussed. Finally, recommendations for avoiding teacher liability are presented. (Author/CL)

  15. The Effect of Biological Movement Variability on the Performance of the Golf Swing in High- and Low-Handicapped Players

    Science.gov (United States)

    Bradshaw, Elizabeth J.; Keogh, Justin W. L.; Hume, Patria A.; Maulder, Peter S.; Nortje, Jacques; Marnewick, Michel

    2009-01-01

    The purpose of this study was to examine the role of neuromotor noise on golf swing performance in high- and low-handicap players. Selected two-dimensional kinematic measures of 20 male golfers (n = 10 per high- or low-handicap group) performing 10 golf swings with a 5-iron club was obtained through video analysis. Neuromotor noise was calculated…

  16. Transmissão vertical do HIV: expectativas e ações da gestante soropositiva Transmisión vertical del VHI: expectativas y acciones de la gestante seropositiva HIV perinatal transmission: expectations and actions of hiv-positive pregnant women

    Directory of Open Access Journals (Sweden)

    Edilene Lins de Moura

    2006-06-01

    Full Text Available Este estudo descritivo, com abordagem qualitativa, foi motivado pelo elevado número de casos de transmissão vertical do HIV. Teve como objetivo identificar as expectativas e ações da gestante HIV positivo quanto à gravidez e ao concepto. A amostra constituiu-se de 14 gestantes infectadas, assintomáticas, que conheciam sua soropositividade antes da gravidez e que estavam no 3º trimestre de gestação. Utilizou-se entrevista para a coleta de dados que ocorreu em 2001 e 2002. Empregou-se o Método do Discurso do Sujeito Coletivo para analisar os dados. Verificou-se que, quanto à maternidade, as gestantes tinham expectativas semelhantes, adaptaram-se à gravidez, e acreditavam na soronegatividade do bebê e na efetividade do tratamento. Concluiu-se pela necessidade de implementação de orientação para a saúde direcionada à mulher com enfoque na transmissão vertical do HIV/aids.Este estudio descriptivo, con aproximación cualitativa, fue motivado por el gran número de niños con transmisión vertical del VHI. Tuvo como objetivo identificar las expectativas y acciones de la gestante VHI positivo en cuanto al embarazo y al concepto. La muestra se constituyó de 14 gestantes infectadas, asintomáticas, que conocían su seropositividad antes del embarazo y que estaban en el 3.er trimestre de gestación. Para la recolección de los datos, realizada en el período de 2001 y 2002, se utilizó la entrevista. El Método de Discurso de Sujeto Colectivo fue empleado para analizar los datos. Se verificó que, en cuanto a la maternidad, las gestantes tenían expectativas semejantes. Se adaptaron a la gestación, confiaban en que el bebé seria suero negativo y en la efectividad del tratamiento realizado. Las conclusiones orientan hacia la necesidad de implementación de orientación sobre la salud de la mujer con acercamiento en la transmisión vertical del VHI/SIDA.This descriptive study with a qualitative approach was motivated by the high number

  17. Drought assessment for cropland of Central America using course-resolution remote sensing data

    Science.gov (United States)

    Chen, C. F.; Nguyen, S. T.; Chen, C. R.; Chiang, S. H.; Chang, L. Y.; Khin, L. V.

    2015-12-01

    Drought is one of the most frequent and costliest natural disasters, which imposes enormous effects to human societies and ecosystems. Agricultural drought is referred to an interval of time, such as weeks or months, when the soil moisture supply of a region consistently falls below the appropriate moisture supply leading to negative impacts on agricultural production. Millions of households in Central America were dependent upon major food crops, including maize, beans, and sorghum, for their daily subsistence. In recent years, impacts of climate change through global warming in forms of higher temperature and widespread rainfall deficits have however triggered severe drought during the primera cropping season (April-August) in the study region, causing profound impacts on agriculture, crop production losses, increased market food prices, as well as food security issues. This study focuses on investigating agricultural droughts for cropland of Central America using the Moderate Resolution Imaging Spectroradiometer (MODIS) data. We processed the data for a normal year 2013 and an abnormal year 2014 using a simple vegetation health index (VHI) that is developed based on the temperature condition index (TCI) and vegetation condition index (VCI). The VHI results were validated using the Advanced Microwave Scanning Radiometer 2 (AMSR2) precipitation data and temperature vegetation dryness index (TVDI) that is developed based on the empirical analysis of TCI and VCI data. The correlation coefficients (r) obtained by comparisons between the VHI data and the AMSR2 precipitation and TVDI data were higher than 0.62 and -0.61, respectively. The severe drought was intensive during the dry season (January-April) and likely backed to normal conditions in May with the onset of rainy season. The larger area of serve drought was observed for the 2014 primera season, especially during April-July. When investigating the cultivated areas affected by severe drought in the primera

  18. Quality of life in oncological patients with oropharyngeal dysphagia: validity and reliability of the Dutch version of the MD Anderson Dysphagia Inventory and the Deglutition Handicap Index.

    Science.gov (United States)

    Speyer, Renée; Heijnen, Bas J; Baijens, Laura W; Vrijenhoef, Femke H; Otters, Elsemieke F; Roodenburg, Nel; Bogaardt, Hans C

    2011-12-01

    Quality of life is an important outcome measurement in objectifying the current health status or therapy effects in patients with oropharyngeal dysphagia. In this study, the validity and reliability of the Dutch version of the Deglutition Handicap Index (DHI) and the MD Anderson Dysphagia Inventory (MDADI) have been determined for oncological patients with oropharyngeal dysphagia. At Maastricht University Medical Center, 76 consecutive patients were selected and asked to fill in three questionnaires on quality of life related to oropharyngeal dysphagia (the SWAL-QOL, the MDADI, and the DHI) as well as a simple one-item visual analog Dysphagia Severity Scale. None of the quality-of-life questionnaires showed any floor or ceiling effect. The test-retest reliability of the MDADI and the Dysphagia Severity Scale proved to be good. The test-retest reliability of the DHI could not be determined because of insufficient data, but the intraclass correlation coefficients were rather high. The internal consistency proved to be good. However, confirmatory factor analysis could not distinguish the underlying constructs as defined by the subscales per questionnaire. When assessing criterion validity, both the MDADI and the DHI showed satisfactory associations with the SWAL-QOL (reference or gold standard) after having removed the less relevant subscales of the SWAL-QOL. In conclusion, when assessing the validity and reliability of the Dutch version of the DHI or the MDADI, not all psychometric properties have been adequately met. In general, because of difficulties in the interpretation of study results when using questionnaires lacking sufficient psychometric quality, it is recommended that researchers strive to use questionnaires with the most optimal psychometric properties.

  19. The DEBT Project: Early Intervention for Handicapped Children and Their Parents.

    Science.gov (United States)

    Macy, Daniel J.; And Others

    Project DEBT (Developmental Education Birth through Two), an early identification and intervention program for handicapped and at risk children and their parents, is described. The Koontz Child Developmental Program, the core curriculum for instructional planning and intervention in DEBT, is reviewed, and new data are presented. It is explained…

  20. Oral Health Status Of Handicapped Primary School Pupils In Dar Es ...

    African Journals Online (AJOL)

    calculus, with highest mean scores mainly among the blind (p= 0.008). Conclusion: The caries prevalence among handicapped primary school pupils was quite low. However, there was relatively high level of gingival bleeding and calculus. Regarding treatment needs, 23% required dental fillings mainly of one and two ...

  1. Coping Strategies and Adaptation of Mothers of Children with Handicapping Conditions.

    Science.gov (United States)

    Hooshyar, Nahid T.

    Mothers' coping mechanisms and adaptations to having a handicapped child were analyzed through extensive structured interviews with mothers of eight preschool-aged Down syndrome children and a language impaired child. Three illustrative case studies are presented, and general conclusions are drawn. Mothers of Down syndrome children go through the…

  2. A Leisure Activities Curricular Component for Severely Handicapped Youth: Why and How.

    Science.gov (United States)

    Voeltz, Luanna M.; Apffel, James A.

    1981-01-01

    A rationale for including a leisure time activities curriculum component in educational programing for severely handicapped individuals is presented. The importance of play and the constructive use of leisure time is described through the use of a model demonstration project. (JN)

  3. He Will Lift Up His Head: A Report to the Developmental Disabilities Office on the Situation of Handicapped Navajos and the Implications Thereof for All Native Americans.

    Science.gov (United States)

    Haskins, James S.; Stifle, J. M.

    Issues involved in education of handicapped Navajo children are examined. Background sections contrast the history of treatment for the handicapped in America with the treatment received by handicapped Navajos. Unemployment, substandard housing, lack of accessibility within the reservation, overpopulation, language barriers, and the relationship…

  4. Reaching Rural Handicapped Children: The Transportation Situation in Rural Service Delivery. Making It Work in Rural Communities. A Rural Network Monograph.

    Science.gov (United States)

    Tucker, Jamie; And Others

    Almost everyone who responded to three transportation surveys of rural Handicapped Children's Early Education Program (HCEEP) projects identified transportation as a critical problem in the delivery of services to handicapped children in rural areas. Transportation problems encountered were attributed to environmental/geographic factors,…

  5. The Philosophy behind a (Danish) Voice-controlled Interface to Internet Browsing for motor-handicapped

    DEFF Research Database (Denmark)

    Brøndsted, Tom

    2005-01-01

    The public-funded project "Indtal" ("Speak-it") has succeeded in developing a Danish voice-controlled utility for internet browsing targeting motor-handicapped users having difficulties using a standard keyboard and/or a standard mouse. The system underlies a number of a priori defined design cri...... with the unimodal oral mode, etc. These criteria have lead to a primarily message-driven system interacting with an existing browser on the end users' systems.......The public-funded project "Indtal" ("Speak-it") has succeeded in developing a Danish voice-controlled utility for internet browsing targeting motor-handicapped users having difficulties using a standard keyboard and/or a standard mouse. The system underlies a number of a priori defined design...

  6. Issues in the Enumeration of Handicapping Conditions in the United States.

    Science.gov (United States)

    Martini, Linda; MacTurk, Robert H.

    1985-01-01

    The article identifies sources of prevalence and incidence rates for handicaps and disabilities, points out problems regarding obtaining this information, and examines reasons for the problems. Two measures are suggested: first, to set up a national directory of those health statistics already being collected; and second, to develop a nationwide…

  7. In Turkey, factors which urge physically handicapped sporters to start badminton sport and their expectations

    Directory of Open Access Journals (Sweden)

    Arslan Ersin

    2017-01-01

    Full Text Available The purpose of the study is to determine factors, which lead physically handicapped badminton players in Turkey to tend towards badminton sport, and expectations of sporters. 45 (Male: 29 Female: 16 physically handicapped sporters, who participated in Turkey Bandminton Championship for Physically Handicapped, which was arranged in Antalya on 24-26 February, 2017, from different cities, attended the study voluntarily. Developed by Sunay and his colluages [13], tendency to sports and expectation survey was used in badminton branch after expert opinions, firstly, were received and necessary regulations were made for using it in our study. In order to determine whether the difference between opinions of sporters, attending the study, according to their genders, their ages, their best sport degrees, their sport years, their parents’ educational backgrounds and jobs, is important or not, one-way analysis of variance was used. To identify resource of the difference, Duncan’s multiple range test was used. Kruskal Wallis H test was used when normality and homogeneity of variances were not provided. Value of p for comparisons was taken as 0,05. Consequently, it was determined that, in Turkey, effects of environment, friend-peer group and trainer on sporters playing at elite level as physically handicapped are high in starting badminton firstly while effects of sport complex, parents and siblings, mass media such as television and media organs on tendency to badminton are quite low. It was ascertained that liking badminton sport and delighting in earning success were effective as the reasons of physically handicappeds’ playing badminton sport and their expectations were, firstly, to be chosen for national team and to be national team sporters.

  8. Ethics of professional relations to functionally handicapped users

    Directory of Open Access Journals (Sweden)

    Mateja Griljc

    1999-01-01

    Full Text Available The basic purpose of 1ibrarianship code is to form and build librarian personality who can make possible the same opportunity to acquiring knowledge for all users, irrespective of their different demands or special needs.When we discuss the importance of building librarian personality the demanding work with users we confront the problem of ethical treatment very often. Ethics advises only general rules which are rarely simple and they are frequently opposite to each other.The process of reacting between the librarian and the user - as with general information needs as with special functional needs - is also dependent on librarian's professional relation which is formed on important elements such as professional qualification,experiences, creativeness and ethics.We are also interested in question where is the border between ethical and non - ethical action in key situations when the 1ibrarian meets functionally handicapped user. Opportunities for non - ethical reaction of professional workers are much more possible if the library's premises and the furniture don't offer suitable conditions for adaptable communication with the handicapped.But on the other side the 1ibrarian has just because of the bad arhitectural conditions better occasion to introduce himself as one of the best ethically formed personalies compared with other professions. With adaptable communication, creative work and with professional relation in offering help to disabled people, the librarian can contribute to more quality service and even more - he/she becomes an example to other professions - also in ethical sense.

  9. Training Teachers at a School for the Handicapped in Quezaltenango, Guatemala.

    Science.gov (United States)

    Lasky, Beth

    A 5 day course was developed to train teachers at the Instituto Neurologico (Guatemala), a day school for about 50 children (aged 3 to 16) considered to be learning handicapped and educationally or trainably retarded. The course addressed five topics (one each day): special education, class routines and schedules, classroom management, evaluating…

  10. Predictors of Self-Handicapping: An Examination of Personal and Contextual Factors.

    Science.gov (United States)

    Garcia, Teresa; And Others

    Evaluation is so paramount in students' lives that researchers have found that, for many students, one's self-worth is intricately tied to one's performance. Self-handicapping is a strategy that may be used to maintain one's self-worth. This anticipatory tactic typically involves the use of procrastination; by procrastinating, one clouds the…

  11. Testing a model of antecedents and consequences of defensive pessimism and self-handicapping in school physical education.

    Science.gov (United States)

    Ntoumanis, Nikos; Taylor, Ian M; Standage, Martyn

    2010-12-01

    There has been very limited research on the use of self-worth protection strategies in the achievement context of school physical education (PE). Thus the aim of the present study was to examine some antecedents and consequences of defensive pessimism and self-handicapping. The sample comprised 534 British pupils (275 females, 259 males) recruited from two schools who responded to established questionnaires. Results of structural equation modelling analysis indicated that self-handicapping and defensive pessimism were positively predicted by fear of failure and negatively predicted by competence valuation. In addition, defensive pessimism was negatively predicted by physical self-concept. In turn, defensive pessimism negatively predicted enjoyment in PE and intentions to participate in future optional PE programmes. Self-handicapping did not predict enjoyment or intentions. Results from multi-sample structural equation modelling showed the specified model to be largely invariant across males and females. The findings indicate that although both strategies aim to protect one's self-worth, some of their antecedents and consequences in PE may differ.

  12. Supporting for Visually Handicapped to Walk Around with RFID Technologies

    Directory of Open Access Journals (Sweden)

    Masayoshhi Asano

    2015-11-01

    Full Text Available Visually handicapped use their white cane to find obstacles. They follow tactile walking surface indicators to find routes and intersections. They use all sensory organs they can use to acquire the surrounding information. They match the surrounding information with routing information they have, to find their current location and target direction. However, even if tactile walking surface indicators are installed, it is difficult for them to visit unknown places because they have no correct routing information. When they go outside depending on tactile walking surface indicators, they have to follow them. They cannot plan their walking routes for themselves in unknown places. It is impossible for them to walk around various places such as shopping malls and station concourses as sighted persons, which is indispensable to enjoy their daily life. In this work, we propose a method which supports visually handicapped people to visit and walk around in their unknown places. We use RFID technologies to achieve voice navigation with the direction to their destination from their current location and their moving direction. To verify effectiveness of our system, we navigate blindfolded people experimentally. In the experiment, we have confirmed the success rate is 81 %.

  13. Strategic behaviour of institutional providers in mental handicapped care in the Netherlands

    NARCIS (Netherlands)

    van Harten, Willem H.; Veldhuis, Marleen J.M.; Hoeksma, Bernhard H.; Krabbendam, Johannes Jacobus

    2007-01-01

    Purpose – The purpose of this paper is to describe an inventory of the strategic responses of institutional providers of mental handicapped care to the strengthening of consumer choice through a personal care budget (PCB) Design/methodology/approach – Semi structured interviews were conducted among

  14. STATE ANXIETY, SUBJECTIVE IMBALANCE AND HANDICAP IN VESTIBULAR SCHWANNOMA

    Directory of Open Access Journals (Sweden)

    Yougan Saman

    2016-07-01

    Full Text Available ABSTRACTEvidence is emerging of a significant clinical and neuro-anatomical relationship between balance and anxiety. Research has suggested a potentially priming effect with anxiety symptoms predicting a worsening of balance function in patients with underlying balance dysfunction. We propose to show that a vestibular stimulus is responsible for an increase in state anxiety and there is a relationship between increased state anxiety and worsening balance function. Aims1.To quantify state anxiety following a vestibular stimulus in patients with a chronic vestibular deficit.2.To determine if state anxiety during a vestibular stimulus would correlate with the severity of chronic balance symptoms and handicap. MethodsTwo separate cohorts Vestibular Schwannoma (VS patients underwent vestibular tests (electronystagmography, cervical and ocular vestibular evoked myogenic potentials and caloric responses and questionnaire assessment (Vertigo handicap Questionnaire, Vertigo Symptom Scale, State Trait Anxiety InventoryFifteen post resection Vestibular schwannoma patients, with complete unilateral vestibular deafferentation, were assessed at a minimum of 6 months after surgery in Experiment 1 (Aim 1. Forty-five patients with VS in-situ and with preserved vestibular function formed the cohort for Experiment 2 (Aim 2. Experiment 1: VS subjects (N=15 with a complete post-resection unilateral vestibular deafferentation completed a State anxiety questionnaire before caloric assessment and again afterwards with the point of maximal vertigo as the reference (Aim 1. Experiment 2: State anxiety measured at the point of maximal vertigo following a caloric assessment was compared between two groups of presenting with balance symptoms (Group 1 N=26 and without balance symptoms (Group 2 N=11 (Aim 2. The presence of balance symptoms was defined as having a positive score on the VSS-VER.ResultsIn experiment 1, a significant difference (p<0.01 was found when comparing

  15. An Investigation into the Self-Handicapping Behaviors of Undergraduates in Terms of Academic Procrastination, the Locus of Control and Academic Success

    Science.gov (United States)

    Akça, Figen

    2012-01-01

    The aim of this study was to investigate the relationship between self-handicapping, academic procrastination, the locus of control and academic success. The aim was also to determine whether these variables predicted self-handicapping behavior. The population of the study consisted of 263 undergraduates studying in different departments of the…

  16. The Professional Education of Handicapped People in Moscow: Opportunities and Obstacles

    Science.gov (United States)

    Chadova, T. A.

    2014-01-01

    In Moscow, one priority area of urban social policy has focused on the formation of equal opportunities for handicapped people and those with impaired health in the process of their integration into all spheres of life and activity, including professional education. The year 2009 was declared to be the Year of Equal Opportunities. The…

  17. Adler's psychology (of use) today: personal history of traumatic life events as a self-handicapping strategy.

    Science.gov (United States)

    DeGree, C E; Snyder, C R

    1985-06-01

    We investigated the hypothesis that the reporting of a history of traumatic life events may serve as a strategy to control attributions about performance in an evaluative setting (i.e., self-handicapping). Following from Alfred Adler's early theorization in the psychology of use, as well as more recent theory and research on self-handicapping, we predicted that individuals would emphasize the adversity of events and experiences in their background when an uncertain evaluation was expected and when a traumatic background would serve as a suitable excuse for potential failure. Results generally supported the hypothesized self-protective reporting of traumatic life events.

  18. Fear of Failure, Self-Handicapping, and Negative Emotions in Response to Failure

    Science.gov (United States)

    Bartels, Jared M.; Herman, William E.

    2011-01-01

    Research suggests that students who fear failure are likely to utilize cognitive strategies such as self-handicapping that serve to perpetuate failure. Such devastating motivational dispositions clearly limit academic success. The present study examined negative emotional responses to scenarios involving academic failure among a sample of…

  19. Nutritional Needs of the Child with a Handicap or Chronic Illness. Manual II: Clinical Nutrition. Presentations from a National Interdisciplinary Symposium.

    Science.gov (United States)

    Ekvall, Shirley M.; Wheby, Elizabeth A.

    The following papers were presented at a symposium on clinical nutrition for the child who is chronically ill or handicapped: (1) "Food Allergy"; (2) "Anemia and the Chronically Ill or Handicapped Child"; (3) "Nutrition and Neurotransmitters--Clinical Implications"; (4) "The Importance of Lipid Type in the Diet after Burn Injury"; (5) "Advances of…

  20. Self-Handicapping Prior to Academic-Oriented Tasks in Children with Attention Deficit/Hyperactivity Disorder (ADHD): Medication Effects and Comparisons with Controls

    Science.gov (United States)

    Waschbusch, Daniel A.; Craig, Rebecca; Pelham, William E., Jr.; King, Sara

    2007-01-01

    The authors examined self-handicapping prior to academic-oriented tasks in children with and without ADHD and examined whether stimulant medication influenced self-handicapping. Participants were 61 children ages 6 to 13, including 22 children with ADHD tested after taking a placebo, 21 children with ADHD tested after taking stimulant medication,…

  1. The Effects of Incidental Teaching on the Generalized Use of Social Amenities at School by a Mildly Handicapped Adolescent

    OpenAIRE

    Oswald, L. K.; Lignugaris/Kraft, Benjamin; West, R.

    1990-01-01

    Recently, researchers have begun exploring the effects of incidental teaching on the acquisition of socially appropriate behavior by handicapped children and adults. The results of these investigations suggest that incidental teaching may facilitate the generalization of newly trained social skills. This study used incidental teaching procedures to teach a 16-year-old mildly handicapped student to use social amenities in a resource classroom. In addition, generalization was assessed to anothe...

  2. Feeding Management of a Child with a Handicap: A Guide for Professionals.

    Science.gov (United States)

    Smith, Mary Ann Harvey; And Others

    Intended for professionals from a variety of disciplines (such as nutrition, dentistry, nursing, occupational and physical therapy, speech pathology, social work, and education), the guide presents information on feeding problems of children with handicaps. Part I, which traces the development of feeding, considers in detail normal development and…

  3. Self-Modification Technique for the Control of Eating Behavior for the Visually Handicapped.

    Science.gov (United States)

    Snoy, Mary T.; van Benten, Letitia

    1978-01-01

    A ten-week study was done of four visually handicapped overweight adolescents (ages 15-19 years) in a residential school to evaluate the efficacy of an operant conditioning technique designed to promote weight loss by altering eating habits. (Author/DLS)

  4. Training Pragmatic Language Skills through Alternate Strategies with a Blind Multiply Handicapped Child.

    Science.gov (United States)

    Evans, C. J.; Johnson, C. J.

    1988-01-01

    A blind multiply handicapped preschooler was taught to respond appropriately to two adjacency pair types ("where question-answer" and "comment-acknowledgement"). The two alternative language acquisition strategies available to blind children were encouraged: echolalia to maintain communicative interactions and manual searching…

  5. The Placement Handbook. A Guide for the Competitive Employment of the Handicapped.

    Science.gov (United States)

    Horn, Adelaide; Drury, Stephen

    This handbook stresses those components that are considered peripheral to the placement process but that must precede the actual placement. The philosophy of placement upon which this guide is based appears first. Discussions follow of the basic components of the process of training and placement of handicapped individuals, including a varied…

  6. Revisiting play elements and self-handicapping in play: a comparative ethogram of five Old World monkey species.

    Science.gov (United States)

    Petrů, Milada; Spinka, Marek; Charvátová, Veronika; Lhota, Stanislav

    2009-08-01

    Play behavior has been viewed as a mixture of elements drawn from "serious" behavior, interspersed by ritualized play signals. Two other types of play behaviors have been overlooked: patterns that are dissimilar from any serious behavior and patterns with self-handicapping character, that is, those that put the animal into unnecessary disadvantageous positions or situations. Here the authors show that these 2 types of patterns can constitute a major part of play repertoire. From our own videorecordings and observations, we constructed play ethograms of 5 monkey species (Semnopithecus entellus, Erythrocebus patas, Chlorocebus pygerythrus, Cercopithecus neglectus, and Cercopithecus diana). The authors evaluated the self-handicapping character of each pattern and in Hanuman langurs also the (dis)similarity to serious behavior. Of the 74 patterns in the 5 species, 33 (45%) were judged to have a self-handicapping character. Of 48 patterns observed in langurs, 16 (33%) were totally dissimilar to any serious langur behavior known to us. The authors discuss the possibility that the different types of play elements may have different functions in play. Copyright 2009 APA, all rights reserved.

  7. Handicap discrimination considerations in treating the impaired worker: drugs, alcohol, pregnancy, and AIDS in the workplace.

    Science.gov (United States)

    Postol, L P

    1988-04-01

    In dealing with applicants and employees, administrators must comply with handicap and pregnancy discrimination statutes, any union collective bargaining agreement, and any state or local statutes specifically directed at protecting certain classes of handicapped persons. The employer must make reasonable accommodations which allow the disabled worker to perform the job, although the employer need not implement accommodations which are an undue hardship. Similarly, if the impaired employee cannot safely perform the essential functions of the job, he or she need not be hired or retained. Employers must also recognize their responsibilities and liability under their health benefit plans and other liability statutes, and attempt to minimize their exposure.

  8. Unanswered Questions on Educating Handicapped Children in Local Public Schools. Report to the Congress by the Comptroller General of the United States.

    Science.gov (United States)

    Comptroller General of the U.S., Washington, DC.

    The report by the General Accounting Office examines the status of education for handicapped children in 10 states. P.L. 94-142, the Education for All Handicapped Children Act, is reviewed briefly, and the states' compliance with the following aspects was assessed: eligibility criteria, individualized educational programs, and provision of a free…

  9. Designing Environments for Handicapped Children: A Design Guide and Case Study. First Edition.

    Science.gov (United States)

    Moore, Gary T.; And Others

    This guide addresses the planning and architectural design of play/learning environments for special needs children. The exceptional children discussed include those with most types of mild to severe handicaps and developmental disabilities. Specifically excluded from consideration are health impairments, severe psycho-emotional difficulties such…

  10. L’inclusion des personnes handicapées dans l’emploi : Le cas de l'Organisation européenne pour la recherche nucléaire (CERN)

    CERN Document Server

    Martínez-Cabañas Rodríguez, María

    2016-01-01

    Travail effectué dans le cadre d'un stage de recherche appliquée. Le mémoire tente de répondre aux questions suivantes: Quelles sont les différentes mesures prises au CERN pour permettre l'inclusion des personnes en situation de handicap? Quelles sont les principales barrières que les personnes en situation de handicap peuvent rencontrer au CERN au quotidien? Quelles mesures sont nécessaires pour que le CERN puisse atteindre l'inclusion des personnes en situation de handicap ? Le mémoire fait une revue de la literature sur le sujet y compris les textes internationaux. Il analyse la situation au CERN à travers une observation et des entreriens, et construit quelques pistes pour une meilleure inclusion des personnes en situation de handicap.

  11. Incapacidad vocal en docentes de la provincia de Huelva Voice handicap in Huelva's teachers

    Directory of Open Access Journals (Sweden)

    Francisco Javier Barbero-Díaz

    2010-03-01

    Full Text Available Introducción: La prevalencia de trastornos de la voz en docentes en nuestro entorno se sitúa entre el 34% y 57%. Desde el año 2006 la patología por nódulos de las cuerdas vocales se considera enfermedad profesional. El Índice de Incapacidad Vocal es una herramienta validada para valorar el menoscabo asociado a la disfonía que percibe la persona. Objetivos: Valorar el impacto de la disfonía y las posibles diferencias en la incapacidad vocal entre factores relacionados con la disfonía. Material y Métodos: Durante el examen de salud voluntario los docentes son interrogados sobre síntomas de disfonía y cumplimentan el Índice de Incapacidad Vocal. Resultados: Los docentes con incapacidad moderada y severa representan el 16,6% y 1,2% respectivamente. Un 50,9% han presentado síntomas de disfonía en algún momento de su vida laboral. Se encuentran diferencias significativas en la incapacidad vocal según el diagnostico de nódulos de cuerdas vocales, la presencia de síntomas y el número de síntomas. Conclusiones: la disfonía supone un importante impacto en la población estudiada. El diagnostico de nódulos de cuerdas vocales, la presencia de síntomas y el número de síntomas de disfonía conllevan diferencias al valorar el menoscabo. No es posible realizar la extrapolación.Introduction: The prevalence of voice disorders in teachers in our environment is between 34% and 57%. Since 2006, the pathology of vocal cord nodules is considered an occupational disease. Vocal Handicap Index is a validated tool to assess the impairment associated with the perceived dysphonia. Objectives: To assess the impact of dysphonia and the possible differences in the vocal disability in function of dysphonia-related factors in teachers. Methods: During the exam of health, volunteer teachers are interviewed about symptoms of dysphonia and complete the Vocal Handicap Index. Results: Teachers with moderate and severe disability represent 16.6% and 1

  12. Electromyography-Guided Botulinum Toxin Injection Into the Cricothyroid Muscles in Bilateral Vocal Fold Abductor Paralysis.

    Science.gov (United States)

    Sahin, Mustafa; Aydogdu, Ibrahim; Akyildiz, Serdar; Erdinc, Munevver; Ozturk, Kerem; Ogut, Fatih

    2017-06-01

    Bilateral vocal fold abductor paralysis (BVFAP) both deteriorates quality of life and may cause life-threatening respiratory problems. The aim of this study was to reduce respiratory symptoms in BVFAP patients using cricothyroid (CT) botulinum toxin (BTX) injection. Before and 2 weeks and 4 months after bilateral BTX injection into the CT muscles under electromyography; alterations in respiratory, acoustic, aerodynamic and quality of life parameters were evaluated in BVFAP patients with respiratory distress. For the respiratory evaluation modified Borg scale and spirometry, for the voice and aerodynamic evaluations Voice Handicap Index-30 (VHI-30), GRBAS, acoustic analysis (sound pressure level, F0, jitter%, shimmer%, noise-to-harmonic ratio) and maximum phonation time and for the quality of life assessment Short Form-36 (SF-36) form were used. All patients were female with a mean age of 47±8.1 years. There was a mean time of 11.8±5.5 (minimum 2, maximum 23) months between BVFAP development and BTX injection. In all cases, other than one case with unknown aetiology, the cause of vocal fold paralysis was prior thyroid surgery. In total 18.6±3.1 units of BTX were applied to the CTs. In the preinjection period, and the 2nd week and 4th month after injection, the Borg dyspnea scale was 7.3/5.3/5.0, FIV1 (forced inspiratory volume in one second) was 1.7/1.7/1.8 L, peak expiratory flow (PEF) was 1.4/1.7/2.1 L/sec, maximum phonation time was 7.0/6.4/6.2 seconds and VHI-30 was 63.2/52.2/61.7 respectively. There was no significant alteration in acoustic analysis parameters. Many of the patients reported transient dysphagia within the first week. There were insignificant increases in SF-36 sub-scale values. After BTX injection, improvements in the mean Borg score, PEF and FIV1 values and SF-36 sub-scale scores showed the restricted success of this approach. This modality may be kept in mind as a transient treatment option for patients refused persistent tracheotomy or

  13. CT of the infants and children with mental and/or physical handicaps

    International Nuclear Information System (INIS)

    Okada, Junichiro; Takeuchi, Kazuo

    1980-01-01

    Computed tomography (CT) was performed on 47 children and adolescents with mental and/or physical handicaps. Of these series, 22 cases of morphological change were noted. Another 25 cases showed no overt CT abnormality. These 47 cases were divided into three groups in the following manner. Group 1, with no CT abnormality; Group 2, with ventricular dilatation and/or cerebral atrophy, and Group 3, with a major morphological anomaly of the brain. Group 1 (25 cases) showed a marked dissociation between the CT findings and the IQ. EEG showed normal findings in two cases, diffuse abnormality in 5 cases, and focal abnormality in 9 cases. This group alone included 8 cases of athetosis. Group 2 (14 cases). Seven cases of EEG showed diffuse abnormality in 3 cases and focal abnormality in 4 cases. So-called cerebral palsy was noted in 11 cases. Group 3 (8 cases). This group included cases of hemihydranencephaly, porencephaly, agenesis of the corpus callosum, and arachnoid cyst. The mean and standard deviations of the IQ's in the groups are 57.1 +- 21.6, 65.2 +- 20.5, and 72.0 +- 8.0. That is, an inverted correlation between the CT abnormality and the IQ was noted. CT is a noninvasive study and a reasonable method of investigation for mentally handicapped children. DeMyer gave three categories of cerebral malformation: cytogenetic malformations, organogenetic disorders, and histogenetic disorders. On the other hand, EEG aimed at evaluating cerebral function and CT undertaken for morphological evaluation reveal no intimate correlation with one another. Rather, these two procedures each have their one value for the evaluation of the function and the structure of the brain. Mentally and/or physically handicapped patients without any overt cerebral anomaly have been found to be as follows: Murobushi, 12.29%; Malamud, 34%; Gross, 15.8%; Benda, 15%, and Hamada, 45.4%. (author)

  14. Relationships between Competitive Anxiety, Social Support and Self-Handicapping in Youth Sport

    Science.gov (United States)

    Wezyk, Agata

    2011-01-01

    Study aim: To assess the level of self-handicapping tendency, competitive anxiety (trait) and social support within groups of young male and female athletes, as well as to determine the relationships between those variables. Material and methods: A group of 75 athletes (46 male football players and 29 female volleyball players) from Sport Mastery…

  15. Out-of-Level Testing for Special Education Students with Mild Learning Handicaps.

    Science.gov (United States)

    Jones, Eric D.; And Others

    The purpose of this study was to evaluate the utility of out-of-level testing (OLT) when it is applied to the assessment of special education students with mild learning handicaps. This evaluation of OLT involved testing hypotheses related to: (1) the adequacy of vertical scaling, (2) the reliability and (3) the validity of OLT scores. Fifty-eight…

  16. Investigating the Relationship between Self-Handicapping Tendencies, Self-Esteem and Cognitive Distortions

    Science.gov (United States)

    Yavuzer, Yasemin

    2015-01-01

    The purpose of this study is to examine the relationship between cognitive distortions, self-handicapping tendencies, and self-esteem in a sample of students studying in a school of education. The sample of the study was comprised of 507 volunteer students chosen through random sampling from a total of 4,720 students who were studying teaching at…

  17. [Transcultural adaptation of an instrument to evaluate hearing handicap in workers with noise-induced hearing loss].

    Science.gov (United States)

    Holanda, Wanessa Tenório Gonçalves; de Lima, Maria Luiza Carvalho; Figueiroa, José Natal

    2011-01-01

    The noise-induced hearing loss (NIHL) is a chronic and irreversible disease resulting of the exposure to noise in high levels at work. Even in the beginning, this hearing loss can damage in many degrees the worker's quality of life. Before this study, there wasn't an instrument, in Portuguese, to evaluate the psychosocial disadvantages of workers with NIHL. The aim of this research was to make a transcultural adaptation of an especific instrument to evaluate the hearing handicap from the original language to Portuguese, and check the reliability and legitimacy. The selected instrument passed by a process of semantic equivalence that was conducted in five stages: translation, back translation, critical appraisal of the versions, pre-test and a final review by a multi-professional group to develop a consensual version of the instrument for current use in Brazil. The instrument called "Inabilities Scale and Hearing Handicap" had, in general, acceptable psychometric measures, considering the little size of the sample and the fact that workers' hearing loss weren't too significant. Therefore, the Portuguese version of this instrument needs to be further tested in a representative sample of Brazilian workers with NIHL to ratify its utility in order to evaluate hearing handicap in this population.

  18. Self-Handicapping and Irrational Beliefs about Approval in a Sample of Teacher Candidates

    Science.gov (United States)

    Kaya, Çinar; Ugur, Erol; Sar, Ali Haydar; Ercengiz, Mustafa

    2017-01-01

    The main objective of the current study is to examine the relationships between self-handicapping, and irrational beliefs about approval, irrational beliefs about interpersonal relationships, irrational beliefs about self and the overall level of irrational beliefs by reference to the " ABC " framework. Participants of the study were 263…

  19. Are anthropometric, flexibility, muscular strength, and endurance variables related to clubhead velocity in low- and high-handicap golfers?

    Science.gov (United States)

    Keogh, Justin W L; Marnewick, Michel C; Maulder, Peter S; Nortje, Jacques P; Hume, Patria A; Bradshaw, Elizabeth J

    2009-09-01

    The present study assessed the anthropometric profile (International Society for the Advancement of Kinanthropometry protocol), flexibility, muscular strength, and endurance of 20 male golfers. These data were collected in order to determine: a) the relationship between these kinanthropometric measures and clubhead velocity; and b) if these measures could distinguish low-handicap (LHG) and high-handicap (HHG) golfers. Ten LHG (handicap of 0.3 +/- 0.5) and 10 HHG (handicap of 20.3 +/- 2.4) performed 10 swings for maximum velocity and accuracy with their own 5-iron golf club at a wall-mounted target. LHG hit the target significantly more (115%) and had a 12% faster clubhead velocity than HHG (p bench press strength and longer (5%) upper am and total arm (4%) length and less (24%) right hip internal rotation than HHG (0.01 velocity (p bench press and hack squat strength as well as upper arm and total arm length also approaching significance (0.01 bench press strength and longer arms may therefore be at a competitive advantage, as these characteristics allow the production of greater clubhead velocity and resulting ball displacement. Such results have implications for golf talent identification programs and for the prescription and monitoring of golf conditioning programs. While golf conditioning programs may have many aims, specific trunk rotation exercises need to be included if increased clubhead velocity is the goal. Muscular hypertrophy development may not need to be emphasized as it could reduce golf performance by limiting range of motion and/or increasing moment of inertia.

  20. [Sport as integration factor of the physically handicapped in our society].

    Science.gov (United States)

    Labronici, R H; Cunha, M C; Oliveira, A D; Gabbai, A A

    2000-12-01

    The objective of this study was to make use of sports as a rehabilitation method, as well as to assess the physical, psychological, and social aspects of those present some physical handicap, particularly those who have some kind of chronic disease and are no longer taking part in any rehabilitation program. Thirty handicapped people were evaluated: fifteen started with basketball and fifteen with swimming, according either to the specific preference of each one of them or to the degree and kind of physical impairment. They were submmited to the following evaluations: clinical examination, physiotherapy assessment, social interview and use of the Rivermead Social Scale, functional classification of the sport, use of the Barthel and Rivermead Functional Scales, and the psychological profile test (POMS). After two years, no relevant change in the moving evolution of the athletes were reported. Concerning the POMS psychological test, both basketball and swimming groups presented with high vigor and low depression levels. Considering the social aspects, both groups presented substantial improvement, specially regarding their relationship to one person or more people and also in the everyday activities (be it social, leisure, or domestic), thus leading them to better social integration. This essay shows that sport can bring people who are physically impaired a better social integration and physical conditions.

  1. Education of the handicapped child: Status, trend, and issues related to electronic delivery

    Science.gov (United States)

    Rothenberg, D.

    1973-01-01

    This study is part of a broader investigation of the role of large-scale educational telecommunications systems. Thus, data are analyzed and trends and issues discussed to provide information useful to the systems designer who wishes to identify and assess the opportunities for large-scale electronic delivery of education for the handicapped.

  2. Evaluation of The Effectiveness of Assertiveness Training for Physically Handicapped Adults on Body Image, Self-Esteem and Attitudes Directed to Themselves

    OpenAIRE

    Keser, İlkay; Ünsal Barlas, Gül

    2015-01-01

    Objective: To evaluate the effectiveness of assertiveness training for physically handicapped adolescents on the self-esteem and assertiveness ability. Method: The study sample consisted of 60 physically handicapped adolescents (30 study and 30 control groups) attending to Private Training and Rehabilitation Centers in Antalya Province. In the study, pre-test and post-test measurement methods were used to test the effectiveness of the assertiveness training program in both study group and con...

  3. Do You Know a Child with a Handicap? Children with Handicaps Have a Right to an Education [and] Do You Know Someone with a Handicap? Individuals with Handicaps Have a Right to an Education = Conoce Usted a un Nino que Tiene Alguna Desventaja? Los Ninos con Desventajas Tienen Derecho a Recibir Educacion [and] Conoce Usted Alguna Persona que Tenga Alguna Desventaja? Las Personas que Tienen Desventajas Tienen Derecho a Recibir Educacion.

    Science.gov (United States)

    California State Dept. of Education, Sacramento. Div. of Special Education.

    Two advertisements and two brochures for the California Search and Serve program are presented in this excerpt from the California Search and Serve "Search Guidelines and Resource Manual." The materials are designed to promote community involvement in the identification of handicapped persons, from birth through age 21, so that they may…

  4. Nursing-care dependency : Development of an assessment scale for demented and mentally handicapped patients

    NARCIS (Netherlands)

    Dijkstra, Ate; Buist, Girbe; Dassen, T

    1996-01-01

    This article describing the first phase in the development of an assessment scale of nursing-care dependency (NCD) for Dutch demented and mentally handicapped patients focuses on the background to the study and the content validation of the nursing-care dependency scale. The scale aims to

  5. Reevaluation of the Amsterdam Inventory for Auditory Disability and Handicap Using Item Response Theory

    Science.gov (United States)

    Hospers, J. Mirjam Boeschen; Smits, Niels; Smits, Cas; Stam, Mariska; Terwee, Caroline B.; Kramer, Sophia E.

    2016-01-01

    Purpose: We reevaluated the psychometric properties of the Amsterdam Inventory for Auditory Disability and Handicap (AIADH; Kramer, Kapteyn, Festen, & Tobi, 1995) using item response theory. Item response theory describes item functioning along an ability continuum. Method: Cross-sectional data from 2,352 adults with and without hearing…

  6. Treatment or Involuntary Euthanasia for Severely Handicapped Newborns: Issues of Philosophy and Public Policy.

    Science.gov (United States)

    Powell, T. Hennessy; And Others

    1982-01-01

    Recent reports have indicated that parents and/or physicians occasionally decide not to provide life-sustaining treatment (referred to as involuntary euthanasia), thus ensuring that the severely handicapped newborn will die. The issues involved relative to treatment or involuntary euthanasia are reviewed from two opposing perspectives…

  7. Discussion of the dizziness handicap inventory.

    Science.gov (United States)

    Mutlu, Basak; Serbetcioglu, Bulent

    2013-01-01

    A review of the Dizziness Handicap Inventory (DHI). NUMBER OF STUDIES: Seventy-four studies. Articles published between January 1990 and May 2012 were identified by searches in PubMed electronic database. Of the 227 articles meeting the inclusion criteria 74 were reviewed. These articles are discussed under nine topics; Reliability, validity and internal consistency of the original version of DHI, relationship between vestibular/balance tests and DHI, association between DHI and the other scales related to balance impairments, exploratory factor analysis of the DHI, screening version of DHI, translations of DHI into other languages, the role of DHI to assess the success of the treatment of balance disorder, DHI results in various vestibular disorders, general characteristics of DHI in patients with balance impairment. Self reported measures represent unique pieces of the information important for the management of dizzy patients. DHI is the most widely used self reported measurement of patients with dizziness. It has been translated into fourteen languages, so it is widely accepted.

  8. Depressive self-presentation: beyond self-handicapping.

    Science.gov (United States)

    Weary, G; Williams, J P

    1990-05-01

    An experiment was conducted to examine the notion that depressives' responses would reflect a protective self-presentation style (Hill, Weary, & Williams, 1986), the underlying goal of which would be the avoidance of future performance demands and potential losses in self-esteem. In this study, depressed and nondepressed Ss were asked to perform a relatively simple visual-motor task. Half of the depressed and half of the nondepressed Ss were told that if they were successful at the task, they would be asked to perform a 2nd, similar task. The remaining Ss were given no such expectation of future performance. We predicted and found that depressed compared with nondepressed Ss strategically failed at the task when presented with the possibility of future performance and further losses in esteem. Moreover, this strategic failure was associated with some costs; depressed-future performance expectancy Ss experienced more discomfort or negative affect as a result of their performance. The relationship between this depressive self-presentation and self-handicapping strategies is discussed.

  9. On the self-serving function of social anxiety: shyness as a self-handicapping strategy.

    Science.gov (United States)

    Snyder, C R; Smith, T W; Augelli, R W; Ingram, R E

    1985-04-01

    We tested the hypothesis that socially anxious or shy individuals use their anxiety symptoms as a strategy to control attributions made about their performances in social-evaluative settings (i.e., self-handicapping strategies). Specifically, we predicted that trait-socially anxious or shy persons would report more symptoms of social anxiety in an evaluative setting in which anxiety or shyness could serve as an excuse for poor performance than would individuals in (a) an evaluative setting in which shyness was precluded as an excuse or (b) a nonevaluative setting. Furthermore, we predicted that this self-protective pattern of symptom reporting would not occur for individuals who were not trait-socially anxious because these persons would not commonly use such symptoms as a self-handicapping strategy. Results supported these predictions for male subjects, but not for female subjects. Sex differences in the strategic use of shyness are discussed in relation to other research on sex differences in the etiology and correlates of social anxiety.

  10. Mobility of people and goods in the urban environment: mobility of the handicapped and elderly. Second year final report. [Methodology

    Energy Technology Data Exchange (ETDEWEB)

    Falcocchio, J.; Santimataneedol, S.; Horwitz, L.; Stephanis, B.

    1976-09-01

    An evaluation methodology for the analysis of alternative transportation improvements for the handicapped and elderly is proposed. The approach is based on the ability to incorporate the qualitative attributes of transportation systems which are particularly significant to the handicapped and elderly groups. These attributes include comfort and convenience, security and safety, and accessibility. In addition, this study addresses the issues of demonstration projects planning and offers guidelines for the design of demonstration experiments which can produce results that are capable of objective analytical interpretation.

  11. Identification of Aurally Handicapped Children and Methods and Procedures of Developing a Program.

    Science.gov (United States)

    Colorado State Dept. of Education, Denver. Div. of Special Education Services.

    An article on identification of preschool and school age aurally handicapped children and program development by John J. O'Neill precedes discussions of the role of the audiologist in evaluation of these children by Jack A. Willeford, and educational aspects of planning by John J. O'Neill. Three articles are presented on the role of the teacher in…

  12. Relating the Capabilities of the Handicapped to the Human Attribute Requirements of Jobs: Appendixes.

    Science.gov (United States)

    Ohio State Univ., Columbus. National Center for Research in Vocational Education.

    Twenty-five appendixes from a study attempting to match capabilities of the handicapped to the human attribute requirements of three jobs (general secretary, automotive mechanic, and business data programmer) are presented. Appendixes include information on such topics as data analysis for identification of key tasks; job descriptions for the…

  13. Pots and Pans Activities for Parent and Child: Activities for Preschool Multiple Handicapped Children.

    Science.gov (United States)

    Van Tassel, Jean

    Intended for parents and teachers of multiply handicapped preschool children, the booklet provides lesson plans in three major areas--basic concepts, motor activities, and language activities. Each lesson plan is broken down into four parts: purpose (a descriptive statement of what the lesson hopes to accomplish), materials (list of materials…

  14. Arte en la Clase para Personas Incapacitadas (Art in the Classroom for Handicapped Persons).

    Science.gov (United States)

    National Committee, Arts for the Handicapped, Washington, DC.

    The Spanish translation contains a collection of arts strategies intended to stimulate, motivate, and teach basic skills to handicapped children. The lessons involve one or more of the basic art forms (movement, music, drama, and art) and are further divided into five levels of aesthetic development: awareness, imitation, self-initiation, skill…

  15. The music therapy of an anorectic mentally handicapped adult.

    Science.gov (United States)

    Heal, M; O'Hara, J

    1993-03-01

    Where words fail, music may be a medium through which to explore one's inner world and experiences. Psychodynamic approaches have helped us to understand what it means to be handicapped (e.g. Sinason, 1992). The subtleties of diagnosing anorexia nervosa have recently been recognized in this group (e.g. Cottrell & Crisp, 1984). Music therapy has been used with clients of normal intelligence who have eating disorders (Nolan, 1989; Sloboda, 1993; Smeijsters & van den Hurk 1993). This article illustrates the music therapy of a woman with Down's syndrome (IQ = 50) and anorexia nervosa. It describes her management and progress in music therapy in relation to her external world and anorectic behaviours.

  16. Ablative dual-phase Erbium:YAG laser treatment of atrophy-related vaginal symptoms in post-menopausal breast cancer survivors omitting hormonal treatment.

    Science.gov (United States)

    Mothes, A R; Runnebaum, M; Runnebaum, I B

    2018-05-01

    First evaluation of dual-phase vaginal Er:YAG laser to omit hormonal treatment for atrophy-related symptoms in post-menopausal breast cancer survivors following prolapse surgery. Patients with a history of breast cancer at the time of surgery for pelvic organ prolapse were offered non-hormonal vaginal Er:YAG laser treatment when complaining of atrophy-related genitourinary syndrome of menopause. A single 10-min course of dual-phase protocol of pulsed Er:YAG laser (2940 nm, fractional ablative and thermal mode, fluence according to tissue thickness). Follow-up included subjective satisfaction, vaginal pH, vaginal health index (VHI), and complications after 6 weeks. A total of 16 breast cancer survivors (age 71 years, SD 7) had been seeking treatment for pelvic floor symptoms related to vaginal atrophy at follow-up visits after prolapse surgery. All ablative vaginal Er:YAG laser outpatient procedures were successfully completed, all patients returned to daily activities without a need for analgetic medication. Evaluation was performed after 8.3 (SD 2.5) weeks. Pre-laser VHI scored 16 (SD 4.6) and post-laser VHI 20 (SD 3) with p = 0.01. Patients were satisfied in 94% (n = 15) regarding symptom relief. Breast cancer survivors with atrophy-related complaints after pelvic floor surgery may benefit from vaginal application of this innovative dual protocol of Er:YAG laser technology as a non-hormonal treatment approach.

  17. The role of juvenile hormone in immune function and pheromone production trade-offs: a test of the immunocompetence handicap principle.

    Science.gov (United States)

    Rantala, Markus J; Vainikka, Anssi; Kortet, Raine

    2003-01-01

    The immunocompetence handicap hypothesis postulates that secondary sexual traits are honest signals of mate quality because the hormones (e.g. testosterone) needed to develop secondary sexual traits have immunosuppressive effects. The best support for predictions arising from the immunocompetence handicap hypothesis so far comes from studies of insects, although they lack male-specific hormones such as testosterone. In our previous studies, we found that female mealworm beetles prefer pheromones of immunocompetent males. Here, we tested how juvenile hormone (JH) affects male investment in secondary sexual characteristics and immune functions in the mealworm beetle, Tenebrio molitor. We injected male mealworm beetles with JH (type III) and found that injection increased the attractiveness of male pheromones but simultaneously suppressed immune functions (phenoloxidase activity and encapsulation). Our results suggest that JH, which is involved in the control of reproduction and morphogenesis, also plays a central role in the regulation of a trade-off between the immune system and sexual advertisement in insects. Thus, the results reflect a general mechanism by which the immunocompetence handicap hypothesis may work in insects. PMID:14613612

  18. Risk identification of agricultural drought for sustainable Agroecosystems

    Science.gov (United States)

    Dalezios, N. R.; Blanta, A.; Spyropoulos, N. V.; Tarquis, A. M.

    2014-09-01

    Drought is considered as one of the major natural hazards with a significant impact on agriculture, environment, society and economy. Droughts affect sustainability of agriculture and may result in environmental degradation of a region, which is one of the factors contributing to the vulnerability of agriculture. This paper addresses agrometeorological or agricultural drought within the risk management framework. Risk management consists of risk assessment, as well as a feedback on the adopted risk reduction measures. And risk assessment comprises three distinct steps, namely risk identification, risk estimation and risk evaluation. This paper deals with risk identification of agricultural drought, which involves drought quantification and monitoring, as well as statistical inference. For the quantitative assessment of agricultural drought, as well as the computation of spatiotemporal features, one of the most reliable and widely used indices is applied, namely the vegetation health index (VHI). The computation of VHI is based on satellite data of temperature and the normalized difference vegetation index (NDVI). The spatiotemporal features of drought, which are extracted from VHI, are areal extent, onset and end time, duration and severity. In this paper, a 20-year (1981-2001) time series of the National Oceanic and Atmospheric Administration/advanced very high resolution radiometer (NOAA/AVHRR) satellite data is used, where monthly images of VHI are extracted. Application is implemented in Thessaly, which is the major agricultural drought-prone region of Greece, characterized by vulnerable agriculture. The results show that agricultural drought appears every year during the warm season in the region. The severity of drought is increasing from mild to extreme throughout the warm season, with peaks appearing in the summer. Similarly, the areal extent of drought is also increasing during the warm season, whereas the number of extreme drought pixels is much less than

  19. Effectiveness of Meta-Cognitive Skills Training on Self-Handicapping and Self-Efficacy of Students

    Directory of Open Access Journals (Sweden)

    Shahrbanou Javidan

    2018-03-01

    Discussion: Findings of the present study suggest that meta-cognitive skills training- as an effective training program- could be used for decreasing students’ self-handicapping. But with regards to the effectiveness of meta-cognitive skills training on self-efficacy, it is revealed that more variables are involved, and it needs further investigation.

  20. The effect of spiritual intelligence instruction on the increasing spiritual intelligence and two components in Maybod adult physical handicaps

    Directory of Open Access Journals (Sweden)

    L Movahedi

    2017-01-01

    Full Text Available Abstract The purpose of this research was the effect of spiritual intelligence instruction on increasing spiritual intelligence’s Maybod adult handicaps in 2014. 28 female and male (7 men and 21 women adult handicaps participated in this research which was as done pretest quasi – experimental – intervention studing with control group. These people were chosen as purposeful sampling and set in two experimental and control group in equal numbers. After fulfilling pretest, two group were compared by T test and after ensuring of absence of significant difference between two group, In ten session (90 minutes, the experimental group were been taught spiritual intelligence and the control group didn’t have any teaching. Befor and after session, these two groups were been complete Abdollahzade spiritual intelligence test. The analysis of data did on one way covariance statistical analysis. The results showed the experimental group got significantly high scores in regard to control group of general spiritual intelligence, the underestsnding of the relation to universe sourceand spiritual life in emphasis of internal core. Regarding to findings, it results the spiritual intelligence instruction can on increase spiritual intelligence of handicaps.

  1. Assessment of Object Permanence in Severely Handicapped Students as a Function of Motor and Prompting Variables.

    Science.gov (United States)

    Ilmer, Steven; And Others

    1981-01-01

    The study assessed object permanence construct performance in 20 severely handicapped students (4 to 14 years old) who were differentiated by treatment (prompt) condition and motor ability level. Results revealed a trait (motor ability) x treatment interaction. (Author/SB)

  2. Evaluating Post-School Transition of Secondary Students with Moderate to Severe Handicaps. Final Report.

    Science.gov (United States)

    Bruininks, Robert H.; Thurlow, Martha L.

    The final report describes a 3-year project which had four primary objectives: (1) development of a followup system feasible for schools to use to obtain information on individuals with handicaps who leave school; (2) data collection on three special education samples; (3) data analysis to evaluate long-term effects of secondary programs and…

  3. An Approximation of an Instructional Model for Developing Home Living Skills in Severely Handicapped Students.

    Science.gov (United States)

    Hamre, S.

    The author discusses the need for severely handicapped students to acquire basic home living skills, reviews task analysis principles, and provides sample instructional programs. Listed are basic grooming, dressing, domestic maintenance, and cooking skills. A sample task analysis procedure is demonstrated for the skill of brushing teeth. Reported…

  4. Mental and Behavioral Symptoms of Person's with Asperger's Syndrome: Relationships with Social Isolation and Handicaps

    Science.gov (United States)

    Tani, Masayuki; Kanai, Chieko; Ota, Haruhisa; Yamada, Takashi; Watanabe, Hiromi; Yokoi, Hideki; Takayama, Yuko; Ono, Taisei; Hashimoto, Ryuichiro; Kato, Nobumasa; Iwanami, Akira

    2012-01-01

    People with Asperger's syndrome (AS) experience mental comorbidities, and behavioral symptoms that can deepen social isolation and handicaps. We compared the frequency of mental and behavioral symptoms, motor abnormality, and life history between adults with AS and those with no mental disorders but with disturbance of social functions and…

  5. Attending Behavior: Commonalities and Differences Among Educable Retarded, Learning Disabled, and Emotionally Handicapped Juvenile Delinquents.

    Science.gov (United States)

    Hill, Nancy C.; And Others

    The study investigated three variables--juvenile delinquency, academic achievement, and attention span--with 77 incarcerated juveniles [18 emotionally handicapped (EH), 20 learning disabled (LD), 19 educable mentally retarded (EMR), and 20 nonidentified]. The Detroit Tests of Learning Aptitude were used for testing in the areas of visual and…

  6. Comparison of cepstral coefficients to other voice evaluation parameters in patients with occupational dysphonia

    Directory of Open Access Journals (Sweden)

    Ewa Niebudek-Bogusz

    2013-12-01

    Full Text Available Background: Special consideration has recently been given to cepstral analysis with mel-frequency cepstral coefficients (MFCCs. The aim of this study was to assess the applicability of MFCCs in acoustic analysis for diagnosing occupational dysphonia in comparison to subjective and objective parameters of voice evaluation. Materials and Methods: The study comprised 2 groups, one of 55 female teachers (mean age: 45 years with occupational dysphonia confirmed by videostroboscopy and 40 female controls with normal voice (mean age: 43 years. The acoustic samples involving sustained vowels "a" and four standardized sentences were analyzed by computed analysis of MFCCs. The results were compared to acoustic parameters of jitter and shimmer groups, noise to harmonic ratio, Yanagihara index evaluating the grade of hoarseness, the aerodynamic parameter: maximum phonation time and also subjective parameters: GRBAS perceptual scale and Voice Handicap Index (VHI. Results: The compared results revealed differences between the study and control groups, significant for MFCC2, MFCC3, MFCC5, MFCC6, MFCC8, MFCC10, particularly for MFCC6 (p < 0.001 and MFCC8 (p < 0.009, which may suggest their clinical applicability. In the study group, MFCC4, MFCC8 and MFCC10 correlated significantly with the major objective parameters of voice assessment. Moreover, MFCC8 coefficient, which in the female teachers correlated with all eight objective parameters, also showed the significant relation with perceptual voice feature A (asthenity of subjective scale GRBAS, characteristic of weak tired voice. Conclusions: The cepstral analysis with mel frequency cepstral coefficients is a promising tool for evaluating occupational voice disorders, capable of reflecting the perceptual voice features better than other methods of acoustic analysis. Med Pr 2013;64(6:805–816

  7. Paradox, reprimand and extinction in adults with mental handicap.

    Science.gov (United States)

    Wood, V E; Chamove, A S

    1991-08-01

    To assess the efficacy of paradoxical directives, levels of challenging behaviour during 2 weeks of paradox, reprimand and extinction were compared with baseline levels in four adults with mental handicaps attending a day centre. Paradox was the most effective procedure for reducing the frequency and severity of challenging behaviour by an average of over 70% by the end of 2 weeks and up to 90% in certain subjects; extinction was least effective. Paradox was most effective with more defiant subjects, when staff rated treatment success as low, when improvement using extinction and reprimand was poorest, and in reducing aggressive behaviour. The present authors suggest the overjustification effect offers an explanation for the effects of paradox.

  8. Infanticide for handicapped infants: sometimes it's a metaphysical dispute.

    Science.gov (United States)

    Long, T A

    1988-01-01

    Since 1973 the practice of infanticide for some severely handicapped newborns has been receiving more open discussion and defence in the literature on medical ethics. A recent and important argument for the permissibility of infanticide relies crucially on a particular concept of personhood that excludes the theological. This paper attempts to show that the dispute between the proponents of infanticide and their religious opponents cannot be resolved because one side's perspective on the infant is shaped by a metaphysics that is emphatically rejected by the other. In such a situation philosophical argument is powerless to bring about a resolution because there can be no refutation of one side by the other. PMID:2969052

  9. Den inre och yttre självkänslans betydelse för tendensen att bruka self-handicapping

    OpenAIRE

    Ottosson, Olivia

    2008-01-01

    Självkänsla är något vi ständigt bär med oss och den inverkar på vårt agerande samt våra val i livet. Johnson (2003) delar in självkänslan i två delar den inre och yttre, vilka kan kombineras till fyra personligheter. Forskning har visat att självkänslan samvarierar med tendensen till att bruka self-handicapping. Self-handicapping innebär att människan skapar hinder för sig själv påhittade eller verkliga. Etthundrasju studenter fyllde i en enkät bestående av 58 påståenden, vilken mätte inre, ...

  10. Predictors of Academic Self-Handicapping and Achievement: Examining Achievement Goals, Classroom Goal Structures, and Culture

    Science.gov (United States)

    Urdan, Tim

    2004-01-01

    The purposes of this study were to examine the predictors and achievement consequences of academic self-handicapping and to explore cultural variations in the pursuit and effects of performance goals and perceived classroom performance goal structures. Data were collected in 2 consecutive academic years from a diverse sample of high school…

  11. The History of Care for the Low-Incident Handicapped in the Territory of Guam: Is There a Necessary Development Change in the Delivery of Special Education Services?

    Science.gov (United States)

    Peckens, Gloria

    A brief history of care for handicapped individuals on Guam is traced from early refusal to acknowledge their existence, to their increased visibility and current efforts toward least restrictive placement for education and care. It is explained that societal attitudes toward the handicapped in Guam are characterized by pity, neglect and repulsion…

  12. Academic Self-Handicapping: Relationships with Learning Specific and General Self-Perceptions and Academic Performance over Time

    Science.gov (United States)

    Gadbois, Shannon A.; Sturgeon, Ryan D.

    2011-01-01

    Background: Academic self-handicapping (ASH) tendencies, strategies students employ that increase their chances of failure on assessments while protecting self-esteem, are correlated with classroom goal structures and to learners' general self-perceptions and learning strategies. In particular, greater ASH is related to poorer academic performance…

  13. Evaluation of CMIP5 continental precipitation simulations relative to satellite-based gauge-adjusted observations

    Science.gov (United States)

    Mehran, A.; AghaKouchak, A.; Phillips, T. J.

    2014-02-01

    The objective of this study is to cross-validate 34 Coupled Model Intercomparison Project Phase 5 (CMIP5) historical simulations of precipitation against the Global Precipitation Climatology Project (GPCP) data, quantifying model pattern discrepancies, and biases for both entire distributions and their upper tails. The results of the volumetric hit index (VHI) analysis of the total monthly precipitation amounts show that most CMIP5 simulations are in good agreement with GPCP patterns in many areas but that their replication of observed precipitation over arid regions and certain subcontinental regions (e.g., northern Eurasia, eastern Russia, and central Australia) is problematical. Overall, the VHI of the multimodel ensemble mean and median also are superior to that of the individual CMIP5 models. However, at high quantiles of reference data (75th and 90th percentiles), all climate models display low skill in simulating precipitation, except over North America, the Amazon, and Central Africa. Analyses of total bias (B) in CMIP5 simulations reveal that most models overestimate precipitation over regions of complex topography (e.g., western North and South America and southern Africa and Asia), while underestimating it over arid regions. Also, while most climate model simulations show low biases over Europe, intermodel variations in bias over Australia and Amazonia are considerable. The quantile bias analyses indicate that CMIP5 simulations are even more biased at high quantiles of precipitation. It is found that a simple mean field bias removal improves the overall B and VHI values but does not make a significant improvement at high quantiles of precipitation.

  14. Administrative and financial responsibilities for sheltered housing for mentally ill and handicapped persons in Germany and its impact on housing supply.

    Science.gov (United States)

    Bramesfeld, Anke; Holler, Gerhard

    2005-06-01

    The integration of mentally ill and handicapped persons in the society requires the availability of various forms of sheltered housing in the community, most important ambulatory (supported) housing facilities. In Germany the administrative and financial responsibility for sheltered housing for mental ill and handicapped persons is usually assigned to two authorities: the welfare authorities at Lander (state) level are responsible for hostels, the welfare authorities on community and district level are responsible for ambulatory housing. However some Lander have distributed these responsibilities differently and other Lander offer subsidy programmes to promote the implementation of ambulatory housing. To evaluate the different modes of distributing the responsibilities for administration and financing of sheltered housing for their impact on the supply with ambulatory and stationary housing in the 16 German Lander. (1) Analysis of the practise of distributing the responsibilities for housing between Lander and community welfare-authorities in the 16 Lander. Analysis of the subsidy programmes in the Lander that aim to promote the implementation of ambulatory housing. (2) Assessment of the capacities in housing for mentally ill and handicapped persons in the Lander. (3) Comparing (1) and (2). Lander that have the responsibilities for ambulatory housing and for hostels organised on the same authority-level, offer generally more housing in ambulatory facilities and less in hostels than Lander that do not. However, three Lander, despite having all responsibilities for housing at one authority level, provide accommodation for mentally ill and handicapped persons predominantly in hostels. There are so far no indications whether it would be more favourable to have a unique authority for housing based on Lander or on community level. Subsidy programmes to promote the implementation of supported housing are successful if they sponsor at least 50% of costs and if they exist

  15. The Efficacy of Fibroblast Growth Factor for the Treatment of Chronic Vocal Fold Scarring: From Animal Model to Clinical Application.

    Science.gov (United States)

    Ban, Myung Jin; Park, Jae Hong; Kim, Jae Wook; Park, Ki Nam; Lee, Jae Yong; Kim, Hee Kyung; Lee, Seung Won

    2017-12-01

    This study assessed the regenerative efficacy of basic fibroblast growth factor (FGF) in a rabbit model of chronic vocal fold scarring and then confirmed its utility and safety in a prospective trial of patients with this condition. FGF was injected three times, at 1-week intervals, into a chronic vocal fold scar created in a rabbit model. After 1 month, mRNA level of procollagen I, hyaluronic acid synthetase 2 (HAS 2), and matrix metalloproteinase 2 (MMP 2) were analyzed by real-time polymerase chain reaction. The relative densities of hyaluronic acid (HA) and collagen were examined 3 months post-injection. From April 2012 to September 2014, a prospective clinical trial was conducted at a tertiary hospital in Korea. FGF was injected into the mild vocal fold scar of 17 consecutive patients with a small glottic gap. The patients underwent perceptual, stroboscopic, acoustic aerodynamic test, and Voice Handicap Index (VHI) survey prior to and 3, 6, and 12 months after FGF injection. FGF injection of the vocal fold scar decreased the density of collagen and increased mRNA level of HAS 2 and MMP 2 expression significantly compared to the control group injected with phosphate buffered solution in a rabbit model (Pvocal fold injections of FGF in patients with mild chronic vocal fold scarring can significantly improve voice quality for as long as 1 year and without side effects. Our results recommend the use of FGF vocal fold injection as an alternative treatment modality for mild chronic vocal fold scarring.

  16. Vocal problems among teachers: evaluation of a preventive voice program.

    Science.gov (United States)

    Bovo, Roberto; Galceran, Marta; Petruccelli, Joseph; Hatzopoulos, Stavros

    2007-11-01

    Vocal education programs for teachers may prevent the emergence of vocal disorders; however, only a few studies have tried to evaluate the effectiveness of these preventive programs, particularly in the long term. Two hundred and sixty-four subjects, mostly kindergarten and primary school female teachers, participated in a course on voice care, including a theoretical seminar (120 minutes) and a short voice group therapy (180 minutes, small groups of 20 subjects). For 3 months, they had to either attend the vocal ergonomics norms and, as psychological reinforcement, they had to make out a daily report of vocal abuse, or to follow the given exercises for a more efficient vocal technique, reporting on whether the time scheduled was respected or not. The effectiveness of the course was assessed in a group of 21 female teachers through a randomized controlled study. Evaluation comprehended stroboscopy, perceptual and electro-acoustical voice analysis, Voice Handicap Index, and a course benefit questionnaire. A group of 20 teachers matched for age, working years, hoarseness grade, and vocal demand served as a control group. At 3 months evaluation, participants demonstrated amelioration in the global dysphonia rates (P=0.0003), jitter (P=0.0001), shimmer (P=0.0001), MPT (P=0.0001), and VHI (P=0.0001). Twelve months after the course, the positive effects remained, although they were slightly reduced. In conclusion, a course inclusive of two lectures, a short group voice therapy, home-controlled voice exercises, and hygiene, represents a feasible and cost-effective primary prevention of voice disorders in a homogeneous and well-motivated population of teachers.

  17. VOICE QUALITY BEFORE AND AFTER THYROIDECTOMY

    Directory of Open Access Journals (Sweden)

    Dora CVELBAR

    2016-04-01

    Full Text Available Introduction: Voice disorders are a well-known complication which is often associated with thyroid gland diseases and because voice is still the basic mean of communication it is very important to maintain its quality healthy. Objectives: The aim of this study referred to questions whether there is a statistically significant difference between results of voice self-assessment, perceptual voice assessment and acoustic voice analysis before and after thyroidectomy and whether there are statistically significant correlations between variables of voice self-assessment, perceptual assessment and acoustic analysis before and after thyroidectomy. Methods: This scientific research included 12 participants aged between 41 and 76. Voice self-assessment was conducted with the help of Croatian version of Voice Handicap Index (VHI. Recorded reading samples were used for perceptual assessment and later evaluated by two clinical speech and language therapists. Recorded samples of phonation were used for acoustic analysis which was conducted with the help of acoustic program Praat. All of the data was processed through descriptive statistics and nonparametric statistical methods. Results: Results showed that there are statistically significant differences between results of voice self-assessments and results of acoustic analysis before and after thyroidectomy. Statistically significant correlations were found between variables of perceptual assessment and acoustic analysis. Conclusion: Obtained results indicate the importance of multidimensional, preoperative and postoperative assessment. This kind of assessment allows the clinician to describe all of the voice features and provides appropriate recommendation for further rehabilitation to the patient in order to optimize voice outcomes.

  18. Title I/PSEN Individualized Reading and Math Services for the Handicapped, 1980-81. Final Evaluation Report.

    Science.gov (United States)

    New York City Board of Education, Brooklyn, NY. Office of Educational Evaluation.

    The Title I Umbrella Program provided compensatory instruction in reading, mathematics, and writing to 24,000 mildly or moderately handicapped students in New York City. The program was comprised of seven discrete components for the remediation of reading and writing skills, five after-school models, and two components for the remediation of math…

  19. Materials on Creative Arts (Arts, Crafts, Dance, Drama, Music, Bibliotherapy) for Persons with Handicapping Conditions. Revised.

    Science.gov (United States)

    American Alliance for Health, Physical Education, and Recreation, Washington, DC. Information and Research Utilization Center.

    Intended as a resource guide for persons who include such subjects as arts, crafts, dance, and music in programs for the handicapped, resources are listed for printed materials, audiovisual materials, resource persons and organizations, and material and equipment suppliers. Brief literature reviews sum up the state of the art in the specific art…

  20. STATEMENT OF GEORGE W. FELLENDORF BEFORE THE MARYLAND COMMISSION TO STUDY EDUCATIONAL NEEDS OF HANDICAPPED CHILDREN.

    Science.gov (United States)

    FELLENDORF, GEORGE W.

    THE EXECUTIVE DIRECTOR OF THE ALEXANDER GRAHAM BELL ASSOCIATION FOR THE DEAF URGED THAT THE STATE OF MARYLAND CONTINUE TO INVESTIGATE NEW DEVELOPMENTS IN THE AREA OF EDUCATION OF THE HANDICAPPED. HE RECOMMENDED THAT CONTINUAL REVIEW AND RECOMMENDATIONS OF NEEDS BE MADE BY REGIONAL SUBCOMMITTEES, PROGRAMS BE COORDINATED BY AN ADMINISTRATOR AT THE…

  1. LOW HANDICAP GOLFERS GENERATE MORE TORQUE AT THE SHOE-NATURAL GRASS INTERFACE WHEN USING A DRIVER

    Directory of Open Access Journals (Sweden)

    Paul Worsfold

    2008-09-01

    Full Text Available The aim was to determine the rotational torque occurring at the shoe-natural grass interface during golf swing performance with different clubs, and to determine the influence of handicap and golf shoe design. Twenty-four golfers (8 low 0-7; 8 medium 8-14; and 8 high 15+ performed 5 shots with a driver, 3-iron and 7-iron when 3 shoes were worn: a modern 8 mm metal 7-spike shoe, an alternative 7-spike shoe and a flat soled shoe. Torque was measured at the front and back foot by grass covered force platforms in an outdoor field. Torque at the shoe- natural turf interface was similar at the front foot when using a driver, 3-iron and 7-iron with maximum mean torque (Tzmax 17-19 Nm and torque generation in the entire backswing and downswing approximately 40 Nm. At the back foot, torque was less than at the front foot when using the driver, 3-iron and 7-iron. At the back foot Tzmax was 6-7 Nm, and torque generation was 10-16 Nm, with a trend for greater torque generation when using the driver rather than the irons. The metal spike shoe allowed significantly more back foot torque generation when using a driver than a flat- soled shoe (p 0.05, although back foot mean torques generated tended to be greater for the metal spike shoe. The golf shot outcomes were similar for low, medium and high handicappers in both metal and alternative spike shoes (metal: 87%; 76%; 54%; alternative: 85%; 74%; 54% respectively. The better, low handicap golfers generated significantly more back foot torque (metal spike: 18.2 Nm; alternative: 15.8 Nm; p < 0.05 when using a driver. Further research should consider back foot shoe-grass interface demands during driver usage by low handicap and lighter body-weight golfers

  2. Validity of the Mania Subscale of the Diagnostic Assessment for the Severely Handicapped-II (DASH-II).

    Science.gov (United States)

    Matson, Johnny L.; Smiroldo, Brandi B.

    1997-01-01

    A study tested the validity of the Diagnostic Assessment for the Severely Handicapped-II (DASH-II) for determining the presence of mania (bipolar disorder) in 22 individuals with severe mental retardation. Results found the mania subscale to be internally consistent and able to be used to classify manic and control subjects accurately. (Author/CR)

  3. Medical loss ratio as a potential regulatory tool in the Israeli healthcare system.

    Science.gov (United States)

    Simon-Tuval, Tzahit; Horev, Tuvia; Kaplan, Giora

    2015-01-01

    The growth of the private health insurance sector in Western countries, which is characterized by information deficiencies and limited competition, necessitates the implementation of effective regulatory tools. One measure which is widely used is the medical loss ratio (MLR). Our objective was to analyze how MLR is applied as a regulatory measure in the Israeli voluntary health insurance (VHI) market in order to promote the protection of beneficiaries. The study will examine MLR values and the use of this tool by regulators of VHI in Israel. Descriptive analysis using 2005-2012 data from public reports of the Ministry of Health and the Ministry of Finance on VHI plans in three market segments: nonprofit health plans, group (collective) policies offered by commercial insurance companies and individual policies offered by commercial insurance companies. In 2012, 74% of the Israeli population owned VHI provided by nonprofit health plans and 43% owned VHI offered by for-profit commercial companies. At that time the MLRs of three nonprofit health plans were significantly lower than 80%, mostly in the upper layers of coverage. The MLR in the individual commercial segment was consistently low (38% in 2012). The use of MLR as a regulation tool was, and continues to be, relatively limited in all segments. The VHI in Israel covers several essential services that are not covered by the statutory benefits package as a result of budget constraints. Thus, due to the high penetration rate of VHI in Israel compared to European countries and the lower levels of MLR, in order to assure the protection of beneficiaries it may be warranted to increase the extent of regulation and adjust it to the nature of the services covered. This may include distinguishing between essential and nonessential coverages and implementation of the most suitable regulatory measures (such as an MLR threshold, limitation of services covered and adjusting the actuarial models to the beneficiaries' behavior

  4. Social Comparison, Multiple Reference Groups, and the Self-Concepts of Academically Handicapped Children Before and After Mainstreaming.

    Science.gov (United States)

    Strang, Louise; And Others

    1978-01-01

    Predictions from social comparison theory and group reference theory were tested in two experiments assessing the impact of half-day mainstreaming upon the self-concepts of academically handicapped children. The results supported the theoretical viability of social comparison theory and group reference theory in educational settings. (Author/BH)

  5. Medical Services from the Point of View of People with a Sight Handicap

    OpenAIRE

    Nováková Peršínová, Lenka

    2010-01-01

    My thesis deals with the provision of medical services to people with a severe sight handicap. My research focuses on fully blind people. The aim of my thesis is to find out the situation of these people within medical facilities. I try to reveal blind people's experience of how healthcare workers communicate with them, how well prepared healthcare professionals are and how blind people themselves are prepared. I also examine what technical obstacles are encountered by blind people in medical...

  6. Patient-reported symptom questionnaires in laryngeal cancer: voice, speech and swallowing.

    Science.gov (United States)

    Rinkel, R N P M; Verdonck-de Leeuw, I M; van den Brakel, N; de Bree, R; Eerenstein, S E J; Aaronson, N; Leemans, C R

    2014-08-01

    To validate questionnaires on voice, speech, and swallowing among laryngeal cancer patients, to assess the need for and use of rehabilitation services, and to determine the association between voice, speech, and swallowing problems, and quality of life and distress. Laryngeal cancer patients at least three months post-treatment completed the VHI (voice), SHI (speech), SWAL-QOL (swallowing), EORTC QLQ-C30, QLQ-HN35, HADS, and study-specific questions on rehabilitation. Eighty-eight patients and 110 healthy controls participated. Cut off scores of 15, 6, and 14 were defined for the VHI, SHI, and SWAL-QOL (sensitivity > 90%; specificity > 80%). Based on these scores, 56% of the patients reported voice, 63% speech, and 54% swallowing problems. VHI, SHI, and SWAL-QOL scores were associated significantly with quality of life (EORTC QLQ-C30 global quality of life scale) (r = .43 (VHI and SHI) and r = .46 (SWAL-QOL)) and distress (r = .50 (VHI and SHI) and r = .58 (SWAL-QOL)). In retrospect, 32% of the patients indicated the need for rehabilitation at time of treatment, and 81% of these patients availed themselves of such services. Post-treatment, 8% of the patients expressed a need for rehabilitation, and 20% of these patients actually made use of such services. Psychometric characteristics of the VHI, SHI, and SWAL-QOL in laryngeal cancer patients are good. The prevalence of voice, speech, and swallowing problems is high, and clearly related to quality of life and distress. Although higher during than after treatment, the perceived need for and use of rehabilitation services is limited. Copyright © 2014 Elsevier Ltd. All rights reserved.

  7. The Veterinary Public Health Service and the National Organization for Nuclear Emergency Planning and Response in the Netherlands: Development of a measurement strategy in case of nuclear accidents

    International Nuclear Information System (INIS)

    Lembrechts, J.F.M.M.; Pruppers, M.J.M.

    1993-12-01

    In this report the position of the Veterinary Public Health Service (VHI), which is part of the Ministry of Welfare, Health and Cultural Affairs, within the National Organisation for Nuclear Emergency Planning and Response (NPK), is evaluated. NPK is activated in case of nuclear accidents in order to describe and model the evolution of the environmental contamination, to advise on countermeasures and to supervise their application and effects. Within this organisation VHI has to organize or execute measurements on animals and veterinary products and to coordinate countermeasures pertaining to their field of work. The suggestion is made to integrate the tasks of VHI and those of the Inspectorate for Health Protection (IGB) and to attune the activities of VHI and those of the State Institute for Quality Control of Agricultural Products (RIKILIT). Advices are given on how to detail the tasks of VHI adequately in the context of NPK, amongst others by describing methods to collect and interpret data. It is suggested to firstly put into practice in vivo monitoring techniques for '3'I and 134 Cs/ 137 Cs and to agree with other institutions on plans for sampling, sample preparation and measurements of milk. Finally a monitoring strategy for VHI is broadly outlined. It provides the framework for the definition of a detailed programme on sampling and measurement in case of a real accident. The monitoring strategy gives answers on the crucial question 'what has to be measured why and how by which person'. Since questions on where, when and how frequently measurements have to made should be tailored to the actual emergency situation, they are not dealt with in this report. 5 figs., 5 tabs., 66 refs

  8. Hearing aid use and long-term health outcomes: hearing handicap, mental health, social engagement, cognitive function, physical health and mortality

    Science.gov (United States)

    Dawes, Piers; Cruickshanks, Karen J.; Fischer, Mary E.; Klein, Barbara E.K.; Klein, Ronald; Nondahl, David M.

    2016-01-01

    Objective To clarify the impact of hearing aids on mental health, social engagement, cognitive function, and physical health outcomes in older adults with hearing impairment. Design We assessed hearing handicap (Hearing Handicap Inventory for the Elderly; HHIE-S), cognition (Mini Mental State Exam, Trail Making, Auditory Verbal Learning, Digit-Symbol Substitution, Verbal Fluency, incidence of cognitive impairment), physical health (SF-12 physical component, basic and instrumental activities of daily living, mortality), social engagement (hours per week spent in solitary activities) and mental health (SF-12 mental component) at baseline, 5 years prior to baseline, and 5 and 11 years after baseline. Study sample Community-dwelling older adults with hearing impairment (N=666) from the Epidemiology of Hearing Loss Study cohort. Results There were no significant differences between hearing aid users and non-users in cognitive, social engagement or mental health outcomes at any time point. Aided HHIE-S was significantly better than unaided HHIE-S. At 11 years hearing aid users had significantly better SF-12 physical health scores (46.2 versus 41.2; p=0.03). There was no difference in incidence of cognitive impairment or mortality. Conclusion There was no evidence that hearing aids promote cognitive function, mental health, or social engagement. Hearing aids may reduce hearing handicap and promote better physical health. PMID:26140300

  9. Ludwig, un roi sur la lune : l’histoire d’un roi fou jouée par des comédien.ne.s en situation de handicap mental

    Directory of Open Access Journals (Sweden)

    Marie Astier

    2017-12-01

    Full Text Available Ludwig, un roi sur la lune, spectacle mis en scène par Madeleine Louarn avec les comédien.ne.s professionnels en situation de handicap mental de l’Atelier Catalyse et présenté lors de la dernière édition du Festival d’Avignon n’est pas une reconstitution historique de la vie de Louis II de Bavière, roi du XIXe siècle diagnostiqué paranoïaque et destitué pour être interné, mais une tentative de transcrire théâtralement la perception du monde d’un homme amoureux de l’Art, de la nature et des hommes, mais qui devait être Roi. Ce n’est ni un personnage ni des comédien.ne.s « handicapé.e.s » que nous sommes invités à voir, mais les visions de Ludwig incarnées par des comédien.ne.s qui se trouvent être en situation de handicap mental. Dans ce spectacle, la « folie » devenue plus tard « handicap mental » apparaît sous les traits de la non-conformité bien plus que sous ceux de la pathologie.

  10. A Comparison of Forward and Concurrent Chaining Strategies in Teaching Laundromat Skills to Students with Severe Handicaps.

    Science.gov (United States)

    McDonnell, John; McFarland, Susan

    1988-01-01

    In a study which taught four high school students with severe handicaps to use a commercial washing machine and laundry soap dispenser, a concurrent chaining strategy was found more efficient than forward chaining in facilitating skill acquisition. Concurrent chaining also resulted in better maintenance at four- and eight-week follow-up…

  11. You Should be Dancin:! The Role of Performing Arts in the Lives of the Severely and Profoundly Handicapped.

    Science.gov (United States)

    Barringer, Mary Dean

    The manual presents a program planning framework and teaching units for teaching dance and movement to severely and profoundly handicapped individuals. The planning framework contains four components: (1) aesthetic perception/multisensory integration; (2) creative expression; (3) dance heritage/historical and cultural; and (4) aesthetic…

  12. The immunocompetence handicap hypothesis in two sexually dimorphic pinniped species - there a sex difference in immunity during early development?

    NARCIS (Netherlands)

    Hall, A.J.; Engelhard, G.H.; Brasseur, S.M.J.M.; Vecchione, A.; Burton, H.R.; Reijnders, P.J.H.

    2003-01-01

    The 'immunocompetence handicap hypothesis' predicts that highly sexually dimorphic and polygynous species will exhibit sex differences in immunity. We tested this hypothesis in southern elephant and grey seals during their early development by measuring the following parameters: leucocyte counts,

  13. The Handicap Principle for Trust in Computer Security, the Semantic Web and Social Networking

    Science.gov (United States)

    Ma, Zhanshan (Sam); Krings, Axel W.; Hung, Chih-Cheng

    Communication is a fundamental function of life, and it exists in almost all living things: from single-cell bacteria to human beings. Communication, together with competition and cooperation,arethree fundamental processes in nature. Computer scientists are familiar with the study of competition or 'struggle for life' through Darwin's evolutionary theory, or even evolutionary computing. They may be equally familiar with the study of cooperation or altruism through the Prisoner's Dilemma (PD) game. However, they are likely to be less familiar with the theory of animal communication. The objective of this article is three-fold: (i) To suggest that the study of animal communication, especially the honesty (reliability) of animal communication, in which some significant advances in behavioral biology have been achieved in the last three decades, should be on the verge to spawn important cross-disciplinary research similar to that generated by the study of cooperation with the PD game. One of the far-reaching advances in the field is marked by the publication of "The Handicap Principle: a Missing Piece of Darwin's Puzzle" by Zahavi (1997). The 'Handicap' principle [34][35], which states that communication signals must be costly in some proper way to be reliable (honest), is best elucidated with evolutionary games, e.g., Sir Philip Sidney (SPS) game [23]. Accordingly, we suggest that the Handicap principle may serve as a fundamental paradigm for trust research in computer science. (ii) To suggest to computer scientists that their expertise in modeling computer networks may help behavioral biologists in their study of the reliability of animal communication networks. This is largely due to the historical reason that, until the last decade, animal communication was studied with the dyadic paradigm (sender-receiver) rather than with the network paradigm. (iii) To pose several open questions, the answers to which may bear some refreshing insights to trust research in

  14. Sex difference in disability and handicap at five years of age in children born at very short gestation

    NARCIS (Netherlands)

    Verloove-Vanhorick, S.P.; Veen, S.; Ens-Dokkum, M.H.; Schreuder, A.M.; Brand, R.; Ruys, J.H.

    1994-01-01

    Objective. The objective of this study was to examine the relationship between sex and disabilities or handicaps at 5 years of age in infants born at less than 32 weeks gestation. Design. From the nationwide collaborative survey starting in 1983, including perinatal data obtained during routine

  15. The Role of Spiritual Attitude in Child-Rearing in Predicting the Psychological Hardiness of Mothers with Handicapped Children

    Directory of Open Access Journals (Sweden)

    Bahman Bahmani

    2015-06-01

    Full Text Available Objectives: Providing care to children who have disability is often a stressful experience, yet spiritual beliefs may help mothers to be patient, tolerant and  hard in coping with child-rearing difficulties. This study examined the relationship between the spiritual attitudes of mothers of handicapped children to child-rearing and psychological hardiness. Methods: In a descriptive correlational study, 120 mothers of handicapped children who were referred to the rehabilitation clinics of the University of Social Welfare and Rehabilitation Sciences (Rofeideh, Akhavan and Sina clinics were selected through purposeful sampling and answered the Sanctification of Parents Scale (SPS, and Personal Views Survey (PVS. Data were analyzed by SPSS-20 software and statistical procedures including Pearson correlation and multiple regression analysis were used. Results: Results showed that spiritual attitudes to child-rearing are significant predictors of hardiness in mothers. Discussion: It seems like having spiritual attitudes in difficult situations such as providing care for disabled children plays a significant role in mother’s patience and hardiness.

  16. Fractional CO2 laser treatment for vulvovaginal atrophy symptoms and vaginal rejuvenation in perimenopausal women

    Directory of Open Access Journals (Sweden)

    Arroyo C

    2017-08-01

    Full Text Available César Arroyo HM Montepríncipe University Hospital Laser Unit, Madrid, Spain Background: This study investigated a novel fractional carbon dioxide (CO2 laser for treatment of symptoms associated with vulvovaginal atrophy (VVA in perimenopausal women.Methods: The study included 21 perimenopausal women (mean age 45±7 years treated three times by CO2 laser resurfacing and coagulation of the vaginal canal tissue and mucosal tissue of the introitus. Vaginal health index (VHI scores were computed by the investigator at baseline and follow-ups. Subjects reported on sexual function, satisfaction, and improvement with treatment. A visual analog scale was used to measure discomfort with treatment.Results: Vaginal health and subject assessment of vaginal symptoms improved with successive treatments. At 12 weeks following the third treatment, 82% of the patients showed a statistically significant improvement in VHI (P<0.05. Additionally, 81% of subjects reported improvement in sexual gratification, 94% reported improvement in vaginal rejuvenation, and 100% reported satisfaction with treatment. VHI improvement remained significant at 6–8 months after treatments (P<0.01. Most patients (97% reported no to mild discomfort with treatment. Responses were mild and transient following treatment, with itching being the most commonly reported (20% side effect.Conclusion: In this study, fractional CO2 laser treatment was associated with improvement of vaginal health and amelioration of symptoms of VVA, resulting in improved sexual function in perimenopausal women. Treatment time was quick, and there was minimal discomfort associated with treatment. Investigation of clinical outcome in a larger study population is warranted. Keywords: genitourinary syndrome of menopause, vaginal rejuvenation, stress urinary incontinence, collagen remodeling, sexual dysfunction, vulvovaginal atrophy

  17. Education of the Handicapped Act Amendments of 1990, P.L. 101-476: A Summary. CRS Report for Congress.

    Science.gov (United States)

    Aleman, Steven R.

    This summary of the Education of the Handicapped Act Amendments of 1990, Public Law 101-476, identifies how these Amendments extend and expand special education research, demonstration, and training programs of the Individuals with Disabilities Education Act (IDEA). IDEA authorizes three state formula grant programs and several discretionary grant…

  18. Clinical assessment of prognostic factors for long-term pain and handicap after whiplash injury: a 1-year prospective study

    DEFF Research Database (Denmark)

    Kasch, H; Qerama, E; Kongsted, Alice

    2008-01-01

    BACKGROUND AND PURPOSE: Physical mechanisms are the possible factors involved in the development and maintenance of long-term handicaps after acute whiplash injury. This study prospectively examined the role of active neck mobility, cervical and extra-cervical pains, as well as non-painful...... of non-painful complaints and active neck mobility [active cervical range of motion (CROM)]. All 458 high-risk patients and 230 low-risk patients received mailed questionnaires after 3, 6 and 12 months. Two examiners examined all high-risk patients (n = 458) and 41 consecutive low-risk patients at median...... complaints after a whiplash injury as predictors for subsequent handicap. METHODS: Consecutive acute whiplash patients (n = 688) were interviewed and examined by a study nurse after the median of 5 days after injury, and divided into a high- or a low-risk group by an algorithm based on pain intensity, number...

  19. Postmenopausal vulvovaginal atrophy (VVA) is positively improved by topical hyaluronic acid application. A prospective, observational study.

    Science.gov (United States)

    Origoni, M; Cimmino, C; Carminati, G; Iachini, E; Stefani, C; Girardelli, S; Salvatore, S; Candiani, M

    2016-10-01

    To evaluate the effectiveness of a topical vaginal preparation containing hyaluronic acid in controlling signs and symptoms correlated with postmenopausal vulvovaginal atrophy (VVA). A prospective, observational study has been performed at the Obstetrics and Gynecology Department of the Vita Salute San Raffaele University of Milan, Italy. Forty-six (46) consecutive postmenopausal women complaining of genital discomfort due to postmenopausal estrogen lack have been enrolled. All patients have been investigated by the use of the Vaginal Health Index (VHI) and of a Visual Analogic Scale (VAS) of symptoms at baseline and one month after the end of the study. The treatment protocol consisted of the administration of a hyaluronic acid-based liquid preparation for vaginal use (Justgin®, Just Pharma, Rome, Italy) three times a week, for a total of 8 weeks. Statistical analysis of VHI and VAS scores has been performed by the use of the Wilcoxon signed-rank test for repeated values, assuming a p-value Hyaluronic acid topical approach with a liquid preparation for vaginal use (Justgin®, Just Pharma, Roma, Italy) to control signs and symptoms of vulvovaginal atrophy (VVA) in postmenopausal women demonstrated significant effectiveness both in terms of objective and subjective improvement.

  20. The immunocompetence handicap hypothesis in two sexually dimorphic pinniped species - is there a sex difference in immunity during early development?

    NARCIS (Netherlands)

    Hall, AJ; Englehard, GH; Brasseur, SMJM; Vecchione, A; Burton, HR; Reijnders, PJH

    2003-01-01

    The 'immunocompetence handicap hypothesis' predicts that highly sexually dimorphic and polygynous species will exhibit sex differences in immunity. We tested this hypothesis in southern elephant and grey seals during their early development by measuring the following parameters: leucocyte counts,

  1. Rights and Responsibilities of Parents and Schools in the Education of Handicapped Children = Derechos y Responsabilidades de los Padres de Familia y los Distritos Escolares en la Educacion de los Ninos Incapacitados.

    Science.gov (United States)

    Arizona State Dept. of Education, Phoenix. Div. of Career and Vocational Education.

    The booklet is intended to help Arizona parents understand their role in the education of handicapped children. A question and answer format draws upon contents of P.L. 94-142, The Education for All Handicapped Children Act; Arizona revised statutes; and the State Board of Education rules and regulations. Four main topics are covered: (1)…

  2. Language Acquisition and Assessment in Normal and Handicapped Preschool Children: A Review of the Literature. Final Report. Volume II.

    Science.gov (United States)

    Longhurst, Thomas M.

    The second of four documents provides a summary of the scientific literature pertaining to spontaneous language acquisition in handicapped preschool children, and reviews and evaluates procedures for assessing language acquisition in these children. Chapter l focuses on language development in nonhandicapped children after they have acquired their…

  3. Can a conditioning programme improve Handicap Index in ...

    African Journals Online (AJOL)

    This study was conducted to determine the effects of a conditioning programme on body composition, flexibility, muscular strength, muscular endurance, ... The 14-week training programme consisted of a 60-minute supervised basic conditioning phase (Weeks 1-4: 9 resistance training exercises, 2-3 sets, 12-20 repetitions), ...

  4. The relationship between structured and free play in the development of a mentally handicapped child: a case study.

    Science.gov (United States)

    Hewson, S; McConkey, R; Jeffree, D

    1980-01-01

    This case study provides an individual illustration of the work of the Parental Involvement Project. A key feature of the approach used was the structured play situation. Thus, the case study also serves to demonstrate the role of structured play, and its relation to free play, in the development of a young, mentally handicapped child.

  5. Age and excuses for forgetting: self-handicapping versus damage-control strategies.

    Science.gov (United States)

    Erber, J T; Prager, I G

    2000-01-01

    Either before or after being interviewed for a volunteer position, a young or old protagonist (i.e., target) gave an excuse for forgetting. Study participants (i.e., perceivers) had a higher opinion of the target's memory, were more confident in the target's capability of performing memory-related tasks, and attributed the target's memory failures more to bad luck when the excuse was given after (damage-control strategy) rather than before (self-handicapping strategy) the interview. Moreover, the excuse given before the interview had no significant effect on perceivers' judgments when compared with data from an earlier study in which the target gave no excuse for forgetting. The present findings suggest that a damage-control strategy can ameliorate negative capability impressions.

  6. Serial in-office laser treatment of vocal fold leukoplakia: Disease control and voice outcomes.

    Science.gov (United States)

    Koss, Shira L; Baxter, Peter; Panossian, Haig; Woo, Peak; Pitman, Michael J

    2017-07-01

    Although vocal fold (VF) leukoplakia is commonly treated with in-office laser, there is no data on its long-term effectiveness. This study hypothesizes that VF leukoplakia treated by serial in-office laser results in long-term disease control with maintenance of voice and minimal morbidity. Retrospective review (2008-2015). Forty-six patients with VF leukoplakia treated by in-office KTP (potassium titanyl phosphate) or PDL (pulsed dye laser) were included. Median follow-up from final laser treatment was 19.6 months. Main outcomes included: 1) rate of disease control, 2) percentage of disease regression using ImageJ analysis. Secondary outcomes included vocal assessment using the Voice Handicap Index-10 (VHI-10). Patients underwent a median of 2 (range: 1-6) in-office laser treatments. Time between treatments was median 7.6 months. After final treatment, 19 patients (41.3%) had no disease; two patients (4.3%) progressed to invasive cancer; overall disease regression was median 77.1% (P office treatment only); failures were 13 patients (28.3%) who required operative intervention and two patients (4%) who underwent radiation. Compared to responders, failures demonstrated significantly shorter duration between treatments (median 2.3 vs. 8.9 months, P = 0.038) and significantly less regression (median 49.3% vs. 100%, P = 0.006). Serial outpatient KTP or PDL treatment of VF leukoplakia is effective for disease control with minimal morbidity and preservation of voice quality. We suggest that patients requiring repeated in-office treatment every 6 months may benefit from earlier operative intervention; other factors associated with in-office success remain unclear. 4. Laryngoscope, 127:1644-1651, 2017. © 2017 The American Laryngological, Rhinological and Otological Society, Inc.

  7. Survival Words and Phrases for Professionals Who Work with Students Who Are Bilingual and Severely/Multiply Handicapped, and with Their Families.

    Science.gov (United States)

    Silberman, Rosanne K.; Correa, Vivian I.

    1989-01-01

    The paper offers a rationale for bilingual special education, provides suggestions for developing bilingual lessons for severely/multiply handicapped students, and includes a list of Spanish words and phrases used most frequently by students and their parents. (JDD)

  8. A Multifaceted Program To Improve Self-Esteem and Social Skills while Reducing Anxiety in Emotionally Handicapped Middle School Students.

    Science.gov (United States)

    Poirier, Lynn

    A practicum was developed to increase self-esteem, to lower anxiety, and to improve social skills in 13 emotionally handicapped (EH) middle school boys. An additional objective was to provide parenting classes which focused on increasing parents' knowledge and skills in improving their children's self esteem. The 8-month multifaceted program…

  9. Child Functional Independence and Maternal Psychosocial Stress as Risk Factors Threatening Adaptation in Mothers of Physically or Sensorially Handicapped Children.

    Science.gov (United States)

    Wallander, Jan L; And Others

    1990-01-01

    Investigated contribution of child functional independence and maternal psychosocial stress to adaptation of 119 mothers of physically or sensorially handicapped children between the ages of 2 and 18. Child functional independence did not uniquely explain variation in mothers' adaptation. Maternal stress was uniquely associated with maternal…

  10. Dental treatment for handicapped patients; sedation vs general anesthesia and update of dental treatment in patients with different diseases

    Science.gov (United States)

    Corcuera-Flores, José R.; Delgado-Muñoz, José M.; Ruiz-Villandiego, José C.; Maura-Solivellas, Isabel

    2014-01-01

    Dental treatment on Handicapped Patients is often difficult because many people with a wide range of ages (from children to the elderly) with different pathologies that can affect the oral cavity and differ widely are included in this group. This situation creates some controversy, because according to pathology, each patient will be treated differently depending on collaboration, general health status, age or medication used to treat this pathologies. According to this situation we can opt for an outpatient treatment without any kind of previous medication, a treatment under conscious or deep sedation or a under general anesthesia treatment. With this systematic review is intended to help clarify in which cases patients should be treated under general anesthesia, sedation (conscious or deep) or outpatient clinic without any medication, as well as clarify what kind of treatments can be carried in private dental clinics and which should be carried out in a hospital. It will also discuss the most common diseases among this group of patients and the special care to be taken for their dental treatment. Key words:Hospital dentistry, handicapped patient. PMID:24121922

  11. A Comparison of Self-Reported Hearing Handicap and Audiometric Thresholds in Nursing Home Residents

    Directory of Open Access Journals (Sweden)

    Nematolla Rouhbakhsh

    2007-12-01

    Full Text Available Background and Aim: Self-reported and questionaire method for hearing impairment assessment allow us to study and to detect the invisible related issues, while They can not be done by traditional audiometry procedures. The purpose of this study is to compare measurement of hearing handicap using self-reported and staff version of NHHI and hearing thresholds in nursing home residents. Materials and Method: The study participants were 43 individuals, 23 males and 20 females, aged 45-95 years. Pure tone average were calculated after conventional Pure tone audiometry . the self- and staff- reported questionnaire were also fulfilled. Results: Nine (20.9% individuals have normal hearing, 6 (14% have slight, 10 (23.3% mild, 7 (16.3% moderate, 6 (16.3% moderate to severe, 4 (9.3% severe, and 1 (2.3% profound hearing loss. Mean score of self and of staff reported versions were 32.22 % +29.31 and 32.67% +30.98, respectively. According to Kruskal-wallis test, there were significant correlation between self-reported and hearing level and between staff-reported and hearing level. The Pierson coefficient variation test between self and staff-reported, and self-reported and hearing level, staff-reported and hearing level showed significant correlation. Conclusion: The NHHI self assessment associated with other equipments significantly improved the identification and assessment of adults and elderly hearing handicap in nursing home residents. According to the study condition, it may be concluded that the self and staff version of NHHI questionnaire are significantly identical and can be used instead.

  12. DEVELOPMENT OF A PROGRAM FOR THE RE-EDUCATION AND REHABILITATION OF EMOTIONALLY HANDICAPPED MALE ADOLESCENTS WITHIN A PUBLIC SCHOOL SETTING.

    Science.gov (United States)

    DEEM, MICHAEL A.; PORTER, WILLIAM R.

    MAJOR OBJECTIVES OF THIS DEMONSTRATION PROJECT WERE (1) TO CONTINUE DEVELOPING A PROTOTYPE SPECIAL CLASS PROGRAM FOR EMOTIONALLY HANDICAPPED PUPILS (18 MALE ADOLESCENTS), (2) TO DEVISE METHODS OF EVALUATION FOR THE PROGRAM, AND (3) TO IDENTIFY SIGNIFICANT VARIABLES FOR FURTHER INVESTIGATION AND RESEARCH. IN PLANNING THE PROJECT DURING THE FIRST…

  13. Minutes: Annual Meeting of the President's Committee on Employment of the Handicapped (Washington, D.C., May 1-2, 1969).

    Science.gov (United States)

    President's Committee on Employment of the Handicapped, Washington, DC.

    Reporting the events of the meeting of the President's Committee on Employment of the Handicapped, the text includes speeches by Chairman Russell, Senator Bob Dole, Secretary of Labor Schultz, Rene Carpenter, Mr. Lustenberger of the W.T. Grant Company, W.F. Schnitzler of the AFL-CIO, Mrs. Koontz of the Department of Labor, Dr. Harlem, President of…

  14. The impact of the inclusion of students with handicaps and disabilities in the regular education science classroom

    Science.gov (United States)

    Donald, Cathey Nolan

    This study was conducted to determine the impact of the inclusion of students with handicaps and disabilities in the regular education science classroom. Surveys were mailed to the members of the Alabama Science Teachers Association to obtain information from teachers in inclusive classrooms. Survey responses from teachers provide insight into these classrooms. This study reports the results of the teachers surveyed. Results indicate multiple changes occur in the educational opportunities presented to regular education students when students with handicaps and disabilities are included in the regular science classroom. Responding teachers (60%) report omitting activities that formerly provided experiences for students, such as laboratory activities using dangerous materials, field activities, and some group activities. Also omitted, in many instances (64.1%), are skill building opportunities of word problems and higher order thinking skills. Regular education students participate in classes where discipline problems related to included students are reported as the teachers most time consuming task. In these classrooms, directions are repeated frequently, reteaching of material already taught occurs, and the pace of instruction has been slowed. These changes to the regular classroom occur across school levels. Many teachers (44.9%) report they do not see benefits associated with the inclusion of students with special needs in the regular classroom.

  15. [Evaluation of an intensive therapy program for treatment of severe behavioral disorders in mentally handicapped patients with autistic or psychotic behavior].

    Science.gov (United States)

    Elbing, U; Rohmann, U H

    1993-09-01

    The development of severely disturbed and socially accepted behavior in mentally handicapped persons with autistic or psychotic symptoms is documented before, during and after an intensive therapy program conducted in a residential institution for mentally handicapped persons. Seven single case studies were made as long term observation with a duration between 18 and 33 weeks, mostly with a multiple baseline design. One or two follow ups with at least four weeks length were conducted in six out of seven cases up to four years after the end of the intensive therapy. The main results show (1) the decrease of disturbed behavior and the increase of socially accepted behavior during the therapy program, and (2) the significant reduction of the disturbed behavior patterns taking place during the baseline phase before the beginning of the therapy in all cases but one. The results are discussed under the aspects of a possible explanation for the findings and their impact on the discussion about psychotherapy research.

  16. Impact of Ospemifene on Quality of Life and Sexual Function in Young Survivors of Cervical Cancer: A Prospective Study

    Directory of Open Access Journals (Sweden)

    Nicoletta De Rosa

    2017-01-01

    Full Text Available Background. Cervical cancer (CC treatments impact quality of life (QoL and sexual function (SF of survivors. Treatment options to reduce sexual dysfunction are limited. The aim of this study was to assess the effectiveness of ospemifene in CC survivors with clinical signs and symptoms of vulvovaginal atrophy (VVA focusing on their QoL and SF. Materials and Methods. Fifty-two patients with previous diagnosis of stage I-IIa CC suffering from VVA and treated with ospemifene were enrolled into a single arm prospective study. Patient underwent 6 months of therapy. At baseline and after 6 months all subjects performed Vaginal Health Index (VHI. The SF and QoL were measured by The European Organization for Research and Treatment of Cancer (EORTC Quality of Life Questionnaire (QLQ and the Cervical Cancer Module (CXC-24. Results. After treatment a significant improvement of each parameter of VHI has been demonstrated. Global health status and emotional and social functioning scores improved significantly. On the contrary, general symptoms scales did not show significant difference from baseline data. Sexual activity, sexual vaginal functioning, body image, and sexual enjoyment scores increased significantly. Conclusion. Ospemifene seems to be effective in decreasing the VVA symptoms in CC survivors.

  17. A cohort study of accidents occurring in mentally handicapped patients living in institutions

    Directory of Open Access Journals (Sweden)

    Muriel Alfonso

    2010-05-01

    Full Text Available Abstract Background Mentally handicapped patients who require extensive and generalised care and are resident in mental health institutions have certain characteristics that could mean that they suffer certain types of accidents. The aim of this study was to determine the number and type of accident-related injuries in this population in order to design appropriate preventative strategies. Methods Accident-related injuries in patients resident in six institutions in the north of Spain were recorded prospectively over a period of 21 months. The characteristics of these injuries were recorded in a database linked to another in which patient data were recorded. A logistic regression model employing the generalized estimating equation (GEE methodology was employed due to the repetition of patient accidents. Results There was one death due to foreign body aspiration into the airways. A total of 1,671 injuries were recorded, 0.5% of which were classified as serious, 10% moderate and 89.5% minor. The serious injuries involved fractures (6 and cuts (2, the moderate injuries mainly cuts (57%, bruising (18% and sprains (13%, and the minor injuries bruising (40%, cuts (35% and scratches (20%. Falls were the main cause of these injuries (25.2%. The variables associated with serious accidents were self-harm (OR = 1.18, non-collaborative behaviour (OR = 1.21 and inpatient (OR = 1.37. Conclusions Accidents in mentally handicapped patients occur in different ways compared to those in the general population. The majority of injuries found were minor (an average of 0.8 to 3.4 accidents per year, with falls being the most common cause. Patients with behavioural disorders undergoing treatment with neuroleptic agents were found to be a risk group, therefore this finding should be taken into consideration when establishing care groups.

  18. Psychometric properties of the Persian version of the Tinnitus Handicap Inventory (THI-P

    Directory of Open Access Journals (Sweden)

    Mir Mohammad Jalali

    2015-03-01

    Full Text Available Introduction: Tinnitus can have a significant effect on an individual’s quality of life, and is very difficult quantify. One of the most popular questionnaires used in this area is the Tinnitus Handicap Inventory (THI. The aim of this study was to determine the reliability and validity of a Persian translation of the Tinnitus Handicap Inventory (THI-P.   Materials and Methods: This prospective clinical study was performed in the Otolaryngology Department of Guilan University of Medical Sciences, Iran. A total of 102 patients aged 23–80 years with tinnitus completed the (THI-P. The patients were instructed to complete the Beck Depression Inventory (BDI and the State-Trait Anxiety Inventory (STAI. Audiometry was performed. Eight-five patients were asked to complete the THI-P for a second time 7–10 days after the initial interview. We assessed test–retest reliability and internal reliability of the THI-P. Validity was assessed by analyzing the THI-P of patients according to their age, tinnitus duration and psychological distress (BDI and STAI. A factor analysis was computed to verify if three subscales (functional, emotional, and catastrophic represented three distinct variables.   Results: Test–retest correlation coefficient scores were highly significant. The THI-P and its subscales showed good internal consistency reliability (α = 0.80 to 0.96. High-to-moderate correlations were observed between THI-P and psychological distress and tinnitus symptom ratings. A confirmatory factor analysis failed to validate the three subscales of THI, and high inter-correlations found between the subscales question whether they represent three distinct factors. Conclusion:  The results suggest that the THI-P is a reliable and valid tool which can be used in a clinical setting to quantify the impact of tinnitus on the quality of life of Iranian patients.

  19. [Political-academic discourse and integration of handicapped people: from appearances to the senses].

    Science.gov (United States)

    de França, Inacia Sátiro; Pagliuca, Lorita Marlena; de Sousa, Rosiléa Alves

    2003-12-01

    Our aim was to analyze law no. 3.298/99 and course plans in undergraduate nursing programs in order to confirm the inclusion of the item for participation of nurses in the Handicapped People (HP) integration process. We read the plans of courses from four universities; identified the courses in common and distributed them according to the level of health care. The proposals of the law are universal, equal, and democratic; the plans of courses analyzed adopt most of the actions recommended by the Ministry of Health in order to prevent deficiencies. Nevertheless, academic practice exercises prevention/treatment of diseases, silencing concern over the insertion of nurse in the HP integration process.

  20. Sociocultural handicap of foreign pupils and professional qualification of teachers

    Directory of Open Access Journals (Sweden)

    Markéta Zachová

    2017-11-01

    Full Text Available The presented text shows the results of research carried out within the dissertation thesis. The main topic is the phenomenon of sociocultural handicap of foreign pupils (pupils with a different mother tongue. The research is based on the expert belief that integration of foreign pupils (pupils with a different mother tongue into Czech schools and the training of teachers in this field is still somewhat marginal, even though there is a growing debate about increasing cultural diversity, increasing heterogeneity of schools and introduction of inclusive measures. The aim of the research was to analyze professional training of teachers in relation to the sociocultural handicap of foreign pupils (pupils with a different mother tongue. The goal was refined by the formulation of research questions: What possible problems (difficulties reflect teachers in the teaching process of foreign pupils? What procedures and strategies do teachers use to help these pupils to be integrated successfully? How do teachers assess their professional readiness for education of foreign pupils (whether they were sufficiently prepared to work with foreign pupils in the course of their undergraduate studies, where they find benefits, deficiencies in this training? How do students assess their undergraduate education for foreign-pupil teaching (whether they were ready to work with foreign pupils in their previous undergraduate education, where they find benefits, deficiencies in this training? The research used questionnaire survey techniques for teachers and students and semi-structured interviews for teachers. The partial technique was the analysis of study subjects focused on the education of foreign pupils at the Faculty of Education at West Bohemian University in Pilsen (hereinafter WBU. The research group was made up of teachers of the 1st grade of primary schools of the Pilsen and Karlovy Vary regions and students of the 4th grade of the field of Teaching for the

  1. Adaptation of the Tinnitus Handicap Inventory into Polish and its testing on a clinical population of tinnitus sufferers.

    Science.gov (United States)

    Skarzynski, Piotr H; Raj-Koziak, Danuta; J Rajchel, Joanna; Pilka, Adam; Wlodarczyk, Andrzej W; Skarzynski, Henryk

    2017-10-01

    To describe how the Tinnitus Handicap Inventory (THI) was translated into Polish (THI-POL) and to present psychometric data on how well it performed in a clinical population of tinnitus sufferers. The original version of THI was adapted into Polish. The reliability of THI-POL was investigated using test-retest, Cronbach's alpha, endorsement rate and item-total correlation. Construct validity and convergent validity were also assessed based on confirmatory factor analysis, inter-item correlation and Pearson product-moment correlations using subscale A (Tinnitus) of the Tinnitus and Hearing Survey (THS-POL); divergent validity was checked using subscale B (Hearing) of THS-POL. A group of 167 adults filled in THI-POL twice over their three-day hospitalisation period. Test-retest reliability for the total THI-POL scores was strong (r = 0.91). Cronbach's alpha coefficient for the total score was high (r = 0.95), confirming the questionnaire's stability. Confirmatory factor analysis (CFA) and inter-item correlation did not confirm the three-factor model. Convergent validity from the Tinnitus subscale of THS showed a positive strong (r = 0.75) correlation. Divergent validity showed only a moderate correlation. All analyses were statistically significant (p tinnitus handicap of Polish-speaking patients to be effectively assessed.

  2. Implementation of an Initial Training Program for New Employees in a Profoundly Mentally and Physically Handicapped Children and Adult Residential Facility.

    Science.gov (United States)

    Hoeft, Linda A.

    A project was designed to reduce the turnover of direct care staff in a community-based residential facility that provides a home and educational or adult day training services for 54 severely or profoundly mentally and physically handicapped children and adults. The project sought to reduce total staff turnover by 40%, reduce employee…

  3. Secrets for Survival: The Training Program for Teachers of the Severely/Profoundly Handicapped (S/PH). Description of Teacher Inservice Education Materials.

    Science.gov (United States)

    National Education Association, Washington, DC. Project on Utilization of Inservice Education R & D Outcomes.

    As a description of a "survival kit" for teachers confronted with the instruction of severely/profoundly handicapped children, complete information with regard to purposes of the kit, printed and audiovisual contents, scope and sequencing of topics for the six training modules, and activities and resources involved in the use of the kit is…

  4. INDEXING AND INDEX FUNDS

    Directory of Open Access Journals (Sweden)

    HAKAN SARITAŞ

    2013-06-01

    Full Text Available Proponents of the efficient market hypothesis believe that active portfolio management is largely wasted effort and unlikely to justify the expenses incurred. Therefore, they advocate a passive investment strategy that makes no attempt to outsmart the market. One common strategy for passive management is indexing where a fund is designed to replicate the performance of a broad-based index of stocks and bonds. Traditionally, indexing was used by institutional investors, but today, the use of index funds proliferated among individual investors. Over the years, both international and domestic index funds have disproportionately outperformed the market more than the actively managed funds have.

  5. JUSTIFICATION OF THE EXISTENCE OF PREPARATORY GROUPS IN SPECIAL SCOOLS FOR CHILDREN LIGHTLY HANDICAPPED

    Directory of Open Access Journals (Sweden)

    Aneta ANDONAKIS

    1997-03-01

    Full Text Available Researches about child’s intellectual development in the psychology has started in the 19th century and the first step has been made by Tiedemann in “ Observation of the development of the mental abilities of the children”. His work caused a great interest in the circles of doctors and psychologists. Their interpretation of intelligence was different, but the most acceptable is the performance of complicated activities for getting knowledge and skills and getting over the obstacles in the development of the person”.The social ability do not correspond with the intelligence. The two aspects are tested and a complete picture of their functioning can be seen. The developmental principle is determined from general to the separate as functionally connected.In the period when a child does not accept the higher level of intelligence and thinking , in relation to which are effectuated by sense-motor activities, than we say that a child is mentally handicapped. The widest approach of the educational system should be treated as a functional, institutional and organizational, that takes part in the realization of the social aims and tasks.Not getting into viewing of the curriculum's and programs for preparatory groups in the preeducational period, we may say that the justification for the existence of these group in the regular schools, is maturation of the perceptive motor coordination and learning. With the maturing the function of the "ego" is increasing.As a child adapts better he can learn better, and the maturity comes sooner. In this way these groups are justified.Mentally handicapped child has not the opportunity to attend an organized prepared education which provides:-forming of the speech, self-control, which can be achieved in the process of learning through a direct contact with other children;· regulation of the lateralization through re-education of the psycho-motor abilities, and in general neuro-motor experienced maturation

  6. Special sliding door with storable handrail to support senior and handicapped persons to walk by themselves

    Science.gov (United States)

    Saitou, K.; Noda, N.-A.; Sano, Y.; Takase, Y.; Murai, K.; Wang, Z. F.; Li, S. Q.; Liu, X.; Tanaka, H.; Kubo, Y.

    2018-06-01

    In this paper, special sliding door is designed in order to support senior and handicapped persons to walk by themselves in hospitals and nursing facilities. This semiautomatic lifting equipment is utilized for the storable handrail to make sure the bad health persons are able to open the door by using a weak force. In this study, to design the equipment of the handrail, the theoretical formula of opening force is derived. Then the simulation is performed by varying geometrical conditions. The simulation results are compared with the experiment results.

  7. Creating Awareness of Sexual Abuse in Children with Special Education Needs: Depending on the Opinions of Teachers of the Mentally Handicapped

    Science.gov (United States)

    Büyükbayraktar, Çagla Girgin; Er, Rukiye Konuk; Kesici, Sahin

    2018-01-01

    The purpose of this research is to determine what students and families should do in order to prevent sexual abuse in students who need special education, depending on the opinions of teachers of mentally handicapped students. The qualitative research technique was used in this research. The study population of the research consisted of the…

  8. An Analysis of Perceptions and Attitudes Toward the Concepts "Disabled" and "Handicapped" and the Effects of Pre-Structured Definition Upon the Concepts.

    Science.gov (United States)

    Ianacone, Robert N.; Stodden, Robert A.

    The semantic differential technique was used in a study involving 40 undergraduate trainees in the area of special education to analyze the concepts "disabled" and "handicapped" and the effects of structured knowledge or definition on the participants' perceptions of and attitudes toward the concepts. The Semantic differential consisted of bipolar…

  9. Wireless hydrotherapy smart suit for monitoring handicapped people

    Science.gov (United States)

    Correia, Jose H.; Mendes, Paulo M.

    2005-02-01

    This paper presents a smart suit, water impermeable, containing sensors and electronics for monitoring handicapped people at hydrotherapy sessions in swimming-pools. For integration into textiles, electronic components should be designed in a functional, robust and inexpensive way. Therefore, small-size electronics microsystems are a promising approach. The smart suit allows the monitoring of individual biometric data, such as heart rate, temperature and movement of the body. Two solutions for transmitting the data wirelessly are presented: through a low-voltage (3.0 V), low-power, CMOS RF IC (1.6 mm x 1.5 mm size dimensions) operating at 433 MHz, with ASK modulation and a patch antenna built on lossy substrates compatible with integrated circuits fabrication. Two different substrates were used for antenna implementation: high-resistivity silicon (HRS) and Corning Pyrex #7740 glass. The antenna prototypes were built to operate close to the 5 GHz ISM band. They operate at a center frequency of 5.705 GHz (HRS) and 5.995 GHz (Pyrex). The studied parameters were: substrate thickness, substrate losses, oxide thickness, metal conductivity and thickness. The antenna on HRS uses an area of 8 mm2, providing a 90 MHz bandwidth and ~0.3 dBi of gain. On a glass substrate, the antenna uses 12 mm2, provides 100 MHz bandwidth and ~3 dBi of gain.

  10. Public Law 94-142, Education for All Handicapped Children Act: Some Plain Talk Pursuant to the Role of Institutions of Higher Education.

    Science.gov (United States)

    Frith, Greg

    The presentation addresses the implications of P.L. 94-142, the Education for All Handicapped Children Act, for institutions of higher education that are concerned with special education personnel preparation. After a review of literature, the supply and demand situation as it pertains to teachers of exceptional children is discussed and quality…

  11. A Study to Design a System to Identify Handicapped Family Members of Active Duty Soldiers at Fort Benning, Georgia

    Science.gov (United States)

    1982-05-01

    2 (June 1975): 341-351. 51 "Consumer Services for Handicapped People at Home." Physiotherapy , March 1981, 77. Feuerstein, et al. "Categories of...improve the level and quality of student and faculty research in the HCA Graduate Program, we are in the process of formalizing a three-way relationship...among our graduate faculty, pre- ceptors and graduate students , and the Health Care Studies Division (HCSD) of the Academy. In this regard, we believe

  12. La Educacion Especial para Ninos con Impedimentos Desde Recien Nacidos Hasta Cinco Anos de Edad = Special Education for Handicapped Children Birth to Five.

    Science.gov (United States)

    New York State Education Dept. Albany. Office for the Education of Children with Handicapping Conditions.

    The manual, in Spanish, describes programs and resources available for preschool handicapped children and their families in conjunction with the New York State Education Department. Section 1 on assistance in securing services, reviews the service provided by Early Childhood Direction Centers, and outlines the role of local Committees on the…

  13. Documenting handicap situations and eliminations through Universal Design patterns

    Directory of Open Access Journals (Sweden)

    Ann Heylighen

    2009-11-01

    Full Text Available According to contemporary academic and social insights,human functional limitations and handicaps are not exclusively the result of the physical and / or mental characteristics of the individual (medical model, but theycan just as well be a consequence of a maladjustment of the social and physical environment (conflict / social model.This radical reversal of focus from person to environment,or in other words, from the assessment that the person isimpeded to the insight that the physical and socialenvironment is an impediment, has far-reaching consequences for the designing of human-made environments.The recent Universal Design paradigm extends beyond accommodating ‘modal’ users and aims to include the realdiversity of user populations, including those with physical and / or mental impairments and functional limitations. To achieve this, a large amount of design information in connection with human dis-abilities (limitations andpossibilities is required.Together with prescriptive laws and regulations, designers need descriptive information about; on the one hand,CONFLICTS between users and built environments, and onthe other hand, empirically evident design RESOLUTIONS. In response to this need, the paper advances the development of specific Universal Design Patterns (UD Patterns in order to collect and organise this information for decision makers and for designers.

  14. Model-based design validation for advanced energy management strategies for electrified hybrid power trains using innovative vehicle hardware in the loop (VHIL) approach

    International Nuclear Information System (INIS)

    Mayyas, Abdel Ra'ouf; Kumar, Sushil; Pisu, Pierluigi; Rios, Jacqueline; Jethani, Puneet

    2017-01-01

    Highlights: •Vehicle hardware In-the-loop VHiL testing and validation is implemented in vehicle test bed. •Torque at the roller bench test is used to control the torque at wheels to reflect vehicle electrification symptoms. •Electrified powertrain with Equivalent Consumption Minimization Strategy is tested and validated using VHiL. •Fuel economy and power train performance is measured using high precision fuel measurement device. -- Abstract: Hybridization of automotive powertrains by using more than one type of energy converter is considered as an important step towards reducing fuel consumption and air pollutants. Specifically, the development of energy efficient, highly complex, alternative drive-train systems, in which the interactions of different energy converters play an important role, requires new design methods and processes. This paper discusses the inclusion of an alternative hybrid power train into an existing vehicle platform for maximum energy efficiency. The new proposed integrated Vehicle Hardware In-the-loop (VHiL) and Model Based Design (MBD) approach is utilized to evaluate the energy efficiency of electrified powertrain. In VHiL, a complete chassis system becomes an integrated part of the vehicle test bed. A complete conventional Internal Combustion Engine (ICE) powered vehicle is tested in roller bench test for the integration of energy efficient hybrid electric power train modules in closed-loop, real-time, feedback configuration. A model that is a replica of the test vehicle is executed – in real-time- where all hybrid power train modules are included. While the VHiL platform is controlling the signal exchange between the test bed automation software and the vehicle on-board controller, the road load exerted on the driving wheels is manipulated in closed –loop real-time manner in order to reflect all hybrid driving modes including: All Electric Range (AER), Electric Power Assist (EPA) and blended Modes (BM). Upon successful

  15. Dental treatment for handicapped patients: sedation vs general anesthesia and update of dental treatment in patients with different diseases

    OpenAIRE

    Corcuera Flores, José Ramón; Delgado Muñoz, José María; Ruiz Villandiego, José Cruz; Maura Solivellas, Isabel; Machuca Portillo, Guillermo

    2014-01-01

    Dental treatment on Handicapped Patients is often difficult because many people with a wide range of ages (from children to the elderly) with different pathologies that can affect the oral cavity and differ widely are included in this group. This situation creates some controversy, because according to pathology, each patient will be treated differently depending on collaboration, general health status, age or medication used to treat this pathologies. According to this situation we can opt f...

  16. Using appreciative inquiry to help students identify strategies to overcome handicaps of their learning styles.

    Science.gov (United States)

    Kumar, Latha Rajendra; Chacko, Thomas Vengail

    2012-01-01

    In India, as in some other neighboring Asian countries, students and teachers are generally unaware of the differences in the learning styles among learners, which can handicap students with learning styles alien to the common teaching/learning modality within the institution. This study aims to find out whether making students aware of their learning styles and then using the Appreciative Inquiry approach to help them discover learning strategies that worked for them and others with similar learning styles within the institution made them perceive that this experience improved their learning and performance in exams. The visual, auditory, read-write, and kinesthetic (VARK) inventory of learning styles questionnaire was administered to all 100 first-year medical students of the Father Muller's Medical College in Mangalore India to make them aware of their individual learning styles. An Appreciate Inquiry intervention was administered to 62 student volunteers who were counseled about the different learning styles and their adaptive strategies. Pre and post intervention change in student's perception about usefulness of knowing learning styles on their learning, learning behavior, and performance in examinations was collected from the students using a prevalidated questionnaire. Post intervention mean scores showed a significant change (P learning style and discovering strategies that worked within the institutional environment. There was agreement among students that the intervention helped them become more confident in learning (84%), facilitating learning in general (100%), and in understanding concepts (100%). However, only 29% of the students agreed that the intervention has brought about their capability improvement in application of learning and 31% felt it improved their performance in exams. Appreciate Inquiry was perceived as useful in helping students discover learning strategies that work for different individual learning styles and sharing them within

  17. Translation and validation of Moroccan Western Ontario and McMaster Universities (WOMAC) osteoarthritis index in knee osteoarthritis.

    Science.gov (United States)

    Faik, A; Benbouazza, K; Amine, B; Maaroufi, H; Bahiri, R; Lazrak, N; Aboukal, R; Hajjaj-Hassouni, N

    2008-05-01

    The aim of this study is to assess the reliability and validity of the Western Ontario and McMaster University Osteoarthritis Index (WOMAC) in Moroccan patients with knee osteoarthritis. The WOMAC was translated and back translated to and from dialectal Arabic, pre-tested and reviewed by a committee following the Guillemin criteria. The Moroccan version of the WOMAC was administered twice during a 24-48 h interval to 71 Moroccan patients with symptomatic knee osteoarthritis, fulfilling the revised criteria of the American College of Rheumatology. The test-retest reliability was assessed using intra-class correlation coefficient, and the Bland and Altman method. Internal consistency was assessed by Cronbach's alpha coefficient. Construct validity was tested by correlating the WOMAC subscales with visual analogic scale (VAS) of pain, VAS of handicap, maximum distance walked and clinical characteristics. The Moroccan version of the WOMAC showed good reliability, with ICC values of the three dimensions: pain, stiffness and physical function being 0.80, 0.77 and 0.89, respectively. Bland and Altman analysis showed that means of differences did not differ significantly from 0 and that no systematic trend was observed. Internal consistency with Cronbach's alpha for pain was found to be 0.76, and its equivalents for stiffness and physical function subscales were evaluated at 0.76, 0.90, respectively. Construct validity showed statistically significant correlation with all WOMAC subscales and VAS of pain (rho=0.38, 0.42, 0.63 respectively, P<0.01). Correlation between VAS handicap (rho=0.38 P<0.001) and maximum distance walked (rho=-0.40, P<0.01) was observed with physical function subscale. There was no correlation between age, duration of disease, BMI and severity of pain and physical function in knee OA. The Moroccan version of the WOMAC is a comprehensible, reliable, and valid instrument to measure outcome in patients with knee OA.

  18. Correlation between morphological characteristics in spectral-domain-optical coherence tomography, different functional tests and a patient's subjective handicap in acute central serous chorioretinopathy.

    Science.gov (United States)

    Gerendas, Bianca S; Kroisamer, Julia-Sophie; Buehl, Wolf; Rezar-Dreindl, Sandra M; Eibenberger, Katharina M; Pablik, Eleonore; Schmidt-Erfurth, Ursula; Sacu, Stefan

    2018-01-16

    The purpose of this study was to identify quantitatively measurable morphologic optical coherence tomography (OCT) characteristics in patients with an acute episode of central serous chorioretinopathy (CSC) and evaluate their correlation to functional and psychological variables for their use in daily clinical practice. Retinal thickness (RT), the height, area and volume of subretinal fluid (SRF)/pigment epithelium detachments were evaluated using the standardized procedures of the Vienna Reading Center. These morphologic characteristics were compared with functional variables [best-corrected visual acuity (BCVA), contrast sensitivity (CS), retinal sensitivity/microperimetry, fixation stability], and patients' subjective handicap from CSC using the National Eye Institute 25-item Visual Function Questionnaire (NEI VFQ-25). Data from 39 CSC patients were included in this analysis. Three different SRF height measures showed a high negative correlation (r = -0.7) to retinal sensitivity within the central 9°, which was also negatively correlated with SRF area and volume (r = -0.6). The CS score and fixation stability (fixation points within 2°) showed a moderate negative correlation (r = -0.4) with SRF height variables. Comparison of the subjective handicap with morphological characteristics in spectral-domain (SD)-OCT showed SRF height had the highest correlation (r = -0.4) with the subjective problems reported and overall NEI VFQ-25 score. In conclusion, SRF height measured in SD-OCT showed the best correlation with functional variables and patients' subjective handicap caused by the disease and therefore seems to be the best variable to look at in daily clinical routine. Even though area and volume also show a correlation, these cannot be so easily measured as height and are therefore not suggested for daily clinical routine. © 2018 Acta Ophthalmologica Scandinavica Foundation. Published by John Wiley & Sons Ltd.

  19. Evaluation of the Vocational Preparation and Success of Handicapped Individuals Who Reside in Rural Areas of Florida. Florida Rural Research Project. Final Report.

    Science.gov (United States)

    Budd, Diane M.

    Phase 2 of a three-phase project examined the secondary education background and employment adjustment of handicapped youth in rural counties in Florida. (Phase 1 was a pilot study.) Subjects were former special education students in five rural project counties who had been identified as needing services in the area of educable mental retardation,…

  20. Task Force on Women, Minorities and the Handicapped in Science and Technology: Executive Session. Report of the Proceedings (Cambridge, Massachusetts, April 8, 1988).

    Science.gov (United States)

    Task Force on Women, Minorities, and the Handicapped in Science and Technology, Washington, DC.

    The Task Force on Women, Minorities, and the Handicapped in Science and Technology was established by the U.S. Congress in Public Law 99-383 with the purpose of developing a long-range plan for broadening participation in science and engineering. Public hearings were held in Albuquerque (New Mexico), Atlanta (Georgia), Baltimore (Maryland), Boston…

  1. Task Force on Women, Minorities and the Handicapped in Science and Technology: Public Hearing. Report of the Proceedings (Cambridge, Massachusetts, April 7, 1988).

    Science.gov (United States)

    Task Force on Women, Minorities, and the Handicapped in Science and Technology, Washington, DC.

    The Task Force on Women, Minorities, and the Handicapped in Science and Technology was established by the U.S. Congress in Public Law 99-383 with the purpose of developing a long-range plan for broadening participation in science and engineering. Public hearings were held in Albuquerque (New Mexico), Atlanta (Georgia), Baltimore (Maryland), Boston…

  2. Task Force on Women, Minorities and the Handicapped in Science and Technology: Executive Session. Report of the Proceedings (Atlanta, Georgia, March 3, 1988).

    Science.gov (United States)

    Task Force on Women, Minorities, and the Handicapped in Science and Technology, Washington, DC.

    The Task Force on Women, Minorities, and the Handicapped in Science and Technology was established by the U.S. Congress in Public Law 99-383 with the purpose of developing a long-range plan for broadening participation in science and engineering. Public hearings were held in Albuquerque (New Mexico), Atlanta (Georgia), Baltimore (Maryland), Boston…

  3. The self-serving function of hypochondriacal complaints: physical symptoms as self-handicapping strategies.

    Science.gov (United States)

    Smith, T W; Snyder, C R; Perkins, S C

    1983-04-01

    The present experiment tested the hypothesis that hypochondriacal individuals commonly use reports of physical illness and symptoms as a strategy to control attributions made about their performances in evaluative settings (i.e., self-handicapping strategies). Specifically, it was predicted that hypochondriacal individuals would report more recent physical illness and complaints and more current physical symptoms in an evaluative setting in which poor health could serve as an alternative explanation for poor performance than would either individuals in an evaluative setting in which poor health was precluded as an excuse or individuals in a nonevaluative setting. As predicted, results supported this self-protective pattern of complaints in a hypochondriacal sample but not in a nonhypochondriacal group. The self-protective role of hypochondriacal behavior is discussed in relation to other theory and research on the nature and treatment of hypochondriasis.

  4. Achados oftalmológicos em pacientes com múltiplas deficiências Ophthalmologic findings in multiple handicapped patients

    Directory of Open Access Journals (Sweden)

    Maria Cecília Remígio

    2006-12-01

    Full Text Available OBJETIVO: Relatar os achados oftalmológicos em portadores de múltiplas deficiências. MÉTODOS: Foram estudados 274 usuários do Sistema Único de Saúde atendidos no Departamento de Oftalmologia Pediátrica e Estrabismo da Fundação Altino Ventura (FAV, no período de junho a setembro de 2004. RESULTADOS: A freqüência dos pacientes quanto ao gênero foi de 58,5% para o masculino e 41,5% para o feminino. A variação das idades foi de 0,1 a 20 anos com mediana de 5. A maioria (61,3% dos pacientes apresentava boa acuidade visual, contudo 38,7% apresentava baixa de visão (PURPOSE: To report the visual findings in patients with multiple handicaps. METHODS: Two hundred and seventy-four patients cared for at the Pediatric and Strabismus Ophthalmology Department of the "Fundação Altino Ventura" - Brazilian National Health System, were examined from June to September 2004. Age varied from 0.1 to 20 years with a median of 5. RESULTS: The majority of the patients (61.3% presented good visual acuity; however low visual acuity (< 20/80 was observed in 38.7% of the patients. Heterotropias were observed in 66 patients (24.0%; astigmatism (53.2% and hyperopia (29.0% were more frequent. CONCLUSION: Children with multiple handicaps need an early ophthalmologic diagnosis and treatment for better global development. The integration of a multidisciplinary team with pediatricians, pediatric ophthalmologists and specialists in low vision, may assure a better visual rehabilitation.

  5. Vnímání barev žákem s mentálním postižením Perception of colours by mentally-handicapped pupils

    Directory of Open Access Journals (Sweden)

    Olga Krejčířová

    2006-02-01

    Full Text Available Předložená stať se pokouší o využití obecných poznatků o barvách v oblasti tělesné kultury a aplikuje je na tělesnou výchovu v podmínkách speciálních škol. Vychází z předpokladu, že vzdělávání žáků s mentálním postižením by mělo probíhat za podmínek, které v nich evokují libé pocity. A k těmto podmínkám patří i barevnost. Jsou prezentovány výsledky šetření preference barev probandy s lehkým a středně těžkým mentálním postižením. Výsledky naznačují, že probandi s lehkým mentálním postižením mají tendenci citlivě vnímat barvy, a to i v abstraktní podobě. Preferují modrou, případně zelenou a červenou barvu a hůře přijímají černou a fialovou. Preference oblíbené barvy je u probandů s těžším mentálním postižením více variabilní než u probandů s lehkým mentálním postižením. The following article attempts to utilize general knowledge of colours in the sphere of physical culture and applies it to physical education in special schools. It is based on the precondition that education of mentally-handicapped pupils should proceed under conditions evoking pleasurable feelings in them. And such conditions also include colours. The article presents the results of an examination of colour preference in probands with slight to moderate mental handicaps. The results show that probands with a slight mental handicap tend to be sensitive in relation to colours, even in their abstract form. They prefer blue, respectively green and red, and they have difficulties with perception of black and violet. The favourite colour preference in probands with a more serious mental handicap is more variable than in probands with a slight mental handicap.

  6. Achievement Goal Orientations and Self Handicapping as Mediator and Moderator of the Relationship between Intrinsic Achievement Motivation and Negative Automatic Thoughts in Adolescence Students

    Science.gov (United States)

    Kapikiran, Sahin

    2012-01-01

    The main purpose of this study was to examine the mediator and moderator role of self-handicapping and achievement goal orientations variables on the relationship between negative automatic thoughts intrinsic achievement motivation in high school students. 586 high school students, ranging in age from 14 to 20 (M = 16.08), adolescence students…

  7. Effects of Binaural Sensory Aids on the Development of Visual Perceptual Abilities in Visually Handicapped Infants. Final Report, April 15, 1982-November 15, 1982.

    Science.gov (United States)

    Hart, Verna; Ferrell, Kay

    Twenty-four congenitally visually handicapped infants, aged 6-24 months, participated in a study to determine (1) those stimuli best able to elicit visual attention, (2) the stability of visual acuity over time, and (3) the effects of binaural sensory aids on both visual attention and visual acuity. Ss were dichotomized into visually handicapped…

  8. The Development of a Consumer Input Program for the National Library Service for the Blind and Physically Handicapped (NLS/BPH) and Network Libraries. Final Report.

    Science.gov (United States)

    Cavenaugh, David

    This document presents a review of the current consumer relations activites of the National Library Service (NLS) for the Blind and Physically Handicapped of the Library of Congress, and an overall plan to improve NLS receipt of user suggestions, comments, opinions, or complaints through libraries which form the nationwide NLS distribution system.…

  9. Validation of the Italian Version of the Dizziness Handicap Inventory, the Situational Vertigo Questionnaire, and the Activity-Specific Balance Confidence Scale for Peripheral and Central Vestibular Symptoms

    Directory of Open Access Journals (Sweden)

    Silvia Colnaghi

    2017-10-01

    Full Text Available Neurophysiological measurements of the vestibular function for diagnosis and follow-up evaluations provide an objective assessment, which, unfortunately, does not necessarily correlate with the patients’ self-feeling. The literature provides many questionnaires to assess the outcome of rehabilitation programs for disequilibrium, but only for the Dizziness Handicap Inventory (DHI is an Italian translation available, validated on a small group of patients suffering from a peripheral acute vertigo. We translated and validated the reliability and validity of the DHI, the Situational Vertigo Questionnaire (SVQ, and the Activities-Specific Balance Confidence Scale (ABC in 316 Italian patients complaining of dizziness due either to a peripheral or to a central vestibular deficit, or in whom vestibular signs were undetectable by means of instrumental testing or clinical evaluation. Cronbach’s coefficient alpha, the homogeneity index, and test–retest reproducibility, confirmed reliability of the Italian version of the three questionnaires. Validity was confirmed by correlation test between questionnaire scores. Correlations with clinical variables suggested that they can be used as a complementary tool for the assessment of vestibular symptoms. In conclusion, the Italian versions of DHI, SVQ, and ABC are reliable and valid questionnaires for assessing the impact of dizziness on the quality of life of Italian patients with peripheral or central vestibular deficit.

  10. L’intégration scolaire des enfants handicapés en France: Etat du problème

    OpenAIRE

    Tomkiewicz, Stanislaw

    1991-01-01

    Le principe de l’intégration scolaire des enfants handicapés, posé en 1975, a fait naître de grands espoirs et de grandes craintes surtout après 1982. J’ai examiné ici l’état de l’intégration en 1989, ses avantages et ses dangers, les résistances des différents groupes intéressés et les limites de la politique intégrative. RESUMO: O principio da integraçâo escolar das crianças com di ficuldades, colocada em 1975, fez aparecer grandes esperanças e grandes crenças, so...

  11. Design and evaluation of nonverbal sound-based input for those with motor handicapped.

    Science.gov (United States)

    Punyabukkana, Proadpran; Chanjaradwichai, Supadaech; Suchato, Atiwong

    2013-03-01

    Most personal computing interfaces rely on the users' ability to use their hand and arm movements to interact with on-screen graphical widgets via mainstream devices, including keyboards and mice. Without proper assistive devices, this style of input poses difficulties for motor-handicapped users. We propose a sound-based input scheme enabling users to operate Windows' Graphical User Interface by producing hums and fricatives through regular microphones. Hierarchically arranged menus are utilized so that only minimal numbers of different actions are required at a time. The proposed scheme was found to be accurate and capable of responding promptly compared to other sound-based schemes. Being able to select from multiple item-selecting modes helps reducing the average time duration needed for completing tasks in the test scenarios almost by half the time needed when the tasks were performed solely through cursor movements. Still, improvements on facilitating users to select the most appropriate modes for desired tasks should improve the overall usability of the proposed scheme.

  12. Coefficients of Correlation of IQ's on the WAIS-R with Standard Age Scores on the Stanford-Binet, 4th Edition for Previously Identified Mentally Handicapped Adolescents.

    Science.gov (United States)

    Richardson, John C.

    This paper presents a study regarding the correlation of the Stanford-Binet: 4th Edition Intelligence Quotient (IQ) scores with the Wechsler Adult Intelligence Scale-Revised (WAIS-R) IQ scores for the purpose of improving the identification process for educable mentally handicapped (EMH) school age adolescents and young adults. The sample included…

  13. Current and Past Research on Autistic Children and Their Families. Conducted by Division TEACCH (Treatment and Education of Autistic and Related Communication Handicapped Children). TEACCH Research Report.

    Science.gov (United States)

    Schopler, Eric

    This report summarizes research conducted by, or in collaboration with, the Division TEACCH (Treatment and Education of Autistic and related Communication handicapped CHildren) of the Department of Psychiatry in the University of North Carolina School of Medicine at Chapel Hill. The summaries contain bibliographic citations for published papers…

  14. Political philosophy, ethnology, and time: a study of the notion of historical handicap

    Directory of Open Access Journals (Sweden)

    João Feres Jr

    2002-06-01

    Full Text Available This article starts by identifying the crucial importance of the notion of historical handicap for the present-day social sciences of Latin America. Such notion is not an original invention made by Latinamericanists. On the contrary, I demonstrate that the genealogy of the notion of historical handicap must be sought in the tradition of Western political philosophy. Such genealogy must take into account the way it was integrated into ethnological descriptions. When and how did the Other become the backward, the primitive? While this relation was secondary for ancient Greek thought, theories of historical development became the main source of ethnological categories in the modern era. Interestingly enough, this modern synthesis suited the practical purpose of justifying two successive waves of European imperialistic: the era of discoveries, and 19th century colonialism. The article concludes by raising questions about the present role and application of the social sciences.Esse artigo começa por identificar o papel central da noção de incapacidade histórica para a literatura de Latin American studies produzida no pós-guerra. Tal noção não foi criada pelos Latinoamericanistas contemporâneos. É possível identificar o embrião da noção de incapacidade histórica nos mitos primitivistas da antiguidade clássica e, a partir daí, examinar as várias maneiras com que ela foi recebida e rearticulada pela tradição filosófica ocidental. Esse estudo é feito tendo em vista a incorporação da noção de incapacidade histórica a teorias etnológicas. Quando e como o "outro" passou a ser visto como o "atrasado", o "primitivo"? Se na antiguidade clássica essa identificação era incompleta, na era moderna teorias de desenvolvimento histórico se tornaram a fonte principal de categorias etnológicas. É importante notar que a síntese moderna dessas teorias também serviram para justificar as aventuras imperialistas Européias: a era dos

  15. Manual of Procedures for Applying for Funding under Title VI, Part B--Education of the Handicapped Act. P.L. 91-230 as Amended by P.L. 93-320, P.L. 94-142 and P.L. 99-457. EHA, Title VI, Part B--Third Year of a Three-Year Plan, 1988-89. ECIA, Chapter 1, Handicapped Preschool Grant Program.

    Science.gov (United States)

    North Carolina State Dept. of Public Instruction, Raleigh. Div. for Exceptional Children.

    The manual presents procedures for local school districts in North Carolina applying for federal funding under Title VI, Part B, Education of the Handicapped Act, as amended by Public Laws 93-320, 94-142, and 99-457. The first chapter gives instructions for submission of amendments for the third year of the 3-year plan and includes an introduction…

  16. B lymphocyte selection and age-related changes in VH gene usage in mutant Alicia rabbits.

    Science.gov (United States)

    Zhu, X; Boonthum, A; Zhai, S K; Knight, K L

    1999-09-15

    Young Alicia rabbits use VHa-negative genes, VHx and VHy, in most VDJ genes, and their serum Ig is VHa negative. However, as Alicia rabbits age, VHa2 allotype Ig is produced at high levels. We investigated which VH gene segments are used in the VDJ genes of a2 Ig-secreting hybridomas and of a2 Ig+ B cells from adult Alicia rabbits. We found that 21 of the 25 VDJ genes used the a2-encoding genes, VH4 or VH7; the other four VDJ genes used four unknown VH gene segments. Because VH4 and VH7 are rarely found in VDJ genes of normal or young Alicia rabbits, we investigated the timing of rearrangement of these genes in Alicia rabbits. During fetal development, VH4 was used in 60-80% of nonproductively rearranged VDJ genes, and VHx and VHy together were used in 10-26%. These data indicate that during B lymphopoiesis VH4 is preferentially rearranged. However, the percentage of productive VHx- and VHy-utilizing VDJ genes increased from 38% at day 21 of gestation to 89% at birth (gestation day 31), whereas the percentage of VH4-utilizing VDJ genes remained at 15%. These data suggest that during fetal development, either VH4-utilizing B-lineage cells are selectively eliminated, or B cells with VHx- and VHy-utilizing VDJ genes are selectively expanded, or both. The accumulation of peripheral VH4-utilizing a2 B cells with age indicates that these B cells might be selectively expanded in the periphery. We discuss the possible selection mechanisms that regulate VH gene segment usage in rabbit B cells during lymphopoiesis and in the periphery.

  17. A comunicação como barreira à inclusão de alunos com deficiência visual em aulas de mecânica Communication as a barrier for including visual handicapped pupils in mechanics classes

    Directory of Open Access Journals (Sweden)

    Eder Pires de Camargo

    2010-01-01

    Full Text Available O presente artigo encontra-se inserido em um estudo que busca compreender as principais barreiras para a inclusão de alunos com deficiência visual no contexto do ensino de física. Focalizando aulas de mecânica, analisa as dificuldades comunicacionais entre licenciandos e discentes com deficiência visual. Para tal, enfatiza as estruturas empírica e semântico-sensorial das linguagens utilizadas, indicando fatores geradores de dificuldades de acessibilidade às informações veiculadas. Recomenda, ainda, alternativas que se destinam a dar condições à participação efetiva do discente com deficiência visual no processo comunicativo. Conclui afirmando que a comunicação representa a principal barreira à participação efetiva de alunos com deficiência visual em aulas de mecânica, e enfatiza a importância da criação de canais comunicacionais adequados como condição básica à inclusão desses alunos.This paper is a part of a broader study aiming to understand the main barriers for including visual handicapped pupils in physics' teaching contexts. It analyzes communication difficulties between future physics teachers and visual handicapped pupils during Mechanics classes. It emphasizes the empirical and semantic-sensorial structures of the languages used, indicating factors which produce the accessibility difficulties for the spread of information. It recommends alternatives in order to make possible the effective participation of visual handicapped pupils in the communicative process. It concludes that communication represents the main barrier to the effective visual handicapped pupils' participation in optics classes and emphasizes the importance of creating communicatively appropriate channels as a basic condition for including these students.

  18. Mental health problems in adolescents with cochlear implants: Peer problems persist after controlling for additional handicaps

    Directory of Open Access Journals (Sweden)

    Maria eHuber

    2015-07-01

    Full Text Available The aims of the present multi-center study were to investigate the extent of mental health problems in adolescents with a hearing loss and cochlear implants (CIs in comparison to normal hearing (NH peers and to investigate possible relations between the extent of mental health problems of young CI users and hearing variables, such as age at implantation, or functional gain of CI. The survey included 140 adolescents with CI (mean age = 14.7, SD = 1.5 years and 140 NH adolescents (mean age = 14.8, SD = 1.4 years, their parents and teachers. Participants were matched by age, gender and social background. Within the CI group, 35 adolescents were identified as risk cases due to possible and manifest additional handicaps, and 11 adolescents were non-classifiable. Mental health problems were assessed with the Strengths and Difficulties Questionnaire (SDQ in the versions Self, Parent, and Teacher. The CI group showed significantly more Peer Problems than the NH group. When the CI group was split into a risk-group (35 risk cases and 11 non-classifiable persons and a non-risk group (n = 94, increased peer problems were perceived in both CI subgroups by adolescents themselves. However, no further differences between the CI non-risk group and the NH group were observed in any rater. The CI-risk group showed significantly more hyperactivity compared to the NH group and more hyperactivity and conduct problems compared to the CI non-risk group. Cluster analyses confirmed that there were significantly more adolescents with high problems in the CI-risk group compared to the CI non-risk group and the NH group. Adolescents with CI, who were able to understand speech in noise had significantly less difficulties compared to constricted CI users. Parents, teachers, and clinicians should be aware that CI users with additionally special needs may have mental health problems. However, peer problems were also experienced by CI adolescents without additional handicaps

  19. A study on CT findings and electroencephalographic findings in severely handicapped children

    International Nuclear Information System (INIS)

    Nakashima, Masao; Nishimura, Masaaki; Kachi, Shozo; Sugimoto, Kimiyuki; Saito, Msahiko; Yamada, Shigeaki; Kameyama, Yoshio; Tanaka, Minoru; Hiraizumi, Yasuhisa.

    1987-01-01

    Sleep electroencephalographic (EEG) and computed tomographic (CT) features were examined in 40 institutionalized severely handicapped persons. Cranial CT appearance fell into five major types: (I) no abnormal findings (n=2), (II) generalized brain atrophy (n=16), (III) diffuse parenchymal disturbance (n=10), (IV) brain malformation (n=4), and (V) localized brain disturbance (n=8). In the I group, one person had normal EEG findings as well, but another person had the presence of focal spikes without spindles on EEG. Five of the II group had no abnormal EEG findings; ten had abnormality in basic waves and/or localized paroxysmal waves; and one had generalized spike-and-slow wave complex. All persons in the III group had flattening or disappearance of spindle waves. In the IV group, two persons with cerebral malformation and one with linear nevus sebaceous syndrome in association with hypoplasia of the cerebral hemisphere had abnormality in basic waves and localized paroxysmal waves. In the remaining one person with deficit of vermis cerebelli, there was no EEG abnormality. Among the last group of persons, there was no EEG abnormality corresponding to CT features. (Namekawa, K)

  20. [Experience of Handicap International in providing humanitarian relief in region near Aceh, Indonesia from March 1 to 27, 2005].

    Science.gov (United States)

    Gillet, Y

    2005-01-01

    This report describes the experience of the author in March 2005 during the relief efforts deployed in the region near Aceh, Indonesia (North Sumatra) by Handicap International, one of the 400 NGO that provided humanitarian aid following the tsunami disaster that struck Southeast Asia on December 26, 2004. Working in Banda Aceh and Meulaboh, the author was confronted with the extent of the devastation both in terms of property damage and human suffering. Clinical cases were often severe and rarely encountered in industrialized countries. The tsunami worsened the already poor sanitary conditions: rundown care facilities, poorly trained health care personnel, tropical disease, poor hygiene, and AVP.