WorldWideScience

Sample records for halley watch ihw

  1. IHW COMET HALLEY LSPN NON-DIGITIZED IMAGES V1.0

    Data.gov (United States)

    National Aeronautics and Space Administration — NASA's International Halley Watch (IHW) has created a Comet Halley Archive. The collection of data spans the full wavelength range as submitted by scientists to the...

  2. International Halley Watch: Discipline specialists for spectroscopy and spectrophotometry

    Science.gov (United States)

    Wyckoff, S.; Feston, M. C.; Wehinger, P.

    1986-01-01

    Spectroscopic observations of Comets P/Crommelin, P/Giacobini-Zinner and P/Halley are coordinated, preliminary results are delivered to the astronomical community and the data collected from observers throughout the world are archived. The ASU IHW Center has the additional responsibility of maintaining the IHW Electronic Bulletin Board which reports real-time information on the status of Comet P/Halley. Access to this electronic bulletin board via telephone modem connection is available to any astronomer upon request.

  3. International Halley Watch: Discipline specialists for near-nucleus studies

    Science.gov (United States)

    Larson, S.; Sekanina, Z.; Rahe, J.

    1986-01-01

    The purpose of the Near-Nucleus Studies Net is to study the processes taking place in the near-nucleus environment as they relate to the nature of nucleus. This is accomplisghed by measuring the spatial and temporal distribution of dust, gases and ions in the coma on high resolution images taken from many observatories around the world. By modeling the motions of discrete dust features in Comet Halley, it is often possible to determine the locations of the emission sources on the surface and learn about the nucleus structure. In addition to the general goals shared by all IHW nets, the scientific goals of the net has been to determine (1)the gross surface structure of the nucleus, (2)the nucleus spin vector, (3)the distribution and evolution of jet sources and (4)the interrelationships between the gas, dust and ion components of the coma. An additional Comet Giacobini-Zinner watch was carried out by the NNSN in support of the NASA International Cometary Explorer flyby.

  4. International Halley watch amateur observers' manual for scientific comet studies. Part 1: Methods

    Science.gov (United States)

    Edberg, S. J.

    1983-01-01

    The International Halley Watch is described as well as comets and observing techniques. Information on periodic Comet Halley's apparition for its 1986 perihelion passage is provided. Instructions are given for observation projects valuable to the International Halley Watch in six areas of study: (1) visual observations; (2) photography; (3) astrometry; (4) spectroscopic observations; (5) photoelectric photometry; and (6) meteor observations.

  5. The Photometric lightcurve of Comet 1P/Halley

    Science.gov (United States)

    Bair, Allison N.; Schleicher, David G.

    2014-11-01

    Comet 1P/Halley is considered an important object for a number of reasons. Not only is it the first-identified and brightest periodic comet, being the only periodic comet visible to the naked eye at every apparition, but in 1986 Halley became the first comet to be imaged by fly-by spacecraft. The NASA-funded International Halley Watch (IHW) directly supported the spacecraft by providing narrowband filters for groundbased photometric observations, and until the arrival of Hale-Bopp (1995 O1), Halley was the subject of the largest groundbased observational campaign in history. Following considerable controversy regarding its rotation period, it was eventually determined to be in complex rotation -- the first comet to be so identified. While the overall brightness variations of the coma repeated with a period of about 7.4 days, the detailed period and shape of the lightcurve constantly evolved. The determination of the specific characteristics of each of the two components of its non-principal axis rotational state has remained elusive.To resolve this situation we have now incorporated all of the narrowband photometry, taken by 21 telescopes from around the world and submitted to the IHW archive, to create the most complete homogeneous lightcurve possible. Using measurements of three gas species and the dust, the lightcurve was investigated and found to alternate between a double- and triple-peaked shape, with no single feature being present throughout the entire duration of our dataset (316 days). The apparent period as a function of time was extracted and seen to vary in a step-wise manner between 7.27 and 7.60 days. Taken together, these results were used to produce a synthetic lightcurve revealing Halley's behavior even when no data were available. Details of this and other results, to be used to constrain future detailed modeling, will be presented. This research is supported by NASA's Planetary Atmospheres Program.

  6. The exploration of Halley's comet - An example of international cooperation

    Science.gov (United States)

    Rahe, Jurgen H.; Newburn, Ray L., Jr.

    1987-01-01

    The history of international cooperation in studies of comets started with observations in 1577 and 1680, when Tycho Brahe and Newton, respectively, collected position measurements made in different countries to determine the paths of the comets observed. In the fall of 1979, a worldwide Comet Halley watch was proposed. As a result of international cooperation, Comet Halley was explored during its recent appearance from the ground, earth orbit, Venus orbit, interplanetary space, and from within the comet itself. The various activities in space were coordinated by the ESA, the USSR Intercosmos, the Japanese ISAS, and NASA, through the Inter-Agency Consultative Group. The activities of the ground-based observers were coordinated by the International Halley Watch.

  7. Near-nucleus optical observations of P/Halley

    International Nuclear Information System (INIS)

    Larson, S.M.

    1987-01-01

    The Near-Nucleus Studies Net of the International Halley Watch has obtained an extensive series of high resolution optical images of P/Halley during its most active phases in 1985-86 which may be useful in interpreting radio observations of Comet Halley. They often show coma structure resulting from anisotropic emission of dust and gas from the inhomogeneous nucleus. Images were obtained in broadband spectral regions to study dust coma morphology, and in medium to narrow spectral bands to isolate the principal emissions of CN, C 3 , C 2 , CO + and H 2 O + . The goals and methods of near-nucleus studies are discussed and recent studies of 1910 images are briefly reviewed. The role of dust jets and cometary activity in P/Halley is discussed and several examples of anisotropic emission of dust during the current apparition are shown. 12 references

  8. Peter Halley / Peter Halley ; interv. Tilman Baumgärtel

    Index Scriptorium Estoniae

    Halley, Peter

    2006-01-01

    Ameerika maalikunstnikust Peter Halley'st (sünd. 1953) ja tema loomingust, intervjuu kunstnikuga tema New Yorgi ateljees 30. XII 1999. Peter Halley võrgustikke kujutavatest maalidest, elektroonilise teadetetahvli The Thing ja Moodsa Kunsti Muuseumi veebilehekülje jaoks tehtud digitaalsetest töödest ning muust

  9. Ali, Cunich: Halley's Churches: Halley and the London Queen Anne Churches

    Science.gov (United States)

    Ali, Jason R.; Cunich, Peter

    2005-04-01

    Edmond Halley's enormous contribution to science has received much attention. New research adds an intriguing chapter to his story and concerns his hitherto unexplored association with the baroque architectural visionary Nicholas Hawksmoor, and some important Temple-inspired churches that were built in London in the early 1700s. We argue that Christchurch Spitalfields and St Anne's Limehouse, which were both started in the summer of 1714, were aligned exactly eastwards using ``corrected'' magnetic-compass bearings and that Halley influenced or aided Hawksmoor. By this time the men had probably known each other for 30 years and had recently worked together on the Clarendon Building in Oxford. Despite there being more than 1500 years of Chinese and about 500 years of Western compass technology at the time, these probably represent the first constructions planned using a modern-day ``scientific'' technique. The research also throws light on Halley's contended religious position.

  10. The Comet Halley Handbook: An Observer's Guide. Second Edition.

    Science.gov (United States)

    Yeomans, Donald K.

    This handbook contains information on: (1) the orbit of comet Halley; (2) the expected physical behavior of comet Halley in 1985-1986, considering brightness estimates, coma diameters, and tail lengths; (3) observing conditions for comet Halley in 1985-1986; and (4) observing conditions for the dust tail of comet Halley in 1985-1986. Additional…

  11. On LAM's and SAM's for Halley's rotation

    Science.gov (United States)

    Peale, Stanton J.

    1992-01-01

    Non principal axis rotation for comet Halley is inferred from dual periodicities evident in the observations. The modes where the spin axis precesses around the axis of minimum moment of inertia (long axis mode or LAM) and where it precesses around the axis of maximum moment of inertia (short axis mode or SAM) are described from an inertial point of view. The currently favored LAM model for Halley's rotation state satisfies observational and dynamical constraints that apparently no SAM can satisfy. But it cannot reproduce the observed post perihelion brightening through seasonal illumination of localized sources on the nucleus, whereas a SAM can easily produce post or pre perihelion brightening by this mechanism. However, the likelihood of a LAM rotation for elongated nuclei of periodic comets such as Halley together with Halley's extreme post perihelion behavior far from the Sun suggest that Halley's post perihelion brightening may be due to effects other than seasonal illumination of localized sources, and therefore such brightening may not constrain its rotation state.

  12. Nitrogen abundance in Comet Halley

    International Nuclear Information System (INIS)

    Wyckoff, S.; Tegler, S.C.; Engel, L.

    1991-01-01

    Data on the nitrogen-containing compounds that observed spectroscopically in the coma of Comet Halley are summarized, and the elemental abundance of nitrogen in the Comet Halley nucleus is derived. It is found that 90 percent of elemental nitrogen is in the dust fraction of the coma, while in the gas fraction, most of the nitrogen is contained in NH3 and CN. The elemental nitrogen abundance in the ice component of the nucleus was found to be deficient by a factor of about 75, relative to the solar photosphere, indicating that the chemical partitioning of N2 into NH3 and other nitrogen compounds during the evolution of the solar nebula cannot account completely for the low abundance ratio N2/NH3 = 0.1, observed in the comet. It is suggested that the low N2/NH3 ratio in Comet Halley may be explained simply by physical fractionation and/or thermal diffusion. 88 refs

  13. Comet Halley and its historic passages during the past millennium

    International Nuclear Information System (INIS)

    Legrand, J.P.

    1986-01-01

    The March 12, 1759 return of Comet Halley verified Halley's hypothesis on the existence of periodic comets and supported Newton's principle of universal attraction. Comet Halley's appearances before the 16th century are traced and it is noted that the length of the comet's tail has varied greatly. The comet's rendezvous with ESA's satellite Giotto is discussed briefly

  14. Inside look at Halley's comet

    International Nuclear Information System (INIS)

    Beatty, J.K.

    1986-01-01

    The 1985-1986 emergence of Halley's comet, the first since the advent of the space age, was explored by a variety of spacecraft. The Vega 1, launched by the USSR together with the Eastern-block alliance, passed 5523 miles from the comet's nucleus at 7:20:06 Universal time. It indicated that the comet was about 300 miles closer to the sun than had been predicted. The Japanese spacecraft, Suisei, was created to map the distribution of neutral hydrogen atoms outside Halley's visible coma. Its pictures indicated that the comet's output of water varied between 25 and 60 tons per second. Five days after the Vega 2's passage through the comet, the Giotto (sponsored by the European Space Agency) probe appeared. Giotto's close approach took place 3.1 minutes after midnight UT on March 14th; the craft had passed 376 miles from its target. Giotto's data indicated that the nucleus was bigger than expected, and that the comet was composed primarily of water, CO2 and N2. The Vegas and Giotto found that as the solar wind approaches Halley, it slows gradually and the solar magnetic lines embedded in the wind begin to pile up. Pick-up ions, from the comet's halo of neutral hydrogen, were found in this solar wind. Sensors on the Vega spacecraft found a variety of plasma waves propagating inside the bow wave. In order to synthesize all the results, a conference on the exploration of Halley's comet will be held this October

  15. Rationalization of Comet Halley's periods

    Science.gov (United States)

    Belton, Michael J. S.

    1990-01-01

    The sense of long axis orientation of Comet Halley during the Vega 1 encounter must be reversed from that deduced by Sagdeev et al. (1986) in order to harmonize the comet nucleus' Vega/Giotto-observed orientations with periodicities extracted from time-series brightness data. It is also demonstrated that Vega/Giotto observations can be satisfied by either a 2.2- or 3.7-day long-axis free precession period. A novel Fourier algorithm is used to reanalyze five independent data sets; strong evidence is adduced for periods harmonically related to a 7.4-day period. The preferred candidate models for Halley's nuclear rotation are characterized by a long-axis precession period of 3.7 days.

  16. Earth-return trajectory options for the 1985-86 Halley opportunity

    Science.gov (United States)

    Farquhar, R. W.; Dunham, D. W.

    1982-01-01

    A unique and useful family of ballistic trajectories to Halley's comet is described. The distinguishing feature of this family is that all of the trajectories return to the Earth's vicinity after the Halley intercept. It is shown that, in some cases, the original Earth-return path can be reshaped by Earth-swingby maneuvers to achieve additional small-body encounters. One mission profile includes flybys of the asteroid Geographos and comet Tempel-2 following the Halley intercept. Dual-flyby missions involving comets Encke and Borrelly and the asteroid Anteros are also discussed. Dust and gas samples are collected during the high-velocity (about 70 km/sec) flythrough of Halley, and then returned to a high-apogee Earth orbit. Aerobraking maneuvers are used to bring the sample-return spacecraft to a low-altitude circular orbit where it can be recovered by the Space Shuttle.

  17. Fast Variations In Spectrum of Comet Halley

    Science.gov (United States)

    Borysenko, S. A.

    The goal of this work is to research fast variations of spectral lines intensities in spectra of comet Halley. The present research was made on the basis of more then 500 high- resolution spectrogram obtained by L.M. Shulman and H.K. Nazarchuk in November- December, 1985 at the 6-m telescope (SAO, Russia). Some fast variations with different quasiperiods were detected in all the spectrograms. Quasiperiods of these variations were from 15 - 40 min to 1.5 - 2 hours. As data from spacecraft "Vega-2" show, more fast variations with quasiperiods 5 - 10 min are obviously present in cometary time variations. Only the most important lines so as C2, C3, CN, CH and NH2 were analyzed. False periods were checked by comparison of the power spectra of the variations with the computed spectral window of the data. Only false periods about 400 sec (the avarage period of exposition) were detected. An algorithm for analysis of locally Poisson's time series was proposed. Two types of fast variations are detected: 1)high amplitude variations with more long quasiperiods (1.5 - 2 hours) and the coefficient of crosscorrelations between line intensities about 0.9 - 0.95; 2)low amplitude variations with short periods (15 - 40 min), which look like white noise and have the coefficient of crosscorrelations about 0.1 - 0.3. This difference may be caused by nature of variations. The first type variations may be an effect of both active processes in cometary nucleus and streams of solar protons. Analysis of solar proton flux variation with energies >1 MeV in November - Decem- ber 1985 confirms the above-mentioned version. In the second case it may by only inner processes in the nucleus that generate the observed variations. For determination of general parameters of cometary atmosphere, such as the produc- tion rates of radicals C2, C3, CN, CH, and NH2 it was necessary to estimate the contri- bution of dust grains luminiscence into the continuum of the comet. Space and wave- length distribution

  18. Colour, albedo and nucleus size of Halley's comet

    Science.gov (United States)

    Cruikshank, D. P.; Tholen, D. J.; Hartmann, W. K.

    1985-01-01

    Photometry of Halley's comet in the B, J, V, and K broadband filters during a time when the coma was very weak and presumed to contribute negligibly to the broadband photometry is reported. The V-J and J-K colors suggest that the color of the nucleus of Halley's comet is similar to that of the D-type asteroids, which in turn suggests that the surface of the nucleus has an albedo less than 0.1.

  19. Halley's Comet: A Bibliography.

    Science.gov (United States)

    Freitag, Ruth S., Comp.

    Included in this bibliography are over 3,200 references to publications on Halley's Comet, its history, orbital motion, and physical characteristics, meteor streams associated with it, preparations for space missions to study it in 1986, and popular reaction to its appearances. Also cited are a few papers that, although they devote little…

  20. Eventos de Desconexao na Cauda de Plasma do Cometa P/Halley

    Science.gov (United States)

    Voelzke, M. R.; Fahr, H. J.

    2001-08-01

    Observacoes cometárias e de vento solar sao comparadas com o propósito de determinar-se as condicoes do vento solar associadas aos eventos de desconexao (DEs) observados em caudas de plasma cometárias. Os dados cometários sao provenientes do The International Halley Watch Atlas of Large-Scale Phenomena. A análise visual sistemática das imagens do atlas revelou, entre outras estruturas morfológicas, 47 DEs ao longo da cauda de plasma do P/Halley. Estes 47 DEs registrados em 47 imagens distintas permitiram a descoberta de 19 origens de DEs, ou seja, o tempo em que as desconexoes iniciaram foi calculado. Os dados do vento solar sao provenientes de medidas feitas in situ pela sonda espacial IMP-8, as quais foram usadas para elaborar a variacao da velocidade do vento solar, densidade e pressao dinâmica durante o intervalo analisado. O presente trabalho compara as atuais teorias conflitantes, baseadas nos mecanismos de formacao, com o intuito de explicar o fenômeno cíclico dos DEs, ou seja, os efeitos de producao iônica, os efeitos de pressao e os efeitos de reconexao magnética sao analisados. Para cada uma das 19 origens de DEs comparou-se a densidade com a respectiva velocidade do vento solar com o intuito de determinar-se uma possível correlacao entre estas origens e os efeitos de pressao dinâmica. Quando da ocorrência de 6 origens de DEs o IMP-8 nao realizou medidas, nos outros 13 casos 10 origens (77%) mostraram uma anticorrelacao entre velocidade e densidade e apenas 3 (23%) revelaram uma tendência similar entre velocidade e densidade. Portanto, a análise inicial demonstra uma fraca correlacao entre as origens dos DEs e os efeitos de pressao.

  1. New Image of Comet Halley in the Cold

    Science.gov (United States)

    2003-09-01

    VLT Observes Famous Traveller at Record Distance Summary Seventeen years after the last passage of Comet Halley , the ESO Very Large Telescope at Paranal (Chile) has captured a unique image of this famous object as it cruises through the outer solar system. It is completely inactive in this cold environment. No other comet has ever been observed this far - 4200 million km from the Sun - or that faint - nearly 1000 million times fainter than what can be perceived with the unaided eye. This observation is a byproduct of a dedicated search [1] for small Trans-Neptunian Objects, a population of icy bodies of which more than 600 have been found during the past decade. PR Photo 27a/03 : VLT image (cleaned) of Comet Halley PR Photo 27b/03 : Sky field in which Comet Halley was observed PR Photo 27c/03 : Combined VLT image with star trails and Comet Halley The Halley image ESO PR Photo 27a/03 ESO PR Photo 27a/03 [Preview - JPEG: 546 x 400 pix - 207k] [Normal - JPEG: 1092 x 800 pix - 614k] [FullRes - JPEG: 1502 x 1100 pix - 1.1M] Caption : PR Photo 27a/03 shows the faint, star-like image of Comet Halley (centre), observed with the ESO Very Large Telescope (VLT) at the Paranal Observatory on March 6-8, 2003. 81 individual exposures from three of the four 8.2-m VLT telescopes with a total exposure time of about 9 hours were combined to show the magnitude 28.2 object. At this time, Comet Halley was about 4200 million km from the Sun (28.06 AU) and 4080 million km (27.26 AU) from the Earth. All images of stars and galaxies in the field were removed during the extensive image processing needed to produce this unique image. Due to the remaining, unavoidable "background noise", it is best to view the comet image from some distance. The field measures 60 x 40 arcsec 2 ; North is up and East is left. Remember Comet Halley - the famous "haired star" that has been observed with great regularity - about once every 76 years - during more than two millennia? Which was visited by an

  2. Properties of comet Halley derived from thermal models and astrometric data

    International Nuclear Information System (INIS)

    Hechler, F.W.; Morley, T.A.; Mahr, P.

    1986-01-01

    The motion of a comet nucleus is influenced by outgassing forces. The orbit determination from astrometric data of comet Halley using empiric force and observation bias models and the incorporation of thermal models developed at ESOC into the orbit determination allows to draw some conclusions on the comet Halley dynamics and physics. 21 references

  3. Encounter with comet Halley

    International Nuclear Information System (INIS)

    Sagdeev, R.Z.

    1989-01-01

    This paper reports on an international armada of six spacecraft which encountered the comet Halley and performed in-situ measurements. These encounters led to the discovery of a number of cometary plasma physics phenomena. Another important result was that a value for the average density of the cometary nucleus could be estimated, which is found to be compatible with snow ball models for the nucleus

  4. VEGA1 HALLEY FLYBY MAGNETOMETER DATA

    Data.gov (United States)

    National Aeronautics and Space Administration — On MARCH 6, 1986, AT 7:20:06 UT, the Vega spacecraft passed the nucleus of comet Halley at a distance of 8,890 km with a relative velocity of 78 km/s. The magnetic...

  5. Comet Halley: An optical continuum study

    International Nuclear Information System (INIS)

    Hoban, S.M.

    1989-01-01

    From an analysis of narrowband CCD images of Comet Halley from 1986 January, March, and April, certain dust structures which are redder than the remainder of the dust coma have become apparent. Mie calculations suggest that this reddening is due to an enhancement of particles with sizes comparable to the observing wavelengths. Although the mass range derived from the calculations presented here is somewhat uncertain as a result of the limitations of Mie theory, these values are in the expected range derived from the calculations presented here is somewhat uncertain as a result of particle sizes which would be both sensitive to radiation pressure and significantly reddened with respect to the solar spectrum at the observing wavelengths. Thus, the red envelopes are plausibly the result of size sorting by solar radiation pressure. The red jets observed on 1986 January 10, March 1 and March 9 can then be explained by the enhanced dust flux at the jet sources, and the subsequent trapping of a relative excess of intermediate mass (i.e. red) particles into the jets which are visible in the continuum images. Analysis of narrowband photometry of the optical continuum of Comet Halley reveals no correlation between the color of the dust and heliocentric distance, phase angle, strength of the continuum or gas-to-dust ratio. The photometric data are thus consistent with a post-ejection sorting mechanism. Chemical inhomogeneities of the nucleus are therefore not necessary to explain the observed structure in the color of the dust in Comet Halley

  6. NASA Infrared Telescope Facility Comet Halley monitoring program 2: Post-perihelion results

    International Nuclear Information System (INIS)

    Tokunaga, A.T.; Golisch, W.F.; Griep, D.M.; Kaminski, C.D.; Hanner, M.S.

    1988-01-01

    The post perihelion results of a 1 to 20 micrometer infrared monitoring program of Comet Halley are presented. These results complement previous observations of the pre-perihelion passages of Halley. The observations cover the time period of Mar. 1986 to the present time. During the time the comet was observable, two or more observations were obtained per month. The most interesting results were: (1) a detectable change in the J-H and H-K colors of Halley, and (2) a search for a nucleus rotation at J during 20 Feb. to 10 Mar. was unsuccessful. The perihelion J-H and K-K colors were constant at 0.48 + or - 0.01 and 0.17, respectively. A preliminary reduction of the data is given. It is concluded that the colors were at first similar to pre-perihelion and then changed from July onward to be bluer and more similar to the solar colors. This suggests that a change may have occurred in the composition of the dust coma of Halley in July 1986

  7. IUE observations of the evolution of Comet Wilson (1986l) - comparison with P/Halley

    International Nuclear Information System (INIS)

    Roettger, E.E.; Feldman, P.D.; A'hearn, M.F.; Festou, M.C.; Mcfadden, L.A.

    1989-01-01

    IUE observations of Comet Wilson from September 1986 to November 1987, through perihelion, allow a comparison to be conducted between this 'new' comet and the highly evolved P/Halley, at comparable heliocentric distances. The temporal decreases of both OH and dust in Comet Wilson near perihelion were monotonic and slow, by contrast to Comet Halley's rapid fluctuations. Despite these differences, relative gas abundances were similar within a factor of about 2 for comparable heliocentric and geocentric distances; this indicates that P/Halley's in situ gas measurements may be typical of comets generally. 33 refs

  8. MOLECULAR OXYGEN IN OORT CLOUD COMET 1P/HALLEY

    Energy Technology Data Exchange (ETDEWEB)

    Rubin, M.; Altwegg, K. [Physikalisches Institut, University of Bern, Sidlerstrasse 5, CH-3012 Bern (Switzerland); Dishoeck, E. F. van [Leiden Observatory, Leiden University, P.O. Box 9513, 2300 RA Leiden (Netherlands); Schwehm, G. [ESA (retired) Science Operations Department, ESTEC, Keplerlaan 1, 2201 AZ Noordwijk (Netherlands)

    2015-12-10

    Recently, the ROSINA mass spectrometer suite on board the European Space Agency's Rosetta spacecraft discovered an abundant amount of molecular oxygen, O{sub 2}, in the coma of Jupiter family comet 67P/Churyumov–Gerasimenko of O{sub 2}/H{sub 2}O = 3.80 ± 0.85%. It could be shown that O{sub 2} is indeed a parent species and that the derived abundances point to a primordial origin. Crucial questions are whether the O{sub 2} abundance is peculiar to comet 67P/Churyumov–Gerasimenko or Jupiter family comets in general, and also whether Oort cloud comets such as comet 1P/Halley contain similar amounts of molecular oxygen. We investigated mass spectra obtained by the Neutral Mass Spectrometer instrument during the flyby by the European Space Agency's Giotto probe of comet 1P/Halley. Our investigation indicates that a production rate of O{sub 2} of 3.7 ± 1.7% with respect to water is indeed compatible with the obtained Halley data and therefore that O{sub 2} might be a rather common and abundant parent species.

  9. Near-infrared polarization and color of Comet Halley: What can we learn about the grains

    International Nuclear Information System (INIS)

    Brooke, T.Y.; Knacke, R.F.

    1988-01-01

    The near infrared polarization and JHK colors of light scattered by dust grains in comet Halley were measured over a wide range in phase angle and heliocentric distance. Colors were redder than solar with no statistically significant variation with phase angle, heliocentric distance, or pre- and post-perihelion. This suggests that the grain population did not change drastically over time and that the data may be combined and modeled. However, short term variations in visible polarization and dust albedo were seen in Halley. Also, near infrared colors became systematically bluer after the observations were completed. The near infrared colors of Halley fall in the range of those of other comets. The near infrared polarization is similar to the visible polarization of Halley and other comets in showing a negative branch at small phase angles and an approximately linear rise toward positive values at larger phase angles. Mie theory calculations and a size distribution based on spacecraft data were used to model the near infrared polarization and color of comet Halley. Numerous lines of evidence point to the presence of dark, absorbing, probably carbonaceous materials in comets

  10. Particle acceleration in the plasma fields near comet Halley

    International Nuclear Information System (INIS)

    Somogyi, A.J.; Erdoes, G.; Shapiro, V.D.; Shevchenko, V.I.

    1990-01-01

    Spacecraft VEGA-1 approached Halley comet to distances less than 10 million km in March 1986. It was equipped with devices capable to detect and measure the energies of charged particles (higher than 50 keV). After a survey of acceleration mechanisms the properties of the 50-800 keV charged particle fluxes observed in various regions around Halley comet are reported. In particular, the regions outside the cometary bow shock, the region between the bow shock and the cometopause, and inside the latter, especially in the magnetic pile-up region are considered. Possible mechanisms responsible for the accelerations of the particle fluxes described are discussed. (author) 73 refs.; 7 figs.; 3 tabs

  11. On the nature of the Halley comet

    International Nuclear Information System (INIS)

    Dobrovol'skij, O.V.; Ioffe, Z.M.

    1987-01-01

    The results of study of the Halley comet by means of the ''Vega'', ''Suisej'', ''Sakigaki'' and ''Jotton'' space probes are presented in the popular form. The form and composition of the comet nucleus, its atmosphere and processes ocurring when moving in the near-the-solar space are described

  12. Carbonaceous Components in the Comet Halley Dust

    Science.gov (United States)

    Fomenkova, M. N.; Chang, S.; Mukhin, L. M.

    1994-01-01

    Cometary grains containing large amounts of carbon and/or organic matter (CHON) were discovered by in situ measurements of comet Halley dust composition during VEGA and GIOTTO flyby missions. In this paper, we report the classification of these cometary, grains by means of cluster analysis, discuss the resulting compositional groups, and compare them with substances observed or hypothesized in meteorites, interplanetary dust particles, and the interstellar medium. Grains dominated by carbon and/or organic matter (CHON grains) represent approx. 22% of the total population of measured cometary dust particles. They, usually contain a minor abundance of rock-forming elements as well. Grains having organic material are relatively more abundant in the vicinity of the nucleus than in the outer regions of the coma, which suggests decomposition of the organics in the coma environment. The majority of comet Halley organic particles are multicomponent mixtures of carbon phases and organic compounds. Possibly, the cometary CHON grains may be related to kerogen material of an interstellar origin in carbonaceous meteorites. Pure carbon grains, hydrocarbons and polymers of cyanopolyynes, and multi-carbon monoxides are present in cometary dust as compositionally simple and distinctive components among a variety of others. There is no clear evidence of significant presence of pure formaldehyde or HCN polymers in Halley dust particles. The diversity of types of cometary organic compounds is consistent with the inter-stellar dust model of comets and probably reflects differences in composition of precursor dust. Preservation of this heterogeneity among submicron particles suggest the gentle formation of cometary, nucleus by aggregation of interstellar dust in the protosolar nebula without complete mixing or chemical homogenization at the submicron level.

  13. Dust-gas interaction deduced from Halley multicolour camera observations

    International Nuclear Information System (INIS)

    Huebner, W.F.; Delamere, W.A.; Keller, H.U.; Reitsema, H.J.; Schmidt, H.U.; Whipple, F.L.; Wilhelm, K.

    1986-01-01

    The dust and gas productions of Comet Halley were measured by the dust counter and the mass spectrometers on the Giotto spacecraft. These instruments give only little information about the spatial asymmetry of the activity. The asymmetry in the dust production is clearly evident from the dust jets seen in the Halley Multicolour Camera images. Since the dust is entrained by the gas, production must be similarly asymmetric. The intensity profiles along and across several dust jets are related to their source regions on the nucleus. Properties of the dust jets are investigated. A few compact, but highly active source regions on the nucleus produce most of the visible dust and can account for most of the gas produced by the comet. 2 refs

  14. The Halley comet

    International Nuclear Information System (INIS)

    Encrenaz, T.; Festou, M.

    1985-01-01

    The conspicuous part of a comet, made of tenuous gas and dusts, represents only a tiny part of its mass. The main information is hidden in the central part: a solid nucleus, ice and rock blocks with a radius less than 10 km, completely invisible from the Earth. The knowledge of the nucleus structure and its composition could give the key of the planet creation mechanisms. That is a reason why it has been decided to send an automatic device to penetrate the Halley comet atmosphere and that two Soviet probes, Vega 1 and 2, one European probe Giotto, and two Japanese, Planet-A and MS-TS, will explore in-situ in March 1986, for the first time, a comet at atmosphere [fr

  15. A ballistic mission to fly by Comet Halley

    Science.gov (United States)

    Boain, R. J.; Hastrup, R. C.

    1980-01-01

    The paper describes the available options, ballistic trajectory opportunities, and a preliminary reference trajectory that were selected as a basis for spacecraft design studies and programmatic planning for a Halley ballistic intercept mission in 1986. The paper also presents trajectory, performance, and navigation data which support the preliminary selection.

  16. Comparative study of the dust emission of 19P/Borrelly (Deep Space 1) and 1P/Halley

    Science.gov (United States)

    Ho, T.-M.; Thomas, N.; Boice, D.C.; Kollein, C.; Soderblom, L.A.

    2003-01-01

    Images obtained by the Miniature Integrated Camera and Imaging Spectrometer (MICAS) experiment onboard the Deep Space 1 spacecraft which encountered comet 19P/Borrelly on September 22nd 2001 show a dust coma dominated by jets. In particular a major collimated dust jet on the sunward side of the nucleus was observed. Our approach to analyse these features is to integrate the observed intensity in concentric envelopes around the nucleus. The same procedures has been used on the Halley Multicolour Camera images of comet 1P/Halley acquired on March 14th 1986. We are able to show that at Borrelly the dust brightness dependence as a function of radial distance is different to that of Halley. At large distances both comets show constant values as the size of the concentric envelopes increases (as one would expect for force free radial outflow). For Halley the integral decreases as one gets closer to the nucleus. Borrelly shows opposite behaviour. The main cause for Halley's intensity distribution is either high optical thickness or particle fragmentation. For Borrelly, we have constructed a simple model of the brightness distribution near the nucleus. This indicates that the influence of deviations from point source geometry is insufficient to explain the observed steepening of the intensity profile close to the nucleus. Dust acceleration or fragmentation into submicron particles appear to be required. We also estimate the dust production rate of Borrelly with respect to Halley and compare their dust to gas ratios. ?? 2003 COSPAR. Published by Elsevier Ltd. All rights reserved.

  17. Comet Halley Returns. A Teacher's Guide, 1985-1986.

    Science.gov (United States)

    Chapman, Robert D.; Bondurant, R. Lynn, Jr.

    This booklet was designed as an aid for elementary and secondary school teachers. It is divided into two distinct parts. Part I is a brief tutorial which introduces some of the most important concepts about comets. Areas addressed include: the historical importance of Comet Halley; how comets are found and names; cometary orbits; what Comet Halley…

  18. Comet Halley - Chapter I in cometary exploration

    International Nuclear Information System (INIS)

    Newburn, R.L. Jr.

    1986-01-01

    The information gained on the Comet Halley by the international probe studies is presented. The new information includes data on the true size and shape of the cometary nucleus and the mass of its dust grains, the chemical composition of the nucleus, and the characteristics of the bow wave of the comet. The requirements of future missions for solving the many questions that are still open are discussed

  19. Organic Chemistry in Interstellar Ices: Connection to the Comet Halley Results

    Science.gov (United States)

    Schutte, W. A.; Agarwal, V. K.; deGroot, M. S.; Greenberg, J. M.; McCain, P.; Ferris, J. P.; Briggs, R.

    1997-01-01

    Mass spectroscopic measurements on the gas and dust in the coma of Comet Halley revealed the presence of considerable amounts of organic species. Greenberg (1973) proposed that prior to the formation of the comet UV processing of the ice mantles on grains in dense clouds could lead to the formation of complex organic molecules. Theoretical predictions of the internal UV field in dense clouds as well as the discovery in interstellar ices of species like OCS and OCN- which have been formed in simulation experiments by photoprocessing of interstellar ice analogues point to the importance of such processing. We undertook a laboratory simulation study of the formation of organic molecules in interstellar ices and their possible relevance to the Comet Halley results.

  20. La comète de Halley une révolution scientifique

    CERN Document Server

    Maffei, Paolo

    1985-01-01

    Mars-avril 1986: la comète de Halley est de retour, passant au plus près de la Terre.Rarement un événement à l'origine strictement astronomique aura à ce point été un événement scientifique. Pas moins de cinq sondes spatiales, en effet, ont été lancées pour rencontrer la comète et effectuer en mars 1986 la première exploration de son atmosphère. Rien, pourtant, ne semblait à l'origine militer pour un tel déploiement de moyens scientifiques: la comète ne dépasse pas en éclat les comètes non périodiques les plus brillantes; sa période de révolution _ 76 ans _ est longue; sa trajectoire est telle que le temps d'observation, lors du survol par les sondes, ne dure que quelques heures.Mais la comète de Halley _ du nom de l'astronome anglais Edmund Halley qui, appliquant les lois de la gravitation de Newton, en détermina les éléments orbitaux et prévit la réapparition de 1758 _ est la seule comète brillante et jeune dont la trajectoire soit parfaitement connue à l'avance. Grâce à s...

  1. 3D CSEM data inversion using Newton and Halley class methods

    Science.gov (United States)

    Amaya, M.; Hansen, K. R.; Morten, J. P.

    2016-05-01

    For the first time in 3D controlled source electromagnetic data inversion, we explore the use of the Newton and the Halley optimization methods, which may show their potential when the cost function has a complex topology. The inversion is formulated as a constrained nonlinear least-squares problem which is solved by iterative optimization. These methods require the derivatives up to second order of the residuals with respect to model parameters. We show how Green's functions determine the high-order derivatives, and develop a diagrammatical representation of the residual derivatives. The Green's functions are efficiently calculated on-the-fly, making use of a finite-difference frequency-domain forward modelling code based on a multi-frontal sparse direct solver. This allow us to build the second-order derivatives of the residuals keeping the memory cost in the same order as in a Gauss-Newton (GN) scheme. Model updates are computed with a trust-region based conjugate-gradient solver which does not require the computation of a stabilizer. We present inversion results for a synthetic survey and compare the GN, Newton, and super-Halley optimization schemes, and consider two different approaches to set the initial trust-region radius. Our analysis shows that the Newton and super-Halley schemes, using the same regularization configuration, add significant information to the inversion so that the convergence is reached by different paths. In our simple resistivity model examples, the convergence speed of the Newton and the super-Halley schemes are either similar or slightly superior with respect to the convergence speed of the GN scheme, close to the minimum of the cost function. Due to the current noise levels and other measurement inaccuracies in geophysical investigations, this advantageous behaviour is at present of low consequence, but may, with the further improvement of geophysical data acquisition, be an argument for more accurate higher-order methods like those

  2. The C-12/C-13 abundance ratio in Comet Halley

    International Nuclear Information System (INIS)

    Wyckoff, S.; Lindholm, E.; Wehinger, P.A.; Peterson, B.A.; Zucconi, J.M.

    1989-01-01

    The individual (C-13)N rotational lines in Comet Halley are resolved using high-resolution spectra of the CN B2Sigma(+)-X2Sigma(+) (0,0) band. The observe C-12/C-13 abundance ratio excludes a site of origin for the comet near Uranus and Neptune and suggests a condensation environment quite distinct from other solar system bodies. Two theories are presented for the origin of Comet Halley. One theory suggest that the comet originated 4.5 Gyr ago in an inner Oort cloud at a heliocentric distance greater than 100 AU where chemical fractionation led to the C-13 enrichment in the CN parent molecule prior to condensation of the comet nucleus. According to the other, more plausible theory, the comet nucleus condensed relatively recently from the interstellar medium which has become enriches in C-13 and was subsequently gravitationally captured by the solar system. 107 refs

  3. Giotto observations of the bow shock at Comet Halley

    International Nuclear Information System (INIS)

    Formisano, V.; Amata, E.; Wilken, B.

    1986-01-01

    Preliminary results from the JPA instrument on Giotto indicate that Comet Halley, even on the flanks, has a bow shock which moves backwards and forwards over the spacecraft. To understand the structure properly will require more detailed investigation of the relationships between three particle populations, cometary ions, solar wind ions and electrons

  4. Color gradients in the coma of P/Halley

    International Nuclear Information System (INIS)

    Meech, K.

    1988-01-01

    Some important information relevant to the understanding of the gas/dust dynamics near the surface of a comet nucleus concerns knowledge of the grain composition and scattering properties as well as the particle size distribution of dust in the coma. Ground based measurements of light scattered from the dust comae can provide some information about the physical grain properties, in particular about the mean optically dominant grain size. Optical spectra of continua of nine comets presented by Jewitt and Meech, 1986, show that all of the scattered light is reddened with respect to the Sun. There is significant scatter in the amount of reddening seen for different comets. In the near IF regions, the reddening decreases until near 2 to 3 micrometers where the reflectivity is nearly neutral. It is of particular interest to see if there are any observable changes in the grain size distribution during outburst. Although no coma colar changes were observed during the Nov. 1985 outbursts, a color gradient within the coma has been observed in Halley. Radial color gradients in J, H, and K images of Halley as reported by Campins have not been observed by the author

  5. Radar observations of Comet Halley

    International Nuclear Information System (INIS)

    Campbell, D.B.; Harmon, J.K.; Shapiro, I.I.

    1989-01-01

    Five nights of Arecibo radar observations of Comet Halley are reported which reveal a feature in the overall average spectrum which, though weak, seems consistent with being an echo from the comet. The large radar cross section and large bandwidth of the feature suggest that the echo is predominantly from large grains which have been ejected from the nucleus. Extrapolation of the dust particle size distribution to large grain sizes gives a sufficient number of grains to account for the echo. The lack of a detectable echo from the nucleus, combined with estimates of its size and rotation rate from spacecraft encounters and other data, indicate that the nucleus has a surface of relatively high porosity. 33 references

  6. Spacecraft environment during the GIOTTO-Halley encounter: a summary

    International Nuclear Information System (INIS)

    Young, D.T.

    1983-01-01

    A summary of the present volume is presented in which the separate disciplines are drawn together to give an overview of the spacecraft environment during the GIOTTO-Halley interaction. Specific recommendations are made as to how the work of the Plasma Environment Working Group might continue to contribute to the GIOTTO program during encounter and post-encounter data analysis. 28 references, 3 tables

  7. The rotation of P/Halley

    International Nuclear Information System (INIS)

    Sagdeev, R.Z.; Szegoe, K.; Kondor, A.; Merenyi, E.; Smith, B.A.; Larson, S.; Toth, I.

    1987-11-01

    The nucleus of the comet Halley rotates as a slightly asymmetric top, the orientation of the rotation axis (the orientation of the angular momentum vector) is b=54 deg +-15 deg, l=219 deg +-15 deg in the ecliptic system. In the case of the rotation of an asymmetric top the rotation axis is not fixed rigidly to the body, which means that while the nucleus rotates around the axis with a period of 2.2+-0.05 d, its long axis 'nods' periodically with a period of 7.4+-0.05 d. The amplitude of the 'nodding' is about 15 deg +-3 deg in both directions relative to a plane perpendicular to the rotation axis. (author) 21 refs.; 6 figs.; 2 tabs

  8. The spacecraft encounters of Comet Halley

    Science.gov (United States)

    Asoka Mendis, D.; Tsurutani, Bruce T.

    1986-01-01

    The characteristics of the Comet Halley spacecraft 'fleet' (VEGA 1 and VEGA 2, Giotto, Suisei, and Sakigake) are presented. The major aims of these missions were (1) to discover and characterize the nucleus, (2) to characterize the atmosphere and ionosphere, (3) to characterize the dust, and (4) to characterize the nature of the large-scale comet-solar wind interaction. While the VEGA and Giotto missions were designed to study all four areas, Suisei addressed the second and fourth. Sakigake was designed to study the solar wind conditions upstream of the comet. It is noted that NASA's Deep Space Network played an important role in spacecraft tracking.

  9. Focus on the future

    International Nuclear Information System (INIS)

    Hanner, M.S.

    1988-01-01

    An assessment is made of what was learned from Halley and recommendations are made for future directions for infrared studies of comets and supporting lab investigations. The following issues are addressed: (1) What steps can be taken to achieve consistent interpretation of Halley infrared data; (2) How successful has the Halley Watch been for infrared studies; (3) What supporting lab research is needed; (4) What are the key infrared observations needed for future comets; and (5) How do current and future NASA programs relate to comet studies

  10. Charge exchange of solar wind ions in the Comet Halley coma

    Science.gov (United States)

    Shelley, E. G.; Ing-H. afgoldstein, B. E. AGGOLDSTEIN, R.; Ing-H. afgoldstein, B. E. AGGOLDSTEIN, R.

    1986-01-01

    The He(2+) and He(+) radial profiles measured by the Giotto mass spectrometer on the inbound trajectory to comet Halley are compared to a simple 1-dimensional charge exchange model. Results indicate that charge exchange alone cannot account for the observed radial profiles of He(2+) and He(+).

  11. The landscape of comet Halley

    International Nuclear Information System (INIS)

    Merenyi, E.; Foeldy, L.; Szegoe, K.; Kondor, A.; Toth, I.

    1989-07-01

    In this paper the three dimensional model of P/Halley's nucleus is constructed based on the results of the imaging experiments. It has the following major characteristics: the overall sizes are 7.2 km, 7.22 km, 15.3 km; its volume is 365 km 3 ; the ratios of the inertial momenta are 3.4:3.3:1, the longest inertial axis is slightly inclined to the geometrical axis of the body, 3.3 deg in latitude and 1.1 deg in longitude if the geometrical axis is at zero latitude and longitude. The shape is very irregular, it is not close to any regular body, e.g. to a tri-axial ellipsoid. Several features on the images are interpreted as local slope variations of the nucleus. (author) 10 refs.; 15 figs

  12. 3 micron spectrophotometry of Comet Halley - Evidence for water ice

    Science.gov (United States)

    Bregman, Jesse D.; Tielens, A. G. G. M.; Witteborn, Fred C.; Rank, David M.; Wooden, Diane

    1988-01-01

    Structure has been observed in the 3-3.6 micron preperihelion spectrum of Comet Halley consistent with either an absorption band near 3.1 microns or emission near 3.3 microns. The results suggest that a large fraction of the water molecules lost by the comet are initially ejected in the form of small ice particles rather than in the gas phase.

  13. Halley comet, implication on the origin

    International Nuclear Information System (INIS)

    Festou, M.C.

    1990-01-01

    One will first give a rapid description of the different parts that compose a comet coma. Then one will describe the spectrum of comets from the UV to the IR regions with special emphasis on how information relative to the physico-chemistry of comet atmospheres can be retrieved. Our basic knowledge about the composition of comets before 1985 will be summarized and the input of the 1985-86 observing campaign of comet Halley will be shown (in situ, ground-based and space borne observations). One will see then that the chemical composition of comets appears as of today completely compatible with a formation from pre-solar matter that condensed inside the solar system [fr

  14. Comet Halley and interstellar chemistry

    International Nuclear Information System (INIS)

    Snyder, L.E.

    1989-01-01

    How complex is the chemistry of the interstellar medium? How far does it evolve and how has it interacted with the chemistry of the solar system? Are the galactic chemical processes destroyed, preserved, or even enhanced in comets? Are biogenic molecules formed in space and have the formation mechanisms interacted in any way with prebiotic organic chemical processes on the early earth? Radio molecular studies of comets are important for probing deep into the coma and nuclear region and thus may help answer these questions. Comets are believed to be pristine samples of the debris left from the formation of the solar system and may have been the carrier between interstellar and terrestrial prebiotic chemistries. Recent observations of Comet Halley and subsequent comets have given the author an excellent opportunity to study the relationship between interstellar molecular chemistry and cometary chemistry

  15. Atlas of Comet Halley 1910 II

    International Nuclear Information System (INIS)

    Brandt, J.C.; Donn, B.

    1986-01-01

    An Atlas of Comet Halley 1910 II photographs and spectra is being prepared. The major section consists of 838 photographic observations from fifteen observatories around the world. Multiple images of many photographs are reproduced to bring out detail in the near nucleus region, in the coma and in the tail. The Atlas contains a total of 1209 photographic images of the 1910 apparition. In addition there are sections showing drawings from 1935 and 1910. A short section compares 1910 drawings and photographs. The final two sections display digitally processed images from 1910 and 1910 spectra. A three part appendix contains diagrams of various data associated with the 1910 apparition, a set of tables of all 1910 images and a bibliography

  16. The cyanogen band of Comet Halley

    Science.gov (United States)

    Tatum, J. B.; Campbell, E. C.

    The results of improved whole disk solar irradiance spectrum calculations performed for projected Halley's Comet heliocentric radial velocity and distance are provided. The computations were carried out to account for Doppler effects in the Fraunhofer lines of rotational excitation bands of violet CN emissions from the comet in its encounters with solar radiation. The calculations spanned every half-day for 200 days before and after perihelion. The 801 computer images of the expected intensities were photographed in sequence to form an animated film paced by background music from Liszt's Second Hungarian Rhapsody. The results are intended for accounting for spectral changes observed due to Doppler effects induced by changing velocity and distance, rather than physical mechanisms of the emitting processes.

  17. Reduction and analysis of photometric data on Comet Halley

    International Nuclear Information System (INIS)

    Belton, M.J.S.; Fink, U.; Wehinger, P.; Spinrad, H.; Meech, K.

    1988-01-01

    The discovery that periodic variations in the brightness of Comet Halley were characterized by two unrelated frequencies implies that the nucleus is in a complex state of rotation. It either nutates as a result of the random addition of small torque perturbations accumulated over many perihelion passages, or the jet activity torques are so strong that it precesses wildly at each perihelion passage. To diagnose the state of nuclear rotation, researchers began a program to acquire photometric time series of the comet as it recedes from the sun. The intention is to observe the decay of the comet's atmosphere and then, when it is unemcumbered by the light of the coma, follow the light variation of the nucleus itself. The latter will be compared with preperihelion time series and the orientation of the nucleus at the time of Vega and Giotto flybys and an accurate rotational ephemeris constructed. Halley was observed on 38 nights during 1987 and approximately 21 nights in 1988. The comet moved from 5 AU to 8.5 AU during this time. The brightness of the coma was found to rapidly decrease in 1988 as the coma and cometary activity collapses. The magnitude in April 1988 was 19 mag (visual) and it is predicted that the nucleus itself will be the major contributor to the brightness in the 1988 and 1989 season

  18. Model for the coma of Comet Halley, based on the Astron ultraviolet spectrophotometry

    International Nuclear Information System (INIS)

    Boiarchuk, A.A.; Grinin, V.P.; Petrov, P.P.; Sheikhet, A.I.; Zvereva, A.M.

    1986-01-01

    The development of a model of the Comet Halley coma from spectral and photometric data is described. Spectra in the 1500-3500 A range and photometric scans at the 3085 A and 2190 A in the (0-0) band of the OH and CO(+) molecules were obtained by the UV telescope of the satellite Astron on December 3, 13, and 23, 1985. Surface-brightness profiles of the coma in the (0-0) band of OH, NH, and CS molecules are derived. The source and formation of these molecules, the lifetime of their radicals, the radial velocity of their parent molecules, and the water-molecule sublimation rate are computed and examined. The basic characteristics of the comet observed from the UV data are compared to the properties of other comets. It is observed that Comet Halley is similar to other large short-period comets. 29 references

  19. On the formation of meteor showers of comet Halley

    International Nuclear Information System (INIS)

    Babadzhanov, P.B.; Obrubov, J.V.; Pushkarev, A.N.; Hajduk, A.

    1987-01-01

    The orbits of test particles ejected from the nucleus of Halley comet at its perihelion passage in 1910 with different velocities are studied for the next three passages of the comet up to 2134 taking into consideration perturbations from all planets. Some characteristics of the stream formation are presented. The calculations show that the return of the comet to its perihelion cannot produce an immediate influence on the activity of its meteor showers. (author). 2 figs., 1 tab., 13 refs

  20. A GazeWatch Prototype

    DEFF Research Database (Denmark)

    Paulin Hansen, John; Biermann, Florian; Møllenbach, Emile

    2015-01-01

    We demonstrate potentials of adding a gaze tracking unit to a smartwatch, allowing hands-free interaction with the watch itself and control of the environment. Users give commands via gaze gestures, i.e. looking away and back to the GazeWatch. Rapid presentation of single words on the watch displ...... provides a rich and effective textual interface. Finally, we exemplify how the GazeWatch can be used as a ubiquitous pointer on large displays....

  1. La teoria di Halley sul magnetismo terrestre e sulle aurore polari.

    Science.gov (United States)

    D'Amico, S.

    1999-10-01

    This paper contains a brief description of some theories developed by Edmund Halley during the last years of the 17th century and the beginning of the 18th. This theories tried to explain the origin of terrestrial magnetism and its changes during the time, and gives a description of how magnetic force by the Earth could influence polar aurorae.

  2. Negative Ion Chemistry in the Coma of Comet 1P/Halley

    Science.gov (United States)

    Cordiner, M. A.; Charnley, S. B.

    2012-01-01

    Negative ions (anions) were identified in the coma of comet 1P/Halley from in-situ measurements performed by the Giotto spacecraft in 1986. These anions were detected with masses in the range 7-110 amu, but with insufficient mass resolution to permit unambiguous identification. We present details of a new chemical-hydrodynamic model for the coma of comet Halley that includes - for the first time - atomic and molecular anions, in addition to a comprehensive hydrocarbon chemistry. Anion number densities arc calculated as a function of radius in the coma, and compared with the Giotto results. Important anion production mechanisms arc found to include radiative electron attachment, polar photodissociation, dissociative electron attachment, and proton transfer. The polyyne anions C4H(-) and C6H(-) arc found to be likely candidates to explain the Giotto anion mass spectrum in the range 49-73 amu. Thc CN(-) anion probably makes a significant contribution to the mass spectrum at 26 amu. Larger carbon-chain anions such as C8H(1) can explain the peak near 100 amu provided there is a source of large carbon-chain-bearing molecules from the cometary nucleus.

  3. Dust-acoustic shock waves in a charge varying electronegative magnetized dusty plasma with nonthermal ions: Application to Halley Comet plasma

    Energy Technology Data Exchange (ETDEWEB)

    Tribeche, Mouloud; Bacha, Mustapha [Plasma Physics Group (PPG), Theoretical Physics Laboratory (TPL), Faculty of Physics, University of Bab-Ezzouar, USTHB, B. P. 32, El Alia, Algiers 16111 (Algeria)

    2013-10-15

    Weak dust-acoustic waves (DAWs) are addressed in a nonthermal charge varying electronegative magnetized dusty plasmas with application to the Halley Comet. A weakly nonlinear analysis is carried out to derive a Korteweg-de Vries-Burger equation. The positive ion nonthermality, the obliqueness, and magnitude of the magnetic field are found to modify the dispersive and dissipative properties of the DA shock structure. Our results may aid to explain and interpret the nonlinear oscillations that may occur in the Halley Comet Plasma.

  4. Comet Halley, parameter study I

    International Nuclear Information System (INIS)

    Huebner, W.F.; Fikani, M.M.

    1982-06-01

    To aid in defining a mission to comet P/Halley, its inner coma is simulated by a computer program that models time-dependent chemical reactions in a radially and isentropically expanding gas, taking into account attenuation of solar ultraviolet radiation in the subsolar direction. Column density predictions are based on intelligently selected combinations of poorly known values for nucleus parameters that include size, visual albedo, and infrared emissivity. Only one chemical composition and a minor modification of it are considered here; the dust-to-gas ratio in this model is zero. Although the somewhat optimistically volatile composition chosen here favors a smaller nucleus, a mean nuclear radius of only 0.5 km is unlikely. No significant increase of molecular column density is predicted by this model as a spacecraft approaches, once it is less than a few 10 4 km from the nucleus. Predictions are made for various heliocentric distances of interest for comet missions and for ground observations

  5. Comet Halley: nucleus and jets

    International Nuclear Information System (INIS)

    Sagdeev, R.Z.; Avanesov, G.A.; Barinov, I.V.

    1986-06-01

    The VEGA-1 and VEGA-2 spacecrafts made their closest approach to Comet Halley on 6 and 9 March, respectively. In this paper results of the onboard imaging experiment are discussed. The nucleus of the comet was clearly identifyable as an irregularly shaped object with overall dimensions of (16+-1)x(8+-1)x(8+-1) km. The nucleus rotates around its axis which is nearly perpendicular to the orbital plane, with a period of 53+-2 hours. Its albedo is only 0.04+-002. Most of the jet features observed during the second fly-by were spatially reconstructed. These sources form a quasi-linear structure on the surface. The dust above the surface is shown to be optically thin except certain specific dust jets. Brightness features on the surface are clearly seen. Correlating the data with other measurements it is concluded that the dirty snow-ball model probably has to be revised. (author)

  6. Particle acceleration near Halley's comet

    International Nuclear Information System (INIS)

    Somogyi, Antal

    1987-01-01

    Vega and Giotto space probes observed energetic ions of cometary origin near Halley's comet. The water molecules evaporating from the cometary nucleus were ionized by the solar UV radiation. These 'standing' ions were accelerated from 1 km/s to a few 1000 km/s. Present paper analyses the possible mechanisms of acceleration based on the data of TUENDE detector (constructed by CRIP, Hungary) working on board of Vega probes. The basic mechanism is the ExB Lorentz acceleration by interplanetary magnetic field and electric field induced by magnetic field frozen into solar wind plasma. It is followed by an acceleration caused by the adiabatic compression of the plasma at shock wave front. These processes can not explain the observed velocity of ions. It is shown that the second order Fermi acceleration which dissipates the ion distribution in the velocity space can lead to the observed velocities. The circumstances required to the occurrence of this process are present at the cometary environment. (D.G.) 2 figs

  7. Espectroscopia del Cometa Halley

    Science.gov (United States)

    Naranjo, O.; Fuenmayor, F.; Ferrin, L.; Bulka, P.; Mendoza, C.

    1987-05-01

    Se reportan observaciones espectroscópicas del cometa Halley. Los espectros fueron tomados usando el espectrógrafo del telescopio reflector de 1 metro del Observatorio Nacional de Venezuela. Se utilizó óptica azul, con una red de difracción de 600 lineas/min, obteniéndose una dispersión de 74.2 A/mm y una resolución de 2.5 A, en el rango espectral de 3500 a 6500 A. Seis placas fueron tomadas con emulsión IIa-O y dos con IIa-D. Los tiempos de exposición fueron entre 10 y 150 minutos. El cometa se encontraba entre 0.70 y 1.04 UA del Sol, y entre 1.28 y 0.73 UA de la Tierra. Las emisiones más prominentes en el espectro, son las del CN, C2, y C3. Otras emisiones detectadas corresponden a CH, NH2 y Na. Los espectros muestran un fuerte continuo, indicando un contenido significativo de polvo. Se detectó mayor intensidad del contínuo, en la dirección anti solar, lo cual es evidencia de la cola de polvo.

  8. Spectrophotometry of comets Giacobini-Zinner and Halley

    International Nuclear Information System (INIS)

    Tegler, S.C.; O'dell, C.R.

    1987-01-01

    Optical window spectrophotometry was performed on comets Giacobini-Zinner and Halley over the interval 300-1000 nm. Band and band-sequence fluxes were obtained for the brightest features of OH, CN, NH, and C2, special care having been given to determinations of extinction, instrumental sensitivities, and corrections for Fraunhofer lines. C2 Swan band-sequence flux ratios were determined with unprecedented accuracy and compared with the predictions of the detailed equilibrium models of Krishna Swamy et al. (1977, 1979, 1981, and 1987). It is found that these band sequences do not agree with the predictions, which calls into question the assumptions made in deriving the model, namely resonance fluorescence statistical equilibrium. Suggestions are made as to how to resolve this discrepancy. 16 references

  9. Spectrophotometry of comets Giacobini-Zinner and Halley

    Science.gov (United States)

    Tegler, Stephen C.; O'Dell, C. R.

    1987-01-01

    Optical window spectrophotometry was performed on comets Giacobini-Zinner and Halley over the interval 300-1000 nm. Band and band-sequence fluxes were obtained for the brightest features of OH, CN, NH, and C2, special care having been given to determinations of extinction, instrumental sensitivities, and corrections for Fraunhofer lines. C2 Swan band-sequence flux ratios were determined with unprecedented accuracy and compared with the predictions of the detailed equilibrium models of Krishna Swamy et al. (1977, 1979, 1981, and 1987). It is found that these band sequences do not agree with the predictions, which calls into question the assumptions made in deriving the model, namely resonance fluorescence statistical equilibrium. Suggestions are made as to how to resolve this discrepancy.

  10. Upstream region, foreshock and bow shock wave at Halley's Comet from plasma electron measurements

    International Nuclear Information System (INIS)

    Anderson, K.A.; Carlson, C.W.; Curtis, D.W.

    1986-01-01

    Halley plasma electron parameters from 2.7 million km from the comet nucleus to the bow shock wave at 1.1 million km and beyond are surveyed. The features of the electron foreshock lying outside the shock to a distance of 230,000 km are described. It is a region of intense solar wind-comet plasma interaction in which energetic electrons are prominent. Several spikes of electrons whose energies extend to 2.5 keV appear in front of the shock. These energetic electrons may be accelerated in the same way electrons are accelerated at the Earth's bow shock to energies of 1 to 10 keV. The direction of the electron bulk flow direction changes abruptly between 1920 and 1922 UT, and the flow speed begins a sharp decline at the same time. It is suggested that the spacecraft entered the bow shock wave between 1920 and 1922 UT. Electron density variations at Halley are very much smaller than those at Giacobini-Zinner

  11. A two component model for thermal emission from organic grains in Comet Halley

    Science.gov (United States)

    Chyba, Christopher; Sagan, Carl

    1988-01-01

    Observations of Comet Halley in the near infrared reveal a triple-peaked emission feature near 3.4 micrometer, characteristic of C-H stretching in hydrocarbons. A variety of plausible cometary materials exhibit these features, including the organic residue of irradiated candidate cometary ices (such as the residue of irradiated methane ice clathrate, and polycyclic aromatic hydrocarbons. Indeed, any molecule containing -CH3 and -CH2 alkanes will emit at 3.4 micrometer under suitable conditions. Therefore tentative identifications must rest on additional evidence, including a plausible account of the origins of the organic material, a plausible model for the infrared emission of this material, and a demonstration that this conjunction of material and model not only matches the 3 to 4 micrometer spectrum, but also does not yield additional emission features where none is observed. In the case of the residue of irradiated low occupancy methane ice clathrate, it is argued that the lab synthesis of the organic residue well simulates the radiation processing experienced by Comet Halley.

  12. Airborne spectrophotometry of P/Halley from 16 to 30 microns

    Science.gov (United States)

    Herter, T.; Gull, G. E.; Campins, H.

    1986-01-01

    Comet Halley was observed in the 16 to 30 micron region using the Cornell University 7-channel spectrometer (resolution = 0.02) on board the Kuiper Airborne Observatory on 1985 Dec. 14.2. A 30-arcsec aperture (FWHM) was used. Measurements centered on the nuclear condensation micron indicate that if present, the 20 micron silicate feature is very weak, and that a relatively narrow strong feature centered at 28.4 microns possibly exists. However, this feature may be an artifact of incomplete correction for telluric water vapor absorption.

  13. On the photometric parameters of comet Halley

    International Nuclear Information System (INIS)

    Toth, I.

    1984-12-01

    Halley's comet is one of the brightest comets in the absolute sense. The paper describes the expectations about its brightness parameters, and the main physical properties of the nucleus can be derived from photometry up to the last opposition. Results were obtained relating to the decrease of absolute magnitude and the possible period of brightness fluctuation according to data obtained at CFHT on 4 th Feb. 1984. The slope of decrease of absolute magnitude is about 0.17 magnitude per revolution. On 4th Feb. 1984, the brightness fluctuations had a period about 9.0+-0.5 hr but it seems that the general form of fluctuations on a large time-scale is not a clear sinosoidal shape, and the most probable periods are between 9 and 48 hrs. (author)

  14. Observations of Halley's Comet by the Solar Maximum Mission (SMM)

    Science.gov (United States)

    Niedner, M. B.

    1986-01-01

    Solar Maximum Mission coronagraph/polarimeter observations of large scale phenomena in Halley's Comet are discussed. Observations of the hydrogen coma with the UV spectrometer are considered. It is concluded that coronograph/polarimeter observations of the disconnection event, in which the entire plasma tail uproots itself from the head of the comet, is convected away in the solar wind at speeds in the 50 to 100 km/sec range (relative to the head), and is replaced by a plasma tail constructed from folding ion-tail rays, are the most interesting.

  15. Dust photometry in the near nucleus region of comet Halley

    International Nuclear Information System (INIS)

    Szegoe, K.; Szatmary, Z.; Kondor, A.; Merenyi, E.; Toth, I.; Smith, B.A.

    1988-08-01

    The dust-jet radial brightness has been analyzed along jet cores on images taken by the tv experiment aboard VEGA 2 spacecraft, during the close encounter with comet Halley in 1986 March. Applying the RFIT code for fitting the data obtained it was shown that there is a breakpoint in the radial brightness distribution which occurs at about 40 km above the surface. These results are interpreted as consequences of the heat shock induced disintegration of dust particles as they are ejected into the near-nucleus environment. (R.P.) 22 refs.; 4 tabs

  16. SPORTS WATCHING CULTURE AMONG MALAYSIANS

    Directory of Open Access Journals (Sweden)

    Gunathevan Elumalai

    2015-12-01

    Full Text Available Background: Ardent sports watching will lead an individual to engage in sports and recreational activities continuously, while it also creates a sports culture among Malaysians. Sports watching culture is actually an intellectual activity. It is capable of evaluating behaviour, moral values and the level of appreciation of every spectator. Methods: This survey was conducted to identify the sports viewing culture among Malaysians. A cluster sampling method was used to select 6000 respondents from 30 million Malaysian population. Respondents were selected from urban (50% and rural areas (50%. Ethnically 56% were Malays, Sarawak and Sabah natives were 11%, Chinese 25% and finally Indians 7%. The respondents age categories were 12 to 19 years (30%, 20 to 25 years (50%, 56 and above (20%. A questionnaire developed by the research team was used to collect data. The quantitative data were analysed using Statistical Package for Social Sciences (SPSS version 21.0 for windows. Results: The findings indicate that from 5864 respondents who answered the questionnaire in full, a total of 4553 people or 77.6% watch sporting events, while a total of 1311 people or 22.4% have stated not watching any sports activities. Comparison by gender showed that 85.2% of the 2482 males watch sports events while among the female 70.2% of the 2071 watch sports events. In the category of those who do not watch, the female are higher at 29.8% than the males at 14.8%. In terms of ethnicity the Malays 80.2%. Chinese 64.6%, Indians 81.9%, natives of Sabah 94.0%, natives of Sarawak 77.6% like to watch sports events. Residential locations showed no significant differences as 78.7% of urban respondents watch sports events compared to 76.8% of rural communities. Conclusion: The findings indicated that majority of Malaysians having fun in watching sports activities. Gender still plays a role in the involvement and enjoyment of sports events either as a player or supporter. Ethnicity

  17. Polarization images of the inner regions of Comet Halley

    International Nuclear Information System (INIS)

    Eaton, N.; Scarrott, S.M.; Warren-Smith, R.F.

    1988-01-01

    The present CCD polarimeter images of intensity and polarization within the near-nucleus regions of Comet Halley show the occurrence of dust jets on two days in January, 1986, which exhibit increased polarizations above the level of the surrounding coma. Three possible reasons for the enhanced polarization in the jets are considered, assuming that the polarization increase is due to dust grains: (1) the size distribution of the grains could be different from the surrounding coma; (2) the material of the grains could have a different refractive index; and (3) the ratio of dust to gas emission could be different in the jets. 13 references

  18. First spacecraft observations of energetic particles near comet Halley

    International Nuclear Information System (INIS)

    Somogyi, A.J.; Szegoe, K.; Gringauz, K.I.

    1986-04-01

    The TUENDE-M energetic particle instrument on board of VEGA-1 detected intense fluxes of energetic (>- 40 keV) ions in the vicinity of comet Halley, at a distance of 10sup(7) km. Three regions of different ion characteristics were identified. An outer region at several 10sup(6) km contains pick up ions in the solar wind. A second region of an extent of several 10sup(5) km inside the bow shock contains the most intense fluxes, whereas the innermost region of 10sup(4) km is characterized by lower intensities and sharp spikes around closest approach (8900 km from the nucleus). (author)

  19. Incorporation of tritium from wrist watches

    International Nuclear Information System (INIS)

    Schoenhofer, F.; Pock, K.

    1995-01-01

    Watches are consumer products and are subject to the regulations that control food and consumer products. Elevated concentrations of tritium were found in the urine of persons who wore wrist watches with luminous dials and plastic cases. High emission of tritium from these watches were observed. In an experiment, a volunteer wore a watch with high emissions and the build-up of the tritium concentration in urine was monitored, as well as the decline after removing the watch. Possible pathways for the incorporation and its mechanism are considered. In spite of the relatively high activity concentrations observed, the dose is negligible. On the other hand, the principle 'ALARA' can be achieved without any costs by simply choosing other types of watches. (author). 12 refs., 2 figs., 2 tabs

  20. Infrared color gradient in the inner coma of Comet Halley

    International Nuclear Information System (INIS)

    Campins, H.; Rieke, M.J.; Rieke, G.H.

    1989-01-01

    A well-defined gradient is noted in the J-H and H-K colors of near-IR images obtained for Comet Halley in November, 1985, within about 8000 km of the nucleus; the bluest colors are at the photocenter, in conjunction with surface brightness profiles that are steeper than those expected. The color gradient and the brightness profiles are both explainable by the present analysis in terms of the presence of volatile, dirty-ice grains in the inner coma. An outburst of Rayleigh-scattering dust particles (unsupported by spacecraft measurements obtained to date) may also account for the observational data. 27 references

  1. 47 CFR 80.301 - Watch requirements.

    Science.gov (United States)

    2010-10-01

    ... Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES STATIONS IN THE MARITIME SERVICES Safety Watch Requirements and Procedures Coast Station Safety Watches § 80.301 Watch...) Except for distress, urgency or safety messages, coast stations must not transmit on 2182 kHz during the...

  2. Fabry-Perot observations of Comet Halley H2O(+)

    International Nuclear Information System (INIS)

    Scherb, F.; Roesler, F.L.D.; Harlander, J.; Magee-sauer, K.

    1990-01-01

    Fabry-Perot scanning spectrometer observations of Comet Halley's H 2 O(+) emissions have yielded 6158.64 and 6158.85 A spin doublet data at distances in the range of 0 to 2 million km from the comet heat in the antisunward direction. Cometary plasma outflow velocities were ascertained on the basis of the emissions' Doppler shifts, yielding results that were mostly but not exclusively consistent with the plasma's constant antisunward acceleration; the acceleration varied from night to night of observations over a 30-300 cm/sec range. The unusual plasma kinematics of December 14-15, 1985, and January 10, 1986, may be associated with the tail-disconnection activity observed by others. 30 refs

  3. Apple Watch for dummies

    CERN Document Server

    Saltzman, Marc

    2015-01-01

    Your all-encompassing guide to the Apple Watch Are you an Apple Watch enthusiast and want to master all of its features to impress friends and intimidate enemies? Or perhaps you're a less-than-tech-savvy newcomer to the ""wearable"" craze and want to get the most out of it? In Apple Watch For Dummies, you'll discover how this incredible device does way more than simply tell time. Through hands-on, easy-to-follow instruction, you'll find out how to send and receive text messages and emails, use Siri, find movie times, access your favorite apps and get directions]. Plus, you'll get a handle on

  4. Study of WATCH GRB error boxes

    DEFF Research Database (Denmark)

    Gorosabel, J.; Castro-Tirado, A. J.; Lund, Niels

    1995-01-01

    We have studied the first WATCH GRB Catalogue ofγ-ray Bursts in order to find correlations between WATCH GRB error boxes and a great variety of celestial objects present in 33 different catalogues. No particular class of objects has been found to be significantly correlated with the WATCH GRBs....

  5. Syllabus. 5. Halley radiological refresher course. Chest, musculoskeleton, G. I. and abdomen, urinary tract

    International Nuclear Information System (INIS)

    Dalla Palma, L.

    1996-01-01

    This volume brings together the papers which 33 radiologists, chosen among the leading European experts, presented at the Halley Project 1996 Refresher Course. The project started out under the aegis of the European Association of Radiology in 1992 with the aim of fostering the advancement of radiolgy in various countries of Eastern Europe: Bulgaria, the Czech Republic, Slovakia, Hungary, Poland and Romania. It was possible to set up, in 1992, 1993, 1994 and 1995, four faculties of experts in uroradiology, gastrointestinal and abdominal radiology, chest radiology and skeletal radiology. These four faculties then gave a refresher course on the four radiological subspecialities in the six nations mentioned above. This year, the fifth in the activities, the event was celebrated by inviting all the 33 speakers who took part in the four previous refresher courses to participate in a single refresher course which would review the four subspecialities in such a way as to update progress in each branch to 1996. This volume gathers together all the 33 lectures presented at this 5th Halley Refresher Course. They focus on the most up-to-date issues in radiology of the chest, gastrointestinal tract, skeleton and urinary tract. (orig./VHE)

  6. Comparison of Wave Energy Transport at the Comets p/Halley and p/Giacobini-Zinner

    Science.gov (United States)

    Sding, A.; Glassmeir, K. H.; Fuselier, S. A.; Neubauer, Fritz M.; Tsurutani, B. T.

    1995-01-01

    Using magnetic field, plasma density and flow observations from spacecraft flybys of two comets, Eler variables are determined in order to study wave propogation directions. We investigate the inbound path of the Giotto spacecraft flyby of comet p/Halley outside the bow shock, and the inbound and outbound path of the ICE spacecraft flyby of comet p/Giacobini-Zinner outsinde of the bow wave.

  7. Spectrophotometry of 25 comets - Post-Halley updates for 17 comets plus new observations for eight additional comets

    Science.gov (United States)

    Newburn, Ray L., Jr.; Spinrad, Hyron

    1989-01-01

    The best possible production figures within the current post-Halley framework and available observations are given for H2O, O(1D), CN, C3, C2 and dust in 25 comets. Of these, the three objects with the smallest mixing ratios of all minor species have moderate to little or no dust and appear 'old'. Comets with large amounts of CN are very dusty, and there is a clear correlation of CN with dust, although comets with little or no dust still have some CN. Thus, CN appears to have at least two sources, dust and one or more parent gases. Also, the C2/CN production ratio changes continuously with heliocentric distance in every comet considered, suggesting that C2 production may be a function of coma density as well as parental abundance. Dust production ranges from essentially zero in Comet Sugano-Saigusa-Fujikawa up to 67,000 kg/s for Halley on March 14, 1986.

  8. Spectrophotometry of 25 comets - Post-Halley updates for 17 comets plus new observations for eight additional comets

    International Nuclear Information System (INIS)

    Newburn, R.L. Jr.; Spinrad, H.

    1989-01-01

    The best possible production figures within the current post-Halley framework and available observations are given for H2O, O(1D), CN, C3, C2 and dust in 25 comets. Of these, the three objects with the smallest mixing ratios of all minor species have moderate to little or no dust and appear 'old'. Comets with large amounts of CN are very dusty, and there is a clear correlation of CN with dust, although comets with little or no dust still have some CN. Thus, CN appears to have at least two sources, dust and one or more parent gases. Also, the C2/CN production ratio changes continuously with heliocentric distance in every comet considered, suggesting that C2 production may be a function of coma density as well as parental abundance. Dust production ranges from essentially zero in Comet Sugano-Saigusa-Fujikawa up to 67,000 kg/s for Halley on March 14, 1986. 61 references

  9. The outflow speed of the coma of Halley's comet

    International Nuclear Information System (INIS)

    Combi, M.R.

    1989-01-01

    Data concerning the outflow speed of the coma of Comet Halley are studied in relation to a generalization of the coupled pure-gas-dynamic/Monte Carlo model of Combi and Smyth (1988) to include the dusty-gas dynamics of the inner coma. Measurements made by the Giotto neutral-gas spectrometer, IR water observations from the Kuiper Airborne Observatory, and Doppler radio line profiles of HCN and OH are used to examine the radial dependence of the outflow speed, the asymmetry in the outflow speed, and the overall heliocentric distance dependence of the Doppler profiles, respectively. The results suggest that the model makes it possible to understand the gross long-term behavior and radial structure of the dynamics of the cometary coma. 23 refs

  10. Finding the Limits of Aid/Watch

    Directory of Open Access Journals (Sweden)

    Matthew Harding

    2011-11-01

    Full Text Available Commissioner of Taxation v Aid/Watch Incorporated is the latest of a series of recent cases in which the High Court of Australia has exhibited what might be described as a ‘generosity of spirit’ to would-be taxpayers whose charitable status has been called into question. In Aid/Watch, the Court ruled that an organisation formed to monitor and evaluate the delivery of foreign aid by Australian government agencies was a charity even though it was engaged, consistently with its objects, in the sorts of political activities that traditionally have been regarded as anathema to charity. This article considers where we might feasibly locate the boundaries of the High Court’s reasoning in Aid/Watch, in light of charity law as a whole. In other words, as a matter of charity law, what are the limits of Aid/Watch? Thinking about this question demands: (a some understanding of what the High Court in Aid/Watch said with certainty; and (b a wider review of charity law to see which of its rules and principles may bear upon cases about political purposes now that Aid/Watch has been decided.

  11. Factors influencing the intention to watch online video advertising.

    Science.gov (United States)

    Lee, Joonghwa; Lee, Mira

    2011-10-01

    This study examines the factors influencing consumer intention to watch online video ads, by applying the theory of reasoned action. The attitude toward watching online video ads, the subjective norm, and prior frequency of watching online video ads positively influence the intention to watch online video ads. Further, beliefs held about entertainment and information outcomes from watching online video ads and subjective norm influence attitude toward watching these ads.

  12. Proposing a tornado watch scale

    Science.gov (United States)

    Mason, Jonathan Brock

    This thesis provides an overview of language used in tornado safety recommendations from various sources, along with developing a rubric for scaled tornado safety recommendations, and subsequent development and testing of a tornado watch scale. The rubric is used to evaluate tornado refuge/shelter adequacy responses of Tuscaloosa residents gathered following the April 27, 2011 Tuscaloosa, Alabama EF4 tornado. There was a significant difference in the counts of refuge adequacy for Tuscaloosa residents when holding the locations during the April 27th tornado constant and comparing adequacy ratings for weak (EF0-EF1), strong (EF2-EF3) and violent (EF4-EF5) tornadoes. There was also a significant difference when comparing future tornado refuge plans of those same participants to the adequacy ratings for weak, strong and violent tornadoes. The tornado refuge rubric is then revised into a six-class, hierarchical Tornado Watch Scale (TWS) from Level 0 to Level 5 based on the likelihood of high-impact or low-impact severe weather events containing weak, strong or violent tornadoes. These levels represent maximum expected tornado intensity and include tornado safety recommendations from the tornado refuge rubric. Audio recordings similar to those used in current National Oceanic and Atmospheric Administration (NOAA) weather radio communications were developed to correspond to three levels of the TWS, a current Storm Prediction Center (SPC) tornado watch and a particularly dangerous situation (PDS) tornado watch. These were then used in interviews of Alabama residents to determine how changes to the information contained in the watch statements would affect each participant's tornado safety actions and perception of event danger. Results from interview participants (n=38) indicate a strong preference (97.37%) for the TWS when compared to current tornado watch and PDS tornado watch statements. Results also show the TWS elicits more adequate safety decisions from participants

  13. The Nurse Watch: Design and Evaluation of a Smart Watch Application with Vital Sign Monitoring and Checklist Reminders.

    Science.gov (United States)

    Bang, Magnus; Solnevik, Katarina; Eriksson, Henrik

    Computerized wearable devices such as smart watches will become valuable nursing tools. This paper describes a smart-watch system developed in close collaboration with a team of nurses working in a Swedish ICU. The smart-watch system provides real-time vital-sign monitoring, threshold alarms, and to-do reminders. Additionally, a Kanban board, visualized on a multitouch screen provides an overview of completed and upcoming tasks. We describe an approach to implement automated checklist systems with smart watches and discuss aspects of importance when implementing such memory and attention support. The paper is finalized with an in-development formative evaluation of the system.

  14. Evidence for the field line reconnection process in the particle and magnetic field measurements obtained during the Giotto-Halley encounter

    Energy Technology Data Exchange (ETDEWEB)

    Kirsch, E.; Daly, P.; Korth, A.; McKenna-Lawlor, S.; Neubauer, F.M.; O' Sullivan, D.; Thompson, A.; Wenzel, K.P.

    1989-04-01

    Measurements of low (E = 250-1000 eV) and high (E = 60 to > 300 keV) energy particles as well as the magnetic field obtained by 3 different instruments (Reme Plasma Analyser, Energetic Particle Analyser, MAGnetometer) during the Giotto-Halley encounter on 13/14 March 1986 are used to study the field line merging process. Spikes of 5-15 min duration in the high energy particle flux which are superimposed on the general intensity time profile are correlated with minima in the low energy particle flux and time periods of oppositely directed magnetic field lines. Strong changes in the pitch angle distribution of energetic ions are observed simultaneously. The observations are considered as evidence for sporadic field line merging processes in the front side of Halley's cometosheath which can accelerate ions and electrons up to E /similar to/ 300 keV.

  15. Nature Watch

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 20; Issue 3. Nature Watch: Symbiosis in Coastal Marine Communities. Neelam Pereira. Feature Article Volume 20 Issue 3 March 2015 pp 245-253. Fulltext. Click here to view fulltext PDF. Permanent link:

  16. Indigenous healthcare worker involvement for Indigenous adults and children with asthma.

    Science.gov (United States)

    Chang, Anne B; Taylor, Brett; Masters, I Brent; Laifoo, Yancy; Brown, Alexander Dh

    2010-05-12

    Asthma education is regarded as an important step in the management of asthma in national guidelines. Racial, ethnicity and socio-economic factors are associated with markers of asthma severity, including recurrent acute presentations to emergency health facilities. Worldwide, indigenous groups are disproportionately represented in the severe end of the asthma spectrum. Appropriate models of care are important in the successful delivery of services, and are likely contributors to improved outcomes for people with asthma. To determine whether involvement of an indigenous healthcare worker (IHW) in comparison to absence of an IHW in asthma education programs, improves asthma related outcomes in indigenous children and adults with asthma. We searched the Cochrane Central Register of Controlled Trials (CENTRAL), the Cochrane Airways Group Specialised Register, MEDLINE and EMBASE databases, review articles and reference lists of relevant articles. The latest search was in January 2010. All randomised controlled trials comparing involvement of an indigenous healthcare worker (IHW) in comparison to absence of an IHW in asthma education programs for indigenous people with asthma. Two independent review authors selected data for inclusion, a single author extracted the data. Both review authors independently assessed study quality. We contacted authors for further information. As it was not possible to analyse data as "intention-to-treat", we analysed data as "treatment received". Two studies fulfilled inclusion criteria involving 133 children randomised to an asthma education programme involving an IHW, compared to a similar education programme without an IHW. One study was not strictly Indigenous. 110 of these children completed the trials. Children's asthma knowledge score was significantly better in the group that had IHW education compared with control (mean difference 3.30; 95% CI 1.07 to 5.53), parents' asthma knowledge score (standardised mean difference (SMD) 1

  17. Nature Watch

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 7. Nature Watch - Singapore's Jurong BirdPark: A Study Model. Abraham Verghese. Feature Article Volume 6 Issue 7 July 2001 pp 74-88. Fulltext. Click here to view fulltext PDF. Permanent link:

  18. Nature Watch

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 9. Nature Watch - Coral Reefs and their Fauna: An Underwater Fantasyland. Anuradha Bhat. Feature Article Volume 9 Issue 9 September 2004 pp 62-73. Fulltext. Click here to view fulltext PDF. Permanent link:

  19. The modelling and assessment of whale-watching impacts

    Science.gov (United States)

    New, Leslie; Hall, Ailsa J.; Harcourt, Robert; Kaufman, Greg; Parsons, E.C.M.; Pearson, Heidi C.; Cosentino, A. Mel; Schick, Robert S

    2015-01-01

    In recent years there has been significant interest in modelling cumulative effects and the population consequences of individual changes in cetacean behaviour and physiology due to disturbance. One potential source of disturbance that has garnered particular interest is whale-watching. Though perceived as ‘green’ or eco-friendly tourism, there is evidence that whale-watching can result in statistically significant and biologically meaningful changes in cetacean behaviour, raising the question whether whale-watching is in fact a long term sustainable activity. However, an assessment of the impacts of whale-watching on cetaceans requires an understanding of the potential behavioural and physiological effects, data to effectively address the question and suitable modelling techniques. Here, we review the current state of knowledge on the viability of long-term whale-watching, as well as logistical limitations and potential opportunities. We conclude that an integrated, coordinated approach will be needed to further understanding of the possible effects of whale-watching on cetaceans.

  20. Tracking Steps on Apple Watch at Different Walking Speeds.

    Science.gov (United States)

    Veerabhadrappa, Praveen; Moran, Matthew Duffy; Renninger, Mitchell D; Rhudy, Matthew B; Dreisbach, Scott B; Gift, Kristin M

    2018-04-09

    QUESTION: How accurate are the step counts obtained from Apple Watch? In this validation study, video steps vs. Apple Watch steps (mean ± SD) were 2965 ± 144 vs. 2964 ± 145 steps; P Apple Watch steps when compared with the manual counts obtained from video recordings. Our study is one of the initial studies to objectively validate the accuracy of the step counts obtained from Apple watch at different walking speeds. Apple Watch tested to be an extremely accurate device for measuring daily step counts for adults.

  1. Airborne spectrophotometry of P/Halley from 20 to 65 microns

    Science.gov (United States)

    Glaccum, W.; Moseley, S. H.; Campins, H.; Loewenstein, R. F.

    1986-01-01

    Simultaneous 20 to 65 microns spectrometry and 100 microns photometry of P/Halley obtained on board the Kuiper Airborne Observatory (KAO) in 1985 Dec. and 1986 April are discussed. Spectra with resolution 30 to 50 were obtained with the NASA/Goddard 24 channel grating spectrometer. Measurements were made on the nucleus as well as 5 points along and perpendicular to the Sun-tail direction. The observations reveal the absence of any strong spectral features. The color temperature of the dust varies over time scales as short as 2 days, but is higher than that expected for a rapidly rotating blackbody at the same distance from the Sun. The color temperature does not vary within 1 arcmin of the nucleus, but the coma is brighter on the sunward side than on the antisunward side.

  2. Airborne spectrophotometry of Comet Halley from 5 to 9 microns

    Science.gov (United States)

    Campins, H.; Bregman, J. D.; Witteborn, F. C.; Wooden, D. H.; Rank, D. M.; Cohen, M.; Allamandola, Louis J.; Tielens, Alexander G. G. M.

    1986-01-01

    Spectrophotometry from 5 to 9 microns (resolution = 0.02) of comet Halley was obtained from the Kuiper Airborne Observatory on 1985 Dec. 12.1 and 1986 April 8.6 and 10.5 UT. Two spectral features are apparent in all the observations, one from 5.24 to 5.6 microns, and the silicate emission feature which has an onset between 7 and 8 microns. There is no evidence for the 7.5 microns feature observed by the Vega 1 spacecraft; the large difference between the areal coverage viewed from the spacecraft and the airplane may explain the discrepancy. Color temperatures significantly higher than a blackbody indicate that small particles are abundant in the coma. Significant spatial and temporal variations in the spectrum show trends similar to those observed from the ground.

  3. Turtle Watch: Community Engagement and Action

    Science.gov (United States)

    Lewis, Elaine; Baudains, Catherine

    2015-01-01

    Many threats face the freshwater turtle, Chelodina colliei, also known as the oblong turtle. A community education project, Turtle Watch, focused on this target species and enabled effective conservation action to be implemented. Turtle Watch was conducted in the Perth Metropolitan Area of Western Australia, as the oblong turtle inhabits the…

  4. Nature Watch

    Indian Academy of Sciences (India)

    ... Lecture Workshops · Refresher Courses · Symposia · Live Streaming. Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 5. Nature Watch - Thinking Like a Tahr: When Males and Females go their Separate Ways. M D Madhusudan. Feature Article Volume 3 Issue 5 May 1998 pp 43-47 ...

  5. SPORTS WATCHING CULTURE AMONG MALAYSIANS

    OpenAIRE

    Gunathevan Elumalai; Mohd Salleh Aman; Cassendra Gilbert; Muhammad Mat Yusof; Ahmad Tajuddin Othman; Lim Khong Chiu; Mohd Sofian Omar Fauzee; Hamdan Mohd Ali

    2015-01-01

    Background: Ardent sports watching will lead an individual to engage in sports and recreational activities continuously, while it also creates a sports culture among Malaysians. Sports watching culture is actually an intellectual activity. It is capable of evaluating behaviour, moral values and the level of appreciation of every spectator. Methods: This survey was conducted to identify the sports viewing culture among Malaysians. A cluster sampling method was used to select 6000 respondent...

  6. Synthetic profile analysis of the observed (0,0) Swan band of Comet Halley

    International Nuclear Information System (INIS)

    Krishna swamy, K.S.

    1991-01-01

    The time-dependent rotational population distribution for the (0,0) band of the Swan system was carried out. These population distributions are used to calculate the synthetic spectra over the wavelength region 5165-5132 A for comparing with the excellent spectra of Lambert et al. (1990) for Comet Halley. The synthetic spectra for the rotational population distribution corresponding to a time interval of about 8000 sec gives a good fit to the observed spectra over the whole special region. This seems to indicate that the level population does not appear to have reached the steady state values. 16 refs

  7. Measurement of plasma and energetic charged particles in the proximity of Halley's comet

    International Nuclear Information System (INIS)

    Erdoes, Geza; Gombosi, Tamas; Kecskemety, Karoly; Somogyi, Antal; Tatrallyay, Mariella; Varga, Andras

    1987-01-01

    The instrumentation aboard the space probe VEGA for the exploration of Halley's comet contained the particle analyzers PLAZMAG and TUENDE-M. PLAZMAG was used for the measurement of the interaction between the low-energy solar plasma and the heavy ions from the comet. From the energy spectra measured near the nucleus of the comet the density distribution of ion groups can also be determined. TUENDE-M recorded the distribution of energetic heavy ions from the comet. The properties of various plasma regions within the 10 million km range from the comet's nucleus are discussed in detail. (R.P.)

  8. ExMC Technology Watch

    Science.gov (United States)

    Krihak, M.; Barr, Y.; Watkins, S.; Fung, P.; McGrath, T.; Baumann, D.

    2012-01-01

    The Technology Watch (Tech Watch) project is a NASA endeavor conducted under the Human Research Program's (HRP) Exploration Medical Capability (ExMC) element, and focusing on ExMC technology gaps. The project involves several NASA centers, including the Johnson Space Center (JSC), Glenn Research Center (GRC), Ames Research Center (ARC), and the Langley Research Center (LaRC). The objective of Tech Watch is to identify emerging, high-impact technologies that augment current NASA HRP technology development efforts. Identifying such technologies accelerates the development of medical care and research capabilities for the mitigation of potential health issues encountered during human space exploration missions. The aim of this process is to leverage technologies developed by academia, industry and other government agencies and to identify the effective utilization of NASA resources to maximize the HRP return on investment. The establishment of collaborations with these entities is beneficial to technology development, assessment and/or insertion and further NASA's goal to provide a safe and healthy environment for human exploration. In 2011, the major focus areas for Tech Watch included information dissemination, education outreach and public accessibility to technology gaps and gap reports. The dissemination of information was accomplished through site visits to research laboratories and/or companies, and participation at select conferences where Tech Watch objectives and technology gaps were presented. Presentation of such material provided researchers with insights on NASA ExMC needs for space exploration and an opportunity to discuss potential areas of common interest. The second focus area, education outreach, was accomplished via two mechanisms. First, several senior student projects, each related to an ExMC technology gap, were sponsored by the various NASA centers. These projects presented ExMC related technology problems firsthand to collegiate laboratories

  9. Nature Watch

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 3. Nature Watch Diversity of Bats. G Marimuthu. Feature Article Volume 1 Issue 3 March 1996 pp 103-110. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/001/03/0103-0110. Author Affiliations.

  10. Nature Watch

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 8. Nature Watch - Secrets of the Shieldtails. Kartik Shanker. Feature Article Volume 1 Issue 8 August 1996 pp 64-70. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/001/08/0064-0070 ...

  11. First in situ plasma and neutral gas measurements at comet Halley: initial VEGA results

    International Nuclear Information System (INIS)

    Gringauz, K.I.; Remizov, A.P.; Gombosi, T.I.

    1986-04-01

    The first in situ observations and a description of the large scale behaviour of comet Halley's plasma environment are presented. The scientific objectives of the PLASMAG-1 experiment were as follows: to study the change of plasma parameters and distributions as a function of cometocentric distance; to investigate the existence and structure of the cometary bow shock; to determine the change in chemical composition of the heavily mass loaded plasma as the spacecraft approached the comet; and to measure the neutral gas distribution along the spacecraft trajectory. (author)

  12. 47 CFR 80.304 - Watch requirement during silence periods.

    Science.gov (United States)

    2010-10-01

    ....304 Section 80.304 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES STATIONS IN THE MARITIME SERVICES Safety Watch Requirements and Procedures Ship Station Safety Watches § 80.304 Watch requirement during silence periods. Each ship station operating on...

  13. Watching Dallas again 3 : Reassessing Ien Ang's Watching Dallas

    NARCIS (Netherlands)

    Heesakkers, Toon; van Hoof, Ward; Jager, Anne; Gilroy, Amanda

    2014-01-01

    This audience reception project performs an audience study of the first season of the new Dallas (2012–14). It draws on Ien Ang's Watching Dallas ([1982] 1985) to analyze the production of irony and nostalgia. We observe that the blend of ironic viewing and nostalgia results in a more ironic,

  14. Nature Watch

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 7. Nature Watch - The Odyssey of the Olive Ridley. Kartik Shanker. Feature Article Volume 4 Issue 7 July 1999 pp 68-78. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/07/0068-0078 ...

  15. Nature Watch

    Indian Academy of Sciences (India)

    2016-08-26

    Aug 26, 2016 ... ... 20; Issue 1. Nature Watch: A Tale of Two Turtles. V Deepak. Feature Article Volume 20 Issue 1 January 2015 pp 47-54. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/020/01/0047-0054. Keywords. Ecology; endemic; India; turtles; tortoises; Western Ghats.

  16. Water group ion distributions in the midcometosheath of comet Halley

    Science.gov (United States)

    Huddleston, D. E.; Neugebauer, M.; Goldstein, Bruce E.

    1993-01-01

    In the midcometosheath of comet Halley (1 x 10(exp 5) to 2 x 10(exp 5) km from the nucleus) the center-of-mass plasma frame is approximately the bulk flow velocity of the cometary ions, and the Alfven wave speed is an appreciable fraction of the flow speed. Here, the peaks of the water group ion distributions observed by the Giotto ion mass spectrometer are at velocities consistently below the expected pickup speed. It is shown that this effect is consistent with the scattering of the new pickup ions onto a bispherical shell distribution. The model does not fit the data inside approximately 1.2 x 10(exp 5) km, however, possibly as a result of the growing importance of collisions or the presence of other processes such as scattering on obliquely propagating magnetosonic waves.

  17. Detection of OH from Comet Halley in the far-infrared

    International Nuclear Information System (INIS)

    Stacey, G.J.; Lugten, J.B.; Genzel, R.

    1986-01-01

    The 2 Pi 3/2 (J = 5/2 yields 3/2 + yields - parity) transition of OH was detected in comet Halley at 119.44 microns. The upper limit to the line intensity of the - yields + parity transition is 119.23 microns. The ratio of these lines is consistent with radiative pumping of the rotational levels through absorption of near ultraviolet solar photons which excite the low lying vibrational levels of OH. The far-infrared lines probe the inner regions of the coma where OH is produced through photodissociation of a parent molecule (presumably H 2 O). Hence, these lines complement the 18 cm radio measurements which are sensitive to the outer regions of the comet coma. The OH production rate is highly model dependent but is of the order 2 to 4 times 10 to the 29th power molecules/sec

  18. Exploration Medical Capability - Technology Watch

    Science.gov (United States)

    Krihak, Michael; Watkins, Sharmila; Barr, Yael; Barsten, Kristina; Fung, Paul; Baumann, David

    2011-01-01

    The objectives of the Technology Watch process are to identify emerging, high-impact technologies that augment current ExMC development efforts, and to work with academia, industry, and other government agencies to accelerate the development of medical care and research capabilities for the mitigation of potential health issues that could occur during space exploration missions. The establishment of collaborations with these entities is beneficial to technology development, assessment and/or insertion. Such collaborations also further NASA s goal to provide a safe and healthy environment for human exploration. The Tech Watch project addresses requirements and capabilities identified by knowledge and technology gaps that are derived from a discrete set of medical conditions that are most likely to occur on exploration missions. These gaps are addressed through technology readiness level assessments, market surveys, collaborations and distributed innovation opportunities. Ultimately, these gaps need to be closed with respect to exploration missions, and may be achieved through technology development projects. Information management is a key aspect to this process where Tech Watch related meetings, research articles, collaborations and partnerships are tracked by the HRP s Exploration Medical Capabilities (ExMC) Element. In 2011, ExMC will be introducing the Tech Watch external website and evidence wiki that will provide access to ExMC technology and knowledge gaps, technology needs and requirements documents.

  19. The WATCH All-Sky Monitor for the Granat Project

    DEFF Research Database (Denmark)

    Brandt, Søren; Lund, Niels; Rao, A. R.

    1990-01-01

    The Watch X-ray all-sky monitor, which is designed to localize strong X-ray sources and follow their development, is examined, focusing on the addition of four Watch units to the Granat satellite project. The components of the Watch instrument are described and the capabilities and potential...... scientific returns of the Granat project are discussed. The applications of the Watch monitor are given, including the study of time variations of known sources and the detection and localization of new, transient sources....

  20. The Mechanics of Mechanical Watches and Clocks

    CERN Document Server

    Du, Ruxu

    2013-01-01

    "The Mechanics of Mechanical Watches and Clocks" presents historical views and mathematical models of mechanical watches and clocks. Although now over six hundred years old, mechanical watches and clocks are still popular luxury items that fascinate many people around the world. However few have examined the theory of how they work as presented in this book. The illustrations and computer animations are unique and have never been published before. It will be of significant interest to researchers in mechanical engineering, watchmakers and clockmakers, as well as people who have an engineering background and are interested in mechanical watches and clocks. It will also inspire people in other fields of science and technology, such as mechanical engineering and electronics engineering, to advance their designs. Professor Ruxu Du works at the Chinese University of Hong Kong, China. Assistant Professor Longhan Xie works at the South China University of Technology, China.

  1. 75 FR 49510 - Credit Watch Termination Initiative

    Science.gov (United States)

    2010-08-13

    ... DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT [Docket No. FR-5411-N-02] Credit Watch Termination Initiative AGENCY: Office of the Assistant Secretary for Housing--Federal Housing Commissioner, HUD. ACTION... FHA Credit Watch Termination Initiative. This notice includes a list of mortgagees which have had...

  2. 75 FR 17944 - Credit Watch Termination Initiative

    Science.gov (United States)

    2010-04-08

    ... DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT [Docket No. FR-5411-N-01] Credit Watch Termination Initiative AGENCY: Office of the Assistant Secretary for Housing--Federal Housing Commissioner, HUD. ACTION... FHA Credit Watch Termination Initiative. This notice includes a list of mortgagees which have had...

  3. Water-Group Ion Distributions in the Mid-Cometosheath of Comet Halley

    Science.gov (United States)

    Huddleston, D. E.; Neugebauer, M.; Goldstein, B. E.

    1993-01-01

    In the mid-cometosheath of comet Halley (1-2x10^5 km from the nucleus) the center- of-mass plasma frame is approximately the bulk flow velocity of the cometary ions, and the Alfven wave speed is an appreciable fraction of the flow speed. Here, the peaks of the water-group ion distributions observed by the Giotto Ion Mass Spectrometer are at velocities consistently below the expected pickup speed. It is shown that this effect is consistent with the scattering of the new pickup ions onto a bispherical shell distribution. The model does not fit the data inside similar 1.2x10^5 km however, possibly as a result of the growing importance of collisions or the presence of other processes such as scattering on obliquely-propagating magnetosonic waves.

  4. The WATCH solar X-ray burst catalogue

    DEFF Research Database (Denmark)

    Crosby, N.; Lund, Niels; Vilmer, N.

    1998-01-01

    The WATCH experiment aboard the GRANAT satellite provides observations of the Sun in the deka-keV range covering the years 1990 through mid-1992. An introduction to the experiment is given followed by an explanation of how the WATCH solar burst catalogue was created. The different parameters list...

  5. Development of Watch Schedule Using Rules Approach

    Science.gov (United States)

    Jurkevicius, Darius; Vasilecas, Olegas

    The software for schedule creation and optimization solves a difficult, important and practical problem. The proposed solution is an online employee portal where administrator users can create and manage watch schedules and employee requests. Each employee can login with his/her own account and see his/her assignments, manage requests, etc. Employees set as administrators can perform the employee scheduling online, manage requests, etc. This scheduling software allows users not only to see the initial and optimized watch schedule in a simple and understandable form, but also to create special rules and criteria and input their business. The system using rules automatically will generate watch schedule.

  6. 47 CFR 80.309 - Watch required by the Bridge-to-Bridge Act.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Watch required by the Bridge-to-Bridge Act. 80... Safety Watches § 80.309 Watch required by the Bridge-to-Bridge Act. In addition to the watch requirement contained in § 80.148, all vessels subject to the Bridge-to-Bridge Act must keep a watch on the designated...

  7. Teach yourself visually Apple Watch

    CERN Document Server

    Hart-Davis, Guy

    2015-01-01

    Master your new smartwatch quickly and easily with this highly visual guide Teach Yourself VISUALLY Apple Watch is a practical, accessible guide to mastering the powerful features and functionality of your new smartwatch. For Apple devotees and new users alike, this easy-to-follow guide features visually rich tutorials and step-by-step instructions that show you how to take advantage of all of the Apple watch's capabilities. You'll learn how to track your health, control household devices, download and install apps, sync your music, sync other Apple devices, and efficiently use the current O

  8. Watching Subtitled Films Can Help Learning Foreign Languages.

    Science.gov (United States)

    Birulés-Muntané, J; Soto-Faraco, S

    2016-01-01

    Watching English-spoken films with subtitles is becoming increasingly popular throughout the world. One reason for this trend is the assumption that perceptual learning of the sounds of a foreign language, English, will improve perception skills in non-English speakers. Yet, solid proof for this is scarce. In order to test the potential learning effects derived from watching subtitled media, a group of intermediate Spanish students of English as a foreign language watched a 1h-long episode of a TV drama in its original English version, with English, Spanish or no subtitles overlaid. Before and after the viewing, participants took a listening and vocabulary test to evaluate their speech perception and vocabulary acquisition in English, plus a final plot comprehension test. The results of the listening skills tests revealed that after watching the English subtitled version, participants improved these skills significantly more than after watching the Spanish subtitled or no-subtitles versions. The vocabulary test showed no reliable differences between subtitled conditions. Finally, as one could expect, plot comprehension was best under native, Spanish subtitles. These learning effects with just 1 hour exposure might have major implications with longer exposure times.

  9. Learning AirWatch

    CERN Document Server

    Dunkerley, Mark

    2015-01-01

    If you are a technical professional who wants to dive deeper into the functionality offered by AirWatch or manage the solution, then this book will help you choose the best set of configuration, device management, and monitoring options that you can use to effectively manage your EMM implementation.

  10. Halley comet position in structure of the comet origin general scheme

    International Nuclear Information System (INIS)

    Davydov, V.D.

    1988-01-01

    Attempt to explain data on the Halley comet nucleus figure by photographes received from space probes in 1986 was undertaken. Peanut-like nucleus might be formed from two bodies former system under specific conditions. This hypothesis preliminary development is made; solution way for the problem about quantitative characteristics of collision and destruction is found. Quantitative assessments confirm retention possibility of two space icebergs original form after their ''docking'' within relative velocity range up to a few meters per second. Then complex with visible saddle point between two jointed fragments is formed. The hypothesis suggested is well inscribed in the origin general scheme of comets with nucleus different types, and from general scheme one may draw up the most important details to this hypothesis (for example, power mechanism of binary system formation and reasons of its destabilization)

  11. 33 CFR 401.60 - Listening watch and notice of arrival.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Listening watch and notice of arrival. 401.60 Section 401.60 Navigation and Navigable Waters SAINT LAWRENCE SEAWAY DEVELOPMENT....60 Listening watch and notice of arrival. (a) Vessels shall be on radio listening watch on the...

  12. Human seasonal and circadian studies in Antarctica (Halley, 75°S).

    Science.gov (United States)

    Arendt, Josephine; Middleton, Benita

    2018-03-01

    Living for extended periods in Antarctica exposes base personnel to extremes of daylength (photoperiod) and temperature. At the British Antarctic Survey base of Halley, 75°S, the sun does not rise for 110 d in the winter and does not set for 100 d in summer. Photoperiod is the major time cue governing the timing of seasonal events such as reproduction in many species. The neuroendocrine signal providing photoperiodic information to body physiology is the duration of melatonin secretion which reflects the length of the night: longer in the short days of winter and shorter in summer. Light of sufficient intensity and spectral composition serves to suppress production of melatonin and to set the circadian timing and the duration of the rhythm. In humans early observations suggested that bright (>2000 lux) white light was needed to suppress melatonin completely. Shortly thereafter winter depression (Seasonal Affective Disorder or SAD) was described, and its successful treatment by an artificial summer photoperiod of bright white light, sufficient to shorten melatonin production. At Halley dim artificial light intensity during winter was measured, until 2003, at a maximum of approximately 500 lux in winter. Thus a strong seasonal and circadian time cue was absent. It seemed likely that winter depression would be common in the extended period of winter darkness and could be treated with an artificial summer photoperiod. These observations, and predictions, inspired a long series of studies regarding human seasonal and circadian status, and the effects of light treatment, in a small overwintering, isolated community, living in the same conditions for many months at Halley. We found little evidence of SAD, or change in duration of melatonin production with season. However the timing of the melatonin rhythm itself, and/or that of its metabolite 6-sulphatoxymelatonin (aMT6s), was used as a primary marker of seasonal, circadian and treatment changes. A substantial phase

  13. Healthcare Applications of Smart Watches

    Science.gov (United States)

    Lu, Tsung-Chien; Fu, Chia-Ming; Ma, Matthew Huei-Ming; Fang, Cheng-Chung

    2016-01-01

    Summary Objective The aim of this systematic review is to synthesize research studies involving the use of smart watch devices for healthcare. Materials and Methods The Preferred Reporting Items for Systematic Reviews and Meta-Analyses (PRISMA) was chosen as the systematic review methodology. We searched PubMed, CINAHL Plus, EMBASE, ACM, and IEEE Xplore. In order to include ongoing clinical trials, we also searched ClinicalTrials.gov. Two investigators evaluated the retrieved articles for inclusion. Discrepancies between investigators regarding article inclusion and extracted data were resolved through team discussion. Results 356 articles were screened and 24 were selected for review. The most common publication venue was in conference proceedings (13, 54%). The majority of studies were published or presented in 2015 (19, 79%). We identified two registered clinical trials underway. A large proportion of the identified studies focused on applications involving health monitoring for the elderly (6, 25%). Five studies focused on patients with Parkinson’s disease and one on cardiac arrest. There were no studies which reported use of usability testing before implementation. Discussion Most of the reviewed studies focused on the chronically ill elderly. There was a lack of detailed description of user-centered design or usability testing before implementation. Based on our review, the most commonly used platform in healthcare research was that of the Android Wear. The clinical application of smart watches as assistive devices deserves further attention. Conclusion Smart watches are unobtrusive and easy to wear. While smart watch technology supplied with biosensors has potential to be useful in a variety of healthcare applications, rigorous research with their use in clinical settings is needed. PMID:27623763

  14. Viewers Motivations for Watching Beauty Videos on You Tube

    OpenAIRE

    Jiroušková, Dominika

    2016-01-01

    The diploma thesis focuses on motivations for watching beauty videos on YouTube. The aim is to clarify why viewers watch amateur videos that communicate topics related to physical appearance. Assuming the audience as an active actor of media communication the thesis is based on uses and gratification theory. Viewers watch beauty videos consciously to meet their individual needs. Based on an analysis of eleven interviews with regular viewers of beauty videos this thesis reveals five categories...

  15. Application of radioisotope for radio-luminous watch and clock industry in Japan

    International Nuclear Information System (INIS)

    Murayama, Yoshihiko

    1981-01-01

    In 1979, Japan became No. 1 watch and clock production country in the world, and has produced 88 million watches and 59 million clocks in 1980. About 65% of them were exported. The production of radio-luminous watches and clocks in 1980 was estimated as 13 million and 11 million, respectively, and has increased by 40% as compared with the previous year. In Japan, the law concerning the prevention of radiation injuries due to radioisotopes and others is applied to radio-luminous watches and clocks, because radioactive substances are contained in luminous paint, and the production is regulated by the law as unsealed RI-using establishments. The permitted establishments engaging in radio-luminous watches and clocks are 3 luminous paint makers, 9 painting works and 35 watch and clock assembling plants. The RI utilized for radio-luminous watches and clocks is limited to Pm-147 at present, and 3788 Ci was used in 1980. About 70 years have elapsed since luminous paint was used for watches and clocks for the first time. The ISO instituted the international standard on radio-luminous paint for watches and clocks in 1975. The beta-ray emitted by Pm-147 is shielded perfectly by glasses and cases, and only the dose of brems-strahlung X-ray is the problem. The radiation control in radio-luminous watch and clock plants is described. (Kako, I.)

  16. Produccion Gaseosa del Cometa Halley: Erupciones Y Fotodisociacion del Radical OH

    Science.gov (United States)

    Silva, A. M.; Mirabel, I. F.

    1990-11-01

    RESUMEN:En este trabajo informamos la detecci6n de 20 erupciones en la li'nea de =18cm (1667MHz) del radical OH en el Cometa Halley.Las observaciones incluyen todos los monitoreos existentes y se extienden desde 120 dias antes del perihelio hasta 90 dias despues.Se detectan bruscos crecimientos en el flujo medido,hasta un factor 1O,seguidos por decaimientos lentos asociados con la fotodisociaci6n del OH. Se obtuvieron valores para el tiempo de vida fotoquimico del OH y del H2O basandose en el modelo desarrollado previamente por Silva(1988). Esos tiempos de vida estan de acuerdo con predicciones teoricas y con las observaciones en el Ultravioleta, y los resultados, los que son fuertemente dependientes de la velocidad heliocentrica del Coineta (variando hasta un factor 6), han sido calculados para varios rangos de velocidad entre +28 y -28 km/seg. Key wo'L :

  17. Interim criteria for Organic Watch List tanks at the Hanford Site

    International Nuclear Information System (INIS)

    Babad, S.; Turner, D.A.

    1993-09-01

    This document establishes interim criteria for identifying single-shell radioactive waste storage tanks at the Hanford Site that contain organic chemicals mixed with nitrate/nitrite salts in potentially hazardous concentrations. These tanks are designated as ''organic Watch List tanks.'' Watch List tanks are radioactive waste storage tanks that have the potential for release of high-level waste as a result of uncontrolled increases in temperature or pressure. Organic Watch List tanks are those Watch List tanks that contain relatively high concentrations of organic chemicals. Because of the potential for release of high-level waste resulting from uncontrolled increases in temperature or pressure, the organic Watch List tanks (collectively) constitute a Hanford Site radioactive waste storage tank ''safety issue.''

  18. Is watching television a realistic leisure option for people with dementia?

    Science.gov (United States)

    Gústafsdóttir, Margrét

    2015-01-01

    Watching television is a common leisure activity, not least among older people. However, watching television may become difficult when it is disturbed by symptoms of dementia. A total of 284 questionnaires were handed out to relatives of people with dementia in Iceland, in the Memory Clinic of the University Hospital and in specialized units for people with dementia (6 day-care units and 8 units within nursing homes). The response rate was just below 58%. Watching television was shown to play a less important role in the course of the daily life of people with dementia as soon as the symptoms of the disease became evident, and it increasingly became less relevant. So, this previous leisure activity left an ever-growing void of time to fill. However, watching television may provide an important social context for contact and togetherness during the progress of the disease, as watching television with someone close to them was important for the individuals with dementia. It is not a viable option for people with dementia to watch television on their own, but they may enjoy watching television while sharing this activity with a person close to them. This may even provide quality time.

  19. Functional electronic screen printing – electroluminescent smart fabric watch

    OpenAIRE

    de Vos, Marc; Torah, Russel; Beeby, Steve; Tudor, John

    2013-01-01

    Motivation for screen printed smart fabrics.Introduce functional electronic screen printing on fabrics.Printed smart fabric watch design.Printing process for electroluminescent watch.Demonstration video.Conclusions and further work.Examples of other screen printed smart fabrics.

  20. P3-1: Ophthalmologic Factors Influencing Asthenopia with Watching 3D Displays

    Directory of Open Access Journals (Sweden)

    Sungwook Wee

    2012-10-01

    Full Text Available Purpose: To identify ophthalmologic factors influencing asthenopia while watching 3D displays. Methods: 30 adult subjects without ophthalmologic abnormality watched the same 3D displays for 30 minutes. Each subject's far and near visual acuity, near points of accommodation and convergence, amplitude of fusional convergence and divergence, stereopsis, angle of phoric deviation, tear break-up time, and temperature of ocular surface before and after watching 3D displays were measured. And surveys for subjective symptoms right after watching 3D displays were conducted. The above-mentioned experiments were performed equally with 2D displays for detection of innate influence of 3D displays. Results: The near points of accommodation and convergence were significantly changed after watching 3D displays (p < .05 compared to 2D displays. And all 10 subjective symptoms were significantly increased after watching 3D displays (p < .05. Conclusion: The accommodation and binocular vergence are predominant ophthalmologic factors that might influence asthenopia significantly while watching 3D displays. Subjective visual discomfort significantly increases with watching 3D displays, and more specific evaluation should be added for detecting the practically related factors with asthenopia.

  1. Toward a qualitative understanding of binge-watching behaviors: A focus group approach.

    Science.gov (United States)

    Flayelle, Maèva; Maurage, Pierre; Billieux, Joël

    2017-12-01

    Background and aims Binge-watching (i.e., seeing multiple episodes of the same TV series in a row) now constitutes a widespread phenomenon. However, little is known about the psychological factors underlying this behavior, as reflected by the paucity of available studies, most merely focusing on its potential harmfulness by applying the classic criteria used for other addictive disorders without exploring the uniqueness of binge-watching. This study thus aimed to take the opposite approach as a first step toward a genuine understanding of binge-watching behaviors through a qualitative analysis of the phenomenological characteristics of TV series watching. Methods A focus group of regular TV series viewers (N = 7) was established to explore a wide range of aspects related to TV series watching (e.g., motives, viewing practices, and related behaviors). Results A content analysis identified binge-watching features across three dimensions: TV series watching motivations, TV series watching engagement, and structural characteristics of TV shows. Most participants acknowledged that TV series watching can become addictive, but they all agreed having trouble recognizing themselves as truly being an "addict." Although obvious connections could be established with substance addiction criteria and symptoms, such parallelism appeared to be insufficient, as several distinctive facets emerged (e.g., positive view, transient overinvolvement, context dependency, and low everyday life impact). Discussion and conclusion The research should go beyond the classic biomedical and psychological models of addictive behaviors to account for binge-watching in order to explore its specificities and generate the first steps toward an adequate theoretical rationale for these emerging problematic behaviors.

  2. Procesamiento Digital de Imagenes del Cometa Halley

    Science.gov (United States)

    Ferrin, L.; Fuenmayor, F.; Naranjo, O.; Bulka, P.; Mendoza, C.

    1987-05-01

    Se reportan observaciones fotográficas del cometa Halley, obtenidas con los telescopios Schmidt de 1-m del CIDA, y de 35 cms de la ULA. Se hicieron exposiciones desde 2 segundos a 30 minutos y se utilizaron emulsiones IIa-O, 103a-F, y 103a-D, guladas manualmente 0 automaticámente. Las imágenes fueron digitalizadas con el microdensitómetro PDS, y procesadas con el sistema HACIENDA del CCIBM. Se experimentó con la Transformada de Fourier en dos dimensiones, y con la aplicación de filtros de paso alto y bajo. Se encontró que el metodo de "autocorrelación" es el mejor para separar "la vegetación" de "la montaña". Se aplicaron diversas técnicas a fin de cubrir ambos extremos: a) enfatizar detalles débiles en la cola, y b) penetrar en las regiones más intensas de la coma. Se lograron ambos objetivos. Detalles en la cola permitieron determinar velocidades de propagación de unos 50 a 90 kms/ seg. Se pudieron detectar no menos de tres perturbaciones en "Y", y una en 5? Co de Cisne). Se cree que las primeras están asociadas a eventos de desconexión. Se puede separar la cola de gas de la de polvo. Las fotos de color permiten enfatizar diferentes regiones espectrales con mayor claridad aún. El "balance" del color puede ser hecho con la computadora.

  3. Watching a Film With Others : Towards a Theory of Collective Spectatorship

    NARCIS (Netherlands)

    Hanich, Julian

    This essay suggests that collectively watching a film with quiet attention should be considered a kind of joint action. When silently watching a film in a cinema the viewers are not merely engaged in individual actions – watching a film with others often implies a shared activity based on a

  4. Reducing TV watching during adult obesity treatment: two pilot randomized controlled trials.

    Science.gov (United States)

    Raynor, Hollie A; Steeves, Elizabeth Anderson; Bassett, David R; Thompson, Dixie L; Gorin, Amy A; Bond, Dale S

    2013-12-01

    The more time adults spend being sedentary, the greater the risk of obesity. The effect of reducing television (TV) watching, a prominent sedentary behavior, on weight loss has not been tested in an adult standard behavioral obesity intervention, and the mechanisms by which reducing TV watching influences energy balance behaviors are not well understood. Two, 8-week, pilot, randomized controlled trials were conducted examining the effect of a reduced TV watching prescription on energy balance behaviors and weight loss within an adult standard behavioral obesity intervention. In the first study, participants (n=24) were randomized into one of two conditions: (a) reduce energy intake and increase moderate to vigorous physical activity (MVPA) (INCREASE PA); or (b) reduce energy intake and decrease TV watching (DECREASE TV). As findings from the first pilot study did not show an increase in MVPA in the DECREASE TV group, the second study was designed to examine the effect of adding a reduced TV prescription to a standard intervention to optimize outcomes. In Pilot Study 2, participants (n=28) were randomized to INCREASE PA or to INCREASE PA+DECREASE TV. Outcomes included objectively measured TV watching and MVPA, self-reported light physical activity (LPA-Pilot Study 2 only), self-reported dietary intake while watching TV, and weight. Conditions with TV watching prescriptions significantly reduced TV watching. Both studies showed medium to large effect sizes for conditions with TV watching prescriptions to show greater reductions in dietary intake while watching TV. Pilot Study 1 found a trend for an increase in MVPA in INCREASE PA and Pilot Study 2 found significant increases in MVPA in both conditions. Pilot Study 2 found a significant increase in LPA in the INCREASE PA+DECREASE TV. Results indicate adding a TV watching prescription to a standard obesity intervention did not enhance increases in MVPA, but may assist with reducing dietary intake while TV watching and

  5. Great Lakes CoastWatch Node

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — CoastWatch is a nationwide National Oceanic and Atmospheric Administration (NOAA) program within which the Great Lakes Environmental Research Laboratory (GLERL)...

  6. Is Watching Television a Realistic Leisure Option for People with Dementia

    Directory of Open Access Journals (Sweden)

    Margrét Gústafsdóttir

    2015-03-01

    Full Text Available Background: Watching television is a common leisure activity, not least among older people. However, watching television may become difficult when it is disturbed by symptoms of dementia. Method: A total of 284 questionnaires were handed out to relatives of people with dementia in Iceland, in the Memory Clinic of the University Hospital and in specialized units for people with dementia (6 day-care units and 8 units within nursing homes. The response rate was just below 58%. Results: Watching television was shown to play a less important role in the course of the daily life of people with dementia as soon as the symptoms of the disease became evident, and it increasingly became less relevant. So, this previous leisure activity left an ever-growing void of time to fill. However, watching television may provide an important social context for contact and togetherness during the progress of the disease, as watching television with someone close to them was important for the individuals with dementia. Conclusion: It is not a viable option for people with dementia to watch television on their own, but they may enjoy watching television while sharing this activity with a person close to them. This may even provide quality time.

  7. International mussel watch

    International Nuclear Information System (INIS)

    Farrington, J.W.; Tripp, B.W.

    1993-01-01

    Deliberate and inadvertent discharges of chemical contaminants of environmental concern to the world's coastal ocean will continue for the foreseeable future, as human population increases and human habitation intensifies in the coastal zone worldwide. The goal of the International Mussel Watch Project is to provide an assessment of the status and trends of chemical contaminants in the world's coastal waters. These data are critical for protecting both the health of people who consume seafood and the health of coastal ecosystems. The International Mussel Watch Project is a global-scale monitoring program based on the concept of a sentinel organism capable of detecting trends in concentrations of several important marine contaminants. These included chlorinated pesticides, fossil-fuel hydrocarbons, and radionuclides from the nuclear fuel cycle and nuclear weapons testing fallout. Since the 1970's, scientists of several countries have been using common bivalve organisms, such as the blue mussels and oysters, to monitor chemical contaminants in coastal waters. Bivalve mollusks are good monitors for several reasons that include their ability to bioconcentrate the chemical contaminants of interest and their sedentary nature, which makes them representative of a specific place

  8. Estimating the impact of whaling on global whale watching

    NARCIS (Netherlands)

    H-I. Kuo (Hsiao-I); C-C. Chen (Chi-Chung); M.J. McAleer (Michael)

    2009-01-01

    textabstractAfter the commercial whaling moratorium was enacted in 1986, whale watching became one of the fastest growing tourism industries worldwide. As whaling was regarded as an activity incompatible with whale watching, the possible resumption of commercial whaling caused an urgent need to

  9. Out of the SHADOW: watch parts in the spotlight -- laser beam microwelding of delicate watch components

    Science.gov (United States)

    Kramer, Thorsten; Olowinsky, Alexander M.

    2003-07-01

    Conventional joining techniques like press fitting or crimping require the application of mechanical forces to the parts which, in combination with the tolerances of both parts to be joined, lead to imprecision and poor tensile strength. In contrast, laser beam micro welding provides consistent joining and high flexibility and it acts as an alternative as long as press fitting, crimping, screwing or gluing are not capable of batch production. Different parts and even different metals can be joined in a non-contact process at feed rates of up to 60 m/min and with weld seam lengths from 0.6 mm to 15.7 mm. Due to the low energy input, typically 1 J to 6 J, a weld width as small as 50 μm and a weld depth as small as 20 μm have been attained. This results in low distortion of the joined watch components. Since the first applications of laser beam micro welding of watch components showed promising results, the process has further been enhanced using the SHADOW technique. Aspects of the technique such as tensile strength, geometry and precision of the weld seam as well as the acceptance amongst the -mostly conservative- watch manufacturers have been improved.

  10. Evaluating the Role and Contribution of Innovation to Health and Wealth in the UK: A Review of Innovation, Health and Wealth: Phase 1 Final Report.

    Science.gov (United States)

    Bienkowska-Gibbs, Teresa; Exley, Josephine; Saunders, Catherine L; Marjanovic, Sonja; Chataway, Joanna; MacLure, Calum; McDonald, Ruth; Ling, Tom

    2016-06-20

    The Department of Health's Innovation, Health and Wealth (IHW) strategy aimed to introduce a more strategic approach to the spread of innovation across the NHS. This study represents the first phase of a three-year evaluation and aims to map progress towards the IHW strategy and its component actions. This evaluation used a combination of quantitative and qualitative methods: document review, key informant interviews and stakeholder survey. This study also forms the basis for selecting case studies for phase two of the evaluation. Our findings from the interviews and survey suggest broad stakeholder support for the overarching ambitions of the IHW strategy. However, we found variable progress towards the overarching objectives of the eight IHW themes and an ambiguous relationship between many of the themes' objectives and their actions. It was difficult to assess progress on IHW's actions as commitment to the actions, implementation guidance and expected outcomes of the actions were not clearly articulated. The Academic Health Science Networks (AHSNs) and the Small Business Research Initiative (SBRI) were reported to be working well, which may be attributed to their clear structures of accountability and earmarked budgets. However, survey respondents and interviewees raised concerns that budgetary pressures may limit the impact of both AHSNs and the SBRI. The main challenges identified for ongoing action were the resources available for their implementation (e.g. Medtech Briefings), lack of awareness of the initiative (e.g. the NICE Implementation Collaborative) and the design of the actions (e.g. the Innovation Scorecard, web portal and High Impact Innovations).

  11. Gender Roles and Night-Sky Watching among College Students

    Science.gov (United States)

    Kelly, William E.; McGee, Catherine M.

    2012-01-01

    The present study investigated the relationship between gender roles and night-sky watching in a sample of college students (N=161). The Bem Sex-Role Inventory (BSRI) and the Noctcaelador Inventory (NI) were used to investigate the differences between gender role groups for night-sky watching. The results supported the hypothesis that androgynous…

  12. Television Watching and Telomere Length Among Adults in Southwest China.

    Science.gov (United States)

    Xue, Hong-Mei; Liu, Qian-Qian; Tian, Guo; Quan, Li-Ming; Zhao, Yong; Cheng, Guo

    2017-09-01

    To explore the independent associations of sedentary behavior and physical activity with telomere length among Chinese adults. Data on total time of sedentary behavior, screen-based sedentary behavior (including television watching and computer or phone use), moderate to vigorous physical activity, and dietary intake of 518 adults in Chengdu, Guizhou, and Xiamen in China (54.25% women) aged 20 to 70 years were obtained between 2013 and 2015 through questionnaires. Height, weight, and waist circumference were measured to calculate body mass index and percentage of body fat. Telomere length was measured through Southern blot technique. Television watching was inversely related to adjusted telomere length (-71.75 base pair; SE = 34.40; P  = .04). Furthermore, a similar trend between telomere length and television watching was found in the group aged 20 to 40 years after adjusting for all covariates. Adults aged 20 to 40 years in the highest tertile of daily time spent on watching television had 4.0% shorter telomere length than adults in the lowest tertile (P = .03). Although the association is modest, television watching is inversely related to telomere length among Chinese adults, warranting further investigation in large prospective studies.

  13. Quasi-periodic variations of cometary ion fluxes at large distances from comet Halley

    Energy Technology Data Exchange (ETDEWEB)

    Richter, A.K.; Daly, P.W.; Verigin, M.I.; Gringauz, K.I.; Erdos, G.; Kecskemety, K.; Somogyi, A.J.; Szego, K.; Varga, A.; McKenna-Lawlor, S.

    1989-04-01

    Large variations, with a period of about 4 h, in the energetic ion fluxes have been observed far upstream (between 2 and 10 million kilometers) of comet Halley on both the Vega-1 and Giotto spacecraft. We have fitted the cometocentric distances of the occurrences to a simple model of expanding shells of neutral particles, the production of which is modulated by the spin of the comet nucleus, and have achieved excellent agreement between the two spacecraft. We derive an expansion speed for the neutrals of 6.18 +- 0.14 km s/sup -1/. Possible candidates for the neutrals are hydrogen atoms, created by the photo-dissociation of OH with a speed of 8 km s/sup -1/, or oxygen atoms, produced from the photo-dissociation of CO/sub 2/ with a speed of 6.5 km s/sup -1/.

  14. Infrared observations of an outburst of small dust grains from the nucleus of Comet P/Halley 1986 III at perihelion

    Science.gov (United States)

    Gehrz, R. D.; Johnson, C. H.; Magnuson, S. D.; Ney, E. P.; Hayward, T. L.

    1995-01-01

    A close examination of the 0.7- to 23-micron infrared data base acquired by Gehrz and Ney (1992), suggests that the nucleus of Comet P/Halley 1986 III emitted a burst of small dust grains during a 3-day period commencing within hours of perihelion passage on 1986 February 9.46 UT. The outburst was characterized by significant increases in the coma's grain color temperature T(sub obs), temperature excess (superheat: S = T(sub obs)/T(sub BB)), infrared luminosity, albedo, and 10-micron silicate emission feature strength. These changes are all consistent with the sudden ejection from the nucleus of a cloud of grains with radii of approximately 0.5 micron. This outburst may have produced the dust that was responsible for some of the tail streamers photographed on 1986 February 22 UT. The peak of the dust outburst occurred about 3 days before a pronounced increase in the water production rate measured by the Pioneer Venus Orbiter Ultraviolet Spectrometer. We suggest that jets that release large quantities of small particles may be largely responsible for some of the variable infrared behavior that has been reported for P/Halley and other comets during the past two decades. Such jets may also account for some of the differences IR Type I and IR Type II comets.

  15. Initiating a watch list for Ebola virus antibody escape mutations

    Directory of Open Access Journals (Sweden)

    Craig R. Miller

    2016-02-01

    Full Text Available The 2014 Ebola virus (EBOV outbreak in West Africa is the largest in recorded history and resulted in over 11,000 deaths. It is essential that strategies for treatment and containment be developed to avoid future epidemics of this magnitude. With the development of vaccines and antibody-based therapies using the envelope glycoprotein (GP of the 1976 Mayinga strain, one important strategy is to anticipate how the evolution of EBOV might compromise these efforts. In this study we have initiated a watch list of potential antibody escape mutations of EBOV by modeling interactions between GP and the antibody KZ52. The watch list was generated using molecular modeling to estimate stability changes due to mutation. Every possible mutation of GP was considered and the list was generated from those that are predicted to disrupt GP-KZ52 binding but not to disrupt the ability of GP to fold and to form trimers. The resulting watch list contains 34 mutations (one of which has already been seen in humans at six sites in the GP2 subunit. Should mutations from the watch list appear and spread during an epidemic, it warrants attention as these mutations may reflect an evolutionary response from the virus that could reduce the effectiveness of interventions such as vaccination. However, this watch list is incomplete and emphasizes the need for more experimental structures of EBOV interacting with antibodies in order to expand the watch list to other epitopes. We hope that this work provokes experimental research on evolutionary escape in both Ebola and other viral pathogens.

  16. Initiating a watch list for Ebola virus antibody escape mutations.

    Science.gov (United States)

    Miller, Craig R; Johnson, Erin L; Burke, Aran Z; Martin, Kyle P; Miura, Tanya A; Wichman, Holly A; Brown, Celeste J; Ytreberg, F Marty

    2016-01-01

    The 2014 Ebola virus (EBOV) outbreak in West Africa is the largest in recorded history and resulted in over 11,000 deaths. It is essential that strategies for treatment and containment be developed to avoid future epidemics of this magnitude. With the development of vaccines and antibody-based therapies using the envelope glycoprotein (GP) of the 1976 Mayinga strain, one important strategy is to anticipate how the evolution of EBOV might compromise these efforts. In this study we have initiated a watch list of potential antibody escape mutations of EBOV by modeling interactions between GP and the antibody KZ52. The watch list was generated using molecular modeling to estimate stability changes due to mutation. Every possible mutation of GP was considered and the list was generated from those that are predicted to disrupt GP-KZ52 binding but not to disrupt the ability of GP to fold and to form trimers. The resulting watch list contains 34 mutations (one of which has already been seen in humans) at six sites in the GP2 subunit. Should mutations from the watch list appear and spread during an epidemic, it warrants attention as these mutations may reflect an evolutionary response from the virus that could reduce the effectiveness of interventions such as vaccination. However, this watch list is incomplete and emphasizes the need for more experimental structures of EBOV interacting with antibodies in order to expand the watch list to other epitopes. We hope that this work provokes experimental research on evolutionary escape in both Ebola and other viral pathogens.

  17. Confessions of a 'guilty' couch potato understanding and using context to optimize binge-watching behavior

    NARCIS (Netherlands)

    de Feijter, D.; Khan, J.V.; van Gisbergen, M.

    2016-01-01

    Viewers more frequently watch television content whenever they want, using devices they prefer, which stimulated "Binge-watching" (consecutive viewing of television programs). Although binge-watching and health concerns have been studied before, the context in which binge-watching takes place and

  18. Contact urticaria caused by the Apple Watch – A case report

    OpenAIRE

    Spencer D. Hawkins; Steven R. Feldman

    2017-01-01

    Smart watches are an upcoming trend that provide quick access to smartphone notifications on the wearer’s wrist. Metal portions of the Apple Watch contain small amounts of nickel, however, the interchangeable bands can be made of a variety of different materials including methacrylate polymers and fluoroelastomer synthetic rubber. There are multiple reports in non-peer reviewed literature such as social media and blogs of the Apple Watch causing skin irritation. Here we present a case report ...

  19. Halley's Legacy: The Selfless Genius Who Founded Geophysics, Led the Science Community to Solve the Problem of Finding Longitude at Sea, and Whose Work in Areas from Geomagnetism to Planetology Still Has Meaning For Today's Scientists

    Science.gov (United States)

    Wakefield, J.

    2005-12-01

    2005 marks the 300th anniversary of Edmond Halley's publication of his infamous synopsis predicting the accurate return of the comet that would come to bear his name. On this occasion, it is time to remember him not only as the founder of geophysics but for his contributions to the world of science beyond his comet work. Halley's comet-transformed by the first triumph of the Newtonian revolution from a dire supernatural omen to a predictable element of the universe's clockwork-remains a recurring symbol of the scientific age of the Enlightenment. His comet is hurtling through space at some 20,000 miles per hour and won't be back until 2061. But it can remind us of past epochs and everlastingly of Halley's contributions to geophysics and the world of science writ large. For a start, Halley completed a series of little known sea voyages in his effort to solve one of his life-long quests: the problem of determining longitude at sea. On the basis of his earlier theories on magnetism, his approach entailed mapping the magnetic deviation across the test-bed of the Atlantic Ocean. In this paper, his findings from the voyages, which technically comprised the first science mission funded by a government and stand as the forerunner of all big science projects, will be reconsidered and put into the context of today's notions about terrestrial magnetism, including the geodynamo. To this day, scientists remain perplexed about exactly how core's dynamo regenerates its energy. When Halley was sailing his vessel, the Paramore, across the North Atlantic and making the first charts of geomagnetism, little did he ever imagine magnetism would underpin today's stunning advances in information technology and electromagnetic engineering. Magnetism also offers ways to study phase transitions, random disorder, and physics in low dimensions, which looks at particle interactions at ever higher energies in order to essentially study matter at smaller and smaller size scales. The presentation

  20. Television watching and risk of childhood obesity: a meta-analysis.

    Science.gov (United States)

    Zhang, Gang; Wu, Lei; Zhou, Lingling; Lu, Weifeng; Mao, Chunting

    2016-02-01

    Over the last few decades, there has been a worldwide epidemic of childhood obesity. An important step in successful prevention in paediatrics is the identification of modifiable risk factors of childhood obesity. Many studies have evaluated the associations between television (TV) watching and childhood obesity but yielded inconsistent results. To help elucidate the role of TV watching, PubMed and Embase databases were searched for published studies on associations between TV watching and childhood obesity. Random-effects models and dose-response meta-analyses were used to pool study results. Fourteen cross-sectional studies with 24 reports containing 106 169 subjects were included in the meta-analysis. Subgroup analyses were conducted by the available characteristics of studies and participants. The multivariable-adjusted overall OR of the childhood obesity for the highest vs. the lowest time of TV watching was 1.47 [95% confidence interval (95% CI): 1.33-1.62]. A linear dose-response relationship was also found for TV watching and childhood obesity (P childhood obesity. And restricting TV time and other sedentary behaviour of children may be an important public health strategy to prevent childhood obesity. © The Author 2015. Published by Oxford University Press on behalf of the European Public Health Association. All rights reserved.

  1. Coral Reef Watch, Hotspots, 50 km

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NOAA Coral Reef Watch provides Coral Bleaching hotspot maps derived from NOAA's Polar Operational Environmental Satellites (POES). This data provides global area...

  2. Aplikace pro nositelnou elektroniku se systémem Apple WatchOS

    OpenAIRE

    Singh, Kevin

    2017-01-01

    Bakalářská práce „Aplikace pro nositelnou elektroniku se systémem Apple WatchOS“ se zabývá teoretickým rozborem komunikací M2M (Machine-to-Machine), H2H (Human- to-Human), D2D (Device-to-Device) a nositelnou elektronikou. V teoretické části jsou dále popsány chytré hodinky Apple Watch, jenž obsahují požadovaný systém WatchOS. V rámci bakalářské práce vznikly dvě aplikace, přičemž první byla vytvořena pro mobilní zařízení iPhone a druhá pro chytré hodinky Apple watch. Aplikace zobrazují inform...

  3. Incidental Foreign-Language Acquisition by Children Watching Subtitled Television Programs

    Science.gov (United States)

    Ina, Lekkai

    2014-01-01

    Series of international studies have shown that subtitled television programs provide a rich context for foreign language acquisition. This study investigated whether incidental language acquisition occurs from watching a television program with/without subtitles. Children in the experimental conditions watch: (a) a 15 minute snapshot of a well…

  4. Ancient Chinese Observations and Modern Cometary Models

    Science.gov (United States)

    Yeomans, D. K.

    1995-12-01

    Ancient astronomical observations by Chinese, Japanese, and Korean observers represent the only data source for discerning the long-term behavior of comets. The primary source material is derived from Chinese astrologers who kept a vigilant celestial watch in an effort to issue up-to-date astrological forecasts for the reigning emperors. Surprisingly accurate records were kept on cometary apparitions with careful notes being made of an object's position, motion, size, color, and tail length. For comets Halley, Swift-Tuttle, and Tempel-Tuttle, Chinese observations have been used to model their motions over two millennia and to infer their photometric histories. One general result is that active comets must achieve an apparent magnitude of 3.5 or brighter before they become obvious naked-eye objects. For both comets Halley and Swift-Tuttle, their absolute magnitudes and hence their outgassing rates, have remained relatively constant for two millennia. Comet Halley's rocket-like outgassing has consistently delayed the comet's return to perihelion by 4 days so that the comet's spin axis must have remained stable for at least two millennia. Although its outgassing is at nearly the same rate as Halley's, comet Swift-Tuttle's motion has been unaffected by outgassing forces; this comet is likely to be ten times more massive than Halley and hence far more difficult for rocket-like forces to push it around. Although the earliest definite observations of comet Tempel-Tuttle were in 1366, the associated Leonid meteor showers have been identified as early as A.D. 902. The circumstance for each historical meteor shower and storm have been used to guide predictions for the upcoming 1998-1999 Leonid meteor displays.

  5. The global economic impact of manta ray watching tourism.

    Science.gov (United States)

    O'Malley, Mary P; Lee-Brooks, Katie; Medd, Hannah B

    2013-01-01

    As manta rays face increased threats from targeted and bycatch fisheries, manta ray watching tourism, if managed properly, may present an attractive economic alternative to consumptive use of these species. Both species in the genus Manta (Manta alfredi and Manta birostris) are classified by the International Union for the Conservation of Nature Red List as species Vulnerable to extinction in the wild, and are considered unsustainable as fisheries resources due to their conservative life history characteristics, which considerably reduce their ability to recover population numbers when depleted. Utilising dive operator surveys, Internet research, and a literature review, this study provides the first global estimate of the direct economic impact of manta ray watching tourism and examines the potential socio-economic benefits of non-consumptive manta ray watching operations relative to consumptive use of manta rays as a fishery resource. In the 23 countries in which manta ray watching operations meeting our criteria were identified, we estimated direct revenue to dive operators from manta ray dives and snorkels at over US$73 million annually and direct economic impact, including associated tourism expenditures, of US$140 million annually. Ten countries account for almost 93% of the global revenue estimate, specifically Japan, Indonesia, the Maldives, Mozambique, Thailand, Australia, Mexico, United States, Federated States of Micronesia and Palau. In many of the areas where directed fisheries for manta rays are known to occur, these activities overlap with manta ray tourism sites or the migratory range of the mantas on which these sites depend, and are likely to be unsustainable and detrimental to manta ray watching tourism.

  6. The analysis of the neutral gas measurements near comet P/Halley based on observations by VEGA-1

    International Nuclear Information System (INIS)

    Gringauz, K.I.; Verigin, M.I.; Remizov, A.P.; Oraevskij, A.A.; Szegoe, K.; Varga, A.

    1989-04-01

    The in-situ measurements of secondary electrons and sputtered ions caused by impacts of neutral particles on metallic surfaces of the Ram Faraday Cup and Plasma Impact Detector sensors in PLAZMAG-1 instrument aboard VEGA 1,2 spacecraft are used to estimate neutral particle density distribution (n n ) around comet P/Halley up to distances of approximately 3x10 σ km. Asymmetries in n n distributions along inbound and outbound legs of spacecraft trajectory are attributed to solar radiation pressure. A model calculation, taking into account solar radiation pressure, leads to 'tear drop' shaped distribution of neutral particles around the cometary nucleus. (author) 46 refs.; 11 figs

  7. Marketing Management: The Analysis of Breitling Watches in The Luxury Watch Market%Marketing Management:The Analysis of Breitling Watches in The Luxury Watch Market

    Institute of Scientific and Technical Information of China (English)

    王丽闻

    2017-01-01

    This essay will critically review the general situation and positioning of Breitling timepieces in the global market;It will begin with the background of Breitling to facilitate an understanding of the object. Initially, the target marketing of Breitling will be discussed by a number of assumptions in view of online researches. Subsequently, four aspects of the marketing mix will be analysed by comparing with its competitors to realise the latest conception and positioning of Breitling. Consequently, the elements that drive the purchase behaviour will be presented to reveal Breitling's competitive advantages in the luxury watch market.

  8. Duration of watching TV and child language development in young children

    Directory of Open Access Journals (Sweden)

    Silva Audya Perdana

    2017-04-01

    Full Text Available Background Many factors contribute to language development in children. About 5-8% of children in Indonesia experience delayed language skills. Young children need appropriate stimulation for optimal development. Children who watch television (TV for long periods of time may receive less two-way interaction, the appropriate stimulation for learning. As such, shorter duration of the appropriate stimulation may impede language development in small children. Objective To assess for an association between duration of watching TV and language development in young children. Methods This cross-sectional study was done with primary data collected from questionnaires. Subjects, aged 18 months to 3 years, were from a Jakarta-area community health center (Puskesmas Jatinegara and the Pediatric Growth and Development Clinic, Cipto Mangunkusumo Hospital, Jakarta. Their language development was tested using the Developmental Pre-screening Questionnaire (Kuesioner Pra Skrining Perkembangan, KPSP and the Early Language Milestone (ELM Scale 2 test. Results From a total of 84 subjects, 47 (56% had normal and 37 (44% had delayed language development. Duration of watching TV was categorized as 4 hours per day. Children who watched TV >4 hours/day (OR 4.4; 95%CI 1.68 to 11.7; P=0.002, and children who watched both Indonesian and English language TV programs (OR 14.7; 95%CI 1.77 to 123.0; P=0.004 had higher risk of language delay. Other variables such as sex, first age exposed to TV, use of gadgets, and TV in the bedroom had no significant associations with delayed language development. Conclusion Children who watch TV >4 hours/day had four times higher risk of developing language delay. In addition, those who watch TV programs in both Indonesian and English, also have a 14.7 higher risk of delayed language development.

  9. CoastWatch Regions in HDF Format

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The mapped data derived from AVHRR is divided into files for CoastWatch regions of interest. Each file contains multiple data variables stored using the HDF-4...

  10. The Global Economic Impact of Manta Ray Watching Tourism

    Science.gov (United States)

    O’Malley, Mary P.; Lee-Brooks, Katie; Medd, Hannah B.

    2013-01-01

    As manta rays face increased threats from targeted and bycatch fisheries, manta ray watching tourism, if managed properly, may present an attractive economic alternative to consumptive use of these species. Both species in the genus Manta (Manta alfredi and Manta birostris) are classified by the International Union for the Conservation of Nature Red List as species Vulnerable to extinction in the wild, and are considered unsustainable as fisheries resources due to their conservative life history characteristics, which considerably reduce their ability to recover population numbers when depleted. Utilising dive operator surveys, Internet research, and a literature review, this study provides the first global estimate of the direct economic impact of manta ray watching tourism and examines the potential socio-economic benefits of non-consumptive manta ray watching operations relative to consumptive use of manta rays as a fishery resource. In the 23 countries in which manta ray watching operations meeting our criteria were identified, we estimated direct revenue to dive operators from manta ray dives and snorkels at over US$73 million annually and direct economic impact, including associated tourism expenditures, of US$140 million annually. Ten countries account for almost 93% of the global revenue estimate, specifically Japan, Indonesia, the Maldives, Mozambique, Thailand, Australia, Mexico, United States, Federated States of Micronesia and Palau. In many of the areas where directed fisheries for manta rays are known to occur, these activities overlap with manta ray tourism sites or the migratory range of the mantas on which these sites depend, and are likely to be unsustainable and detrimental to manta ray watching tourism. PMID:23741450

  11. The global economic impact of manta ray watching tourism.

    Directory of Open Access Journals (Sweden)

    Mary P O'Malley

    Full Text Available As manta rays face increased threats from targeted and bycatch fisheries, manta ray watching tourism, if managed properly, may present an attractive economic alternative to consumptive use of these species. Both species in the genus Manta (Manta alfredi and Manta birostris are classified by the International Union for the Conservation of Nature Red List as species Vulnerable to extinction in the wild, and are considered unsustainable as fisheries resources due to their conservative life history characteristics, which considerably reduce their ability to recover population numbers when depleted. Utilising dive operator surveys, Internet research, and a literature review, this study provides the first global estimate of the direct economic impact of manta ray watching tourism and examines the potential socio-economic benefits of non-consumptive manta ray watching operations relative to consumptive use of manta rays as a fishery resource. In the 23 countries in which manta ray watching operations meeting our criteria were identified, we estimated direct revenue to dive operators from manta ray dives and snorkels at over US$73 million annually and direct economic impact, including associated tourism expenditures, of US$140 million annually. Ten countries account for almost 93% of the global revenue estimate, specifically Japan, Indonesia, the Maldives, Mozambique, Thailand, Australia, Mexico, United States, Federated States of Micronesia and Palau. In many of the areas where directed fisheries for manta rays are known to occur, these activities overlap with manta ray tourism sites or the migratory range of the mantas on which these sites depend, and are likely to be unsustainable and detrimental to manta ray watching tourism.

  12. TideWatch: Fingerprinting the cyclicality of big data workloads

    KAUST Repository

    Williams, Daniel W.

    2014-04-01

    Intrinsic to \\'big data\\' processing workloads (e.g., iterative MapReduce, Pregel, etc.) are cyclical resource utilization patterns that are highly synchronized across different resource types as well as the workers in a cluster. In Infrastructure as a Service settings, cloud providers do not exploit this characteristic to better manage VMs because they view VMs as \\'black boxes.\\' We present TideWatch, a system that automatically identifies cyclicality and similarity in running VMs. TideWatch predicts period lengths of most VMs in Hadoop workloads within 9% of actual iteration boundaries and successfully classifies up to 95% of running VMs as participating in the appropriate Hadoop cluster. Furthermore, we show how TideWatch can be used to improve the timing of VM migrations, reducing both migration time and network impact by over 50% when compared to a random approach. © 2014 IEEE.

  13. 47 CFR 80.305 - Watch requirements of the Communications Act and the Safety Convention.

    Science.gov (United States)

    2010-10-01

    ... and the Safety Convention. 80.305 Section 80.305 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES STATIONS IN THE MARITIME SERVICES Safety Watch Requirements and Procedures Ship Station Safety Watches § 80.305 Watch requirements of the Communications Act and the Safety...

  14. Microbiology as if Bird Watching

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 10. Microbiology as if Bird Watching. Milind G Watve. Classroom Volume 1 Issue 10 October 1996 pp 78-81. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/001/10/0078-0081. Author Affiliations.

  15. VizieR Online Data Catalog: WATCH Solar X-Ray Burst Catalogue (Crosby+ 1998)

    Science.gov (United States)

    Crosby, N.; Lund, N.; Vilmer, N.; Sunyaev, R.

    1998-01-01

    Catalogue containing solar X-ray bursts measured by the Danish Wide Angle Telescope for Cosmic Hard X-Rays (WATCH) experiment aboard the Russian satellite GRANAT in the deca-keV energy range. Table 1 lists the periods during which solar observations with WATCH are available (WATCH ON-TIME) and where the bursts listed in the catalogue have been observed. (2 data files).

  16. Strategic and operational information watch newsletter nr 2

    International Nuclear Information System (INIS)

    2017-02-01

    This newsletter proposes an overview of events related to security and defence issues in relationship with impacts of climate change. A first part reports a strategic watch which addresses news about the responsibility of climate changes in the emergence or aggravation of some present crisis, about what is going on in the USA in relationship with climate and defence issues (decisions by Trump, statement of the Secretary of Defence, influence of the political context), about the energy sector (instability of the oil market, the international role of India in the international climate and energy policy), and about international negotiations on climate. The second part reports an operational information watch addresses new technologies and renewable energies, and issues related to the vulnerability, protection and adaptation of infrastructures and equipment, and a health watch (soldier training in hot and wet environment, drought as a factor of Nile fever epidemic, climate changes and always higher risks for human health in Europe). The newsletter finally indicates some brief news, events and recent publications

  17. Strategic and operational information watch newsletter nr 3

    International Nuclear Information System (INIS)

    2017-04-01

    This newsletter proposes an overview of events related to security and defence issues in relationship with impacts of climate change. A first part reports a strategic watch which addresses news about the Paris agreement (negotiation in Bonn, statement of the Canadian minister of Defence, commitment by the Lebanese army to reduce its emissions), about the energy sector (the lowest level of oil discovery, partial privatisation of Saudi Aramco, and economic and energetic diversification of Saudi Arabia), and climate change as a source of tensions and collaborations. The second part reports an operational information watch which addresses new technologies and renewable energies (photovoltaic cells operating in the dark, waste energetic valorisation in field operations, the issue of energy security for US military allowances, use of drones for logistics, a Gripen fighter aircraft flies with bio-fuel) and proposes a health watch (consequences of UV exposure in field operations, impact of El Nino on cholera distribution in Africa, the ban of ragweed in France). The newsletter finally indicates some brief news, events and recent publications

  18. Warfarin Side Effects: Watch for Interactions

    Science.gov (United States)

    Warfarin side effects: Watch for interactions Although commonly used to treat blood clots, warfarin (Coumadin, Jantoven) can have dangerous side effects or ... bleeding. Here are precautions to take to avoid warfarin side effects. By Mayo Clinic Staff If you' ...

  19. 47 CFR 80.303 - Watch on 156.800 MHz (Channel 16).

    Science.gov (United States)

    2010-10-01

    ... Section 80.303 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES STATIONS IN THE MARITIME SERVICES Safety Watch Requirements and Procedures Coast Station Safety... maintain a safety watch on the frequency 156.800 MHz except when transmitting on 156.800 MHz. (b) A coast...

  20. Connected to TV series: Quantifying series watching engagement.

    Science.gov (United States)

    Tóth-Király, István; Bőthe, Beáta; Tóth-Fáber, Eszter; Hága, Győző; Orosz, Gábor

    2017-12-01

    Background and aims Television series watching stepped into a new golden age with the appearance of online series. Being highly involved in series could potentially lead to negative outcomes, but the distinction between highly engaged and problematic viewers should be distinguished. As no appropriate measure is available for identifying such differences, a short and valid measure was constructed in a multistudy investigation: the Series Watching Engagement Scale (SWES). Methods In Study 1 (N Sample1  = 740 and N Sample2  = 740), exploratory structural equation modeling and confirmatory factor analysis were used to identify the most important facets of series watching engagement. In Study 2 (N = 944), measurement invariance of the SWES was investigated between males and females. In Study 3 (N = 1,520), latent profile analysis (LPA) was conducted to identify subgroups of viewers. Results Five factors of engagement were identified in Study 1 that are of major relevance: persistence, identification, social interaction, overuse, and self-development. Study 2 supported the high levels of equivalence between males and females. In Study 3, three groups of viewers (low-, medium-, and high-engagement viewers) were identified. The highly engaged at-risk group can be differentiated from the other two along key variables of watching time and personality. Discussion The present findings support the overall validity, reliability, and usefulness of the SWES and the results of the LPA showed that it might be useful to identify at-risk viewers before the development of problematic use.

  1. Healthcare Applications of Smart Watches. A Systematic Review.

    Science.gov (United States)

    Lu, Tsung-Chien; Fu, Chia-Ming; Ma, Matthew Huei-Ming; Fang, Cheng-Chung; Turner, Anne M

    2016-09-14

    The aim of this systematic review is to synthesize research studies involving the use of smart watch devices for healthcare. The Preferred Reporting Items for Systematic Reviews and Meta-Analyses (PRISMA) was chosen as the systematic review methodology. We searched PubMed, CINAHL Plus, EMBASE, ACM, and IEEE Xplore. In order to include ongoing clinical trials, we also searched ClinicalTrials.gov. Two investigators evaluated the retrieved articles for inclusion. Discrepancies between investigators regarding article inclusion and extracted data were resolved through team discussion. 356 articles were screened and 24 were selected for review. The most common publication venue was in conference proceedings (13, 54%). The majority of studies were published or presented in 2015 (19, 79%). We identified two registered clinical trials underway. A large proportion of the identified studies focused on applications involving health monitoring for the elderly (6, 25%). Five studies focused on patients with Parkinson's disease and one on cardiac arrest. There were no studies which reported use of usability testing before implementation. Most of the reviewed studies focused on the chronically ill elderly. There was a lack of detailed description of user-centered design or usability testing before implementation. Based on our review, the most commonly used platform in healthcare research was that of the Android Wear. The clinical application of smart watches as assistive devices deserves further attention. Smart watches are unobtrusive and easy to wear. While smart watch technology supplied with biosensors has potential to be useful in a variety of healthcare applications, rigorous research with their use in clinical settings is needed.

  2. Losing Sleep to Watch the Night-Sky: The Relationship between Sleep-Length and Noctcaelador

    Science.gov (United States)

    Kelly, William E.; Rose, Callie

    2005-01-01

    For most of history, humans have been watching the night-sky (Hawkins, 1983). Historically, individuals have watched the night-sky for aesthetic appreciation and to gain insights and knowledge (Brecher & Feirtag, 1979). Despite the long history of night-sky watching among humans and the apparent importance of the behavior to large groups of…

  3. Fast Flux Watch: A mechanism for online detection of fast flux networks

    Directory of Open Access Journals (Sweden)

    Basheer N. Al-Duwairi

    2014-07-01

    Full Text Available Fast flux networks represent a special type of botnets that are used to provide highly available web services to a backend server, which usually hosts malicious content. Detection of fast flux networks continues to be a challenging issue because of the similar behavior between these networks and other legitimate infrastructures, such as CDNs and server farms. This paper proposes Fast Flux Watch (FF-Watch, a mechanism for online detection of fast flux agents. FF-Watch is envisioned to exist as a software agent at leaf routers that connect stub networks to the Internet. The core mechanism of FF-Watch is based on the inherent feature of fast flux networks: flux agents within stub networks take the role of relaying client requests to point-of-sale websites of spam campaigns. The main idea of FF-Watch is to correlate incoming TCP connection requests to flux agents within a stub network with outgoing TCP connection requests from the same agents to the point-of-sale website. Theoretical and traffic trace driven analysis shows that the proposed mechanism can be utilized to efficiently detect fast flux agents within a stub network.

  4. Blog and Podcast Watch: Neurologic Emergencies

    Directory of Open Access Journals (Sweden)

    Andrew Grock

    2016-11-01

    Full Text Available Introduction: The WestJEM Blog and Podcast Watch presents high quality open-access educational blogs and podcasts in emergency medicine (EM based on the ongoing ALiEM Approved Instructional Resources (AIR and AIR-Professional series. Both series critically appraise resources using an objective scoring rubric. This installment of the Blog and Podcast Watch highlights the topic of neurologic emergencies from the AIR series. Methods: The AIR series is a continuously building curriculum that follows the Council of Emergency Medicine Residency Director’s (CORD annual testing schedule. For each module, relevant content is collected from the top 50 Social Media Index sites published within the previous 12 months, and scored by eight board members using five equally weighted measurement outcomes: Best Evidence in Emergency Medicine (BEEM score, accuracy, educational utility, evidence based, and references. Resources scoring ≥30 out of 35 available points receive an AIR label. Resources scoring 27-29 receive an honorable mention label, if the executive board agrees that the post is accurate and educationally valuable. Results: A total of 125 blog posts and podcasts were evaluated. Key educational pearls from the 14 AIR posts are summarized, and the 20 honorable mentions are listed. Conclusion: The WestJEM Blog and Podcast Watch series is based on the AIR and AIR-Pro series, which attempts to identify high quality educational content on open-access blogs and podcasts. This series provides an expert-based, post-publication curation of educational social media content for EM clinicians with this installment focusing on neurologic emergencies.

  5. Effects of Presidential Debate Watching and Ideology on Attitudes and Knowledge.

    Science.gov (United States)

    Benoit, William L.; Webber, David J.; Berman, Julie

    1998-01-01

    Compares respondents who watched the first 1996 presidential debate with respondents who did not. Finds (1) those who watched the debate could more accurately recognize issue positions of Clinton and Dole than nonwatchers; (2) differences in the groups' assessment of character traits of the leading candidates; and (3) more respondents gave policy…

  6. National Status and Trends: Mussel Watch Project

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Mussel Watch represents the longest running continuous contaminant monitoring program in U.S. coastal and Great Lakes waters and was created in response to concerns...

  7. Iran - waiting and watching

    International Nuclear Information System (INIS)

    Malhotra, T. C.

    2007-01-01

    Global oil companies are reported to be divided on the issue of possible energy deals in Iran. Some companies may adopt wait and watch policy before singing a fresh deal with Iran, but there are some oil companies, those are still interested to sign a deal with Iran, despite the risks, even as Tehran decided to expand its uranium enrichment programme rather than complying with a UN Security Council ultimatum to freeze it, which clears the path for further harsher sanctions (author) (ml)

  8. Watch-wearing as a marker of conscientiousness

    Directory of Open Access Journals (Sweden)

    David A. Ellis

    2015-08-01

    Full Text Available Several aspects of an individual’s appearance have been shown to predict personality and related behaviour. While some of these cues are grounded in biology (e.g., the human face, other aspects of a person’s appearance can be actively controlled (e.g., clothing. In this paper, we consider a common fashion accessory, the wristwatch. In an exploratory sample (N > 100 and a confirmatory sample (N > 600, we compared big-five personality traits between individuals who do or do not regularly wear a standard wristwatch. Significantly higher levels of conscientiousness were observed in participants who wore a watch. In a third study (N = 85, watch wearers arrived significantly earlier to appointments in comparison to controls. These results are discussed in relation to enclothed cognition and the rise of wearable technology including smartwatches.

  9. Watch-wearing as a marker of conscientiousness.

    Science.gov (United States)

    Ellis, David A; Jenkins, Rob

    2015-01-01

    Several aspects of an individual's appearance have been shown to predict personality and related behaviour. While some of these cues are grounded in biology (e.g., the human face), other aspects of a person's appearance can be actively controlled (e.g., clothing). In this paper, we consider a common fashion accessory, the wristwatch. In an exploratory sample (N > 100) and a confirmatory sample (N > 600), we compared big-five personality traits between individuals who do or do not regularly wear a standard wristwatch. Significantly higher levels of conscientiousness were observed in participants who wore a watch. In a third study (N = 85), watch wearers arrived significantly earlier to appointments in comparison to controls. These results are discussed in relation to enclothed cognition and the rise of wearable technology including smartwatches.

  10. Counter-Democratic Surveillance: The Watchful Eye of a Local Institution

    DEFF Research Database (Denmark)

    Hjelholt, Morten

    2014-01-01

    mechanisms similar to those described by Foucault, but in the service of society. From this perspective democracy is seen as a composite of two realms – a sphere of electoral representation and a constellation of counter-democratic organizations – in constant tension with each other (Rosanvallon 2008......). The watchful eyes of counter-democratic organizations are particularly made powerful by the rise of the Internet with its spontaneous adaption of watchful functions. However increased awareness and mistrust have led not to broader participation in traditional liberal institutions but to a greater social...... in the interest of the national overseers but correspondingly given as responds to fulfill legal requirements or more loosely defined public concerns. Consequently the watchful eye of a local institution form a counter-democratic sight aimed at the strategic intentions of the Government. The paper introduces...

  11. Health at hand: A systematic review of smart watch uses for health and wellness.

    Science.gov (United States)

    Reeder, Blaine; David, Alexandria

    2016-10-01

    Smart watches have the potential to support health in everyday living by: enabling self-monitoring of personal activity; obtaining feedback based on activity measures; allowing for in-situ surveys to identify patterns of behavior; and supporting bi-directional communication with health care providers and family members. However, smart watches are an emerging technology and research with these devices is at a nascent stage. We conducted a systematic review of smart watch studies that engaged people in their use by searching PubMed, Embase, IEEE XPlore and ACM Digital libraries. Participant demographics, device features, watch applications and methods, and technical challenges were abstracted from included studies. Seventy-three studies were returned in the search. Seventeen studies published were included. Included studies were published from 2014 to 2016, with the exception of one published in 2011. Most studies employed the use of consumer-grade smart watches (14/17, 82%). Patient-related studies focused on activity monitoring, heart rate monitoring, speech therapy adherence, diabetes self-management, and detection of seizures, tremors, scratching, eating, and medication-taking behaviors. Most patient-related studies enrolled participants with few exclusion criteria to validate smart watch function (10/17, 58%). Only studies that focused on Parkinson's disease, epilepsy, and diabetes management enrolled persons living with targeted conditions. One study focused on nursing work in the ICU and one focused on CPR training for laypeople. Consumer-grade smart watches have penetrated the health research space rapidly since 2014. Smart watch technical function, acceptability, and effectiveness in supporting health must be validated in larger field studies that enroll actual participants living with the conditions these devices target. Copyright © 2016 Elsevier Inc. All rights reserved.

  12. Cardiometabolic risk factors and TV watching in a rural community in West Bengal, India.

    Science.gov (United States)

    Nag, Tanmay; Ghosh, Arnab

    2015-01-01

    No study has been undertaken among rural adult population of India to investigate the association of cardiometabolic risk factors with TV watching. This cross-sectional study was carried out in 1007 participants (645 males and 362 females) aged 20-80 years from a rural community. Anthropometric measures were collected using standard techniques. HOMA-IR was calculated accordingly. The significant higher value for MWC, WHtR, TER, SF4, BMI, %BF, FM, VFL, IVF, TC, LDL and FBG was observed with increasing duration of TV watching. No significant change was observed for TG, HDL, VLDL, DBP and MAP. Chi-square revealed significant difference for central obesity between male and females across TV watching category. The higher metabolic syndrome phenotypes were prevalent among both sexes with increasing duration of TV watching. Furthermore, multiple regression analyses (stepwise) revealed that occupation, monthly income, duration of TV watching in a day, education and monthly expenditure cumulatively explained ∼19% (R(2)=0.191) of the total variance of % body fat in the study. It seems rational to argue that lengthy TV watching time might have detrimental effect on CVD health. Copyright © 2015 Diabetes India. Published by Elsevier Ltd. All rights reserved.

  13. National Status and Trends: Mussel Watch Program

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Mussel Watch is the longest running continuous chemical contaminant monitoring program in U.S. coastal and Great Lakes waters and was created in response to concerns...

  14. Blog and Podcast Watch: Cutaneous Emergencies

    Directory of Open Access Journals (Sweden)

    Andrew Grock

    2017-02-01

    Full Text Available The WestJEM Blog and Podcast Watch presents high quality open-access educational blogs and podcasts in emergency medicine (EM based on the ongoing Academic Life in Emergency Medicine (ALiEM Approved Instructional Resources (AIR and AIR-Professional series. Both series critically appraise resources using an objective scoring rubric. This installment of the Blog and Podcast Watch highlights the topic of cutaneous emergencies from the AIR series.    The AIR series is a continuously building curriculum that follows the Council of Emergency Medicine Residency Directors (CORD annual testing schedule. For each module, relevant content is collected from the top 50 most accessed sites per the Social Media Index published within the previous 12 months and scored by eight board members using five equally weighted measurement outcomes: Best Evidence in Emergency Medicine (BEEM score, accuracy, educational utility, evidence based, and references. Resources scoring ≥30 out of 35 available points receive an AIR label. Resources scoring 27-29 receive an “honorable mention” label, if the editorial board agrees that the post is accurate and educationally valuable. A total of 35 blog posts and podcasts were evaluated. None scored ≥30 points necessary for the AIR label, although four honorable mention posts were identified. Key educational pearls from these honorable mention posts are summarized. This Blog and Podcast Watch series is based on the AIR and AIR-Pro series, which attempts to identify high quality educational content on open-access blogs and podcasts. This series provides an expertbased, post-publication curation of educational social media content for EM clinicians with this installment focusing on cutaneous emergencies. [West J Emerg Med. 2017;18(2288-292.

  15. 2007 Hypoxia Watch Bottom CTD Station Locations

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  16. 2004 Hypoxia Watch Bottom CTD Station Locations

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  17. 2005 Hypoxia Watch Bottom CTD Station Locations

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  18. 2002 Hypoxia Watch Bottom CTD Station Locations

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  19. 2003 Hypoxia Watch Bottom CTD Station Locations

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  20. 2001 Hypoxia Watch Bottom CTD Station Locations

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  1. The origin of Halley-type comets: probing the inner Oort cloud

    Science.gov (United States)

    Levison, H.; Dones, L.; Duncan, M.

    2000-10-01

    We have integrated the orbits of 27,700 test particles initially entering the planetary system from the Oort cloud in order to study the origin of Halley-type comets (HTCs). We included the gravitational influence of the Sun, giant planets, passing stars, and galactic tides. We find that an isotropically distributed Oort cloud does not reproduce the observed orbital element distribution of the HTCs. In order to match the observations, the initial inclination distribution of the progenitors of the HTCs must be similar to the observed HTC inclination distribution. We can match the observations with an Oort cloud that consists of an isotropic outer cloud and a disk-like massive inner cloud. These idealized two-component models have inner disks with median inclinations that range from 10 to 50o. This analysis represents the first link between observations and the structure of the inner Oort cloud. HFL and LD gratefully acknowledges grants provided by the NASA Origins of Solar Systems and Planetary Geology and Geophysics Programs. MJD is grateful for the continuing financial support of the Natural Science and Engineering Research Council of Canada and for financial support for work done inthe U.S.from NASA Planetary Geology and Geophysics Programs.

  2. Implementacija aplikacije Smart Watch Workout za naprave iOS s pametno uro Apple Watch

    OpenAIRE

    Skledar, Dejan

    2016-01-01

    V diplomskem delu opišemo in predstavimo naprave ter operacijske sisteme, na katerih teče naša aplikacija. Le-ta je namenjena mobilnim navdušencem, ki jim pomaga do vsakodnevne aktivnosti. Prav tako opišemo potek, razvoj in cilje končnega izdelka na napravi iPhone kot tudi na napravi Apple Watch. Podatki, ki so pomembni za pravilno delovanje aplikacij, se shranjujejo v lokalno podatkovno bazo.

  3. Relationship between wave energy and free energy from pickup ions in the Comet Halley environment

    Science.gov (United States)

    Huddleston, D. E.; Johnstone, A. D.

    1992-01-01

    The free energy available from the implanted heavy ion population at Comet Halley is calculated by assuming that the initial unstable velocity space ring distribution of the ions evolves toward a bispherical shell. Ultimately this free energy adds to the turbulence in the solar wind. Upstream and downstream free energies are obtained separately for the conditions observed along the Giotto spacecraft trajectory. The results indicate that the waves are mostly upstream propagating in the solar wind frame. The total free energy density always exceeds the measured wave energy density because, as expected in the nonlinear process of ion scattering, the available energy is not all immediately released. An estimate of the amount which has been released can be obtained from the measured oxygen ion distributions and again it exceeds that observed. The theoretical analysis is extended to calculate the k spectrum of the cometary-ion-generated turbulence.

  4. Impacts of Watching Television and Computer Using on Student' Reading Habits

    Directory of Open Access Journals (Sweden)

    Ayşe Gül Aksaçlıoğlu

    2013-11-01

    Full Text Available Reading habits contribute both to the cognitive and social developments of indi- viduals in so many aspects. This function of the reading habit continues in the rapid social changing process of today’s world. However, children’s habits of te- levision watching and computer using have been recently seen to affect their reading habits. Therefore, defining the positive or negative impacts of television and computers on children and finding solutions carries significant importance. The aim of this study is to determine the influences of the television watching and computer using on children’s reading habits. In order to find out the influ- ences, a survey was performed on all 5th grade students at Bilkent Private Primary School and Çankaya Public Primary School located within Ankara Büyükþehir Municipality borders. The questionaire was applied to 222 students in these two schools. As a result of the study, it is clear that students prefer to play on com- puters and watch television in their leisure time to reading books. There is an inverse proportion apparent between the time spent using computers and watching television and the time spent on reading.

  5. Mental Health and Teens: Watch for Danger Signs

    Science.gov (United States)

    ... Gradeschool Teen Dating & Sex Fitness Nutrition Driving Safety School Substance Use Young Adult Healthy Children > Ages & Stages > Teen > Mental Health and Teens: Watch for Danger Signs Ages & Stages ...

  6. The Ulysses supplement to the Granat/WATCH catalog of cosmic gamma-ray bursts

    DEFF Research Database (Denmark)

    Hurley, K.; Lund, Niels; Brandt, Søren Kristian

    2000-01-01

    We present third Interplanetary Network (IPN) localization data for 56 gamma-ray bursts in the Granat/WATCH catalog that occurred between 1990 November and 1994 September. These localizations are obtained by triangulation using various combinations of spacecraft and instruments in the IPN, which ...... consisted of Ulysses, BATSE, Pioneer Venus Orbiter, Mars Observer, WATCH, and PHEBUS. The intersections of the triangulation annuli with the WATCH error circles produce error boxes with areas as small as 16 arcmin(2), reducing the sizes of the error circles by factors of up to 800....

  7. Whale Watching in the Gulf of Maine.

    Science.gov (United States)

    Carkin, Clayton A.

    1985-01-01

    Describes a variety of teaching strategies to prepare a class for a whale watching field trip. Guidelines for recording a sighting, pictures and statistics for commonly and/or occasionally seen whales, and hints for avoiding sea sickness are included. (DH)

  8. Preliminary results of the Vega-1 and Vega-2 space probes rendezvous with the Halley comet

    International Nuclear Information System (INIS)

    Anon.

    1986-01-01

    Preliminary results of the Halley comet investigation using the Vega-1 and Vega-2 space probes which passed on the 6th and 9th of March, 1986 the comet nucleus at a distance of 9000 and 8200 respectively, are presented. The comet nucleus appeared to be one of the darkest bodies of the Solar system: its albedo is just about 4%. The IR spectrum analysis has shown, that water and carbon dioxide appear to be the main components of the comet material. Mass analysis points out to the presence in the comet dust of iron, oxygen and silicon. It is ascertained, that about 30 t of water vapors and about 5-10 t of dust are evaporated from the comet nucleus surface in one second. Solar wind interaction with the comet streched atmosphere was investigated

  9. Why Is 10 Past 10 the Default Setting for Clocks and Watches in Advertisements? A Psychological Experiment

    Directory of Open Access Journals (Sweden)

    Ahmed A. Karim

    2017-08-01

    Full Text Available Have you ever noticed that in watch advertisements the time is usually set at 10:10? The reasons and psychological effects of this default time setting are elusive. In Experiment 1, we hypothesized that watches showing a time setting resembling a smiling face (10:10 would enhance emotional valence and intention to buy compared to a neutral time setting (11:30, whereas a time setting resembling a sad face (8:20 would have the opposite effect. Moreover, we investigated a possible interaction effect with the gender of the participants. In Experiment 2, we directly tested the hypotheses that watches set at 10:10 resemble a smiling face, whereas watches set at 8:20 resemble a sad face. The data of the first experiment reveal that watches set at 10:10 showed a significant positive effect on the emotion of the observer and the intention to buy. However, watches set at 8:20 did not show any effect on the emotion or the intention to buy. Moreover, watches set at 10:10 induced in women significantly stronger ratings of pleasure than in men. The data of the second experiment show that participants consistently perceive high resemblance between watches set at 10:10 and a smiling face as well as high resemblance between watches set at 8:20 and a sad face. This study provides for the first time empirical evidence for the notion that using watches with a time setting resembling a smiling face (like 10:10 can positively affect the emotional response of the observers and their evaluation of a seen watch, even though they are not aware of the fact that the shown time setting is inducing this effect. Practical implications of the observed findings and alternative explanations are discussed.

  10. Why Is 10 Past 10 the Default Setting for Clocks and Watches in Advertisements? A Psychological Experiment.

    Science.gov (United States)

    Karim, Ahmed A; Lützenkirchen, Britta; Khedr, Eman; Khalil, Radwa

    2017-01-01

    Have you ever noticed that in watch advertisements the time is usually set at 10:10? The reasons and psychological effects of this default time setting are elusive. In Experiment 1, we hypothesized that watches showing a time setting resembling a smiling face (10:10) would enhance emotional valence and intention to buy compared to a neutral time setting (11:30), whereas a time setting resembling a sad face (8:20) would have the opposite effect. Moreover, we investigated a possible interaction effect with the gender of the participants. In Experiment 2, we directly tested the hypotheses that watches set at 10:10 resemble a smiling face, whereas watches set at 8:20 resemble a sad face. The data of the first experiment reveal that watches set at 10:10 showed a significant positive effect on the emotion of the observer and the intention to buy. However, watches set at 8:20 did not show any effect on the emotion or the intention to buy. Moreover, watches set at 10:10 induced in women significantly stronger ratings of pleasure than in men. The data of the second experiment show that participants consistently perceive high resemblance between watches set at 10:10 and a smiling face as well as high resemblance between watches set at 8:20 and a sad face. This study provides for the first time empirical evidence for the notion that using watches with a time setting resembling a smiling face (like 10:10) can positively affect the emotional response of the observers and their evaluation of a seen watch, even though they are not aware of the fact that the shown time setting is inducing this effect. Practical implications of the observed findings and alternative explanations are discussed.

  11. Fire Extinguisher Training for Fire Watch and Designated Workers, Course 9893

    Energy Technology Data Exchange (ETDEWEB)

    Harris, Jimmy D. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-04-19

    At Los Alamos National Laboratory (LANL), all workers must be aware of LANL fire protection policies and be trained on what to do in the event of a fire. This course, Fire Extinguisher Training for Fire Watch and Designated Workers (#9893), provides awareness-level and hands-on training for fire watch personnel and designated workers. Fire watch personnel and designated workers are appointed by line management and must receive both awareness-level training and hands-on training in the use of portable fire extinguishers to extinguish an incipient-stage fire. This training meets the requirements of the Occupational Safety and Health Administration (OSHA) Code of Federal Regulations (CFR) 29 CFR 1910.157, Portable Fire Extinguishers, and Procedure (P) 101-26, Welding, Cutting, and Other Spark-/Flame-Producing Operations.

  12. Fire Extinguisher Designated Worker and Fire Watch: Self-Study Course 15672

    Energy Technology Data Exchange (ETDEWEB)

    Harris, Jimmy D. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-07-08

    At Los Alamos National Laboratory (LANL), all workers must be aware of LANL fire protection policies and be trained on what to do in the event of a fire. This course, Fire Extinguisher Training for Fire Watch and Designated Workers (#9893), provides awareness-level and hands-on training for fire watch personnel and designated workers. Fire watch personnel and designated workers are appointed by line management and must receive both awareness-level training and hands-on training in the use of portable fire extinguishers to extinguish an incipient-stage fire. This training meets the requirements of the Occupational Safety and Health Administration (OSHA) Code of Federal Regulations (CFR) 29 CFR 1910.157, Portable Fire Extinguishers, and Procedure (P) 101-26, Welding, Cutting, and Other Spark-/Flame-Producing Operations.

  13. Analysis of IPTV Channels Watching Preferences in Bosnia and Herzegovina

    Directory of Open Access Journals (Sweden)

    F. Orucevic

    2011-10-01

    Full Text Available IPTV service is a new service which is today offered from almost every Telecom operator. One of the advantages of IPTV service stemming from its architecture is certainly the fact that it is very easy to measure what TV channels are the ones mostly watched. This papers desribes this measurement and analysis results in one Telecom operator in Bosnia and Herzegovina. They describe what TV channels are mostly watched in different time periods. We developed a simple weighting algorithm to order the channels by watching rate. Based on it we are providing extensive tables. This paper forms an industrial contribution with results important for marketing but also is scientific contribution because it introduces one new method of scoring TV channels based on previous measurements in their audience. We also developed IPTV Statistics model and described results from this research for a new statistics model. This paper is the continuous of previously published contributions from this area.

  14. Modelling the physical multiphase interactions of HNO3 between snow and air on the Antarctic Plateau (Dome C) and coast (Halley)

    Science.gov (United States)

    Chan, Hoi Ga; Frey, Markus M.; King, Martin D.

    2018-02-01

    Emissions of nitrogen oxide (NOx = NO + NO2) from the photolysis of nitrate (NO3-) in snow affect the oxidising capacity of the lower troposphere especially in remote regions of high latitudes with little pollution. Current air-snow exchange models are limited by poor understanding of processes and often require unphysical tuning parameters. Here, two multiphase models were developed from physically based parameterisations to describe the interaction of nitrate between the surface layer of the snowpack and the overlying atmosphere. The first model is similar to previous approaches and assumes that below a threshold temperature, To, the air-snow grain interface is pure ice and above To a disordered interface (DI) emerges covering the entire grain surface. The second model assumes that air-ice interactions dominate over all temperatures below melting of ice and that any liquid present above the eutectic temperature is concentrated in micropockets. The models are used to predict the nitrate in surface snow constrained by year-round observations of mixing ratios of nitric acid in air at a cold site on the Antarctic Plateau (Dome C; 75°06' S, 123°33' E; 3233 m a.s.l.) and at a relatively warm site on the Antarctic coast (Halley; 75°35' S, 26°39' E; 35 m a.s.l). The first model agrees reasonably well with observations at Dome C (Cv(RMSE) = 1.34) but performs poorly at Halley (Cv(RMSE) = 89.28) while the second model reproduces with good agreement observations at both sites (Cv(RMSE) = 0.84 at both sites). It is therefore suggested that in winter air-snow interactions of nitrate are determined by non-equilibrium surface adsorption and co-condensation on ice coupled with solid-state diffusion inside the grain, similar to Bock et al. (2016). In summer, however, the air-snow exchange of nitrate is mainly driven by solvation into liquid micropockets following Henry's law with contributions to total surface snow NO3- concentrations of 75 and 80 % at Dome C and Halley

  15. Dolphin Watching in the Southern Tañon Strait Protected Seascape, Philippines: Issues and Challenges

    Directory of Open Access Journals (Sweden)

    Lemnuel V. Aragones

    2013-12-01

    Full Text Available Dolphin watching is a growing economic activity in the southern Tañon Strait Protected Seascape (TSPS, the Philippines, an area that is also heavily exploited by fisheries. In order to examine the issues and challenges in this growing industry, we monitored relevant information regarding cetacean watching, conducted focus group discussions (FGDs and educational seminar-workshops for various local stakeholders from 2004 to 2006, and followed these up from 2008-2012. From 9 May to 16 August 2004, we conducted structured interviews to determine the perceptions of cetacean-watching tourists (CWTs and assess the level of local knowledge of f ishers and non-fishers (NFs regarding marine mammals and environmental management in this area. Ninety f ive (95 CWTs, 100 local fishers, and 64 NFs were interviewed. Sixty seven percent (n=64 of the CWTs believed that the overall quality of tours was impressive primarily because they were able to watch, at reasonable costs, large groups of dolphins in close proximity and in an almost pristine environment. The majority of CWTs (~91% felt that there is a need to develop a ‘Special Management Plan’ (SMP for the southern TSPS focusing on cetaceans and their habitats. The increasing number of dolphin watching boats, heavy exploitation of f ishing ground, misperception of local f ishers that cetaceans are competitors with f isheries, and lack of a SMP or a Management Plan per se for TSPS warranted the facilitation of a participatory management process to protect the cetaceans and their habitats.This study has shown that even with only preliminary results, survey interviews of key stakeholders in combination with FGDs and seminar-workshop could be critical in facilitating a participatory management process. In the case of the TSPS, this par ticipatory approach led to the formation of the Tañon Strait Association of Dolphin and Whale Watching Operators, Inc. (TaSADoWWI, and eventual development of cetacean

  16. Astronaut Bonnie Dunbar watches crewmates during training

    Science.gov (United States)

    1994-01-01

    Astronaut Bonnie J. Dunbar, STS-71 mission specialist, smiles as she watches a crew mate (out of frame) make a simulated parachute landing in nearby water. The action came as part of an emergency bailout training session in the JSC Weightless Environment

  17. The impact of 3D and 2D TV watching on neurophysiological responses and cognitive functioning in adults.

    Science.gov (United States)

    Jeong, Hyun-Ghang; Ko, Young-Hoon; Han, Changsu; Oh, So-Young; Park, Kun Woo; Kim, Taehee; Ko, Deokwon

    2015-12-01

    Watching three-dimensional television (3D TV) may strain the eyes. However, other potential harmful effects of 3D TV watching have been rarely investigated. The current study examined the impact of 3D TV watching on neurophysiological responses and cognitive functioning as compared with two-dimensional TV (2D TV) watching. A total of 72 individuals were randomly assigned to either a 3D TV watching group or a 2D TV watching group. Electroencephalography (EEG) was used to measure neurophysiological responses, and computerized neurocognitive tests were conducted immediately before and after TV watching. The Simulator Sickness Questionnaire (SSQ) was used to assess visual discomfort. There was a significant change in visual discomfort between the two groups (SSQ score at baseline: 2.28 ± 3.05 for the 3D TV group and 3.69 ± 3.49 for the 2D TV group; SSQ score after watching TV: 4.6 ± 3.35 for the 3D TV group and 4.03 ± 3.47 for the 2D TV group), and this change was greater for the 3D TV watching group (P = 0.025). However, 3D TV watching did not have a differential impact on EEG responses. Furthermore, there were no significant differences between the groups in terms of changes in cognitive performance, except for a subtle difference in backward digit span performance. Our findings suggest that 3D TV watching is as safe as 2D TV watching in terms of neurophysiological responses and cognitive functioning. Potential harmful effects of TV viewing might be similar regardless of whether 3D or 2D TV is viewed. © The Author 2015. Published by Oxford University Press on behalf of the European Public Health Association. All rights reserved.

  18. MedWatch Safety Alerts for Human Medical Products

    Data.gov (United States)

    U.S. Department of Health & Human Services — MedWatch alerts provide timely new safety information on human drugs, medical devices, vaccines and other biologics, dietary supplements, and cosmetics. The alerts...

  19. Who uses running apps and sports watches? Determinants and consumer profiles of event runners' usage of running-related smartphone applications and sports watches.

    Directory of Open Access Journals (Sweden)

    Mark Janssen

    Full Text Available Individual and unorganized sports with a health-related focus, such as recreational running, have grown extensively in the last decade. Consistent with this development, there has been an exponential increase in the availability and use of electronic monitoring devices such as smartphone applications (apps and sports watches. These electronic devices could provide support and monitoring for unorganized runners, who have no access to professional trainers and coaches. The purpose of this paper is to gain insight into the characteristics of event runners who use running-related apps and sports watches. This knowledge is useful from research, design, and marketing perspectives to adequately address unorganized runners' needs, and to support them in healthy and sustainable running through personalized technology. Data used in this study are drawn from the standardized online Eindhoven Running Survey 2014 (ERS14. In total, 2,172 participants in the Half Marathon Eindhoven 2014 completed the questionnaire (a response rate of 40.0%. Binary logistic regressions were used to analyze the impact of socio-demographic variables, running-related variables, and psychographic characteristics on the use of running-related apps and sports watches. Next, consumer profiles were identified. The results indicate that the use of monitoring devices is affected by socio-demographics as well as sports-related and psychographic variables, and this relationship depends on the type of monitoring device. Therefore, distinctive consumer profiles have been developed to provide a tool for designers and manufacturers of electronic running-related devices to better target (unorganized runners' needs through personalized and differentiated approaches. Apps are more likely to be used by younger, less experienced and involved runners. Hence, apps have the potential to target this group of novice, less trained, and unorganized runners. In contrast, sports watches are more likely to

  20. Who uses running apps and sports watches? Determinants and consumer profiles of event runners’ usage of running-related smartphone applications and sports watches

    Science.gov (United States)

    Scheerder, Jeroen; Thibaut, Erik; Brombacher, Aarnout

    2017-01-01

    Individual and unorganized sports with a health-related focus, such as recreational running, have grown extensively in the last decade. Consistent with this development, there has been an exponential increase in the availability and use of electronic monitoring devices such as smartphone applications (apps) and sports watches. These electronic devices could provide support and monitoring for unorganized runners, who have no access to professional trainers and coaches. The purpose of this paper is to gain insight into the characteristics of event runners who use running-related apps and sports watches. This knowledge is useful from research, design, and marketing perspectives to adequately address unorganized runners’ needs, and to support them in healthy and sustainable running through personalized technology. Data used in this study are drawn from the standardized online Eindhoven Running Survey 2014 (ERS14). In total, 2,172 participants in the Half Marathon Eindhoven 2014 completed the questionnaire (a response rate of 40.0%). Binary logistic regressions were used to analyze the impact of socio-demographic variables, running-related variables, and psychographic characteristics on the use of running-related apps and sports watches. Next, consumer profiles were identified. The results indicate that the use of monitoring devices is affected by socio-demographics as well as sports-related and psychographic variables, and this relationship depends on the type of monitoring device. Therefore, distinctive consumer profiles have been developed to provide a tool for designers and manufacturers of electronic running-related devices to better target (unorganized) runners’ needs through personalized and differentiated approaches. Apps are more likely to be used by younger, less experienced and involved runners. Hence, apps have the potential to target this group of novice, less trained, and unorganized runners. In contrast, sports watches are more likely to be used by a

  1. Easier Seen Than Done: Merely Watching Others Perform Can Foster an Illusion of Skill Acquisition.

    Science.gov (United States)

    Kardas, Michael; O'Brien, Ed

    2018-04-01

    Modern technologies such as YouTube afford unprecedented access to the skilled performances of other people. Six experiments ( N = 2,225) reveal that repeatedly watching others can foster an illusion of skill acquisition. The more people merely watch others perform (without actually practicing themselves), the more they nonetheless believe they could perform the skill, too (Experiment 1). However, people's actual abilities-from throwing darts and doing the moonwalk to playing an online game-do not improve after merely watching others, despite predictions to the contrary (Experiments 2-4). What do viewers see that makes them think they are learning? We found that extensive viewing allows people to track what steps to take (Experiment 5) but not how those steps feel when taking them. Accordingly, experiencing a "taste" of performing attenuates the illusion: Watching others juggle but then holding the pins oneself tempers perceived change in one's own ability (Experiment 6). These findings highlight unforeseen problems for self-assessment when watching other people.

  2. Coral Reef Watch, Degree Heating Weeks, 50 km

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NOAA Coral Reef Watch distributes Degree Heating Week products using a combination of the POES AVHRR Global Area Coverage data, and data from a climatological...

  3. Mussel watch

    Science.gov (United States)

    Contamination of U.S. coastal areas may be decreasing as a result of environmental regulations that have banned or curtailed toxic chemicals, concludes a report by the National Oceanic and Atmospheric Administration. The report, “Recent Trends in Coastal Environmental Quality: Results from the Mussel Watch Project,” presents results of analyzing chemical concentrations found in mussel and oyster tissues collected every year since 1986.These mollusks are collected once a year at more than 240 sites nationwide and analyzed for over 70 polycyclic aromatic hydrocarbons, polychlorinated biphenyls, chlorinated pesticides, butyltins, and toxic trace elements such as copper, cadmium, and lead. The report states that from 1986 to 1993 there were many more decreases than increases in chemical concentrations in coastal regions. These decreasing trends were not unexpected; all of the monitored chlorinated hydrocarbons have been banned for use in the United States, and tributyltin has been banned as a biocide on recreational boats.

  4. Modeling the Physical Multi-Phase Interactions of HNO3 Between Snow and Air on the Antarctic Plateau (Dome C) and coast (Halley)

    Science.gov (United States)

    Chan, Hoi Ga; Frey, Markus M.; King, Martin D.

    2017-04-01

    Nitrogen oxides (NOx = NO + NO2) emissions from nitrate (NO3-) photolysis in snow affect the oxidising capacity of the lower troposphere especially in remote regions of the high latitudes with low pollution levels. The porous structure of snowpack allows the exchange of gases with the atmosphere driven by physicochemical processes, and hence, snow can act as both source and sink of atmospheric chemical trace gases. Current models are limited by poor process understanding and often require tuning parameters. Here, two multi-phase physical models were developed from first principles constrained by observed atmospheric nitrate, HNO3, to describe the air-snow interaction of nitrate. Similar to most of the previous approaches, the first model assumes that below a threshold temperature, To, the air-snow grain interface is pure ice and above To, a disordered interface (DI) emerges assumed to be covering the entire grain surface. The second model assumes that Air-Ice interactions dominate over the entire temperature range below melting and that only above the eutectic temperature, liquid is present in the form of micropockets in grooves. The models are validated with available year-round observations of nitrate in snow and air at a cold site on the Antarctica Plateau (Dome C, 75°06'S, 123°33'E, 3233 m a.s.l.) and at a relatively warm site on the Antarctica coast (Halley, 75°35'S, 26°39'E, 35 m a.s.l). The first model agrees reasonably well with observations at Dome C (Cv(RMSE) = 1.34), but performs poorly at Halley (Cv(RMSE) = 89.28) while the second model reproduces with good agreement observations at both sites without any tuning (Cv(RMSE) = 0.84 at both sites). It is therefore suggested that air-snow interactions of nitrate in the winter are determined by non-equilibrium surface adsorption and co-condensation on ice coupled with solid-state diffusion inside the grain. In summer, however, the air-snow exchange of nitrate is mainly driven by solvation into liquid

  5. 2013 Summer Hypoxia Watch Bottom CTD Station Locations

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  6. 2011 Summer Hypoxia Watch Bottom CTD Station Locations

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  7. 2008 Summer Hypoxia Watch Bottom CTD Station Locations

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  8. 2009 Summer Hypoxia Watch Bottom CTD Station Locations

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  9. 2015 Summer Hypoxia Watch Bottom CTD Station Locations

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  10. 2012 Summer Hypoxia Watch Bottom CTD Station Locations

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  11. 2010 Summer Hypoxia Watch Bottom CTD Station Locations

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  12. A Timely Intervention: Endoscopic Retrieval of a Swallowed Magnetized Activity Watch

    Directory of Open Access Journals (Sweden)

    Jason S. Radowsky

    2016-01-01

    Full Text Available The accidental ingestion of a foreign object often presents a difficult scenario for the clinician. This includes not only the decision to retrieve the material but also the appropriate technique to use. We present the case of a young asymptomatic girl who swallowed a magnetic activity watch, which was then successfully retrieved with an endoscopic snare. To our knowledge, this is the first documented case of salvaging an operational watch from the stomach using an endoscopic technique.

  13. Relationship of Terror Feelings and Physiological Response During Watching Horror Movie

    OpenAIRE

    Fukumoto, Makoto; Tsukino, Yuuki

    2015-01-01

    Part 8: ICBAKE 2015 Workshop; International audience; Movie is one of the most popular media types. Horror movie is a kind of attractive movie contents which part of people want to watch very much. Although the users feel terror of the contents, the users want to watch the horror movies to have extraordinary feelings such as excitements. Therefore, terror feelings of the horror movies are considered as an important factor to establish more attractive movie contents, and the effect of horror m...

  14. Influence of socio-economic status and television watching on childhood obesity in Kolkata.

    Science.gov (United States)

    Bharati, S; Pal, M; Shome, S; Roy, P; Dhara, P; Bharati, P

    2017-12-01

    Obesity is fast becoming an epidemic among the urban children and it has its adverse effect on the status of health even during adulthood. In this paper an attempt is made to assess the percentage of obesity among 6-10 year children and assess the effect of different socio-economic variables and TV watching on childhood obesity. We restricted our study to primary school-going children who attended classes I-IV. The sample consisted of 5216 children from 20 different Bengali medium and English medium schools in Kolkata. Categorical logistic regression of obesity on the socio-economic factors namely type of medium school, religion, parent's education, duration of television watching etc., has been carried out. The categorical logistic regression shows the significant effect of some of the socio-economic or demographic variables including the duration of television watching on obesity. We have seen a positive association between obesity and TV watching and also between obesity and consumption of fast food. This calls for making the parents aware and taking action as early as possible. Copyright © 2017 Elsevier GmbH. All rights reserved.

  15. Television and families: what do young children watch with their parents?

    Science.gov (United States)

    St Peters, M; Fitch, M; Huston, A C; Wright, J C; Eakins, D J

    1991-12-01

    A sample of 271 3- and 5-year-olds and their families participated in a 2-year longitudinal study of television viewing patterns. 5 1-week diaries for all family members were collected at 6-month intervals. Programs were categorized as: (1) child informative, (2) child entertainment, (3) news and informative, (4) sports, (5) comedy, (6) drama, (7) action-adventure, and (8) variety-game. The majority of child programs were viewed without parents, while the majority of adult programs were watched with parents. Coviewing patterns of adult programs were predicted from parents' individual viewing habits, but not from the child's. Coviewing declined with age. Parental encouragement and regulation of viewing were orthogonal. Children whose parents encouraged viewing watched more child informative programming; children of restrictive parents watched less entertainment programming. Encouraging parents coviewed more than nonencouraging parents. Results support the assertion that parental viewing preferences, habits, and orientations toward television influence children's viewing, both with and without parents.

  16. Augmented Reality Implementation in Watch Catalog as e-Marketing Based on Mobile Aplication

    Science.gov (United States)

    Adrianto, D.; Luwinda, F. A.; Yesmaya, V.

    2017-01-01

    Augmented Reality is one of important methods to provide user with a better interactive user interface. In this research, Augmented Reality in Mobile Application will be applied to provide user with useful information related with Watch Catalogue. This research will be focused on design and implementation an application using Augmented Reality. The process model used in this research is Extreme Programming. Extreme Programming have a several steps which are planning, design, coding, and testing. The result of this research is Augmented Reality application based on Android. This research will be conclude that implementation of Augmented Reality based on Android in Watch Catalogue will help customer to collect the useful information related to the specific object of watch.

  17. Vakuuttava teknologia älykelloissa:case Apple Watch

    OpenAIRE

    Laaksoviita, J. (Joonas)

    2016-01-01

    Tiivistelmä Tämä kandidaatintutkielma perehtyi vakuuttavaan teknologiaan Apple Watch -älykellossa. Tutkielman ensimmäisessä osassa esiteltiin kirjallisuuskatsauksen kautta älykellojen taustaa ja tutkittava laite. Sen jälkeen luotiin katsaus vakuuttavan teknologian perusideaan ja esiteltiin Persuasive Systems Design -malli vakuuttavan teknologian sovellusten analysointiin. Toisessa osiossa suoritettiin analyysi Apple Watchin...

  18. Effect of electronic time monitors on children's television watching: pilot trial of a home-based intervention.

    Science.gov (United States)

    Ni Mhurchu, Cliona; Roberts, Vaughan; Maddison, Ralph; Dorey, Enid; Jiang, Yannan; Jull, Andrew; Tin Tin, Sandar

    2009-11-01

    This pilot study evaluated the feasibility (recruitment, retention, and acceptability) and preliminary efficacy of a six-week home-based electronic time monitor intervention on New Zealand children's television watching in 2008. Twenty-nine children aged 9 to 12 years who watched more than 20 h of television per week (62% male, mean age 10.4 years) were randomised to either the intervention or the control group. The intervention group received an electronic TV time monitor for 6 weeks and advice to restrict TV watching to 1 h per day or less. The control group was given verbal advice to restrict TV watching. Participant retention at 6 weeks was 93%. Semi-structured interviews with intervention families confirmed moderate acceptability of TV time monitors and several perceived benefits including better awareness of household TV viewing and improved time planning. Drawbacks reported included disruption to parents' TV watching and increased sibling conflict. Time spent watching television decreased by 4.2 h (mean change [SD]: -254 [536] min) per week in the intervention group compared with no change in the control group (-3 [241] min), but the difference between groups was not statistically significant, p=0.77. Both groups reported decreases in energy intake from snacks and total screen time and increases in physical activity measured by pedometer and between-group differences were not statistically significant. Electronic TV time monitors are feasible to use for home-based TV watching interventions although acceptability varies between families. Preliminary findings from this pilot suggest that such devices have potential to decrease children's TV watching but a larger trial is needed to confirm effectiveness. Future research should be family-orientated; take account of other screen time activities; and employ TV time monitors as just one of a range of strategies to decrease sedentary behaviour.

  19. Measuring the validity and reliability of the Apple Watch as a physical activity monitor.

    Science.gov (United States)

    Zhang, Peng; Godin, Steven D; Owens, Matthew V

    2018-04-04

    This study aimed to investigate the validity and reliability of the energy expenditure (EE) estimation of Apple Watch among college students. Thirty college students completed two sets of three 10-minute treadmill walking and running trials while wearing three Apple Watches and being connected to indirect calorimetry. The walking trials were at speeds of 54, 80, and 107 m•min-1 while the running trials were at 134, 161, 188m•min-1. Energy expenditure comparisons were made using Two-way ANOVA with repeatedmeasures. Reliability was analyzed by Intraclass Correlation. There was no significant device x speed interactions (F (15, 696) = 1.113, p = 0.341) between the indirect calorimetry (criterion) and Apple Watch. The lowest Inter-Class Correlation (ICC) scores were 0.49 (95%CI) at 54 while the highest were 0.72 (95%CI) at 107 and 134 m•min-1. Apple Watch demonstrated a low to moderate validity and reliability on measuring EE.

  20. ALiEM Blog and Podcast Watch: Toxicology.

    Science.gov (United States)

    Zaver, Fareen; Craddick, Michael; Sanford, Audrey; Sefa, Nana; Hughes, George; Lin, Michelle

    2017-10-01

    The WestJEM Blog and Podcast Watch presents high-quality open-access educational blogs and podcasts in emergency medicine based on the ongoing Academic Life in Emergency Medicine (ALiEM) Approved Instructional Resources (AIR) and AIR-Professional (Pro) series. Both series critically appraise open-access educational blogs and podcasts in EM using an objective scoring instrument. This installment of the blog and podcast watch series curated and scored relevant posts in the specific topic of toxicology emergencies from the AIR-Pro Series. The AIR-Pro Series is a continuously building curriculum covering a new subject area every two months. For each area, eight EM chief residents identify 3-5 advanced clinical questions. Using FOAMsearch.net and FOAMSearcher to search blogs and podcasts, relevant posts are scored by eight reviewers from the AIR-Pro editorial board, which is comprised of EM faculty and chief residents at various institutions across North America. The scoring instrument contains five measurement outcomes based on seven-point Likert scales: recency, accuracy, educational utility, evidence based, and references. The AIR-Pro label is awarded to posts with a score of ≥28 (out of 35) points. An "honorable mention" label is awarded if board members collectively felt that the blogs were valuable and the scores were > 25. A total of 31 blog posts and podcasts were included. Key educational pearls from the six high-quality AIR-Pro posts and four honorable mentions are summarized. The WestJEM ALiEM Blog and Podcast Watch series is based on the AIR and AIR-Pro Series, which attempts to identify high-quality educational content on open-access blogs and podcasts. This series provides an expert-based, crowdsourced approach towards critically appraising educational social media content for EM clinicians. This installment focuses on toxicology emergencies.

  1. Should I Let My Child Watch Television?

    Science.gov (United States)

    Bharadwaj, Balaji

    2013-01-01

    While the prevalence of autism has been increasing globally, there is a search for the causative factors behind the rise. The point of view presented here examines the possibility of children brought up in social deprivation and watching television being at higher risk for developing autistic symptoms. The association is evident in the clinical…

  2. Watching your weight? The relations between watching soaps and music television and body dissatisfaction and restrained eating in young girls

    NARCIS (Netherlands)

    Anschutz, D.J.; Engels, R.C.M.E.; Leeuwe, J.F.J. van; Strien, T. van

    2009-01-01

    Although previous research showed that the thin ideal provided by the media affects body image and eating behaviour in young children, less is known about specific media contents that are related to body image and eating behaviour. This study tested the associations between watching soaps and music

  3. Obesity and television watching in preschoolers in Greece: the GENESIS study.

    Science.gov (United States)

    Manios, Yannis; Kourlaba, Georgia; Kondaki, Katerina; Grammatikaki, Evangelia; Anastasiadou, Anastasia; Roma-Giannikou, Eleytheria

    2009-11-01

    The aim of the current work was to evaluate the effect of preschoolers' television (TV) watching time on the prevalence of obesity even after controlling for their total energy intake and their physical activity status. A representative sample of 2,374 Greek children aged 1-5 years was examined ("Growth, Exercise and Nutrition Epidemiological Study in preSchoolers", GENESIS study). Children's TV watching time on a usual weekday and at a usual weekend was recorded. The overall mean of children's TV viewing time was 1.32 h/day. The majority of participants (74.0%) spent 4 h/day in front of a TV set. Overall, 65.2% of participants were normal weight, 17.2% were overweight, and the rest 17.6% were obese. The prevalence of obesity was significantly higher among those with TV viewing time >or=2 h/day (21.7%) compared to those watching TV characteristics and physical activity status) only among children aged 3-5 years. However, further adjusting for children's total energy intake revealed that the association between the TV viewing time and the probability of being obese was no longer statistically significant. On the other hand, physical activity status continued to be an independent factor of being obese. The current findings support the hypothesis that the effect of TV viewing time on childhood obesity is independent of physical activity status and may be attributed to the increased total energy intake during TV watching.

  4. Reading Books and Watching Films as a Protective Factor against Suicidal Ideation

    OpenAIRE

    Kasahara-Kiritani, Mami; Hadlaczky, Gerg?; Westerlund, Michael; Carli, Vladimir; Wasserman, Camilla; Apter, Alan; Balazs, Judit; Bobes, Julio; Brunner, Romuald; McMahon, Elaine M.; Cosman, Doina; Farkas, Luca; Haring, Christian; Kaess, Michael; Kahn, Jean-Pierre

    2015-01-01

    Reading books and watching films were investigated as protective factors for serious suicidal ideation (SSI) in young people with low perceived social belonging. Cross-sectional and longitudinal (12-month) analyses were performed using data from a representative European sample of 3256 students from the “Saving and Empowering Young Lives in Europe” study. Low social belonging was associated to SSI. However, reading books and watching films moderated this association, especially for those with...

  5. 47 CFR 80.302 - Notice of discontinuance, reduction, or impairment of service involving a distress watch.

    Science.gov (United States)

    2010-10-01

    ... COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES STATIONS IN THE MARITIME SERVICES Safety Watch Requirements and Procedures Coast Station Safety Watches § 80.302 Notice of discontinuance...

  6. 47 CFR 80.310 - Watch required by voluntary vessels.

    Science.gov (United States)

    2010-10-01

    ... Section 80.310 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES STATIONS IN THE MARITIME SERVICES Safety Watch Requirements and Procedures Ship Station Safety...] Distress, Alarm, Urgency and Safety Procedures ...

  7. Testosterone and Cortisol Release among Spanish Soccer Fans Watching the 2010 World Cup Final

    NARCIS (Netherlands)

    van der Meij, L.; Almela, M.; Hidalgo, V.; Villada, C.; IJzerman, H.; van Lange, P.A.M.; Salvador, A.

    2012-01-01

    This field study investigated the release of testosterone and cortisol of a vicarious winning experience in Spanish fans watching the finals between Spain and the Netherlands in the 2010 FIFA World Cup Soccer. Spanish fans (n = 50) watched the match with friends or family in a public place or at

  8. Social Media Influence and Intensity of Watching Television Drama on Achievement of Students

    Directory of Open Access Journals (Sweden)

    Ali Akbar Himawan

    2017-10-01

    Full Text Available The aims of this study are to get: (1 the influence of the social media use on achievement of students; (2 the influence of the watching television drama intensity on achievement of students grade X TKJ in SMK Batik 1 Surakarta; and (3 the influence both of social media use and the watching television drama intensity on achievement of students. The sample used was 78 from 100 student population based on Isaac and Michael table. This study was quantitative research using ex post facto method. The data were collected by questionnaire and documentation. Data analysis used single and multi-linear regression. The result showed that there was significance influence between the used of social media towards the achievement of the students, there was significance influence between the intensity of watching television drama towards the achievement of the students, there was significance influence between the social media use and the intensity of watching television drama towards the achievement of students. Out of the two independent variables, the use of social media is a variable that contributes more influence to student learning outcomes.

  9. Watching reality television beauty shows is associated with tanning lamp use and outdoor tanning among college students.

    Science.gov (United States)

    Fogel, Joshua; Krausz, Faye

    2013-05-01

    Ultraviolet radiation exposure through natural sunlight or tanning lamps is a risk factor for skin cancer. As the media can influence behavior, we studied whether watching reality television (TV) beauty shows is associated with tanning lamp use or outdoor tanning. College students (n = 576) were surveyed on their reality TV beauty show watching, their use of tanning lamps, and outdoor tanning behavior. We asked media attitude questions about connectivity with reality TV shows and Internet use of Facebook to discuss reality TV shows. Those who did versus did not watch reality TV beauty shows used tanning lamps (12.9% vs 3.7%, P < .001) and tanned outdoors (43.3% vs 28.7%, P < .001) at significantly greater percentages. Significant predictors of tanning lamp use included watching reality TV beauty shows (odds ratio [OR] 2.58, 95% confidence interval [CI] 1.11-6.00), increasing age (OR 1.17, 95% CI 1.04-1.32), and female sex (OR 10.16, 95% CI 3.29-31.41). Significant predictors of outdoor tanning included watching reality TV beauty shows (OR 2.11, 95% CI 1.33-3.34). The specific names of the reality TV beauty shows watched were not obtained and therefore we cannot determine if particular shows were more or less associated with this behavior. Watching reality TV beauty shows is associated with both tanning lamp use and outdoor tanning. Dermatologists should consider discussing the potential harmful aspects of tanning beds and outdoor tanning, especially with their patients who watch reality TV beauty shows. Copyright © 2012 American Academy of Dermatology, Inc. Published by Mosby, Inc. All rights reserved.

  10. Numerical images applied to the spatial technics: the discovery of the Halley's comet nucleus

    International Nuclear Information System (INIS)

    Abergel, A.

    1988-01-01

    For the first time, the solide nucleus of a comet was observed by the 2 soviet spacecraft VEGA on 6 and 9 March 1986. They were followed by the european spacecraft GIOTTO on 14 march. The numerical images transmitted by the 3 spacecraft have been corrected from instrumental degradations and allowed a unique description of the shape and the movement of Halley's comet nucleus. Thus the contours become clearly apparent. Its volume can be described by an ellipsoid which principal axis are equal to 16, 8.2 and 7.5 km: it has an oblate rugby balloon shape. Its rational movement is complicated, but we are able to analyse it with the identification of details seen on the surface at three different moments. The nucleus is greater than expected in the past. It is made of a mixture of water ice and dust, and is covered by a dust dark mantle: it is one of the darkest objects in the solar system. This mantle is not uniform, as shown by the images sent by the 3 spacecraft. They display a spectacular distribution of dust jets emitted by very active regions on the nucleus surface [fr

  11. Watching Dallas Again 1 : Doing Retro Audience Research

    NARCIS (Netherlands)

    Gilroy, Amanda

    2014-01-01

    This essay and the audience reception projects it introduces alleviate the desperation of seeking the television audience by recourse to Ien Ang's influential book, Watching Dallas ([1982] 1985). Within the context of a unit on audience research in a master's-level course on media, two groups of

  12. The in-situ cometary particulate size distribution measured for one comet: P/Halley

    International Nuclear Information System (INIS)

    McDonnell, J.A.M.; Pankiewicz, G.S.

    1989-01-01

    The close approach of Giotto to comet Halley during its 1986 apparition offered an opportunity to study the particulate mass distribution to masses of up to one gram. Data acquired by the front end channels of the highly sensitive mass spectrometer PIA and the dust shield detector system, DIDSY, provide definition to the detected distribution as close as 1000 km to the nucleus. Dynamic motion of the particulates after emission leads to a spatial differentiation affecting the size distribution in several forms: (1) ejecta velocity dispersion; (2) radiation pressure; (3) varying heliocentric distance; and (4) anisotropic nucleus emission. Transformation of the in-situ distribution from PIA and DIDSY weighted heavily by the near-nucleus fluxes leads to a presumed nucleus distribution. The data lead to a puzzling distribution at large masses, not readily explained in an otherwise monotonous power law distribution. Although temporal changes in nucleus activity could and do modify the in-situ size distribution, such an explanation is not wholly possible, because the same form is observed at differing locations in the coma where the time of flight from the nucleus greatly varies. Thus neither a general change in comet activity nor spatial variations lead to a satisfactory explanation

  13. The Australian Constitution and the Aid/Watch Case

    Directory of Open Access Journals (Sweden)

    George Williams

    2011-11-01

    Full Text Available The Australian Constitution played a significant role in underpinning the result in the Aid/Watch Case. It was invoked by the majority to support their conclusion that a body can be a ‘charitable institution’ despite engaging in political activities. The use of the Constitution in this way came as a surprise. The case extended an existing constitutional principle relating to freedom of political communication from its electoral base into the protection of the political activities of non-government organisations. This may have future ramifications for those organisations in other areas, as well as further implications for the development of what it means to be a charity in Australia. This article examines the use of the Australian Constitution in the Aid/Watch Case. It explains how the High Court was able to invoke the Constitution in defining what it means to be a ‘charitable institution’. It also examines the implications of that reasoning for the development of charitable law in Australia.

  14. NATURE VIDEO WATCHING: CONSEQUENCES ON ANGER AND ANXIETY

    Directory of Open Access Journals (Sweden)

    Nicoleta Răban-Motounu

    2017-12-01

    Full Text Available Extensive research has been conducted on the effects of natural environment on people’s well-being, starting with the short term restoring effects on the brain, and continuing with the long-term effects on the emotional self-regulating processes. In the present research we have focused on the latter, trying to connect two of the problems in our world: the violent behavior, and the preservation of natural environment. Thus, the objective was to study the effects of watching a video from nature wild life on anger (the feeling and its expression, and state-anxiety. The statistical analysis indicated that, while there were no significant differences regarding anxiety (worry, internal tension or general mechanisms in dealing with fury, watching the video significantly decreased the feeling of anger, and the tendency to express it either verbally or physically. As a main conclusion we highlight the link between the accessibility of natural environment, and the violent expressions of anger.

  15. Strategic and operational information watch newsletter nr 1

    International Nuclear Information System (INIS)

    2016-12-01

    This newsletter proposes an overview of events related to security and defence issues in relationship with impacts of climate change. A first part reports a strategic watch which addresses the following topics: the environment taken into account by the International Criminal Court, impacts of climate change on tensions about rural estate in Africa, resolution of the European Parliament on the European Union of Defence, environmental and energy strategy of the Danish Ministry of Defence, COP22 in Marrakech, and so on. The second part reports an operational information watch addresses the threat on the US DoD environmental agenda by the new Trump administration, the adaptation of US forces to climate changes, the threat of climate change on US DoD infrastructures, a US base self-sufficient in energy, NATO actions for energy efficiency, thermal regulation improvement for soldiers, impact of El Nino on the propagation of the Zika virus, launching of the Lancet countdown. The newsletter finally indicates some brief news, events and recent publications

  16. Modelling the physical multiphase interactions of HNO3 between snow and air on the Antarctic Plateau (Dome C and coast (Halley

    Directory of Open Access Journals (Sweden)

    H. G. Chan

    2018-02-01

    Full Text Available Emissions of nitrogen oxide (NOx  =  NO + NO2 from the photolysis of nitrate (NO3− in snow affect the oxidising capacity of the lower troposphere especially in remote regions of high latitudes with little pollution. Current air–snow exchange models are limited by poor understanding of processes and often require unphysical tuning parameters. Here, two multiphase models were developed from physically based parameterisations to describe the interaction of nitrate between the surface layer of the snowpack and the overlying atmosphere. The first model is similar to previous approaches and assumes that below a threshold temperature, To, the air–snow grain interface is pure ice and above To a disordered interface (DI emerges covering the entire grain surface. The second model assumes that air–ice interactions dominate over all temperatures below melting of ice and that any liquid present above the eutectic temperature is concentrated in micropockets. The models are used to predict the nitrate in surface snow constrained by year-round observations of mixing ratios of nitric acid in air at a cold site on the Antarctic Plateau (Dome C; 75°06′ S, 123°33′ E; 3233 m a.s.l. and at a relatively warm site on the Antarctic coast (Halley; 75°35′ S, 26°39′ E; 35 m a.s.l. The first model agrees reasonably well with observations at Dome C (Cv(RMSE  =  1.34 but performs poorly at Halley (Cv(RMSE  =  89.28 while the second model reproduces with good agreement observations at both sites (Cv(RMSE  =  0.84 at both sites. It is therefore suggested that in winter air–snow interactions of nitrate are determined by non-equilibrium surface adsorption and co-condensation on ice coupled with solid-state diffusion inside the grain, similar to Bock et al. (2016. In summer, however, the air–snow exchange of nitrate is mainly driven by solvation into liquid micropockets following Henry's law with

  17. [Smoking initiation and watching television, video, DVD among adolescents in Poland].

    Science.gov (United States)

    Kowalewska, Anna; Mazur, Joanna

    2012-01-01

    The aim of the study was to analyse the relationship between smoking initiation and the time spent watching TV, video, DVD by adolescents 11, 13, and 15-year-old in Poland. The research was conducted in 2010 as a part of Health Behaviour in School-aged Children: A WHO Collaborative Cross-national Study (HBSC) in a sample of 4751 students, using a standard, international HBSC questionnaire. It was found that there is a relationship between smoking attempts made by the young people and time spent watching TV during weekdays. In the analyzes using logistic regression combined variable relating to the time to watch TV on weekdays and weekends was used. Nearly a quarter of respondents (24.3%) were qualified to the group of adolescents spending too much time in front of the screen. Age was the strongest predictor of smoking onset. Between 11 and 13 years of age the risk of taking the first cigarette increased three times, and between 11 and 15 years of age more than seven times. Relative risk of smoking attempts related to gender and frequency of watching television, video or DVD was both equal to 1.5. In smoking prevention focused on adolescents it is should be better to pay more attention on constructive leisure time activities, and the role of parents in shaping pro-health attitudes. This is particularly important in the initial stages of schooling, when to develop and enhance the psychosocial competences as a the protective factor of risk taking behaviors among adolescents.

  18. AirDraw: Leveraging Smart Watch Motion Sensors for Mobile Human Computer Interactions

    OpenAIRE

    Sajjadi, Seyed A; Moazen, Danial; Nahapetian, Ani

    2017-01-01

    Wearable computing is one of the fastest growing technologies today. Smart watches are poised to take over at least of half the wearable devices market in the near future. Smart watch screen size, however, is a limiting factor for growth, as it restricts practical text input. On the other hand, wearable devices have some features, such as consistent user interaction and hands-free, heads-up operations, which pave the way for gesture recognition methods of text entry. This paper proposes a new...

  19. The introduction of Copyright Law in England and its effect on the dispute between Newton, Halley and Flamsteed concerning the 'pirated' Historia Coelestis 1712

    Science.gov (United States)

    Birks, J. L.

    2013-03-01

    In 1712 Sir Isaac Newton and Dr Edmund Halley, acting on behalf of the Royal Society, printed some 400 copies of the star catalogue Historia Coelestis under the name of John Flamsteed, including his observations of the positions of nearly 3000 stars made at Greenwich from 1676. Flamsteed had not been allowed to check the proofs of this work before it was published, and he was enraged to see what he considered to be a travesty of his life's work. This became a great scientific scandal of the early eighteenth century, which echoes down to the present day.

  20. Syncope During Competitive Events: Interrogating Heart Rate Monitor Watches May Be Useful!

    Science.gov (United States)

    Thabouillot, Oscar; Bostanci, Kevin; Bouvier, Francois; Dumitrescu, Nicolae; Stéfuriac, Maria; Paule, Philippe; Roche, Nicolas-Charles

    2017-12-01

    This is a case report of a 45-year-old man who reported complete amnesia during the very first kilometer of a 10-km run. He was wearing a heart rate monitor (HRM). The interrogation of his HRM watch showed 200 bpm tachycardia beginning in the first kilometer and increasing up to 220 bpm during the last kilometer. The patient was asked to wear a Holter-monitor (Holter Research Laboratory; Helena, Montana USA) electrocardiogram (ECG) while practicing a training session. This examination allowed for the diagnosis of an adrenergic paroxysmal atrial fibrillation (AF) with an impressive auriculo-ventricular conduction over 260 bpm. This case highlights that non-medical devices, such as connected watches, can be helpful to diagnose arrhythmias. Thabouillot O , Bostanci K , Bouvier F , Dumitrescu N , Stéfuriac M , Paule P , Roche NC . Syncope during competitive events: interrogating heart rate monitor watches may be useful! Prehosp Disaster Med. 2017;32(6):691-693.

  1. Trajectories of Television Watching from Childhood to Early Adulthood and Their Association with Body Composition and Mental Health Outcomes in Young Adults.

    Science.gov (United States)

    McVeigh, Joanne; Smith, Anne; Howie, Erin; Straker, Leon

    2016-01-01

    Prior studies examining longitudinal patterns of television (TV) watching have tended to use analytical approaches which do not allow for heterogeneity in the variation of TV watching over time. In the current study, we used latent class analysis (LCA) to examine the relationships between television watching (from childhood to early adulthood) and body fat percentage (%) and mental health. Data were collected from 2411 participants (50% female) from the Raine Study, a prospective birth cohort study in Australia. Participants were followed up over 15 years and answered questions about hours of TV watching per week at six time-points (5, 8, 10, 14, 17 and 20yrs). Trajectories of television watching were estimated using LCA and appropriate regression models used to test the association of television watching class with percentage body fat (measured by DXA) and mental health (DASS-21) at age 20. Physical activity was used as a covariate. Three distinct trajectories of TV watching were identified. Class 1 (47.4%) had consistently high (>14 hrs/wk) levels of TV watching, Class 2 (37.9%) was characterised by an increase in TV watching over adolescence and Class 3 (14.7%) had consistently lower (0.05). TV watching from childhood to young adulthood appears to be a relatively stable behavior for around two thirds of participants, but not everyone tracks consistently. This study identified a subset of participants with low levels of TV watching in childhood and also that this group, despite an increase in TV watching over adolescence, maintained a lower level of body fat in young adulthood.

  2. Association of leisure time physical activity, watching television ...

    African Journals Online (AJOL)

    The present study shows the association of leisure time physical activity (LTPA) and watching TV with lipid profile & obesity in a South Indian adult population. Methods: This cross-sectional study was performed on 2171 women and 2016 men in Mahatma Gandhi Medical College and Research Institute. The subjects were ...

  3. Watch Out for Glaucoma | NIH MedlinePlus the Magazine

    Science.gov (United States)

    ... of this page please turn JavaScript on. Feature: Glaucoma Watch Out for Glaucoma Past Issues / Spring 2015 Table of Contents A ... used to check eye pressure for signs of glaucoma. Photo courtesy of NEI Glaucoma is a group ...

  4. Validation of the ADAMO Care Watch for step counting in older adults.

    Science.gov (United States)

    Magistro, Daniele; Brustio, Paolo Riccardo; Ivaldi, Marco; Esliger, Dale Winfield; Zecca, Massimiliano; Rainoldi, Alberto; Boccia, Gennaro

    2018-01-01

    Accurate measurement devices are required to objectively quantify physical activity. Wearable activity monitors, such as pedometers, may serve as affordable and feasible instruments for measuring physical activity levels in older adults during their normal activities of daily living. Currently few available accelerometer-based steps counting devices have been shown to be accurate at slow walking speeds, therefore there is still lacking appropriate devices tailored for slow speed ambulation, typical of older adults. This study aimed to assess the validity of step counting using the pedometer function of the ADAMO Care Watch, containing an embedded algorithm for measuring physical activity in older adults. Twenty older adults aged ≥ 65 years (mean ± SD, 75±7 years; range, 68-91) and 20 young adults (25±5 years, range 20-40), wore a care watch on each wrist and performed a number of randomly ordered tasks: walking at slow, normal and fast self-paced speeds; a Timed Up and Go test (TUG); a step test and ascending/descending stairs. The criterion measure was the actual number of steps observed, counted with a manual tally counter. Absolute percentage error scores, Intraclass Correlation Coefficients (ICC), and Bland-Altman plots were used to assess validity. ADAMO Care Watch demonstrated high validity during slow and normal speeds (range 0.5-1.5 m/s) showing an absolute error from 1.3% to 1.9% in the older adult group and from 0.7% to 2.7% in the young adult group. The percentage error for the 30-metre walking tasks increased with faster pace in both young adult (17%) and older adult groups (6%). In the TUG test, there was less error in the steps recorded for older adults (1.3% to 2.2%) than the young adults (6.6% to 7.2%). For the total sample, the ICCs for the ADAMO Care Watch for the 30-metre walking tasks at each speed and for the TUG test were ranged between 0.931 to 0.985. These findings provide evidence that the ADAMO Care Watch demonstrated highly accurate

  5. Duration of daily TV/screen watching with cardiovascular, respiratory, mental and psychiatric health: Scottish Health Survey, 2012-2013.

    Science.gov (United States)

    Shiue, Ivy

    2015-01-01

    The link of duration of TV and/or screen watching and chronic health conditions by subtypes is unclear. Therefore, the relationship between TV and/or screen watching hours and cardiovascular, respiratory, mental and psychiatric health and well-being (happiness) was assessed in an independent population-based survey to identify correlations of various hours with health conditions. Data was retrieved from the Scottish Health Survey, 2012-2013. Information on demographics, lifestyle factors, self-reported health conditions and TV and/or screen watching duration in both Scottish adults and children was collected by annual household interviews. Chi-square test and survey weighted logistic and multi-nominal modelling were performed. 5527 (57.0%) Scottish adults aged 16-99 watched TV and/or screen daily for 3 + h on average. There was a trend toward more hypertension, angina, stroke, diabetes, chronic obstructive pulmonary disease and poor self-rated health and mental health. Reporting watching TV and/or screen for 4 + h, for 5 + h and for 8 + h was associated with higher rates of heart attack, heart murmur or other heart troubles and abnormal heart rhythms, respectively. 414 (20.7%) Scottish children aged 4-12 watched TV and/or screen for 3h or more. They tended to have poor self-rated health and life difficulties perceived as emotional and behavioural problems. There were associations between various hours of TV and/or screen watching (3+h) and poor health observed both in Scottish adults and children. Future educational and public health programmes minimising TV and/or screen watching in order to protect cardiovascular, respiratory, mental and psychiatric health might be considered. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  6. Numerical compliance testing of human exposure to electromagnetic radiation from smart-watches.

    Science.gov (United States)

    Hong, Seon-Eui; Lee, Ae-Kyoung; Kwon, Jong-Hwa; Pack, Jeong-Ki

    2016-10-07

    In this study, we investigated the electromagnetic dosimetry for smart-watches. At present, the standard for compliance testing of body-mounted and handheld devices specifies the use of a flat phantom to provide conservative estimates of the peak spatial-averaged specific absorption rate (SAR). This means that the estimated SAR using a flat phantom should be higher than the SAR in the exposure part of an anatomical human-body model. To verify this, we numerically calculated the SAR for a flat phantom and compared it with the numerical calculation of the SAR for four anatomical human-body models of different ages. The numerical analysis was performed using the finite difference time domain method (FDTD). The smart-watch models were used in the three antennas: the shorted planar inverted-F antenna (PIFA), loop antenna, and monopole antenna. Numerical smart-watch models were implemented for cellular commutation and wireless local-area network operation at 835, 1850, and 2450 MHz. The peak spatial-averaged SARs of the smart-watch models are calculated for the flat phantom and anatomical human-body model for the wrist-worn and next to mouth positions. The results show that the flat phantom does not provide a consistent conservative SAR estimate. We concluded that the difference in the SAR results between an anatomical human-body model and a flat phantom can be attributed to the different phantom shapes and tissue structures.

  7. 47 CFR 80.1123 - Watch requirements for ship stations.

    Science.gov (United States)

    2010-10-01

    ... Section 80.1123 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES STATIONS IN THE MARITIME SERVICES Global Maritime Distress and Safety System (GMDSS) Operating... watches for broadcasts of maritime safety information on the appropriate frequency or frequencies on which...

  8. LifeWatch - a Large-scale eScience Infrastructure to Assist in Understanding and Managing our Planet's Biodiversity

    Science.gov (United States)

    Hernández Ernst, Vera; Poigné, Axel; Los, Walter

    2010-05-01

    Understanding and managing the complexity of the biodiversity system in relation to global changes concerning land use and climate change with their social and economic implications is crucial to mitigate species loss and biodiversity changes in general. The sustainable development and exploitation of existing biodiversity resources require flexible and powerful infrastructures offering, on the one hand, the access to large-scale databases of observations and measures, to advanced analytical and modelling software, and to high performance computing environments and, on the other hand, the interlinkage of European scientific communities among each others and with national policies. The European Strategy Forum on Research Infrastructures (ESFRI) selected the "LifeWatch e-science and technology infrastructure for biodiversity research" as a promising development to construct facilities to contribute to meet those challenges. LifeWatch collaborates with other selected initiatives (e.g. ICOS, ANAEE, NOHA, and LTER-Europa) to achieve the integration of the infrastructures at landscape and regional scales. This should result in a cooperating cluster of such infrastructures supporting an integrated approach for data capture and transmission, data management and harmonisation. Besides, facilities for exploration, forecasting, and presentation using heterogeneous and distributed data and tools should allow the interdisciplinary scientific research at any spatial and temporal scale. LifeWatch is an example of a new generation of interoperable research infrastructures based on standards and a service-oriented architecture that allow for linkage with external resources and associated infrastructures. External data sources will be established data aggregators as the Global Biodiversity Information Facility (GBIF) for species occurrences and other EU Networks of Excellence like the Long-Term Ecological Research Network (LTER), GMES, and GEOSS for terrestrial monitoring, the

  9. New indicators for global crop monitoring in CropWatch -case study in North China Plain

    International Nuclear Information System (INIS)

    Bingfang, Wu; Miao, Zhang; Hongwei, Zeng; Guoshui, Liu; Sheng, Chang; Gommes, René

    2014-01-01

    CropWatch is a monitoring system developed and operated by the Institute of Remote Sensing and Digital Earth (Chinese Academy of Sciences) to provide global-scale crop information. Now in its 15th year of operation, CropWatch was modified several times to be a timely, comprehensive and independent global agricultural monitoring system using advanced remote sensing technology. Currently CropWatch is being upgraded with new indicators based on new sensors, especially those on board of China Environmental Satellite (HJ-1 CCD), the Medium Resolution Spectral Imager (MERSI) on Chinese meteorological satellite (FY-3A) and cloud classification products of FY-2. With new satellite data, CropWatch will generate new indicators such as fallow land ratio (FLR), crop condition for irrigated (CCI) and non-irrigated (CCNI) areas separately, photosynthetically active radiation (PAR), radiation use efficiency for the photosynthetically active radiation (RUE PAR ) and cropping index (CI) with crop rotation information (CRI). In this paper, the methods for monitoring the new indicators are applied to the North China Plain which is one of the major grain producing areas in China. This paper shows the preliminary results of the new indicators and methods; they still need to be thoroughly validated before being incorporated into the operational CropWatch system. In the future, the new and improved indicators will help us to better understand the global situation of food security

  10. The Ramparts We Watch: film documentary discourse in the field of Public Relations/The Ramparts We Watch: el discurso del cine documental en el campo de las Relaciones Públicas

    Directory of Open Access Journals (Sweden)

    Ramón Girona

    2014-05-01

    Full Text Available The aim of this article is to analyze Louis de Rochemont’s The Ramparts We Watch as a public relations war effort from the past century. Arising from the informative and propagandistic strategy of late 1930s newsreels, the aforementioned documentary was made using very appropriate narrative techniques to award it the dimension of objectivity and truthfulness characteristic of public relations messages, without losing sight of its educational and persuasive function. From this standpoint, The Ramparts We Watch founded a genre and constituted one of the clearest precedents of public relations war films in America. // El objetivo de este artículo es analizar el film de Louis de Rochemont, The Ramparts We Watch, en tanto que un esfuerzo de relaciones públicas en tiempos de guerra. Surgido de la estrategia informativa y propagandística de los noticiarios de la segunda mitad de los años 30, este documental se realizó mediante el uso de técnicas narrativas muy adecuadas para conseguir la dimensión de objetividad y veracidad que debe caracterizar los mensajes de relaciones públicas, sin perder de vista su función educativa y persuasiva. Desde ese punto de vista, The Ramparts We Watch adquirió un carácter fundacional y constituyó uno de los más claros precedentes de los filmes de relaciones públicas realizados en Estados Unidos, en el contexto de la guerra.

  11. Small scale irregularities in Comet Halley's plasma mantle - An attempt at self-consistent analysis of plasma and magnetic field data

    Science.gov (United States)

    Vaisberg, O. L.; Russell, C. T.; Luhmann, J. G.; Schwingenschuh, K.

    1989-01-01

    VEGA-1 measurements of the plasma density and magnetic field in the coma of Comet Halley show characteristic signatures over a significant portion of the outbound pass. It is found that the assumption that there is a balance between the thermal and magnetic pressures in these features can be used to obtain estimates of the plasma temperature as a function of distance from the nucleus. These estimates indicate that the ions cool from about 1.5 x 10 to the 6th K at 10 to the 5th km to 2 x 10 to the 5th K at 5 x 10 to the 4th km. The technique used here represents a novel approach whereby temperature measurements can be made in situations where only plasma density and magnetic field data are available.

  12. Watching television for more than two hours increases the likelihood of reporting poor sleep quality among Brazilian schoolteachers.

    Science.gov (United States)

    de Souza, Sara Carolina Scremin; Campanini, Marcela Zambrim; de Andrade, Selma Maffei; González, Alberto Durán; de Melo, Juliana Moura; Mesas, Arthur Eumann

    2017-10-01

    Although time spent watching television and sleep problems have increased in the last few decades, it is unclear whether these conditions are associated in working adults after controlling for lifestyle, job characteristics and other individual aspects. The present study analyzed the association between time spent watching television and sleep quality among teachers from public schools in Londrina, Brazil. In this cross-sectional study, information from the Pittsburgh Sleep Quality Index (PSQI) and about time spent watching television was obtained during personal interviews. Logistic regression models adjusted by the main confounders (sociodemographic, occupational and lifestyle variables) were used in the analyses. Among the 959 studied teachers (68.2% women, median age: 42years), teachers who watched >120min/day had a higher likelihood of reporting poor sleep quality (PSQI>5) (odds ratio=1.41; 95% confidence interval=1.01; 1.98) compared with those who watched television for up to 60min/day, regardless of gender, age, work hours, leisure time physical activity and other lifestyle variables. This association did not remain significant after the adjustment for health conditions, i.e., obesity, anxiety, depression and chronic pain, which may act as confounding variables in the relationship between watching television and poor sleep quality. Watching television for >120min/day was independently associated with poorer sleep quality, which should be considered in the prevention and treatment of sleep disturbances among working population. Copyright © 2017 Elsevier Inc. All rights reserved.

  13. Safety evaluation of interim stabilization of non-stabilized single-shell watch list tanks

    International Nuclear Information System (INIS)

    Stahl, S.M.

    1994-01-01

    This report provides results of a review of recently completed safety analyses related to hazards associated with Interim Stabilization of Single analyses related to hazards included oh the Hanford Site Waste Tank-Watch Shell Tanks (SSTs) that are included on the Hanford List. The purpose of the review was to identify and summarize conclusions regarding the safety of interim stabilization of Watch List SSTs, and to highlight applicable limitations, restrictions, and controls. The scope of this review was restricted to SSTs identified List in the categories of flammable gas ferrocyanide, and organic salts. High heat tanks were not included in the scope. A Watch List tank is defined as an underground storage tank containing waste that requires special safety precautions because it may have a serious potential for release of high level radioactive waste because of uncontrolled increases in temperature or pressure. Special restrictions have been placed on these tanks

  14. Conference report. Women's perspectives: keeping a close watch.

    Science.gov (United States)

    Datta, B

    1994-01-01

    Most individuals in the women's movement are happy with the accomplishments of the 1994 International Conference on Population and Development (ICPD). Activists were able to introduce feminist discourse into world governments and have a term like "gender equality" used as freely as "mother's milk." Some women, however, critique that the conference will do little to empower women in any real sense. Whatever the long-term effects, it is clear that women and women's groups were required to put aside their confrontational politics and adopt a more organized, collaborative approach. The Women's Caucus at Cairo created Women Watching ICPD, a group to monitor if governments, donors, and service providers follow through with the commitments they made at the conference. Six nongovernmental organizations (NGO) from the North and South have already agreed to participate in the task force. The group promises to ensure an end to coercion and to make certain that positive recommendations are implemented. It will watch budgets, allocation processes, and decision makers, and try to ensure that NGOs monitoring international financial institutions make gender efforts central to their efforts.

  15. [Association between hours of television watched, physical activity, sleep and excess weight among young adults].

    Science.gov (United States)

    Martínez-Moyá, María; Navarrete-Muñoz, Eva M; García de la Hera, Manuela; Giménez-Monzo, Daniel; González-Palacios, Sandra; Valera-Gran, Desirée; Sempere-Orts, María; Vioque, Jesús

    2014-01-01

    To explore the association between excess weight or body mass index (BMI) and the time spent watching television, self-reported physical activity and sleep duration in a young adult population. We analyzed cross-sectional baseline data of 1,135 participants (17-35 years old) from the project Dieta, salud y antropometría en población universitaria (Diet, Health and Anthrompmetric Variables in Univeristy Students). Information about time spent watching television, sleep duration, self-reported physical activity and self-reported height and weight was provided by a baseline questionnaire. BMI was calculated as kg/m(2) and excess of weight was defined as ≥25. We used multiple logistic regression to explore the association between excess weight (no/yes) and independent variables, and multiple linear regression for BMI. The prevalence of excess weight was 13.7% (11.2% were overweight and 2.5% were obese). A significant positive association was found between excess weight and a greater amount of time spent watching television. Participants who reported watching television >2h a day had a higher risk of excess weight than those who watched television ≤1h a day (OR=2.13; 95%CI: 1.37-3.36; p-trend: 0.002). A lower level of physical activity was associated with an increased risk of excess weight, although the association was statistically significant only in multiple linear regression (p=0.037). No association was observed with sleep duration. A greater number of hours spent watching television and lower physical activity were significantly associated with a higher BMI in young adults. Both factors are potentially modifiable with preventive strategies. Copyright © 2013 SESPAS. Published by Elsevier Espana. All rights reserved.

  16. Effects of Watching Eyes and Norm Cues on Charitable Giving in a Surreptitious Behavioral Experiment

    Directory of Open Access Journals (Sweden)

    Moe Fathi

    2014-04-01

    Full Text Available A series of experimental studies by multiple groups of researchers have found that displaying images of watching eyes causes people to behave more prosocially. It is not yet clear whether watching eyes increase prosocial motivation per se, or whether they simply make people's behavior more normative. Here, we report results from a surreptitious behavioral experiment examining the impacts of watching eye images and cues to local norms on charitable donations in a controlled setting. Eye images significantly increased average donations. Eye images did not make people conform more closely to the apparent norm overall. Instead, there were different patterns according to the apparent norm. For an apparent norm of small donations, eye images made many participants more generous than the norm. For an apparent norm of large donations, there was an excess of participants giving zero in the no-eyes treatment, which was abolished in the eyes treatment. Our results can be explained by a combination of watching eyes increasing prosocial motivation and reluctance to leave a donation visibly less generous than the norm.

  17. Dicty_cDB: AFL667 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nnsg ggeksgknfeiklklkllknqetgliefesdkffpidtnnnltlsiptnsiksykdsdgk ihnyhfclkfnnklyfngtnlneefirftgdddvlcfh***isy--- ---xxxxxxsxxxxxxxxx...xxxgdxfxxx*xmxx*xxvxxxxw*i*snrvxqxnvmvnvx xvfvxixxalxkixnsvpkn*mimixxifll*skywl*gin...*lsflfki***iif*wykfk*rvy*ihw***cfmfslmin*ll--- ---xxxxxixxxxxxxxxxxxrrxxxxxxxxxxmxxsvxxxxvnlkq*gxxmxcxgkcxx

  18. Attitudes of Consumers from Podgorica toward Advertising through Sport among the Frequency of Watching Sports Events

    Directory of Open Access Journals (Sweden)

    Nikola Milovic

    2018-04-01

    Full Text Available This investigation was aimed at gaining relevant knowledge about the attitudes of Podgorica consumers toward advertising through sport among. The sample included 330 students from Faculty of Economics in Podgorica, divided into six subsample groups: consumers, who do not watch sports events at all, then consumers who watch sports events 1-30 minutes, next 31-60 minutes, 61-90 minutes, 91-120 minutes, as well as consumers who watch sports events more than 120 minutes during the typical day. The sample of variables contained the system of three general attitudes which were modelled by seven-point Likert scale. The results of the measuring were analyzed by multivariate analysis (MANOVA and univariate analysis (ANOVA and Post Hoc test. Based on the statistical analyses it was found that significant differences occur at multivariate level, as well as between all three variables at a significance level of p=.00. Hence, it is interesting to highlight that it was found there are significant differences showed up between the attitudes of consumers toward advertising through sport among the frequency of watching sports events. The significant differences were found in two of three variables, while the consumers who do not watch sports events had much more negative attitudes toward advertising though sport.

  19. The Effects of the H abits of Children and Teenagers Watching Matches on Television to the Violence Actions at Sport

    Directory of Open Access Journals (Sweden)

    Erdal ÇETİN

    2015-07-01

    Full Text Available The technologies developed in media and communication areas have played an important role in commercialization (industrialization of sport and especially football. While television channels which are visual elements of media, create great economic incomes for clubs in industrialized sports, they tired to meet the great numbers that they invested in sport with ciphered broadcast. Ciphered broadcast which settled in Turkey as of 1990 both changed the sports broadcast and create important changes on sport spectators. Individuals ,according to their income distribution s and residence stiuations, started to watch the contests via making payment whether in the stadiums or at home and public watch places such as coffee houses/cafes/cake shops . Public watch places especially such as coffee houses/cafes/cake shops both prov ide economic cycle and constitute a new culture. The aim of this study is to present whether the habits of children and teenagers’ watching contests are effective in displaying pathological (abnormal, violence, criminal attitudes or not. In this study, th e viewpoints of individuals, who watch the matches in public watch places such as coffee houses/cafes/cake shops and home atmosphere and are in different ages, genders and have different incomes, towards their own teams, rivals and referees are tried to be found out. For this, a questionnaire consists of 24 questions was applied to the 110 female students and 206 male students who are between 13 - 19 years old and reside in Batman. The datas obtained from the questionnaire study were analyzed with SPSS 21.0 p rogram. It was seen that the children and teenagers who took part in the study sample have a positive perception as to fanaticism. % 65,5 of females, and % 68 of males pointed out that they regard themselves as fanatic. % 27,8 of individulas declared that they watch all the contests on TV, % 56 of them declared that they watch some of the contests and % 16,1 of them declared

  20. Presence While Watching Movies

    Directory of Open Access Journals (Sweden)

    Tom Troscianko

    2011-05-01

    Full Text Available “Presence” is the illusion of being in a mediated experience rather than simply being an observer. It is a concept often applied to the question of realism of virtual environments. However, it is equally applicable to the act of watching a movie. A movie provides a markedly different visual environment to that given by the natural world—particularly because of frequent edits. And yet, the audience in a movie achieves high levels of presence. We investigate the relationship between presence and the optical and temporal parameters of movies. We find effects of mean shot length, colour/b&w, and 3D/2D. We find that short shots, while being unnatural, are associated with high levels of presence. We consider why such artificial stimuli should appear so real and immersive.

  1. The Data Platform for Climate Research and Action: Introducing Climate Watch

    Science.gov (United States)

    Hennig, R. J.; Ge, M.; Friedrich, J.; Lebling, K.; Carlock, G.; Arcipowska, A.; Mangan, E.; Biru, H.; Tankou, A.; Chaudhury, M.

    2017-12-01

    The Paris Agreement, adopted through Decision 1/CP.21, brings all nations together to take on ambitious efforts to combat climate change. Open access to climate data supporting climate research, advancing knowledge, and informing decision making is key to encourage and strengthen efforts of stakeholders at all levels to address and respond to effects of climate change. Climate Watch is a robust online data platform developed in response to the urgent needs of knowledge and tools to empower climate research and action, including those of researchers, policy makers, the private sector, civil society, and all other non-state actors. Building on the rapid growing technology of open data and information sharing, Climate Watch is equipped with extensive amount of climate data, informative visualizations, concise yet efficient user interface, and connection to resources users need to gather insightful information on national and global progress towards delivering on the objective of the Convention and the Paris Agreement. Climate Watch brings together hundreds of quantitative and qualitative indicators for easy explore, visualize, compare, download at global, national, and sectoral levels: Greenhouse gas (GHG) emissions for more than 190 countries over the1850-2014 time period, covering all seven Kyoto Gases following IPCC source/sink categories; Structured information on over 150 NDCs facilitating the clarity, understanding and transparency of countries' contributions to address climate change; Over 6500 identified linkages between climate actions in NDCs across the 169 targets of the sustainable development goals (SDG); Over 200 indicators describing low carbon pathways from models and scenarios by integrated assessment models (IAMs) and national sources; and Data on vulnerability and risk, policies, finance, and many more. Climate Watch platform is developed as part of the broader efforts within the World Resources Institute, the NDC Partnership, and in collaboration

  2. Dance on cortex: enhanced theta synchrony in experts when watching a dance piece.

    Science.gov (United States)

    Poikonen, Hanna; Toiviainen, Petri; Tervaniemi, Mari

    2018-03-01

    When watching performing arts, a wide and complex network of brain processes emerge. These processes can be shaped by professional expertise. When compared to laymen, dancers have enhanced processes in observation of short dance movement and listening to music. But how do the cortical processes differ in musicians and dancers when watching an audio-visual dance performance? In our study, we presented the participants long excerpts from the contemporary dance choreography of Carmen. During multimodal movement of a dancer, theta phase synchrony over the fronto-central electrodes was stronger in dancers when compared to musicians and laymen. In addition, alpha synchrony was decreased in all groups during large rapid movement when compared to nearly motionless parts of the choreography. Our results suggest an enhanced cortical communication in dancers when watching dance and, further, that this enhancement is rather related to multimodal, cognitive and emotional processes than to simple observation of dance movement. © 2018 Federation of European Neuroscience Societies and John Wiley & Sons Ltd.

  3. Astronaut Pedro Duque Watches A Water Bubble

    Science.gov (United States)

    2003-01-01

    Aboard the International Space Station (ISS), European Space Agency astronaut Pedro Duque of Spain watches a water bubble float between a camera and himself. The bubble shows his reflection (reversed). Duque was launched aboard a Russian Soyuz TMA-3 spacecraft from the Baikonur Cosmodrome, Kazakhstan on October 18th, along with expedition-8 crew members Michael C. Foale, Mission Commander and NASA ISS Science Officer, and Cosmonaut Alexander Y. Kaleri, Soyuz Commander and flight engineer.

  4. Correlation between Inter-Blink Interval and Episodic Encoding during Movie Watching

    Science.gov (United States)

    Shin, Young Seok; Chang, Won-du; Park, Jinsick; Im, Chang-Hwan; Lee, Sang In; Kim, In Young; Jang, Dong Pyo

    2015-01-01

    Human eye blinking is cognitively suppressed to minimize loss of visual information for important real-world events. Despite the relationship between eye blinking and cognitive state, the effect of eye blinks on cognition in real-world environments has received limited research attention. In this study, we focused on the temporal pattern of inter-eye blink interval (IEBI) during movie watching and investigated its relationship with episodic memory. As a control condition, 24 healthy subjects watched a nature documentary that lacked a specific story line while electroencephalography was performed. Immediately after viewing the movie, the subjects were asked to report its most memorable scene. Four weeks later, subjects were asked to score 32 randomly selected scenes from the movie, based on how much they were able to remember and describe. The results showed that the average IEBI was significantly longer during the movie than in the control condition. In addition, the significant increase in IEBI when watching a movie coincided with the most memorable scenes of the movie. The results suggested that the interesting episodic narrative of the movie attracted the subjects’ visual attention relative to the documentary clip that did not have a story line. In the episodic memory test executed four weeks later, memory performance was significantly positively correlated with IEBI (pmovie. PMID:26529091

  5. Social Media Influence and Intensity of Watching Television Drama on Achievement of Students

    OpenAIRE

    Ali Akbar Himawan; Basori Basori; Taufiq Lilo Adi Sucipto

    2017-01-01

    The aims of this study are to get: (1) the influence of the social media use on achievement of students; (2) the influence of the watching television drama intensity on achievement of students grade X TKJ in SMK Batik 1 Surakarta; and (3) the influence both of social media use and the watching television drama intensity on achievement of students. The sample used was 78 from 100 student population based on Isaac and Michael table. This study was quantitative research using ex post facto metho...

  6. Towards the problem ChAES alienation zone residing conditions for watch-shift personal

    International Nuclear Information System (INIS)

    Akimenko, V.Ya.; Yanko, N.M.; Semashko, P.V.; Yarygin, A.V.

    1994-01-01

    The article deals with some results of hygienic study concerning watch-shift workers residing condition in the ChAES 30-km zone. The evaluation is given for residing environment prioritative living parameters, air ventilation, hostels inhabiting conditions, the acoustic regime. Some indoor environment aerosol pollution levels different kind domestic activity a revealed. Electrostatic air cleaning installing as devices of radioactive smalldispers aerosol control a studied. Some tasks of further research are substantiated in order of watch-shift workers residing environment optimization in the alienation zone

  7. Dicty_cDB: VSJ452 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lkth*haqlllvitkri*pk*fhlml hqvntlvtllspiktmlkspvlmliltckrik*nkik*khtix* Frame C: ik*neiiisp...ydrndsi*csir* ihw*rcyhrskqc*nrly*c*y*lvne*nkik*nkntpsinyl*ikkk--- ---ik*neiiisplfrscfsfpifhpslvklwyccr*ipnyq

  8. Watch-Dog: Detecting Self-Harming Activities From Wrist Worn Accelerometers.

    Science.gov (United States)

    Bharti, Pratool; Panwar, Anurag; Gopalakrishna, Ganesh; Chellappan, Sriram

    2018-05-01

    In a 2012 survey, in the United States alone, there were more than 35 000 reported suicides with approximately 1800 of being psychiatric inpatients. Recent Centers for Disease Control and Prevention (CDC) reports indicate an upward trend in these numbers. In psychiatric facilities, staff perform intermittent or continuous observation of patients manually in order to prevent such tragedies, but studies show that they are insufficient, and also consume staff time and resources. In this paper, we present the Watch-Dog system, to address the problem of detecting self-harming activities when attempted by in-patients in clinical settings. Watch-Dog comprises of three key components-Data sensed by tiny accelerometer sensors worn on wrists of subjects; an efficient algorithm to classify whether a user is active versus dormant (i.e., performing a physical activity versus not performing any activity); and a novel decision selection algorithm based on random forests and continuity indices for fine grained activity classification. With data acquired from 11 subjects performing a series of activities (both self-harming and otherwise), Watch-Dog achieves a classification accuracy of , , and for same-user 10-fold cross-validation, cross-user 10-fold cross-validation, and cross-user leave-one-out evaluation, respectively. We believe that the problem addressed in this paper is practical, important, and timely. We also believe that our proposed system is practically deployable, and related discussions are provided in this paper.

  9. Heterogeneity in time and energy use of watching television

    International Nuclear Information System (INIS)

    Sekar, Ashok; Williams, Eric; Chen, Roger

    2016-01-01

    There is substantial variability in residential energy use, partly driven by heterogeneous behavioral patterns. Time-use is relevant to energy when consumption tracks the time a device is used. Cluster analysis is a promising approach to identify time-use patterns. If clusters with particularly long time use and thus high energy consumption emerge, these groups could merit targeted policy intervention. We investigate these ideas via an empirical study of time use for television watching in the U.S. Three clusters were identified. In 2013, the average time spent watching television by Clusters 1, 2 and 3 are dramatically different: 1.1, 3.5 and 7.7 h per day respectively. While members of Cluster 3 are only 14% of the total population they represent 34% of TV energy consumption. The population of Cluster 3 tends to be older, less employed and less educated. Energy savings per adopter is much larger for Cluster 3, suggesting much higher benefits from efficient devices. These results are relevant to the design of efficiency programs, indicating potential for variable rebates and/or tiered communication. With variable rebates, utilities would offer higher incentives to high-use customers. In tiered communication, utilities would devote more resources to engage customers with larger savings potential. - Highlights: •Utility and other efficiency programs often treat consumers as homogenous groups. •Heterogeneity in consumer behavior affects benefits/costs of efficiency upgrade. •Significant heterogeneity is found in U.S. television watching patterns. •Heavy watchers (7.7 h/day) are 14% of population but consume 34% of energy. •Energy savings of efficient television for heavy watcher is 3 times the average.

  10. Attitudes of Montenegrin Consumers Toward Advertising Through Sport Among the Frequency of Watching Sports Events

    Directory of Open Access Journals (Sweden)

    Bojan Masanovic

    2018-01-01

    Full Text Available It is proposed that potential consumers form attitudes based on advertising through sport can influence decisions to purchase a particular advertiser’s product. From this reason, it is important to analyse their general attitudes toward advertising through sport among various questions, and this investigation was aimed at gaining relevant knowledge about the attitudes of Montenegrin consumers toward advertising through sport among. The sample included 342 respondents, divided into six subsample groups: consumers, who do not watch sports events at all, then consumers who watch sports events 1-30 minutes, next 31-60 minutes, 61-90 minutes, 91-120 minutes, as well as consumers who watch sports events more than 120 minutes during the typical day. The sample of variables contained the system of three general attitudes which were modelled by seven-point Likert scale. The results of the measuring were analysed by multivariate analysis (MANOVA and univariate analysis (ANOVA and Post Hoc test. Based on the statistical analyses it was found that significant differences occur at multivariate level, as well as between all three variables at a significance level of p=.00. Hence, it is interesting to highlight that it was found there are significant differences showed up between the attitudes of consumers toward advertising through sport among the frequency of watching sports events. These results are so important for the marketers, mostly due to the reason they can’t merge all the potential consumers regarding the frequency they watch the sports events. On the other hand, this is the case in previous investigations and this observation presents relevant information.

  11. Young low-income ethnic minority children watch less television when their mothers regulate what they are viewing.

    Science.gov (United States)

    Thompson, Darcy A; Vandewater, Elizabeth A; Matson, Pamela A; Tschann, Jeanne M

    2015-03-01

    Parenting practices can reduce how much television (TV) children watch. This study evaluated the longitudinal association between maternal regulation of TV content and the amount of TV watched by low-income ethnic minority children. This was a secondary data analysis of the Welfare, Children & Families: A Three City Study. Data were used from ethnic minority mothers with a child from birth to 4 years old, collected over two waves approximately 16 months apart. The dependent variable was the amount of TV watched by the child (wave two). The main independent variable was the maternal regulation of TV content (wave one). Using multiple linear regression, we evaluated the relationship between maternal regulation of TV content and the amount of TV watched by the child, adjusting for covariates. Of the 835 mothers, 71% were high content regulators and 8% reported no content regulation. Children whose mothers reported no regulation watched more TV approximately 16 months later than those whose mothers reported high regulation of content (β = 0.91, 95% CI: 0.09-1.73). Our findings suggest that regulating content influences viewing amounts in young children approximately 16 months later. Interventions focused on heightening parental regulation of content may improve content and diminish viewing amounts. ©2014 Foundation Acta Paediatrica. Published by John Wiley & Sons Ltd.

  12. Watch Out for Children: A Mothers' Statement to Advertisers.

    Science.gov (United States)

    Institute for American Values, New York, NY.

    This report explains that all adults must watch out for all children, cautioning that marketing is harmful to children. Advertisers are aggressively targeting age groups that, until recently, have been considered off-limits and occupying more of children's psychic and physical space. The report presents a commitment by mothers to all children to…

  13. Association of sleep quality with watching TV, computer games and caffeine intake in adolescents of Minoodar district, Qazvin

    Directory of Open Access Journals (Sweden)

    A. Avani

    2015-12-01

    Full Text Available Background: Insufficient sleep or poor sleep quality affect learning, memory and performance and cause behavioral disorders. Watching television (TV, using computer and internet, playing computer games, and caffeine intake are of factors affecting sleep quality. Objective: The aim of this study was to determine the association of sleep quality with watching TV, computer games and caffeine intake in adolescents of Minoodar district, Qazvin41T. Methods: This cross sectional study was conducted in 319 adolescents (10 to 18 years old that were selected by multistage cluster random sampling method during 2010-2011. Demographic data and data on duration of playing computer games and watching TV were collected. Food frequency questionnaire and BEARS questionnaire were completed. Data were analyzed using Chi-square test, logistic regression analysis and ANOVA. Findings:Mean age was15±2.43 years41T. Of 319 adolescents, 162 (50.8% were female41T. The duration of watching TV or video41T was not significantly different41T between boys and girls. The duration of playing computer or video games41T was statistically different41T between boys and girls. There was no correlation between sleep quality and duration of watching TV or videos in a day, duration of playing computer or video games in a day, and caffeine intake in adolescents. Conclusions: With regards to the results, it seems that there is no association between sleep quality and watching TV, playing computer games and caffeine intake.

  14. Neighborhood Environmental Watch Network

    International Nuclear Information System (INIS)

    Sanders, L.D.

    1993-01-01

    The Neighborhood Environmental Watch Network (NEWNET) is a regional network of environmental monitoring stations and a data archival center that supports collaboration between communities, industry, and government agencies to solve environmental problems. The stations provide local displays of measurements for the public and transmit measurements via satellite to a central site for archival and analysis. Station managers are selected from the local community and trained to support the stations. Archived data and analysis tools are available to researchers, educational institutions, industrial collaborators, and the public across the nation through a communications network. Los Alamos National Laboratory and the Environmental Protection Agency have developed a NEWNET pilot program for the Department of Energy. The pilot program supports monitoring stations in Nevada, Arizona, Utah, Wyoming, and California. Additional stations are being placed in Colorado and New Mexico. Pilot stations take radiological and meteorological measurements. Other measurements are possible by exchanging sensors

  15. Seagrass-Watch: Engaging Torres Strait Islanders in marine habitat monitoring

    Science.gov (United States)

    Mellors, Jane E.; McKenzie, Len J.; Coles, Robert G.

    2008-09-01

    Involvement in scientifically structured habitat monitoring is a relatively new concept to the peoples of Torres Strait. The approach we used was to focus on awareness, and to build the capacity of groups to participate using Seagrass-Watch as the vehicle to provide education and training in monitoring marine ecosystems. The project successfully delivered quality scientifically rigorous baseline information on the seasonality of seagrasses in the Torres Strait—a first for this region. Eight seagrass species were identified across the monitoring sites. Seagrass cover varied within and between years. Preliminary evidence indicated that drivers for seagrass variability were climate related. Generally, seagrass abundance increased during the north-west monsoon ( Kuki), possibly a consequence of elevated nutrients, lower tidal exposure times, less wind, and higher air temperatures. Low seagrass abundance coincided with the presence of greater winds and longer periods of exposure at low tides during the south-east trade wind season ( Sager). No seasonal patterns were apparent when frequency of disturbance from high sedimentation and human impacts was high. Seagrass-Watch has been incorporated in to the Thursday Island High School's Marine Studies Unit ensuring continuity of monitoring. The students, teachers, and other interested individuals involved in Seagrass-Watch have mastered the necessary scientific procedures to monitor seagrass meadows, and developed skills in coordinating a monitoring program and skills in mentoring younger students. This has increased the participants' self-esteem and confidence, and given them an insight into how they may participate in the future management of their sea country.

  16. MHD waves detected by ice at distances > 28 x 106 km from Comet Halley: Cometary or solar wind origin

    International Nuclear Information System (INIS)

    Tsurutani, B.T.; Brinca, A.L.; Smith, E.J.; Thorne, R.M.; Scarf, F.L.; Gosling, J.T.; Ipavich, F.M.

    1986-01-01

    Spectral analyses of the high resolution magnetic field data are employed to determine if there is evidence of cometary heavy ion pickup when ICE was closest to Halley, ∼28 x 10 6 km. No evidence is found for the presence of heavy ion cyclotron waves. However, from this search, two new wave modes are discovered in the solar wind: electromagnetic ion cyclotron waves and drift mirror mode waves. Both modes have scales of 10 to 60 s (1 to 6 T/sub p/) in the spacecraft frame. The possibility of wave generation by cometary hydrogen pickup is explored. Theoretical arguments and further experimental evidence indicates that cometary origin is improbable. The most likely source is plasma instabilities associated with solar wind stream-stream interactions. VLF electrostatic emissions are found to occur in field minima or at gradients of the drift mirror structures. Possible generation mechanisms of drift mirror mode waves, cyclotron waves and electrostatic waves are discussed

  17. Attitudes of Turkish Consumers toward Advertising through Sport among the Frequency of Watching Sports Events

    Directory of Open Access Journals (Sweden)

    Bojan Masanovic

    2017-08-01

    Full Text Available It is proposed that potential consumers form attitudes based on advertising through sport can influence decisions to purchase a particular advertiser’s product. From this reason, it is important to analyse their general attitudes toward advertising through sport among various questions, and this investigation was aimed at gaining relevant knowledge about the attitudes of Serbian consumers toward advertising through sport among. The sample included 173 respondents, divided into six subsample groups: consumers, who do not watch sports events at all, then consumers who watch sports events 1-30 minutes, next 31-60 minutes, 61-90 minutes, 91-120 minutes, as well as consumers who watch sports events more than 120 minutes during the typical day. The sample of variables contained the system of three general attitudes which were modelled by seven-point Likert scale. The results of the measuring were analysed by multivariate analysis (MANOVA and univariate analysis (ANOVA and Post Hoc test. Based on the statistical analyses it was found that significant differences occur at multivariate level, as well as between two out of three variables at a significance level of p=.05. Hence, it is interesting to highlight that it was found there are significant differences showed up between the attitudes of consumers toward advertising through sport among the frequency of watching sports events. These results are so important for the marketers, mostly due to the reason they can’t merge all the potential consumers regarding the frequency they watch the sports events. On the other hand, this is the case in previous investigations and this observation presents relevant information.

  18. AVHRR CoastWatch Regional Data, November 2003 - present (NODC Accession 0099041)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The mapped data derived from AVHRR (Advanced High Resolution Radiometer) onboard NOAA and Metop satellites is divided into files for CoastWatch regions of interest....

  19. Study on Motives of University Students for Watching Sport Events (Sırnak Province Case Study

    Directory of Open Access Journals (Sweden)

    Hanifi ÜZÜM

    2014-07-01

    Full Text Available This case study has been conducted to determine the factors influencing motives of university students in Sirnak on watching sport events. The sampling group includes 73 females and 107 males, totally 180 students. External motivations scale for sport spectators (EMSSS and internal motivations scale for sport spectators (IMSSS developed by Polat and Yalçın (2014 were used as a data collection tool for this study. (EMSSS consists of totally 34 articles and 9 sub - dimensions, which are defined as Social Sharing , Popularity and Actuality, Family Bonds, Promotion and Media, Ethics, Opportunities for Betting, Knowledge, Cultural Development, and Esthetic Values (IMSSS consists of 40 articles and 7 sub - dimensions, whic h are described as National Sentiments, Passion for the Sport, Quality and Sense of Competition, Fanship, Regional Loyalty, Success and Level of Skill, Relaxation and Reducing Stress . T - test, Pearson's correlation analysis and one - way analysis of varianc e test were applied for the analysis of survey data. According to the survey findings; it is possible to say that factors such as gender, active sportsmanship, the most watched sport branch, age, the amount of expenses for watching competitions etc. can in fluence motives for watching sport events.

  20. Watching TV has a distinct sociodemographic and lifestyle profile compared with other sedentary behaviors: A nationwide population-based study.

    Directory of Open Access Journals (Sweden)

    Elena Andrade-Gómez

    Full Text Available Watching TV has been consistently associated with higher risk of adverse health outcomes, but the effect of other sedentary behaviors (SB is uncertain. Potential explanations are that watching TV is not a marker of a broader sedentary pattern and that each SB reflects different sociodemographic and health characteristics. Data were taken form a survey on 10,199 individuals, representative of the Spanish population aged ≥18 years. SB and other health behaviors were ascertained using validated questionnaires. Watching TV was the predominant SB (45.4% of the total sitting time, followed by sitting at the computer (22.7%. TV watching time showed no correlation with total time on other SB (r: -0.02, p = 0.07. By contrast, time spent at the computer was directly correlated with time spent on commuting (r: 0.07, p<0.01, listening to music (r: 0.10, p<0.01 and reading (r: 0.08, p<0.01. TV watching time was greater in those with older age, lower education, unhealthier lifestyle, and with diabetes or osteomuscular disease. More time spent at the computer or in commuting was linked to younger age, male gender, higher education and having a sedentary job. In conclusion, watching TV is not correlated with other SB and shows a distinct demographic and lifestyle profile.

  1. Short-Duration X-ray Transients Observed with WATCH on Granat

    DEFF Research Database (Denmark)

    Castro-Tirado, Alberto J.; Brandt, Søren; Lund, Niels

    1995-01-01

    During 1990–92, the WATCH all-sky X-ray monitor on GRANAT has discovered 6 short-duration X-ray transients. We discuss their possible relationship to peculiar stars. Only one source, GRS 1100-77 seems to be related to a T Tauri star....

  2. 'Mussel Watch' and chemical contamination of the coasts by polycyclic aromatic hydrocarbons

    International Nuclear Information System (INIS)

    Farrington, J.W.

    1999-01-01

    Polycyclic aromatic hydrocarbons (PAH) enter the coastal marine environment from three general categories of sources; pyrogenic, petrogenic (or petroleum), and natural diagenesis. PAH from different sources appear to have differential biological availability related to how the PAH are sorbed, trapped, or chemically bound to particulate matter, including soot. Experience to date with bivalve sentinel organism, or 'Mussel Watch', monitoring programs indicates that these programs can provide a reasonable general assessment of the status and trends of biologically available PAH in coastal ecosystems. As fossil fuel use increases in developing countries, it is important that programs such as the International Mussel Watch Program provide assessments of the status and trends of PAH contamination of coastal ecosystems of these countries. (author)

  3. Reading Books and Watching Films as a Protective Factor against Suicidal Ideation.

    Science.gov (United States)

    Kasahara-Kiritani, Mami; Hadlaczky, Gergö; Westerlund, Michael; Carli, Vladimir; Wasserman, Camilla; Apter, Alan; Balazs, Judit; Bobes, Julio; Brunner, Romuald; McMahon, Elaine M; Cosman, Doina; Farkas, Luca; Haring, Christian; Kaess, Michael; Kahn, Jean-Pierre; Keeley, Helen; Nemes, Bogdan; Mars Bitenc, Urša; Postuvan, Vita; Saiz, Pilar; Sisask, Merike; Värnik, Airi; Sarchiapone, Marco; Hoven, Christina W; Wasserman, Danuta

    2015-12-15

    Reading books and watching films were investigated as protective factors for serious suicidal ideation (SSI) in young people with low perceived social belonging. Cross-sectional and longitudinal (12-month) analyses were performed using data from a representative European sample of 3256 students from the "Saving and Empowering Young Lives in Europe" study. Low social belonging was associated to SSI. However, reading books and watching films moderated this association, especially for those with lowest levels of belonging. This was true both at baseline and at 12 months of follow-up analyses. These media may act as sources of social support or mental health literacy and thus reduce the suicide risk constituted by low sense of belonging.

  4. Reading Books and Watching Films as a Protective Factor against Suicidal Ideation

    Directory of Open Access Journals (Sweden)

    Mami Kasahara-Kiritani

    2015-12-01

    Full Text Available Reading books and watching films were investigated as protective factors for serious suicidal ideation (SSI in young people with low perceived social belonging. Cross-sectional and longitudinal (12-month analyses were performed using data from a representative European sample of 3256 students from the “Saving and Empowering Young Lives in Europe” study. Low social belonging was associated to SSI. However, reading books and watching films moderated this association, especially for those with lowest levels of belonging. This was true both at baseline and at 12 months of follow-up analyses. These media may act as sources of social support or mental health literacy and thus reduce the suicide risk constituted by low sense of belonging.

  5. MedWatch, the FDA Safety Information and Adverse Event Reporting Program

    Science.gov (United States)

    ... Reporting Program MedWatch: The FDA Safety Information and Adverse Event Reporting Program Share Tweet Linkedin Pin it ... approved information that can help patients avoid serious adverse events. Potential Signals of Serious Risks/New Safety ...

  6. Aid/Watch and the Public Benefit of Advocacy for the Extra-territorial Relief of Poverty

    OpenAIRE

    David Barnden; Giri Sivaraman

    2011-01-01

    The disqualification of Aid/Watch as a charity and the High Court of Australia's subsequent decision shines a spotlight on the common law definition of charitable activity. The Aid/Watch decision enables charitable organisations to legitimately advocate for more efficient implementation of government policies on the relief of poverty and for the advancement of education and religion, without fear of reprisal. Initially we comment on the inherent tension the Australian Taxation Office e...

  7. Recreational valuation of whale watching safaris, a case study from the Andøy region

    OpenAIRE

    Robertsen, Liv Tone Olsen

    2014-01-01

    Due to increased activity level along the Norwegian coast and ocean, there is an increasing need of estimating the non-market values from potentially affected marine ecosystem services. One activity that might be impacted from marine activities and regulations is whale watching. The demand of whale watching has increased rapidly the past decades, and generates remarkable economic and recreational benefits to the society. The recreational benefits are not directly obtained through the market p...

  8. Associations between children's diet quality and watching television during meal or snack consumption: A systematic review.

    Science.gov (United States)

    Avery, Amanda; Anderson, Catherine; McCullough, Fiona

    2017-10-01

    Studies have identified an association between watching television (TV) and childhood obesity. This review adds context to existing research by examining the associations between TV viewing, whilst eating, and children's diet quality. Web of Science and PubMed databases were searched from January 2000 to June 2014. Cross-sectional trials of case control or cohort studies, which included baseline data, measuring the associations between eating whilst watching TV and children's food and drink intake. Quality of selected papers was assessed. Thirteen studies, representing 61,674 children aged 1-18 yrs, met inclusion criteria. Of six studies reporting overall food habits, all found a positive association between TV viewing and consumption of pizza, fried foods, sweets, and snacks. Of eight studies looking at fruit and vegetable consumption, seven identified a negative association with eating whilst watching TV (p consumption of sugar-sweetened beverages and high-fat, high-sugar foods and fewer fruits and vegetables. Although these differences in consumption are small, the cumulative effect may contribute to the positive association between eating whilst watching TV and childhood obesity. © 2017 John Wiley & Sons Ltd.

  9. Psychosocial and Patient Education Needs of Prostate Cancers Selecting Watchful Waiting

    National Research Council Canada - National Science Library

    Knight, Sara J; Latini, David M

    2006-01-01

    ... of this approach to disease management. We propose to gather data from prostate cancer patients selecting watchful waiting in lieu of an active treatment for their cancer in order to understand the psychosocial and symptom management...

  10. Comparison of WATCH and IPN Locations of Gamma-Ray Bursts

    DEFF Research Database (Denmark)

    Hurley, K.; Lund, Niels; Brandt, Søren

    1994-01-01

    The WATCH all sky monitors aboard the Granat and EURECA spacecraft have the capability of independently localizing gamma‐ray bursts to error circles whose 3 sigma radii are 1 degree or less. These are the most accurate single‐experiment localizations currently achievable. In those cases where bot...

  11. Investigating the Free-Body Diagram of a Stationary Object on an Inclined Plane Using Apple Watch

    Science.gov (United States)

    Dilek, Ufuk; Çaliskan, Serap

    2017-01-01

    In this study, we present an activity in which the free-body diagram of a real stationary object on an inclined plane can be examined interactively. We use an Apple Watch and a few other materials that can be accessed easily. Instead of an Apple Watch, a mobile phone or a tablet could also be used. This activity may be employed to introduce the…

  12. Validity and Reliability of the Apple Watch for Measuring\\ud Heart Rate During Exercise

    OpenAIRE

    Khushhal, Alaa; Nichols, Simon; Evans, Will; Gleadall-Siddall, Damien; Page, Richard; O'Doherty, Alasdair; Carroll, Sean; Ingle, Lee; Abt, Grant

    2017-01-01

    We examined the validity and reliability of the Apple Watch heart rate sensor during and in recovery from exercise. Twentyone males completed treadmill exercise while wearing two Apple Watches (left and right wrists) and a Polar S810i monitor (criterion). Exercise involved 5-min bouts of walking, jogging, and running at speeds of 4 km.h − 1, 7 km.h − 1, and 10 km.h − 1, followed by 11 min of rest between bouts. At all exercise intensities the mean bias was trivial. There were very good correl...

  13. Aid/Watch and the Public Benefit of Advocacy for the Extra-territorial Relief of Poverty

    Directory of Open Access Journals (Sweden)

    David Barnden

    2011-11-01

    Full Text Available The disqualification of Aid/Watch as a charity and the High Court of Australia's subsequent decision shines a spotlight on the common law definition of charitable activity. The Aid/Watch decision enables charitable organisations to legitimately advocate for more efficient implementation of government policies on the relief of poverty and for the advancement of education and religion, without fear of reprisal. Initially we comment on the inherent tension the Australian Taxation Office experiences as a result of its status as a government department, its responsibilities to administer revenue collection and its role interpreting charity law. We then discuss the common law definition of charity and the Constitutional basis for the High Court’s decision in Aid/Watch. To conclude we outline areas of uncertainties but also potential benefits to charitable organisations which are relevant for any proposal to define ‘charitable organisation’.

  14. “Veillant Panoptic Assemblage”: Mutual Watching and Resistance to Mass Surveillance after Snowden

    Directory of Open Access Journals (Sweden)

    Vian Bakir

    2015-10-01

    Full Text Available The Snowden leaks indicate the extent, nature, and means of contemporary mass digital surveillance of citizens by their intelligence agencies and the role of public oversight mechanisms in holding intelligence agencies to account. As such, they form a rich case study on the interactions of “veillance” (mutual watching involving citizens, journalists, intelligence agencies and corporations. While Surveillance Studies, Intelligence Studies and Journalism Studies have little to say on surveillance of citizens’ data by intelligence agencies (and complicit surveillant corporations, they offer insights into the role of citizens and the press in holding power, and specifically the political-intelligence elite, to account. Attention to such public oversight mechanisms facilitates critical interrogation of issues of surveillant power, resistance and intelligence accountability. It directs attention to the veillant panoptic assemblage (an arrangement of profoundly unequal mutual watching, where citizens’ watching of self and others is, through corporate channels of data flow, fed back into state surveillance of citizens. Finally, it enables evaluation of post-Snowden steps taken towards achieving an equiveillant panoptic assemblage (where, alongside state and corporate surveillance of citizens, the intelligence-power elite, to ensure its accountability, faces robust scrutiny and action from wider civil society.

  15. Presidential Debate Watching, Issue Knowledge, Character Evaluation, and Vote Choice

    Science.gov (United States)

    Benoit, William L.; Hansen, Glenn J.

    2004-01-01

    This study employs NES (National Election Survey) data from several presidential elections to investigate the effects of presidential debate watching on voters' issue knowledge, character evaluation, and vote choice. Debates can instill issue knowledge; however, voters are less likely to learn about incumbent presidents seeking re-election after a…

  16. Watching TV has a distinct sociodemographic and lifestyle profile compared with other sedentary behaviors: A nationwide population-based study.

    Science.gov (United States)

    Andrade-Gómez, Elena; García-Esquinas, Esther; Ortolá, Rosario; Martínez-Gómez, David; Rodríguez-Artalejo, Fernando

    2017-01-01

    Watching TV has been consistently associated with higher risk of adverse health outcomes, but the effect of other sedentary behaviors (SB) is uncertain. Potential explanations are that watching TV is not a marker of a broader sedentary pattern and that each SB reflects different sociodemographic and health characteristics. Data were taken form a survey on 10,199 individuals, representative of the Spanish population aged ≥18 years. SB and other health behaviors were ascertained using validated questionnaires. Watching TV was the predominant SB (45.4% of the total sitting time), followed by sitting at the computer (22.7%). TV watching time showed no correlation with total time on other SB (r: -0.02, p = 0.07). By contrast, time spent at the computer was directly correlated with time spent on commuting (r: 0.07, pmusic (r: 0.10, peducation, unhealthier lifestyle, and with diabetes or osteomuscular disease. More time spent at the computer or in commuting was linked to younger age, male gender, higher education and having a sedentary job. In conclusion, watching TV is not correlated with other SB and shows a distinct demographic and lifestyle profile.

  17. Are we in Sync? Synchronization Requirements for Watching Online Video Together

    NARCIS (Netherlands)

    D. Geerts (David); I. Vaishnavi (Ishan); R.N. Mekuria (Rufael); M.O. van Deventer (Oskar); P.S. Cesar Garcia (Pablo Santiago)

    2011-01-01

    htmlabstractSynchronization between locations is an important factor for enabling remote shared experiences. Still, experimental data on what is the acceptable synchronization level is scarce. This paper discusses the synchronization requirements for watching online videos together - a popular set

  18. A Smart Tool for the Diagnosis of Parkinsonian Syndromes using Wireless Watches

    Directory of Open Access Journals (Sweden)

    Andreas Goll

    2014-11-01

    Full Text Available Early detection and diagnosis of Parkinson disease will provide a good chance for patients to take early actions and prevent its further development. In this paper, a smart tool for the diagnosis of Parkinsonian syndromes is designed and developed using low–cost Texas Instruments eZ430-Chronos wireless watches. With this smart tool, Parkinson Bradykinesia is detected based on the cycle of a human gait, with the watch worn on the foot, and Parkinson Tremor shaking is detected and differed by frequency 0 to 8 Hz on the arm in real-time with a developed statistical diagnosis chart. It can be used in small clinics as well as home environment due to its low-cost and easy-use property.

  19. Television watching and incident diabetes: Findings from the European Prospective Investigation into Cancer and Nutrition-Potsdam Study.

    Science.gov (United States)

    Ford, Earl S; Schulze, Matthias B; Kröger, Janine; Pischon, Tobias; Bergmann, Manuela M; Boeing, Heiner

    2010-03-01

    The aim of the present study was to examine whether the amount of time spent watching television is a potential risk factor for incident diabetes and to what extent this association may be explained by obesity. We used data for 23,855 men and women from the European Prospective Investigation into Cancer and Nutrition-Potsdam Study. During an average of 7.8 years of follow-up, 927 participants developed diabetes. Incident diabetes was identified on the basis of self-report and was verified by contacting the patient's attending physician. The amount of time spent watching television was self-reported. The mean time that the participants who developed diabetes watched television was 2.4 h/week, compared with 2.0 h/week for those who did not develop diabetes (Pday of television compared with those who watched day was 1.63 [95% confidence interval (CI): 1.17-2.27]. After additional adjustment for waist circumference and body mass index, the hazard ratio was reduced to 1.14 (95% CI: 0.81-1.61). In the present study, the amount of time spent watching television was an independent predictor of incident diabetes only in models that adjusted for sociodemographic characteristics, lifestyle behaviors, and systolic blood pressure. The attenuation of the association after adjusting for anthropometric measures may represent an explanatory mechanism for our findings. Published 2010. This article is a US Government work and is in the public domain in the USA.

  20. Do medical students watch video clips in eLearning and do these facilitate learning?

    Science.gov (United States)

    Romanov, Kalle; Nevgi, Anne

    2007-06-01

    There is controversial evidence of the impact of individual learning style on students' performance in computer-aided learning. We assessed the association between the use of multimedia materials, such as video clips, and collaborative communication tools with learning outcome among medical students. One hundred and twenty-one third-year medical students attended a course in medical informatics (0.7 credits) consisting of lectures, small group sessions and eLearning material. The eLearning material contained six learning modules with integrated video clips and collaborative learning tools in WebCT. Learning outcome was measured with a course exam. Approximately two-thirds of students (68.6%) viewed two or more videos. Female students were significantly more active video-watchers. No significant associations were found between video-watching and self-test scores or the time used in eLearning. Video-watchers were more active in WebCT; they loaded more pages and more actively participated in discussion forums. Video-watching was associated with a better course grade. Students who watched video clips were more active in using collaborative eLearning tools and achieved higher course grades.

  1. Optical Follow-Up of Gamma-Ray Bursts Observed by WATCH

    DEFF Research Database (Denmark)

    Castro-Tirado, A.; Brandt, Søren; Lund, Niels

    1994-01-01

    44 Gamma‐Ray Bursts have been localized by the WATCH experiments on GRANAT and EURECA. For some of them, Schmidt plates were taken within days after the burst. In other cases, time‐correlated plates were found in some of the main astronomical archives. No obvious optical counterpart has been found...

  2. High-dose chemoradiotherapy and watchful waiting for distal rectal cancer

    DEFF Research Database (Denmark)

    Appelt, Ane L; Pløen, John; Harling, Henrik

    2015-01-01

    -dose radiotherapy with concomitant chemotherapy followed by observation (watchful waiting) was successful for non-surgical management of low rectal cancer. METHODS: Patients with primary, resectable, T2 or T3, N0-N1 adenocarcinoma in the lower 6 cm of the rectum were given chemoradiotherapy (60 Gy in 30 fractions...

  3. In-situ observations of a bi-modal ion distribution in the outer coma of comet P/Halley

    Science.gov (United States)

    Thomsen, M. F.; Feldman, W. C.; Wilken, B.; Jockers, K.; Stuedemann, W.

    1987-01-01

    Observations obtained by the Johnstone Plasma Analyzer on the Giotto fly-by of comet Halley showed a fairly sudden decrease in the count rate of energetic (about 30 KeV) water-group ions inside about 500,000 km from the nucleus. This decrease was accompanied by the appearance of a new water-group ion population at slightly lower energies (less than 10 KeV). Close inspection reveals that this lower-energy peak was also present somewhat earlier in the postshock flow but only became prominent near the sudden transition just described. It is shown that the observed bimodal ion distribution is well explained in terms of the velocity history of the accreting solar wind flow in the outer coma. The decline in count rate of the energetic pick-up distribution is due to a relatively sudden slowing of the bulk flow there and not to a loss of particles. Hence, charge-exchange cooling of the flow is probably not important at these distances from the nucleus. The observations suggest that pitch-angle scattering is fairly efficient at least after the bow shock, but that energy diffusion is probably not very efficient.

  4. 3 keys to defeating unconscious bias watch, think, act

    CERN Document Server

    Thiederman, Sondra

    2015-01-01

    Have you ever had a biased thought? If the answer is “yes,” join the club. Everybody has biases and, although that doesn’t make us bad people, it does mean we compromise our ability to get along with people who are different from us. The good news is, there’s a lot we can do to defeat bias. Calling on Dr. Sondra Thiederman’s twenty-five years of experience in the diversity/inclusion field, the book lays out an innovative WATCH, THINK, ACT strategy that each of us can immediately apply to the task. Easy-to-read and filled with anecdotes and activities, 3 Keys shows the reader: • How to WATCH their thoughts, experiences, and actions to identify unconscious biases and target them for extinction. • How to THINK in such a way as to weaken and control our biases. • How to ACT to defeat our biases and cultivate the kind of common ground that we know to be inhospitable to the survival of bias. Designed to motivate real change, the answer to defeating our biases is in these pages. The rest is up to you...

  5. Current National Weather Service Watches, Warnings, or Advisories for the United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The National Weather Service (NWS) Storm Prediction Center uses RSS feeds to disseminate all watches, warnings and advisories for the United States that are...

  6. Observations of cosmic gamma ray bursts with WATCH on EURECA

    DEFF Research Database (Denmark)

    Brandt, Søren; Lund, N.; Castro-Tirado, A. J.

    1995-01-01

    19 Cosmic Gamma-Ray Bursts were detected by the WATCH wide field X-ray monitor during the 11 months flight of EURECA. The identification of the bursts were complicated by a high frequency of background of events caused by high energy cosmic ray interactions in the detector and by low energy, trap...

  7. What men and women think while watching the news: An exploration

    NARCIS (Netherlands)

    Hendriks Vettehen, P.G.J.; Schaap, G.J.; Schlösser, S.

    2004-01-01

    This study addresses gender differences in television news processing. Male and female subjects were asked to verbalize their thoughts while they watched an edited television newscast. The authors use an interpretive procedure to analyze both the newscast's content and protocols of the thoughts

  8. Radio-Observaciones del OH EN la Coma del Cometa Halley Desde EL Hemisferio Sur

    Science.gov (United States)

    Silva, A. M.; Bajaja, E.; Morras, R.; Cersosimo, J. C.; Martin, M. C.; Arnal, E. M.; Poppel, W. G. L.; Colomb, F. R.; Mazzaro, J.; Olalde, J. C.; Boriakoff, V.; Mirabel, I. F.

    1987-05-01

    Se utilizó una antena de 30 metros del Instituto Argentino de Radioastronomía para observaciones diarias Cf ebrero a abril de 1986) de la transición en 1667 MHz ( λ = 18 cm) del OH en la coma del cometa Halley. De las observaciones realizadas se concluye: 1) El número promedio de moléculas de OH en la coma durante 37 días de observación fue de (8.9±3.5)x1034 moléculas, lo que implica una tasa de producción promedio de OH de 1.8x1029 moléculas seg-1 y consecuentemente una pérdida de masa promedio de 17±6 toneladas seg-1 . Este valor está de acuerdo con las mediciones realizadas por las sondas Vega y Giotto. 2) El monitoreo desde el lAR revela la existencia de variaciones bruscas en los flujos de absorción del OH. Estas variaciones son consistentes con los modelos que representan la producción gaseosa a partir de ejecciones y/o desprendimientos discretos de materia congelada del núcleo. 3) Las variaciones en la densidad de flujo son consistentes con las estimaciones de los tiem- pos de vida medios del H2O y del OH en presencia del campo de radiación solar. 4) Se encuentra una correlación entre la intensidad del flujo absorbido y anisotropías en Ia dinamica de la coma.

  9. Foreign-grammar acquisition while watching subtitled television programmes.

    Science.gov (United States)

    Van Lommel, Sven; Laenen, Annouschka; d'Ydewalle, Géry

    2006-06-01

    Past research has shown that watching a subtitled foreign movie (i.e. foreign language in the soundtrack and native language in the subtitles) leads to considerable foreign-language vocabulary acquisition; however, acquisition of the grammatical rules has failed to emerge. The aim of this study was to obtain evidence for the acquisition of grammatical rules in watching subtitled foreign movies. Given an informal context, younger children were predicted to outperform older children in acquiring a foreign language; however, older children will take more advantage of explicit instruction compared with younger children. In Experiment 1, 62 sixth-graders from a primary school and 47 sixth-graders from a secondary school volunteered to participate. The participants in Experiment 2 were 94 sixth-graders from primary schools and 84 sixth-graders from secondary schools. The two experiments manipulated the instructions (incidental- vs. intentional-language learning). Moreover, before the experiments began, some participants explicitly received some of the foreign grammatical rules (presented rules), while the movie contained cases of presented rules as well as cases of rules which had to be inferred (not-presented rules). Rule acquisition through the movie only was not obtained; there was a strong effect of advance rule presentation but only on the items of presented rules, particularly among the older participants. Contrary to vocabulary, grammar may be too complicated to acquire from a rather short movie presentation.

  10. Quality of Life in Rectal Cancer Patients After Chemoradiation: Watch-and-Wait Policy Versus Standard Resection - A Matched-Controlled Study.

    Science.gov (United States)

    Hupkens, Britt J P; Martens, Milou H; Stoot, Jan H; Berbee, Maaike; Melenhorst, Jarno; Beets-Tan, Regina G; Beets, Geerard L; Breukink, Stéphanie O

    2017-10-01

    Fifteen to twenty percent of patients with locally advanced rectal cancer have a clinical complete response after chemoradiation therapy. These patients can be offered nonoperative organ-preserving treatment, the so-called watch-and-wait policy. The main goal of this watch-and-wait policy is an anticipated improved quality of life and functional outcome in comparison with a total mesorectal excision, while maintaining a good oncological outcome. The aim of this study was to compare the quality of life of watch-and-wait patients with a matched-controlled group of patients who underwent chemoradiation and surgery (total mesorectal excision group). This was a matched controlled study. This study was conducted at multiple centers. The study population consisted of 2 groups: 41 patients after a watch-and-wait policy and 41 matched patients after chemoradiation and surgery. Patients were matched on sex, age, tumor stage, and tumor height. All patients were disease free at the moment of recruitment after a minimal follow-up of 2 years. Quality of life was measured by validated questionnaires covering general quality of life (Short Form 36, European Organization for Research and Treatment of Cancer QLQ-C30), disease-specific total mesorectal excision (European Organization for Research and Treatment of Cancer QLQ-CR38), defecation problems (Vaizey and low anterior resection syndrome scores), sexual problems (International Index of Erectile Function and Female Sexual Function Index), and urinary dysfunction (International Prostate Symptom Score). The watch-and-wait group showed better physical and cognitive function, better physical and emotional roles, and better global health status compared with the total mesorectal excision group. The watch-and-wait patients showed fewer problems with defecation and sexual and urinary tract function. This study only focused on watch-and-wait patients who achieved a sustained complete response for 2 years. In addition, this is a study

  11. Television watching, leisure time physical activity, and the genetic predisposition in relation to body mass index in women and men.

    Science.gov (United States)

    Qi, Qibin; Li, Yanping; Chomistek, Andrea K; Kang, Jae H; Curhan, Gary C; Pasquale, Louis R; Willett, Walter C; Rimm, Eric B; Hu, Frank B; Qi, Lu

    2012-10-09

    Previous studies on gene-lifestyle interaction and obesity have focused mostly on the FTO gene and physical activity, whereas little attention has been paid to sedentary behavior as indicated by television (TV) watching. We analyzed interactions between TV watching, leisure time physical activity, and genetic predisposition in relation to body mass index (BMI) in 7740 women and 4564 men from 2 prospective cohorts: The Nurses' Health Study and the Health Professionals Follow-up Study. Data on physical activity and TV watching were collected 2 years before assessment of BMI. A weighted genetic risk score was calculated on the basis of 32 established BMI-associated variants. In both women and men, the genetic associations with BMI strengthened with increased hours of TV watching. An increment of 10 points in the weighted genetic risk score was associated with 0.8 (SE, 0.4), 0.8 (SE, 0.2), 1.4 (SE, 0.2), 1.5 (SE, 0.2), and 3.4 (SE, 1.0) kg/m(2) higher BMI across the 5 categories of TV watching (0-1, 2-5, 6-20, 21-40, and >40 h/wk; P for interaction=0.001). In contrast, the genetic association with BMI weakened with increased levels of physical activity. An increment of 10 points in the weighted genetic risk score was associated with 1.5 (SE, 0.2), 1.3 (SE, 0.2), 1.2 (SE, 0.2), 1.2 (SE, 0.2), and 0.8 (SE, 0.2) kg/m(2) higher BMI across the quintiles of physical activity. The interactions of TV watching and physical activity with genetic predisposition in relation to BMI were independent of each other. A sedentary lifestyle, indicated by prolonged TV watching, may accentuate the predisposition to elevated adiposity, whereas greater leisure time physical activity may attenuate the genetic association.

  12. Comparative evaluation of heart rate-based monitors: Apple Watch vs Fitbit Charge HR.

    Science.gov (United States)

    Bai, Yang; Hibbing, Paul; Mantis, Constantine; Welk, Gregory J

    2018-08-01

    The purpose of this investigation was to examine the validity of energy expenditure (EE), steps, and heart rate measured with the Apple Watch 1 and Fitbit Charge HR. Thirty-nine healthy adults wore the two monitors while completing a semi-structured activity protocol consisting of 20 minutes of sedentary activity, 25 minutes of aerobic exercise, and 25 minutes of light intensity physical activity. Criterion measures were obtained from an Oxycon Mobile for EE, a pedometer for steps, and a Polar heart rate strap worn on the chest for heart rate. For estimating whole-trial EE, the mean absolute percent error (MAPE) from Fitbit Charge HR (32.9%) was more than twice that of Apple Watch 1 (15.2%). This trend was consistent for the individual conditions. Both monitors accurately assessed steps during aerobic activity (MAPE Apple : 6.2%; MAPE Fitbit : 9.4%) but overestimated steps in light physical activity. For heart rate, Fitbit Charge HR produced its smallest MAPE in sedentary behaviors (7.2%), followed by aerobic exercise (8.4%), and light activity (10.1%). The Apple Watch 1 had stronger validity than the Fitbit Charge HR for assessing overall EE and steps during aerobic exercise. The Fitbit Charge HR provided heart rate estimates that were statistically equivalent to Polar monitor.

  13. Investigating the free-body diagram of a stationary object on an inclined plane using Apple Watch

    Science.gov (United States)

    Dilek, Ufuk; Çalışkan, Serap

    2017-11-01

    In this study, we present an activity in which the free-body diagram of a real stationary object on an inclined plane can be examined interactively. We use an Apple Watch and a few other materials that can be accessed easily. Instead of an Apple Watch, a mobile phone or a tablet could also be used. This activity may be employed to introduce the fundamental concepts associated with free-body diagrams in classroom settings, or adapted to physics labs.

  14. Connoisseurship as a Substitute for User Research? The Case of the Swiss Watch Industry

    Directory of Open Access Journals (Sweden)

    Matthew Sinclair

    2015-12-01

    Full Text Available Conventional wisdom holds that new product development is more successfully undertaken when design is user-led. An exception is the luxury goods sector, in which a common presentation of the brand is one where the customer should aspire to the vision of its designers. In such cases, the proprietor is often cast as a connoisseur, an expert in the brand’s history who is intuitively able to give vision and direction. Within the Swiss luxury watch industry, heritage and the illusion of exclusivity are vital strategies in the communication of products as luxury items. Connoisseurship plays a central role in this communication, establishing the boundaries of brands whose products might otherwise appear similar. In such cases, connoisseurship is presented to the customer as superior to user research, engendering products with a sophistication which customer insights cannot provide. Nonetheless, whilst conventional user research methods play little part in the design of Swiss watches, less formal methods are employed. These are shown to also have application in non-luxury sectors too. The utilization of strategies employed by the Swiss watch industry in future scenarios of new product development is also discussed.

  15. Gamma-ray bursts observed by the watch experiment

    DEFF Research Database (Denmark)

    Lund, Niels; Brandt, Søren; Castro-Tirado, A. J.

    1991-01-01

    After two years in orbit the WATCH instruments on the GRANAT space observatory have localized seven gamma burst sources with better than 1° accuracy. In several cases, follow‐up observations with Schmidt telescopes have been made within a few days. Some of the bursts have also been detected...... by the distant space probes PVO and ULYSSES and there are, therefore, good prospects for obtaining much improved positions using the burst arrival times. The existence of the almost concurrent Schmidt plates could then become particularly interesting....

  16. ATTITUDES OF SERBIAN CONSUMERS TOWARD ADVERTISING THROUGH SPORT WITH REGARD TO THE FREQUENCY OF WATCHING SPORTS EVENTS

    Directory of Open Access Journals (Sweden)

    Stevo Popović

    2015-05-01

    Full Text Available It is proposed that potential cosumers form attitudes based on advertising through sport can influence decisions to purchase a particular advertiser’s product (Pyun, 2006. From this reason, it is important to analyse their general attitudes toward advertising through sport among various questions, and this investigation was aimed at gaining relevant knowledge about the attitudes of Serbian consumers toward advertising through sport among. Methods: The sample included 127 respondents, divided into six subsample groups: cconsumers, who do not watch sports events at all, then consumers who watch sports events 1-30 minutes, next 31-60 minutes, 61-90 minutes, 91-120 minutes, as well as consumers who watch sports events more than 120 minutes during the typical day. The sample of variables contained the system of three general attitudes which were modeled by seven-point Likert scale. The results of the measuring were analyzed by multivariate analysis (MANOVA and univariate analysis (ANOVA and Post Hoc test. Results: Based on the statistical analyses it was found that significant differences didn’t occur at multivariate level, as well as between all three variables at a significance level of p=.05. Hence, it is interesting to highlight that it was found there are no significant differences showed up between the attitudes of consumers toward advertising through sport among the frequency of watching sports events. Discussion: These results are so important for the marketers, mostly due to the reason they can merge all the potential consumers regarding the frequency they watch the sports events. On the other hand, this wasn’t the case in previous investigations (Bjelica and Popović, 2011 and this observation presents relevant information.

  17. Structure And Chemistry Of Ion Masses ≤ 40 Amu In The Inner Coma Of Comet HalleyStructure And Chemistry Of Ion Masses ≤ 40 Amu In The Inner Coma Of Comet Halley

    Science.gov (United States)

    Haider, S. A.; Bhardwaj, A.

    In this paper, we have developed a chemical model to study the chemistry of 46 ions (CH5+, SH+, S+, H2S+, NH3OH+, CH3+, HCO+, H2CO+, C2H3+, C3H3+, H3CO+, H2CN+, H3S+, NH3+, CH3OH2+, CH3OH+, NH4+, H3O+, N+, NH+, NH2+, N2+, C2H+, C+, CH2+, CH+, C2N+, C3H+, C2H4+, C2H5+, CO+, O+, H+, C2+, HCN+, OH+, O2+, CHOH2+, HNO+, N2H+, H2O+, CH4+, C2H2+, (H2O)2+, H5O2+ and C3H+) corresponding to masses ≤ 40 amu in the inner coma of comet Halley. The ionization sources included in the model are solar EUV photon, photoelectron and auroral electron of solar wind origin. The production rates, loss rates and mass densities of these ions are calculated using Analytical Yield Spectrum approach and coupled continuity equation controlled by steady state photochemical model, which involves over 600 chemical reactions between ions, neutrals, photons and electrons in the coma. The calculated mass densities are compared with Giotto Ion Mass Spectrometer (IMS) and Neutral Mass Spectrometer (NMS) data at radial distances 1500 km, 3500 km and 6000 km. The nine major peaks at 12, 15, 19, 26, 28, 31, 33, 35, and 39 amu observed in IMS/NMS spectra are reproduced well by model calculation. ^

  18. The energy expenditure of an activity-promoting video game compared to sedentary video games and TV watching.

    Science.gov (United States)

    Mitre, Naim; Foster, Randal C; Lanningham-Foster, Lorraine; Levine, James A

    2011-01-01

    In the present study we investigated the effect of television watching and the use of activity-promoting video games on energy expenditure in obese and lean children. Energy expenditure and physical activity were measured while participants were watching television, playing a video game on a traditional sedentary video game console, and while playing the same video game on an activity-promoting video game console. Energy expenditure was significantly greater than television watching and playing video games on a sedentary video game console when children played the video game on the activity-promoting console. When examining movement with accelerometry, children moved significantly more when playing the video game on the Nintendo Wii console. Activity-promoting video games have shown to increase movement, and be an important tool to raise energy expenditure by 50% when compared to sedentary activities of daily living.

  19. PSA doubling time of prostate carcinoma managed with watchful observation alone

    International Nuclear Information System (INIS)

    Choo, Richard; DeBoer, Gerrit; Klotz, Lawrence; Danjoux, Cyril; Morton, Gerard C.; Rakovitch, Eileen; Fleshner, Neil; Bunting, Peter; Kapusta, Linda; Hruby, George

    2001-01-01

    Purpose: To study prostate-specific antigen (PSA) doubling time of untreated, favorable grade, prostate carcinoma. Methods and Materials: A prospective single-arm cohort study has been in progress to assess the feasibility of a watchful observation protocol with selective delayed intervention using clinical, histologic, or PSA progression as treatment indication in untreated, localized, favorable grade prostate adenocarcinoma (T1b-T2bN0 M0, Gleason Score ≤7, and PSA ≤15 ng/mL). Patients are conservatively managed with watchful observation alone, as long as they do not meet the arbitrarily defined disease progression criteria. Patients are followed regularly and undergo blood tests including PSA at each visit. PSA doubling time (Td) is estimated from a linear regression of ln(PSA) on time, assuming a simple exponential growth model. Results: As of March 2000, 134 patients have been on the study for a minimum of 12 months (median, 24; range, 12-52) and have a median frequency of PSA measurement of 7 times (range, 3-15). Median age is 70 years. Median PSA at enrollment is 6.3 (range, 0.5-14.6). The distribution of Td is as follows: 50 years, 27. The median Td is 5.1 years. In 44 patients (33%), Td is greater than 10 years. There was no correlation between Td and patient age, clinical T stage, Gleason score, or initial PSA level. Conclusion: Td of untreated prostate cancer varies widely. In our cohort, 33% have Td >10 years. Td may be a useful tool to guide treatment intervention for patients managed conservatively with watchful observation alone

  20. Cardiovascular and Energy Requirements of Parents Watching Their Child Compete: A Pilot Mixed-Methods Investigation

    Directory of Open Access Journals (Sweden)

    Marc Lochbaum

    2017-11-01

    Full Text Available Purpose: Researchers have extensively documented the cardiovascular and metabolic demands for sports participation. To date, researchers have ignored the same requirements of competitor’s parents. Hence, our purpose was to document parent cardiovascular and metabolic responses to watching their child compete while also paying particular attention to their thoughts before and after the competition. Achievement Goal Theory (AGT drove interpretation of parent thoughts. Materials: Parents wore a device, made by Firstbeat Technologies, which continuously monitored heart rate. The parents wore the device the night before the competition to be acclimated to the technology and during the event until later in the day. Parents also completed two open-ended questions, one before the tournament and one after the contest. Results: Before the contest, the dad expected that his son won the event (Croatian National Championships for juniors. Conversely, the mother’s expectations centered more on her son’s enjoyment and competing to the best of his abilities. Parents had differing cardiovascular and energy requirement responses to watching their son compete. In addition, post-competition reflections differed as the father expressed disappointment whereas the mother expressed sadness. Conclusions: The data presented are unique and a first in the sports literature. The parents varied in the intensity of their cardiovascular responses and calories burned while watching their son compete. The father’s cardiovascular response over the course of watching was that of an aerobic workout. Whether this pattern is unique or universal are a critical research question. Last, AGT appears relevant when assessing the parent’s expectations.

  1. In situ energetic particle observations at comet Halley recorded by instrumentation aboard the Giotto and Vega 1 missions

    Energy Technology Data Exchange (ETDEWEB)

    McKenna-Lawlor, S.; Daly, P.; Kirsch, E.; Wilken, B.; O' Sullivan, D.; Thompson, A.; Kecskemety, K.; Somogyi, A.; Coates, A.

    1989-04-01

    Three important observations recorded in the energetic particle data secured at Halley's comet during March 1986 are reviewed. These include (a) quasi periodic variations of cometary ion fluxes observed inbound and outbound by both the EPONA instrument aboard Giotto and by the Tunde-M instrument aboard Vega 1. A possible explanation of the results in terms of a spin modulation of the outgassing rate of the nucleus is discussed; (b) by combining the EPONA data with JPA-IIS data it is possible to infer that the ion fluxes measured at encounter by EPONA were of the water group. These particles displayed energies in excess of those attained by the pick-up process acting alone. Comparisons between energy spectra prepared using the composite observational data and, corresponding, theoretically derived plots suggest that, downstream of the shock (inbound), stochastic (second-order-Fermi) acceleration may have contributed to energizing the particles; (c) large fluxes of electrons (E>300keV) and ions (E>3.5 MeV) were unexpectedly recorded by EPONA in the magnetic cavity. The observed enhancements (up to approximately three orders of magnitude) appear to be cometary in origin.

  2. In situ energetic particle observations at comet Halley recorded by instrumentation aboard the Giotto and Vega 1 missions

    International Nuclear Information System (INIS)

    McKenna-Lawlor, S.; Daly, P.; Kirsch, E.; Wilken, B.; O'Sullivan, D.; Thompson, A.; Kecskemety, K.; Somogyi, A.

    1989-01-01

    Three important observations recorded in the energetic particle data secured at Halley's comet during March 1986 are reviewed. These include (a) quasi periodic variations of cometary ion fluxes observed inbound and outbound by both the EPONA instrument aboard Giotto and by the Tunde-M instrument aboard Vega 1. A possible explanation of the results in terms of a spin modulation of the outgassing rate of the nucleus is discussed; (b) by combining the EPONA data with JPA-IIS data it is possible to infer that the ion fluxes measured at encounter by EPONA were of the water group. These particles displayed energies in excess of those attained by the pick-up process acting alone. Comparisons between energy spectra prepared using the composite observational data and, corresponding, theoretically derived plots suggest that, downstream of the shock (inbound), stochastic (second-order-Fermi) acceleration may have contributed to energizing the particles; (c) large fluxes of electrons (E>300keV) and ions (E>3.5 MeV) were unexpectedly recorded by EPONA in the magnetic cavity. The observed enhancements (up to approximately three orders of magnitude) appear to be cometary in origin

  3. Challenges and considerations for the design and production of a purpose-optimized body-worn wrist-watch computer

    Science.gov (United States)

    Narayanaswami, Chandra; Raghunath, Mandayam T.

    2004-09-01

    We outline a collection of technological challenges in the design of wearable computers with a focus on one of the most desirable form-factors, the wrist watch. We describe our experience with building three generations of wrist watch computers. We built these research prototypes as platforms to investigate the fundamental limitations of wearable computing. Results of our investigations are presented in the form of challenges that have been overcome and those that still remain.

  4. Fall Detection Using Commodity Smart Watch and Smart Phone

    OpenAIRE

    Maglogiannis , Ilias; Ioannou , Charalampos; Spyroglou , George; Tsanakas , Panayiotis

    2014-01-01

    Part 3: Social Media and Mobile Applications of AI; International audience; Human motion data captured from wearable devices such as smart watches can be utilized for activity recognition or emergency event detection, especially in the case of elderly or disabled people living independently in their homes. The output of such sensors is data streams that require real-time recognition, especially in emergency situations. This paper presents a novel application that utilizes the low-cost Pebble ...

  5. Children and television watching: a qualitative study of New Zealand parents' perceptions and views.

    Science.gov (United States)

    Dorey, E; Roberts, V; Maddison, R; Meagher-Lundberg, P; Dixon, R; Ni Mhurchu, C

    2010-05-01

    Television (TV) viewing is one of the most pervasive sedentary pursuits among children and adolescents. Research studies have shown that higher TV viewing hours are associated with a number of negative effects such as being overweight and obese, attention and behavioural problems, and impaired academic performance. Most interventions to reduce time spent watching TV have been school-based and little is known about the strategies that families use to control TV watching time. Six focus groups with Māori, Pacific and non-Māori non-Pacific parents were conducted to examine New Zealand parents' perceptions of their children's TV watching. Focus groups explored attitudes towards TV viewing, strategies used to reduce viewing, and opinion on two different electronic monitors that can be used to restrict TV viewing. Focus group discussions were transcribed and a content analysis was conducted. Parents described TV as playing a dominant role in their family's lives, and highlighted several barriers to reducing children's TV viewing, such as parents not willing to reduce their own TV watching, a lack of safe alternatives to TV and the need to use TV as a babysitting tool. Limiting access to TV, making TV viewing a reward and finding alternative activities were current strategies parents employed to limit TV viewing; however, the barriers highlighted by parents make implementing such strategies difficult. Attitudes towards electronic monitor use to reduce TV viewing were mixed, but suggest further investigation of these devices is needed. Electronic devices that restrict the amount and content of TV viewing have some potential to support interventions and merit further investigation. It is imperative for interventions aimed at reducing TV viewing to consider the role TV plays within a family context, ensuring parental perceptions around the benefits and barriers of reducing TV are accounted for.

  6. Learning by watching Vernacular Iñupiaq-Inuit design learning as inspiration for design education

    Directory of Open Access Journals (Sweden)

    Janne Beate Reitan

    2014-12-01

    Full Text Available In this article, I explore a single case of vernacular clothing design — the practice and learning of design for contemporary Iñupiaq-Inuit clothing made by women from Kaktovik in Northern Alaska — and I hope to contribute to a better understanding of design practice and learning in general. Design research has many unexplored areas, and one of these omissions is vernacular design, or folk design. In my opinion, professional and academic design may well have something to learn from vernacular design, although this research is about vernacular learning and about what, why and how the‘making’ discipline of clothing design is learned. This study was based on observations of and interviews with seamstresses and research-by-design, which includes authorial participation in designing and sewing in adherence to Iñupiaq tradition. All of this was recorded on digital video film. The investigation of Iñupiaq-Inuit clothing design indicates that watching was the most common way of learning, a phenomenon I have chosen to call learning-by-watching, a concept that can be seen as a development of both Schön and Wenger’s theories of learning, as influenced by John Dewey’s theory of learning-by-doing. This study will be discussed in connection with design education, from kindergarten to professional studies in higher education, in the forthcoming research project, Design Literacy, the purpose of which is to develop theory to improve design education in both compulsory and academic design education. Consequently, to improve design education in general, a thorough focus on learning-by-watching in communities of practice would make for more reflective practitioners and more sustainable design practices in the long run.Keywords: Vernacular design, clothing design, design thinking, learning-by-watching, learning-bydoing.

  7. Choking under monitoring pressure: being watched by the experimenter reduces executive attention.

    Science.gov (United States)

    Belletier, Clément; Davranche, Karen; Tellier, Idriss S; Dumas, Florence; Vidal, Franck; Hasbroucq, Thierry; Huguet, Pascal

    2015-10-01

    Performing more poorly given one's skill level ("choking") is likely in situations that offer an incentive if a certain outcome is achieved (outcome pressure) or when one is being watched by others-especially when one's performance is being evaluated (monitoring pressure). According to the choking literature, outcome pressure is associated with reduced executive control of attention, whereas monitoring pressure is associated with increased, yet counterproductive, attention to skill processes. Here, we show the first evidence that monitoring pressure-being watched by the experimenter-may lead individuals with higher working memory to choke on a classic measure of executive control-just the task effect thought to result from outcome pressure. Not only does this finding help refine our understanding of the processes underlying choking under monitoring pressure, but it also leads to a new look at classic audience effects, with an important implication for experimental psychology.

  8. Telling a Story from Watching a Movie Potentially Improving Students’ Oral Communication

    Directory of Open Access Journals (Sweden)

    Lia Agustina

    2015-07-01

    Full Text Available Watching a movie in a class has not always been really appreciated by administrators in education since they considered it as something used by teachers when teachers do not have anything better to do. But watching a movie in an appropriate way can be really useful for students since: a. students would learn English in a natural way and associating vocabulary to a context, as presenting vocabulary within a context is important. b. movies are a tool for communication; it is motivated than just doing exercises in students notebooks, c. students are motivated to express ideas and therefore they would feel important as being involve in class, d. moviesoffer a visual context aids, besides verbal language, there is also color, movement, and sound, the class would be livelier. Movie-viewing experiences and it also creates more student-teacher and student-student discussions.

  9. TELLING A STORY FROM WATCHING A MOVIE POTENTIALLY IMPROVING STUDENTS’ ORAL COMMUNICATION

    Directory of Open Access Journals (Sweden)

    Lia Agustina

    2015-01-01

    Full Text Available Watching a movie in a class has not always been really appreciated by administrators in education since they considered it as something used by teachers when teachers do not have anything better to do. But watching a movie in an appropriate way can be really useful for students since: a. students would learn English in a natural way and associating vocabulary to a context, as presenting vocabulary within a context is important. b. movies are a tool for communication; it is motivated than just doing exercises in students notebooks, c. students are motivated to express ideas and therefore they would feel important as being involve in class, d. moviesoffer a visual context aids, besides verbal language, there is also color, movement, and sound, the class would be livelier. Movie-viewing experiences and it also creates more student-teacher and student-student discussions

  10. Deka-keV X-ray observations of solar bursts with WATCH/GRANAT: frequency distributions of burst parameters

    DEFF Research Database (Denmark)

    Crosby, N.; Vilmer, N.; Lund, Niels

    1998-01-01

    be observed as low as 10 keV. A statistical study is performed on the total WATCH solar database and frequency distributions are built on measured X-ray flare parameters. It is also investigated how the properties of these frequency distributions behave when subgroups of events defined by different ranges......Solar flare observations in the deka-keV range are performed by the WATCH experiment on board the GRANAT satellite. The WATCH experiment is presented, including the energy calibration as applied in the present work. The creation of the solar burst catalogue covering two years of observation...... is described and some examples of solar observations are given. The estimated energy releases in the flares presented here are found to extend below the range of hard X-ray flares which were previously studied by ISEE-3 and HXRBS/SMM detectors. The X-ray emitting component cannot be exclusively explained...

  11. How does Australia's largest dolphin-watching industry affect the behaviour of a small and resident population of Indo-Pacific bottlenose dolphins?

    Science.gov (United States)

    Steckenreuter, Andre; Möller, Luciana; Harcourt, Robert

    2012-04-30

    The small, genetically distinct population of Indo-Pacific bottlenose dolphins (Tursiops aduncus) in Port Stephens, New South Wales (NSW), is the target of the largest dolphin-watching industry in Australia and is located within the Port Stephens - Great Lakes Marine Park that was created in 2005. The effects of this industry have been identified as of significant management importance by the Marine Parks Authority NSW. Accordingly, the impact of commercial dolphin-watching boats was investigated from boat-based surveys from August 2008 to August 2009. Presence of dolphin-watching boats altered both the dolphins' behavioural states and activity budgets. Dolphins spent 66.5% less time feeding and 44.2% less time socialising, spent four times more milling, and were never observed to rest in the presence of dolphin-watching boats. Moreover, dolphin groups were more cohesive during dolphin-watching boat encounters and dolphins tended to avoid tour boats. These effects were exacerbated as the number of boats increased and the distance from boats decreased. The rate of approach was high with boats approaching each dolphin group three times per day in winter and six times in summer. Moreover, groups of dolphins with newborns were approached closer than state regulated minimum approach distances in nine out of ten encounters. Globally, dolphin-watching industries frequent small resident groups of coastal dolphins and effects are likely to be similar. We suggest that existing controls are inadequate and that these together with additional regulations be enforced by a regular presence of authorities. We suggest no more than one dolphin-watching boat within 50 m of a group of dolphins, or 100 m if calves are present. Operating times of dolphin-watching boats should be restricted in numbers after 1 pm, i.e., during preferred foraging times for dolphins. Additionally, exclusion zones should be considered to reduce pressure on dolphins undertaking critical activities such as

  12. Technology Watch and Competitive Intelligence: A New Challenge in Education for Information.

    Science.gov (United States)

    Dou, Henri; And Others

    1993-01-01

    Discusses the need for education of information professionals in France to change because of changing needs for scientific, technological, and economic information. The functions of technology watch and competitive intelligence based on an organization's critical success factor are shown to be important. (13 references) (EAM)

  13. Binocular vision and abnormal head posture in children when watching television

    Directory of Open Access Journals (Sweden)

    Di Zhang

    2016-05-01

    Full Text Available AIM: To determine the association between the binocular vision and an abnormal head posture (AHP when watching television (TV in children 7-14y of age. METHODS: Fifty normal children in the normal group and 52 children with an AHP when watching TV in the AHP group were tested for spherical equivalents, far and near fusional convergence (FC and fusional divergence (FD amplitudes, near point of convergence, far and near heterophoria, accommodative convergence/ accommodation ratio and stereoacuity. The values of these tests were compared between the two groups. The independent t test was applied at a confidence level of 95%. RESULTS: The far and near FC amplitudes and far FD amplitudes were lower in the AHP group (the far FC amplitudes: break point 13.6±5.4△, recovery point 8.7±5.4△. The near FC amplitudes: break point 14.5±7.3△, recovery point 10.3±5.1△. The far FD amplitudes: break point 3.9±2.7△, recovery point 2.6±2.3△ compared with those in the normal group (the far FC amplitudes: break point 19.1±6.2△, recovery point 12.4±4.5△. The near FC amplitudes: break point 22.3±8.0△, recovery point 16.1±5.7△. The far FD amplitudes: break point 7.0±2.1△, recovery point 4.6±1.9△. Other tests presented no statistically significant differences. CONCLUSION: An association between the reduced FC and FD amplitudes and the AHP in children when watching TV is proposed in the study. This kind of AHP is considered to be an anomalous manifestation which appears in a part of puerile patients of fusional vergence dysfunction.

  14. Experimental study of the differential effects of playing versus watching violent video games on children's aggressive behavior.

    Science.gov (United States)

    Polman, Hanneke; de Castro, Bram Orobio; van Aken, Marcel A G

    2008-01-01

    There is great concern about the effects of playing violent video games on aggressive behavior. The present experimental study was aimed at investigating the differential effects of actively playing vs. passively watching the same violent video game on subsequent aggressive behavior. Fifty-seven children aged 10-13 either played a violent video game (active violent condition), watched the same violent video game (passive violent condition), or played a non-violent video game (active non-violent condition). Aggression was measured through peer nominations of real-life aggressive incidents during a free play session at school. After the active participation of actually playing the violent video game, boys behaved more aggressively than did the boys in the passive game condition. For girls, game condition was not related to aggression. These findings indicate that, specifically for boys, playing a violent video game should lead to more aggression than watching television violence. Copyright 2007 Wiley-Liss, Inc.

  15. Effects of Watching Primary Debates in the 2000 U.S. Presidential Campaign.

    Science.gov (United States)

    Benoit, William L.; McKinney, Mitchell S.; Stephenson, Michael T.

    2002-01-01

    Reports the results of two studies measuring the effects on undergraduate communication students of watching U.S. presidential primary debates. Concludes that primary debates are capable of influencing both policy and character impressions of the candidates, as well as changing voting intentions and increasing voter confidence. (SG)

  16. Social Media Usage Combined with TV/Video Watching: Opportunities and Associated Challenges

    NARCIS (Netherlands)

    M.A. Montagud Climent (Mario); P.S. Cesar Garcia (Pablo Santiago); F. Boronat (Fernando); D. Marfil (Dani)

    2015-01-01

    htmlabstractThis paper provides an overview of the impact and opportunities provided by Social Media and other social interaction tools when watching TV/video content. The analysis has been conducted from the viewpoints of both individual and shared media experiences between remote users. On the one

  17. Watch This! A Guide to Implementing Video Modeling in the Classroom

    Science.gov (United States)

    Wynkoop, Kaylee Stahr

    2016-01-01

    The video modeling (VM) teaching strategy is one in which a student watches a video of someone performing a specific behavior, skill, or task and is then expected to complete the behavior, skill, or task. This column discusses the variety of ways in which VM has been documented within the literature and supports teacher interest in the strategy by…

  18. Association of sleep quality with watching TV, computer games and caffeine intake in adolescents of Minoodar district, Qazvin

    OpenAIRE

    A. Avani; Sh. Jalilolghadr; A. Barikani; A. Javadi; S. Shabbidar; M. Javadi

    2015-01-01

    Background: Insufficient sleep or poor sleep quality affect learning, memory and performance and cause behavioral disorders. Watching television (TV), using computer and internet, playing computer games, and caffeine intake are of factors affecting sleep quality. Objective: The aim of this study was to determine the association of sleep quality with watching TV, computer games and caffeine intake in adolescents of Minoodar district, Qazvin41T. Methods: This cross sectional study was con...

  19. Associations among physical activity, television watching, and obesity in adult Pima Indians

    DEFF Research Database (Denmark)

    Fitzgerald, S J; Kriska, A M; Pereira, M A

    1997-01-01

    in adult Pima Indians, a population with a high prevalence of obesity. Hours per day of television watched, past-year physical levels (MET-h/wk; leisure and occupational combined) and BMI (kg.m-2) were measured in 2452 men and women subjects 21-59 yr old. In adults between the ages of 21 and 39 yr, TV...... and physical activity levels were negatively correlated (r = -0.11 for men and -0.10 for women). Weaker associations were found between TV and BMI (r = 0.08 for men and 0.04 for women). There were no significant relationships among these variables in older adults (49-59 yr), possibly because of low reported...... levels of physical activity and TV. Multiple linear regression analysis revealed that physical activity and television watching in men and activity in women were significantly related to BMI. These data suggest that increasing activity levels and decreasing the time spent in sedentary behavior...

  20. Safety evaluation of interim stabilization of non-stabilized single-shell watch list tanks

    Energy Technology Data Exchange (ETDEWEB)

    Stahl, S.M.

    1994-12-30

    The report provides a summation of the status of safety issues associated with interim stabilization of Watch List SSTs (organic, ferrocyanide, and flammable gas), as extracted from recent safety analyses, including the Tank Farms Accelerated Safety Analysis efforts.

  1. Safety evaluation of interim stabilization of non-stabilized single-shell watch list tanks

    International Nuclear Information System (INIS)

    Stahl, S.M.

    1994-01-01

    The report provides a summation of the status of safety issues associated with interim stabilization of Watch List SSTs (organic, ferrocyanide, and flammable gas), as extracted from recent safety analyses, including the Tank Farms Accelerated Safety Analysis efforts

  2. Understanding Zora Neale Hurston's Their Eyes Were Watching God

    Directory of Open Access Journals (Sweden)

    Tatjana Vukelić

    2007-12-01

    Full Text Available The work of Zora Neale Hurston, in particular, the novel Their Eyes Were Watching God, has been the object of more than a decade of critical attention. But, in addition to the critical consideration of Hurston's writings, her work has received the level of institutional support necessary for Hurston to enter the American literary mainstream. The article addresses the issue of black women literary tradition and the search for freedom and identity in the white American social and cultural environment.

  3. Wearable technology smart watches to Google Glass for libraries

    CERN Document Server

    Bruno, Tom

    2015-01-01

    Emerging devices are placing powerful computing abilities into the wardrobes of consumers through wearable technology which combines fashion and function in new and exciting ways. The most recognizable of these emerging gadgets is Google Glass. Wearable Technology: Smart Watches to Google Glass for Libraries provides a comprehensive overview of the current wearable technology landscape, the types of devices and functionality available, the benefits and limitations of this type of technology, and how you can make use of it in yo

  4. Brief Report: Just-in-Time Visual Supports to Children with Autism via the Apple Watch:® A Pilot Feasibility Study.

    Science.gov (United States)

    O'Brien, Amanda; Schlosser, Ralf W; Shane, Howard C; Abramson, Jennifer; Allen, Anna A; Flynn, Suzanne; Yu, Christina; Dimery, Katherine

    2016-12-01

    Using augmented input might be an effective means for supplementing spoken language for children with autism who have difficulties following spoken directives. This study aimed to (a) explore whether JIT-delivered scene cues (photos, video clips) via the Apple Watch ® enable children with autism to carry out directives they were unable to implement with speech alone, and (b) test the feasibility of the Apple Watch ® (with a focus on display size). Results indicated that the hierarchical JIT supports enabled five children with autism to carry out the majority of directives. Hence, the relatively small display size of the Apple Watch does not seem to hinder children with autism to glean critical information from visual supports.

  5. Folklore in Zora Neale Hurston's "Their Eyes Were Watching God." [Lesson Plan].

    Science.gov (United States)

    2002

    Zora Neale Hurston's work is lively, lyrical, funny, and poignant, but this consummate literary craftsperson was also a first-rate ethnographer, conducting field work for Franz Boas and for the Works Progress Administration (WPA). "Their Eyes Were Watching God," often acclaimed as Hurston's masterpiece, is perhaps the richest beneficiary…

  6. Country watch. Brazil.

    Science.gov (United States)

    Szterenfeld, C; Lopes, V

    1993-01-01

    A fictional story using publicity-type language was depicted in an AIDS prevention video produced by the Health in Prostitution Project in Rio de Janeiro to support its work with prostitutes. The video was produced through the volunteer efforts of a professional cast and crew who used cultural entertainment codes to raise awareness. Although both established and new actors participated, the cast was comprised of largely famous soap opera and movie artists. This approach was chosen was the understanding that Brazilians watch soap operas 4-5 hours/day and would therefore readily recognize and pay attention to messages conveyed by the protagonists. The video was shot 2 weeks before Carnival when most actors usually rest and received wide media coverage and attention from the public sector. Prostitutes participated in all stages of production, from script-writing to casting to final editing. The video, Venus Fire, describes a pleasure lottery of which the prize is a lucky condom. The video was officially released on World AIDS Day 1992, and broadcast nationwide in January 1993. It was then subsequently aired in public squares and other street worker sites with question-and-answer sessions and public debates among average audience of 200-300 people. Similar health projects elsewhere in Brazil have also show the film with very good audience response. The prostitutes are happy that their profession is being treated with respect, while clients are attracted by the sexy images.

  7. A new paradigm for individual subject language mapping: Movie-watching fMRI

    Science.gov (United States)

    Tie, Yanmei; Rigolo, Laura; Ovalioglu, Aysegul Ozdemir; Olubiyi, Olutayo; Doolin, Kelly L.; Mukundan, Srinivasan; Golby, Alexandra J.

    2015-01-01

    Background Functional MRI (fMRI) based on language tasks has been used in pre-surgical language mapping in patients with lesions in or near putative language areas. However, if the patients have difficulty performing the tasks due to neurological deficits, it leads to unreliable or non-interpretable results. In this study, we investigate the feasibility of using a movie-watching fMRI for language mapping. Methods A 7-min movie clip with contrasting speech and non-speech segments was shown to 22 right-handed healthy subjects. Based on all subjects' language functional regions-of-interest, six language response areas were defined, within which a language response model (LRM) was derived by extracting the main temporal activation profile. Using a leave-one-out procedure, individuals' language areas were identified as the areas that expressed highly correlated temporal responses with the LRM derived from an independent group of subjects. Results Compared with an antonym generation task-based fMRI, the movie-watching fMRI generated language maps with more localized activations in the left frontal language area, larger activations in the left temporoparietal language area, and significant activations in their right-hemisphere homologues. Results of two brain tumor patients' movie-watching fMRI using the LRM derived from the healthy subjects indicated its ability to map putative language areas; while their task-based fMRI maps were less robust and noisier. Conclusions These results suggest that it is feasible to use this novel “task-free” paradigm as a complementary tool for fMRI language mapping when patients cannot perform the tasks. Its deployment in more neurosurgical patients and validation against gold-standard techniques need further investigation. PMID:25962953

  8. Television watching and the emotional impact on social modeling of food intake among children.

    Science.gov (United States)

    Bevelander, Kirsten E; Meiselman, Herbert L; Anschütz, Doeschka J; Engels, Rutger C M E

    2013-04-01

    The main goal of this study was to test whether exposure to happy, neutral, or sad media content influences social modeling effects of (snack) food intake in young children. The study was conducted at 14 Dutch urban and suburban primary schools. The participants (N=112) were asked to watch a movie with a same-sex normal-weight confederate who was instructed to eat either nothing or a standardized amount of snack food (10 chocolate-coated peanuts). The study involved a 3 (movie clips: happy, neutral, and sad)×2 (peer's food intake: no intake versus a standardized intake) between-participants design. A significant interaction between the movie clip condition and intake condition was found (F(2,102)=3.30, P=.04, Cohen's f(2)=.20). Positive as well as negative emotions were found to lead to adjustment to the intake of a peer, as compared to that of children in the neutral movie condition. The findings suggest that children eat more mindlessly when watching an emotional movie and, therefore, respond more automatically to a peer's food intake, whereas children may be less susceptible to a peer's intake while watching a neutral movie. As young children are not in the position to choose their food consumption environment yet, parents and schools should provide consumption settings that limit eating in front of the television. Copyright © 2012 Elsevier Ltd. All rights reserved.

  9. The influence of the gait-related arm swing on elevation gain measured by sport watches

    Directory of Open Access Journals (Sweden)

    Ammann Rahel

    2016-06-01

    Full Text Available The elevation gain is an important contributor to the total workload in endurance sports. The purpose of this study was to evaluate the influence of the arm swing on elevation gain in three sport watches (Garmin® Forerunner 910XT, Polar® RS800CX and Suunto® Ambit2 on a flat 400 m outdoor track. Altogether, a total of 120 repetitions of 1,200 m were performed at self-selected speeds corresponding to strolling, walking, jogging and running. During the assessment two devices of each sport watch, one secured on the hip and one on the wrist, were worn by the participants. A small but significant (effect size = .39; p < .001 influence of the arm swing on elevation was revealed in all sport watches. Elevation indication errors recorded on the wrist were significantly larger than the ones recorded on the hip (4.0-7.4 vs. 1.2-5.7 m per 1,200 m; p < .05. Furthermore, when wearing the devices on the wrist, errors in elevation indication increased when gait speed increased. Users should be aware that wearing the devices on the hip can significantly decrease measurement errors. This might be especially relevant for activities with high dynamics, such as jogging and running.

  10. 76 FR 74788 - Patient Safety Organizations: Voluntary Relinquishment From HealthWatch, Inc.

    Science.gov (United States)

    2011-12-01

    ... DEPARTMENT OF HEALTH AND HUMAN SERVICES Agency for Healthcare Research and Quality Patient Safety... relinquishment from HealthWatch, Inc. of its status as a Patient Safety Organization (PSO). The Patient Safety and Quality Improvement Act of 2005 (Patient Safety Act), Public Law 109-41, 42 U.S.C. 299b-21--b-26...

  11. Prediction of Pathological Complete Response Using Endoscopic Findings and Outcomes of Patients Who Underwent Watchful Waiting After Chemoradiotherapy for Rectal Cancer.

    Science.gov (United States)

    Kawai, Kazushige; Ishihara, Soichiro; Nozawa, Hiroaki; Hata, Keisuke; Kiyomatsu, Tomomichi; Morikawa, Teppei; Fukayama, Masashi; Watanabe, Toshiaki

    2017-04-01

    Nonoperative management for patients with rectal cancer who have achieved a clinical complete response after chemoradiotherapy is becoming increasingly important in recent years. However, the definition of and modality used for patients with clinical complete response differ greatly between institutions, and the role of endoscopic assessment as a nonoperative approach has not been fully investigated. This study aimed to investigate the ability of endoscopic assessments to predict pathological regression of rectal cancer after chemoradiotherapy and the applicability of these assessments for the watchful waiting approach. This was a retrospective comparative study. This study was conducted at a single referral hospital. A total of 198 patients with rectal cancer underwent preoperative endoscopic assessments after chemoradiotherapy. Of them, 186 patients underwent radical surgery with lymph node dissection. The histopathological findings of resected tissues were compared with the preoperative endoscopic findings. Twelve patients refused radical surgery and chose watchful waiting; their outcomes were compared with the outcomes of patients who underwent radical surgery. The endoscopic criteria correlated well with tumor regression grading. The sensitivity and specificity for a pathological complete response were 65.0% to 87.1% and 39.1% to 78.3%. However, endoscopic assessment could not fully discriminate pathological complete responses, and the outcomes of patients who underwent watchful waiting were considerably poorer than the patients who underwent radical surgery. Eventually, 41.7% of the patients who underwent watchful waiting experienced uncontrollable local failure, and many of these occurrences were observed more than 3 years after chemoradiotherapy. The number of the patients treated with the watchful waiting strategy was limited, and the selection was not randomized. Although endoscopic assessment after chemoradiotherapy correlated with pathological response

  12. Watching television or listening to music while exercising failed to affect post-exercise food intake or energy expenditure in male adolescents.

    Science.gov (United States)

    Livock, Holly; Barnes, Joel D; Pouliot, Catherine; LeBlanc, Allana G; Saunders, Travis J; Tremblay, Mark S; Prud'homme, Denis; Chaput, Jean-Philippe

    2018-08-01

    Watching television or listening to music while exercising can serve as motivating factors, making it more pleasant to exercise for some people. However, it is unknown whether these stimuli influence food intake and/or physical activity energy expenditure (PAEE) for the remainder of the day, potentially impacting energy balance and weight control. We examined the effects of watching television or listening to music while exercising on post-exercise energy intake and expenditure. Our study was a randomized crossover design, in which 24 male adolescents (mean age: 14.9 ± 1.1 years) completed three 30-min experimental conditions consisting of walking/jogging on a treadmill at 60% of heart rate reserve while (1) watching television; (2) listening to music; or (3) exercising with no other stimulus (control). An ad libitum lunch was offered immediately after the experimental conditions, and a dietary record was used to assess food intake for the remainder of the day. An Actical accelerometer was used to estimate PAEE until bedtime. The primary outcome measure was post-exercise energy intake and expenditure (kJ). We found that exercising while watching television or listening to music did not significantly affect post-exercise energy intake or energy expenditure. Exercising on a treadmill was found to be significantly more enjoyable while watching television than with no stimulus present. Ratings of perceived exertion were not significantly different between conditions. Overall, our results suggest that watching television or listening to music while exercising does not impact post-exercise energy intake or expenditure in male adolescents, which may have positive implications for adolescents who may need additional motivation to participate in physical activity. Copyright © 2018 Elsevier Ltd. All rights reserved.

  13. Antibodies to watch in 2014.

    Science.gov (United States)

    Reichert, Janice M

    2014-01-01

    Since 2010, mAbs has documented the biopharmaceutical industry's progress in transitioning antibody therapeutics to first Phase 3 clinical studies and regulatory review, and its success at gaining first marketing approvals for antibody-based products. This installment of the "Antibodies to watch" series outlines events anticipated to occur between December 2013 and the end of 2014, including first regulatory actions on marketing applications for vedolizumab, siltuximab, and ramucirumab, as well as the Fc fusion proteins Factor IX-Fc and Factor VIII-Fc; and the submission of first marketing applications for up to five therapeutics (secukinumab, ch14.18, onartuzumab, necitumumab, gevokizumab). Antibody therapeutics in Phase 3 studies are described, with an emphasis on those with study completion dates in 2014, including antibodies targeting interleukin-17a or the interleukin-17a receptor (secukinumab, ixekizumab, brodalumab), proprotein convertase subtilisin/kexin type 9 (alirocumab, evolocumab, bococizumab), and programmed death 1 receptor (lambrolizumab, nivolumab). Five antibodies with US Food and Drug Administration's Breakthrough Therapy designation (obinutuzumab, ofatumumab, lambrolizumab, bimagrumab, daratumumab) are also discussed.

  14. Look who's cooking. Investigating the relationship between watching educational and edutainment TV cooking shows, eating habits and everyday cooking practices among men and women in Belgium.

    Science.gov (United States)

    De Backer, Charlotte J S; Hudders, Liselot

    2016-01-01

    Television (TV) cooking shows have evolved from focusing on educating to focusing on entertaining, as well. At present, educational TV cooking shows focus on the transfer of cooking knowledge and skills, whereas edutainment TV cooking shows focus on entertaining their viewers. Both types of shows are ongoing success stories. However, little is known regarding the shows' links with the cooking and eating habits of their audiences. Therefore, the current study investigates the relationship between watching an educational or edutainment TV cooking show and one's cooking and eating habits. Given public health concerns regarding the decline in cooking behaviors and the simultaneous increase in caloric intake from food outside the home, this study suggests a promising intervention. The results of a cross-sectional survey in Belgium (n = 845) demonstrate that the audiences of educational and edutainment TV cooking shows do not overlap. Although there is little connection between watching specific shows and eating behavior, the connection between watching shows and cooking behaviors varies across gender and age lines. Behaviors also differ depending on whether the viewer is watching an educational or edutainment cooking show. For example, men of all ages appear to cook more often if they watch an educational show. However, only older men (above 38 years) seem to cook more often if they watch an edutainment TV show. The results demonstrate that the relationship between watching TV cooking shows and cooking habits warrants further investigation. Copyright © 2015 Elsevier Ltd. All rights reserved.

  15. Factors associated with body image dissatisfaction in Portuguese adolescents: obesity, sports activity and TV watching

    Directory of Open Access Journals (Sweden)

    Eduarda Maria Rocha Teles de Castro Coelho

    2016-10-01

    Full Text Available This cross-sectional study intended to determine the prevalence of body image dissatisfaction and associated factors in Portuguese adolescents (N=529, 10-18 years, 53.7% male and 46.3% female. The prevalence of body dissatisfaction (estimated through Collins's silhouettes was 58%. Multivariate logistic regression analyses showed that the variables associated were: obesity, watch TV over 2 hours/day and practice sport activities 4 or more days/week. In male, obesity and watch TV over 2 hours/day were related to body dissatisfaction and among female only obesity had statistical significance. It is necessary to considered different public health interventions for men and women in order to reduce this high body image dissatisfaction.   Keywords: Body image, adolescence, gender, obesity, sports activity

  16. Testosterone and cortisol release among Spanish soccer fans watching the 2010 World Cup final.

    Science.gov (United States)

    van der Meij, Leander; Almela, Mercedes; Hidalgo, Vanesa; Villada, Carolina; Ijzerman, Hans; van Lange, Paul A M; Salvador, Alicia

    2012-01-01

    This field study investigated the release of testosterone and cortisol of a vicarious winning experience in Spanish fans watching the finals between Spain and the Netherlands in the 2010 FIFA World Cup Soccer. Spanish fans (n = 50) watched the match with friends or family in a public place or at home and also participated in a control condition. Consistent with hypotheses, results revealed that testosterone and cortisol levels were higher when watching the match than on a control day. However, neither testosterone nor cortisol levels increased after the victory of the Spanish team. Moreover, the increase in testosterone secretion was not related to participants' sex, age or soccer fandom, but the increase in total cortisol secretion during the match was higher among men than among women and among fans that were younger. Also, increases in cortisol secretion were greater to the degree that people were a stronger fan of soccer. Level of fandom further appeared to account for the sex effect, but not for the age effect. Generally, the testosterone data from this study are in line with the challenge hypothesis, as testosterone levels of watchers increased to prepare their organism to defend or enhance their social status. The cortisol data from this study are in line with social self-preservation theory, as higher cortisol secretion among young and greater soccer fans suggests that especially they perceived that a negative outcome of the match would threaten their own social esteem.

  17. Testosterone and cortisol release among Spanish soccer fans watching the 2010 World Cup final.

    Directory of Open Access Journals (Sweden)

    Leander van der Meij

    Full Text Available This field study investigated the release of testosterone and cortisol of a vicarious winning experience in Spanish fans watching the finals between Spain and the Netherlands in the 2010 FIFA World Cup Soccer. Spanish fans (n = 50 watched the match with friends or family in a public place or at home and also participated in a control condition. Consistent with hypotheses, results revealed that testosterone and cortisol levels were higher when watching the match than on a control day. However, neither testosterone nor cortisol levels increased after the victory of the Spanish team. Moreover, the increase in testosterone secretion was not related to participants' sex, age or soccer fandom, but the increase in total cortisol secretion during the match was higher among men than among women and among fans that were younger. Also, increases in cortisol secretion were greater to the degree that people were a stronger fan of soccer. Level of fandom further appeared to account for the sex effect, but not for the age effect. Generally, the testosterone data from this study are in line with the challenge hypothesis, as testosterone levels of watchers increased to prepare their organism to defend or enhance their social status. The cortisol data from this study are in line with social self-preservation theory, as higher cortisol secretion among young and greater soccer fans suggests that especially they perceived that a negative outcome of the match would threaten their own social esteem.

  18. Evaluation of Reading, Writing, and Watching TV Using the Dutch ICF Activity Inventory

    NARCIS (Netherlands)

    Bruijning, J.E.; van Rens, G.H.M.B.; Knol, D.L.; van Nispen, R.M.A.

    2014-01-01

    PURPOSE: To investigate the longitudinal outcomes of rehabilitation (from baseline to 4 and 12 months) at a multidisciplinary rehabilitation center. The three goals (“Reading,” “Writing,” and “Watching TV”) were measured with the Dutch ICF Activity Inventory (D-AI). In addition, outcomes were

  19. 76 FR 66035 - Proposed Information Collection; Comment Request; Application for Insular Watch and Jewelry...

    Science.gov (United States)

    2011-10-25

    ... DEPARTMENT OF COMMERCE International Trade Administration Proposed Information Collection; Comment Request; Application for Insular Watch and Jewelry Program Benefits AGENCY: International Trade Administration. ACTION: Notice. SUMMARY: The Department of Commerce, as part of its continuing effort to reduce...

  20. Association between overweight/obesity and eating habits while watching television among primary-school children in the city of Shiraz, Iran.

    Science.gov (United States)

    Ghobadi, Saeed; Totosy de Zepetnek, Julia O; Hemmatdar, Zeinab; Bellissimo, Nick; Barati, Reza; Ahmadnia, Hoda; Salehi-Marzijarani, Mohammad; Faghih, Shiva

    2018-02-01

    It has been reported that television (TV) viewing is associated with childhood obesity in Western countries. The present study aimed to investigate the relationship between obesity and eating habits while watching TV among primary-school children in the Middle East. Cross-sectional. Children were recruited from primary schools of four educational districts in Shiraz, Iran. Anthropometric indices of mass (kg) and height (m) were measured, and BMI (percentile) was calculated. Demographic characteristics, TV viewing behaviours and physical activity data were collected from parents during face-to-face interviews and a 3d dietary record was completed. Subject Children (n 607) aged 6-10 years. Mean (sd) age of children was 8·16 (1·37) years, of whom 9·1 and 8·4 % were overweight and obese, respectively. Children who spent ≥2 h watching TV on weekdays (OR=1·99; 95 % CI 1·09, 3·60) and weekend days (OR=1·86; 95 % CI 1·01, 3·43) had higher odds of being obese, even after adjusting for physical activity. Children who ate breakfast while watching TV had higher odds of being overweight v. those who did not watch TV while eating breakfast (OR=2·70; 95 % CI 1·02, 7·60). There were no associations between TV viewing during other meals (lunch and dinner) and overweight/obesity. TV viewing for ≥2 h daily increases the risk of being obese in Iranian children aged 6-10 years, independent of physical activity. Further, breakfast consumption while watching TV may increase the risk of overweight/obesity, independent of total TV viewing time.

  1. EnviroAtlas - Bird Watching Recreation Demand by 12-Digit HUC in the Conterminous United States

    Data.gov (United States)

    U.S. Environmental Protection Agency — This EnviroAtlas dataset includes the total number of recreational days per year demanded by people ages 18 and over for bird watching by location in the contiguous...

  2. Canadian children's and youth's pedometer-determined steps/day, parent-reported TV watching time, and overweight/obesity: The CANPLAY Surveillance Study

    OpenAIRE

    Tudor-Locke, Catrine; Craig, Cora L; Cameron, Christine; Griffiths, Joseph M

    2011-01-01

    Abstract Background This study examines associations between pedometer-determined steps/day and parent-reported child's Body Mass Index (BMI) and time typically spent watching television between school and dinner. Methods Young people (aged 5-19 years) were recruited through their parents by random digit dialling and mailed a data collection package. Information on height and weight and time spent watching television between school and dinner on a typical school day was collected from parents...

  3. Occurrence and removal of organic micropollutants: An overview of the watch list of EU Decision 2015/495.

    Science.gov (United States)

    Barbosa, Marta O; Moreira, Nuno F F; Ribeiro, Ana R; Pereira, Manuel F R; Silva, Adrián M T

    2016-05-01

    Although there are no legal discharge limits for micropollutants into the environment, some regulations have been published in the last few years. Recently, a watch list of substances for European Union-wide monitoring was reported in the Decision 2015/495/EU of 20 March 2015. Besides the substances previously recommended to be included by the Directive 39/2013/EU, namely two pharmaceuticals (diclofenac and the synthetic hormone 17-alpha-ethinylestradiol (EE2)) and a natural hormone (17-beta-estradiol (E2)), the first watch list of 10 substances/groups of substances also refers three macrolide antibiotics (azithromycin, clarithromycin and erythromycin), other natural hormone (estrone (E1)), some pesticides (methiocarb, oxadiazon, imidacloprid, thiacloprid, thiamethoxam, clothianidin, acetamiprid and triallate), a UV filter (2-ethylhexyl-4-methoxycinnamate) and an antioxidant (2,6-di-tert-butyl-4-methylphenol) commonly used as food additive. Since little is known about the removal of most of the substances included in the Decision 2015/495/EU, particularly regarding realistic concentrations in aqueous environmental samples, this review aims to: (i) overview the European policy in the water field; (ii) briefly describe the most commonly used conventional and advanced treatment processes to remove micropollutants; (iii) summarize the relevant data published in the last decade, regarding occurrence and removal in aqueous matrices of the 10 substances/groups of substances that were recently included in the first watch list for European Union monitoring (Decision 2015/495/EU); and (iv) highlight the lack of reports concerning some substances of the watch list, the study of un-spiked aquatic matrices and the assessment of transformation by-products. Copyright © 2016 Elsevier Ltd. All rights reserved.

  4. The New Product Watch: Successes and Challenges of Crowdsourcing as a Method of Surveillance.

    Science.gov (United States)

    Nyman, Amy L; Biener, Lois

    2016-01-01

    New smokeless tobacco (eg, snus and dissolvable tobacco products) and nontobacco nicotine products (eg, e-cigarettes) have emerged in recent years amid widespread speculation about locations of test marketing, toxic constituents, and consumer targeting. The New Product Watch was a pilot online monitoring system aimed at filling these information gaps by using a form of crowdsourcing: recruiting volunteers to visit local retailers and report their findings. With very little funding, the New Product Watch gathered county-specific data on new product availability in 19 states as well as trend data on product marketing and demand, and completed 2 rounds of product purchases and subsequent toxic constituent analyses. Data were collected over a 2-year period, between 2009 and 2011. Despite the successes, we found that this small-scale, volunteer effort was not a sustainable method for ensuring continuous, systematic surveillance of new product availability, marketing, and toxicity.

  5. Gulf of Mexico Hypoxia Watch Bottom Dissolved Oxygen Contours for SEAMAP Cruises of 2001 - 2016

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana-Florida continental shelf...

  6. Listening, Watching, and Reading: The Structure and Correlates of Entertainment Preferences

    OpenAIRE

    Rentfrow, Peter J.; Goldberg, Lewis R.; Zilca, Ran

    2011-01-01

    People spend considerable amounts of time and money listening to music, watching TV and movies, and reading books and magazines, yet almost no attention in psychology has been devoted to understanding individual differences in preferences for such entertainment. The present research was designed to examine the structure and correlates of entertainment genre preferences. Analyses of the genre preferences of over 3,000 individuals revealed a remarkably clear factor structure. Using multiple sam...

  7. Fat watch: A nationwide campaign in the Netherlands to reduce fat intake-effect evaluation

    NARCIS (Netherlands)

    Wechem, S.N. van; Brug, J.; Assema, P. van; Kistemaker, C.; Riedstra, M.; Löwik, M.R.H.

    1998-01-01

    In the Netherlands, the nationwide Fat Watch campaign aiming at a reduction in fat consumption was organized from 1991 onwards. This study describes the effects of the first three consecutive campaign years on attention to fat, diet and health, attitudes, self-efficacy expectations and intentions

  8. Assessment of the radiological status of the French environment in 2008: synthesis of the results of the IRSN's watch networks

    International Nuclear Information System (INIS)

    2009-01-01

    This report presents the data obtained in 2008 within the frame of the follow-up by the IRSN of the levels of radioactivity on the French national territory. After having recalled the objectives of this radiological watch of the environment and its organization, the report describes the methodology adopted for the choice of the watch stations, the choice of the environmental matrices, the analysis plans, the sample preparation and packing. It presents the various radionuclides which are naturally or artificially present in the French environment. Then, it presents the results obtained by the different station networks by watching the atmosphere, rivers and soils, or coasts. The report recalls and comments the different radiological events which occurred in 2008, i.e. the detection of different radionuclides in different environments: nuclear plants, nuclear research centres, nuclear sites, nuclear industries, nuclear waste storage sites, nuclear marine bases, rivers

  9. Canadian children's and youth's pedometer-determined steps/day, parent-reported TV watching time, and overweight/obesity: The CANPLAY Surveillance Study

    Directory of Open Access Journals (Sweden)

    Craig Cora L

    2011-06-01

    Full Text Available Abstract Background This study examines associations between pedometer-determined steps/day and parent-reported child's Body Mass Index (BMI and time typically spent watching television between school and dinner. Methods Young people (aged 5-19 years were recruited through their parents by random digit dialling and mailed a data collection package. Information on height and weight and time spent watching television between school and dinner on a typical school day was collected from parents. In total, 5949 boys and 5709 girls reported daily steps. BMI was categorized as overweight or obese using Cole's cut points. Participants wore pedometers for 7 days and logged daily steps. The odds of being overweight and obese by steps/day and parent-reported time spent television watching were estimated using logistic regression for complex samples. Results Girls had a lower median steps/day (10682 versus 11059 for boys and also a narrower variation in steps/day (interquartile range, 4410 versus 5309 for boys. 11% of children aged 5-19 years were classified as obese; 17% of boys and girls were overweight. Both boys and girls watched, on average, Discussion Television viewing is the more prominent factor in terms of predicting overweight, and it contributes to obesity, but steps/day attenuates the association between television viewing and obesity, and therefore can be considered protective against obesity. In addition to replacing opportunities for active alternative behaviours, exposure to television might also impact body weight by promoting excess energy intake. Conclusions In this large nationally representative sample, pedometer-determined steps/day was associated with reduced odds of being obese (but not overweight whereas each parent-reported hour spent watching television between school and dinner increased the odds of both overweight and obesity.

  10. Television watching, diet and body mass index of school children in Saudi Arabia.

    Science.gov (United States)

    Alghadir, Ahmad H; Gabr, Sami A; Iqbal, Zaheen A

    2016-04-01

    Watching television has been widely associated with various health and psychological outcomes in children. Excessive intake of carbonated, sweetened beverages and fast foods, inadequate intake of fruit and dairy products; and reduced levels of physical activity also pose a risk to healthy lifestyle among youth. Limited literature is available, however, on the cross-cultural aspects of duration of television viewing, diet preferences and their effect on weight in school children in the Middle East, especially in Saudi Arabia. We conducted an online survey in school children in Saudi Arabia (age 12-16 years) to determine whether there is any association between duration of daily television watching, body mass index (BMI), eating habits and diet preferences. A self-administered questionnaire was uploaded online and the link was sent to school children, inviting them to participate in the study. It included questions on demographic data; family medical status; daily routine in and after school; number of hours of daily TV watching, self-perception of health and daily diet habits and preferences. A total of 220 children aged between 12 and 16 years participated in the present study. There was a higher duration of television viewing, and higher consumption of high-fat fast foods and high-sugar drinks, and this was significantly associated with BMI (P Saudi Arabia seems to be the major cause of the association between sedentary lifestyle and dietary habits, which needs to be checked and limited. Parents and teachers need to be trained because they can play a major role in its prevention. Saudi Arabia is a growing country banking on its youth. Their awareness can prevent the incidence and lower the prevalence of such ill health habits among them. © 2015 Japan Pediatric Society.

  11. Community Solutions for Solid Waste Pollution, Level 6. Teacher Guide. Operation Waste Watch.

    Science.gov (United States)

    Virginia State Dept. of Waste Management, Richmond. Div. of Litter & Recycling.

    Operation Waste Watch is a series of seven sequential learning units which addresses the subject of litter control and solid waste management. Each unit may be used in a variety of ways, depending on the needs and schedules of individual schools, and may be incorporated into various social studies, science, language arts, health, mathematics, and…

  12. A multi-centre open-label randomised non-inferiority trial comparing watchful waiting to antibiotic treatment for acute otitis media without perforation in low-risk urban Aboriginal and Torres Strait Islander children (the WATCH trial): study protocol for a randomised controlled trial.

    Science.gov (United States)

    Abbott, Penelope; Gunasekera, Hasantha; Leach, Amanda Jane; Askew, Deborah; Walsh, Robyn; Kong, Kelvin; Girosi, Federico; Bond, Chelsea; Morris, Peter; Lujic, Sanja; Hu, Wendy; Usherwood, Tim; Tyson, Sissy; Spurling, Geoffrey; Douglas, Markeeta; Schubert, Kira; Chapman, Shavaun; Siddiqui, Nadeem; Murray, Reeion; Rabbitt, Keitha; Porykali, Bobby; Woodall, Cheryl; Newman, Tina; Reath, Jennifer

    2016-03-03

    Treatment guidelines recommend watchful waiting for children older than 2 years with acute otitis media (AOM) without perforation, unless they are at high risk of complications. The high prevalence of chronic suppurative otitis media (CSOM) in remote Aboriginal and Torres Strait Islander communities leads these children to be classified as high risk. Urban Aboriginal and Torres Strait Islander children are at lower risk of complications, but evidence to support the subsequent recommendation for watchful waiting in this population is lacking. This non-inferiority multi-centre randomised controlled trial will determine whether watchful waiting is non-inferior to immediate antibiotics for urban Aboriginal and Torres Strait Islander children with AOM without perforation. Children aged 2 - 16 years with AOM who are considered at low risk for complications will be recruited from six participating urban primary health care services across Australia. We will obtain informed consent from each participant or their guardian. The primary outcome is clinical resolution on day 7 (no pain, no fever of at least 38 °C, no bulging eardrum and no complications of AOM such as perforation or mastoiditis) as assessed by general practitioners or nurse practitioners. Participants and outcome assessors will not be blinded to treatment. With a sample size of 198 children in each arm, we have 80 % power to detect a non-inferiority margin of up to 10 % at a significance level of 5 %, assuming clinical improvement of at least 80 % in both groups. Allowing for a 20 % dropout rate, we aim to recruit 495 children. We will analyse both by intention-to-treat and per protocol. We will assess the cost- effectiveness of watchful waiting compared to immediate antibiotic prescription. We will also report on the implementation of the trial from the perspectives of parents/carers, health professionals and researchers. The trial will provide evidence for the safety and effectiveness of watchful waiting

  13. Gynecologic Cancer Information on YouTube: Will Women Watch Advertisements to Learn More?

    Science.gov (United States)

    Cooper, Crystale Purvis; Gelb, Cynthia A; Chu, Jennifer

    2016-09-01

    The quality and accuracy of health content posted on YouTube varies widely. To increase dissemination of evidence-based gynecologic cancer information to US YouTube users, the Centers for Disease Control and Prevention (CDC) sponsored two types of advertisements: (1) pre-roll videos that users had to watch for at least 5 s before seeing a video they selected and (2) keyword-targeted listings that appeared in search results when users entered terms related to gynecologic cancer. From July 2012 to November 2013, pre-roll videos were shown 9.2 million times, viewed (watched longer than the mandatory 5 s) 1.6 million times (17.6 %), and cost $0.09 per view. Keyword-targeted listings were displayed 15.3 million times, viewed (activated by users) 59,766 times (0.4 %), and cost $0.31 per view. CDC videos in advertisements played completely in 17.0 % of pre-roll video views and 44.4 % of keyword-targeted listing views. Advertisements on YouTube can disseminate evidence-based cancer information broadly with minimal cost.

  14. Applicability of WaveWatch-III wave model to fatigue assessment of offshore floating structures

    NARCIS (Netherlands)

    Zou, T.; Kaminski, M.L.

    2016-01-01

    In design and operation of floating offshore structures, one has to avoid fatigue failures caused by action of ocean waves. The aim of this paper is to investigate the applicability of WaveWatch-III wave model to fatigue assessment of offshore floating structures. The applicability was investigated

  15. The Energy Expenditure of an Activity-Promoting Video Game compared to Sedentary Video Games and TV Watching

    Science.gov (United States)

    Mitre, Naim; Foster, Randal C; Lanningham-Foster, Lorraine; Levine, James A.

    2014-01-01

    Background Screen time continues to be a major contributing factor to sedentariness in children. There have been more creative approaches to increase physical over the last few years. One approach has been through the use of video games. In the present study we investigated the effect of television watching and the use of activity-promoting video games on energy expenditure and movement in lean and obese children. Our primary hypothesis was that energy expenditure and movement decreases while watching television, in lean and obese children. Our secondary hypothesis was that energy expenditure and movement increases when playing the same game with an activity-promoting video game console compared to a sedentary video game console, in lean and obese children. Methods Eleven boys (10 ± 1 year) and eight girls (9 ± 1 year) ranging in BMI from 14–29 kg/m2 (eleven lean and eight overweight or obese) were recruited. Energy expenditure and physical activity were measured while participants were watching television, playing a video game on a traditional sedentary video game console, and while playing the same video game on an activity-promoting video game (Nintendo Wii) console. Results Energy expenditure was significantly greater than television watching and playing video games on a sedentary video game console when children played the video game on the activity-promoting console(125.3 ± 38.2 Kcal/hr vs. 79.7 ± 20.1 and 79.4 ±15.7, Pvideo games on a sedentary video game console is not different. Activity-promoting video games have shown to increase movement, and be an important tool to raise energy expenditure by 50% when compared to sedentary activities of daily living. PMID:22145458

  16. Watching TV and food intake: the role of content.

    Directory of Open Access Journals (Sweden)

    Colin D Chapman

    Full Text Available Obesity is a serious and growing health concern worldwide. Watching television (TV represents a condition during which many habitually eat, irrespective of hunger level. However, as of yet, little is known about how the content of television programs being watched differentially impacts concurrent eating behavior. In this study, eighteen normal-weight female students participated in three counter-balanced experimental conditions, including a 'Boring' TV condition (art lecture, an 'Engaging' TV condition (Swedish TV comedy series, and a no TV control condition during which participants read (a text on insects living in Sweden. Throughout each condition participants had access to both high-calorie (M&Ms and low-calorie (grapes snacks. We found that, relative to the Engaging TV condition, Boring TV encouraged excessive eating (+52% g, P = 0.009. Additionally, the Engaging TV condition actually resulted in significantly less concurrent intake relative to the control 'Text' condition (-35% g, P = 0.05. This intake was driven almost entirely by the healthy snack, grapes; however, this interaction did not reach significance (P = 0.07. Finally, there was a significant correlation between how bored participants were across all conditions, and their concurrent food intake (beta = 0.317, P = 0.02. Intake as measured by kcals was similarly patterned but did not reach significance. These results suggest that, for women, different TV programs elicit different levels of concurrent food intake, and that the degree to which a program is engaging (or alternately, boring is related to that intake. Additionally, they suggest that emotional content (e.g. boring vs. engaging may be more associated than modality (e.g. TV vs. text with concurrent intake.

  17. Watching TV and food intake: the role of content.

    Science.gov (United States)

    Chapman, Colin D; Nilsson, Victor C; Thune, Hanna Å; Cedernaes, Jonathan; Le Grevès, Madeleine; Hogenkamp, Pleunie S; Benedict, Christian; Schiöth, Helgi B

    2014-01-01

    Obesity is a serious and growing health concern worldwide. Watching television (TV) represents a condition during which many habitually eat, irrespective of hunger level. However, as of yet, little is known about how the content of television programs being watched differentially impacts concurrent eating behavior. In this study, eighteen normal-weight female students participated in three counter-balanced experimental conditions, including a 'Boring' TV condition (art lecture), an 'Engaging' TV condition (Swedish TV comedy series), and a no TV control condition during which participants read (a text on insects living in Sweden). Throughout each condition participants had access to both high-calorie (M&Ms) and low-calorie (grapes) snacks. We found that, relative to the Engaging TV condition, Boring TV encouraged excessive eating (+52% g, P = 0.009). Additionally, the Engaging TV condition actually resulted in significantly less concurrent intake relative to the control 'Text' condition (-35% g, P = 0.05). This intake was driven almost entirely by the healthy snack, grapes; however, this interaction did not reach significance (P = 0.07). Finally, there was a significant correlation between how bored participants were across all conditions, and their concurrent food intake (beta = 0.317, P = 0.02). Intake as measured by kcals was similarly patterned but did not reach significance. These results suggest that, for women, different TV programs elicit different levels of concurrent food intake, and that the degree to which a program is engaging (or alternately, boring) is related to that intake. Additionally, they suggest that emotional content (e.g. boring vs. engaging) may be more associated than modality (e.g. TV vs. text) with concurrent intake.

  18. Brief Report: Just-in-Time Visual Supports to Children with Autism via the Apple Watch:® A Pilot Feasibility Study

    OpenAIRE

    O’Brien, Amanda; Abramson, Jennifer; Yu, Christina; Dimery, Katherine; Schlosser, Ralf W.; Shane, Howard C.; Allen, Anna A.; Flynn, Suzanne

    2016-01-01

    Using augmented input might be an effective means for supplementing spoken language for children with autism who have difficulties following spoken directives. This study aimed to (a) explore whether JIT-delivered scene cues (photos, video clips) via the Apple Watch® enable children with autism to carry out directives they were unable to implement with speech alone, and (b) test the feasibility of the Apple Watch® (with a focus on display size). Results indicated that the hierarchical JIT sup...

  19. Watching Dallas again 1: Doing retro audience research

    Directory of Open Access Journals (Sweden)

    Amanda Gilroy

    2015-06-01

    Full Text Available This essay and the audience reception projects it introduces alleviate the desperation of seeking the television audience by recourse to Ien Ang's influential book, Watching Dallas ([1982] 1985. Within the context of a unit on audience research in a master's-level course on media, two groups of students explored the possibilities of remixing Ang in the present digital media landscape via informants' comments on the first season of the new series of Dallas (2012–14. Discourses of nostalgia circulate within and around the text, as well as the project itself. Retro audience research generates not only data about the affective memories and critical reflections of informants but also insights into research methods and the production of new nostalgic subjects.

  20. Attitudes of Consumers from the Mostar Canton in Bosnia and Herzegovina toward Advertising through Sport among the Frequency of Watching Sports Events

    Directory of Open Access Journals (Sweden)

    Marina Vukotic

    2018-04-01

    Full Text Available It is proposed that potential consumers form attitudes based on advertising through sport can influence decisions to purchase a particular advertiser’s product. From this reason, it is important to analyse their general attitudes toward advertising through sport among various questions, and this investigation was aimed at gaining relevant knowledge about the attitudes of Mostar consumers toward advertising through sport among. The sample included 228 respondents, divided into six subsample groups: consumers, who do not watch sports events at all, then consumers who watch sports events 1-30 minutes, next 31-60 minutes, 61-90 minutes, 91-120 minutes, as well as consumers who watch sports events more than 120 minutes during the typical day. The sample of variables contained the system of three general attitudes which were modelled by seven-point Likert scale. The results of the measuring were analysed by multivariate analysis (MANOVA and univariate analysis (ANOVA and Post Hoc test. Based on the statistical analyses it was found that significant differences occur at multivariate level, as well as between all three variables at a significance level of p=.006. Hence, it is interesting to highlight that it was found there are significant differences showed up between the attitudes of consumers toward advertising through sport among the frequency of watching sports events. These results are so important for the marketers, mostly due to the reason they can’t merge all the potential consumers regarding the frequency they watch the sports events. On the other hand, this is the case in previous investigations and this observation presents relevant information.

  1. Attitudes of Consumers from the Sarajevo Canton in Bosnia and Herzegovina toward Advertising through Sport among the Frequency of Watching Sports Events

    Directory of Open Access Journals (Sweden)

    Izet Bajramovic

    2018-04-01

    Full Text Available It is proposed that potential consumers form attitudes based on advertising through sport can influence decisions to purchase a particular advertiser’s product. From this reason, it is important to analyse their general attitudes toward advertising through sport among various questions, and this investigation was aimed at gaining relevant knowledge about the attitudes of Sarajevo consumers toward advertising through sport among. The sample included 358 respondents, divided into six subsample groups: consumers, who do not watch sports events at all, then consumers who watch sports events 1-30 minutes, next 31-60 minutes, 61-90 minutes, 91-120 minutes, as well as consumers who watch sports events more than 120 minutes during the typical day. The sample of variables contained the system of three general attitudes which were modelled by seven-point Likert scale. The results of the measuring were analysed by multivariate analysis (MANOVA and univariate analysis (ANOVA and Post Hoc test. Based on the statistical analyses it was found that significant differences occur at multivariate level, as well as between all three variables at a significance level of p=.00. Hence, it is interesting to highlight that it was found there are significant differences showed up between the attitudes of consumers toward advertising through sport among the frequency of watching sports events. These results are so important for the marketers, mostly due to the reason they can’t merge all the potential consumers regarding the frequency they watch the sports events. On the other hand, this is the case in previous investigations and this observation presents relevant information.

  2. 78 FR 30389 - Requested Administrative Waiver of the Coastwise Trade Laws: Vessel LITTLE BAY WATCH; Invitation...

    Science.gov (United States)

    2013-05-22

    ... entered into this docket is available on the World Wide Web at http://www.regulations.gov . FOR FURTHER... LITTLE BAY WATCH is: Intended Commercial Use Of Vessel: ``Snorkel trips and marine science education...

  3. Fat watch: A nationwide campaign in the Netherlands to reduce fat intake-process evaluations

    NARCIS (Netherlands)

    Cornelie, J.; Feen van der, Lille, J.C.J.F. de; Riedstra, M.; Hardeman, W.; Wedel, M.; Brug, J.; Pruyn, J.F.A.; Löwik, M.R.H.

    1998-01-01

    Fat Watch was a four-year campaign carried out in cooperation with retailers and industry, aiming at a reduction of fat consumption by 10% among the Dutch population. Mass media and supermarkets were the main conveyers of the message. Supermarkets participated well in the first (53%) and in the

  4. Smart watch-based coaching with tiotropium and olodaterol ameliorates physical activity in patients with chronic obstructive pulmonary disease

    Science.gov (United States)

    Hataji, Osamu; Nishii, Yoichi; Ito, Kentaro; Sakaguchi, Tadashi; Saiki, Haruko; Suzuki, Yuta; D'Alessandro-Gabazza, Corina; Fujimoto, Hajime; Kobayashi, Tetsu; Gabazza, Esteban C.; Taguchi, Osamu

    2017-01-01

    Combined therapy with tiotropium and olodaterol notably improves parameters of lung function and quality of life in patients with chronic obstructive pulmonary disease (COPD) compared to mono-components; however, its effect on physical activity is unknown. The present study evaluated whether combination therapy affects daily physical performance in patients with COPD under a smart watch-based encouragement program. This was a non-blinded clinical trial with no randomization or placebo control. A total of 20 patients with COPD were enrolled in the present study. The patients carried an accelerometer for 4 weeks; they received no therapy during the first 2 weeks but they were treated with combined tiotropium and olodaterol under a smart watch-based encouragement program for the last 2 weeks. The pulmonary function test, COPD assessment test, 6-min walk distance and parameters of physical activity were significantly improved (Pcoaching compared with values prior to treatment. To the best of our knowledge, the present study for the first time provides evidence that smart watch-based coaching in combination with tiotropium and olodaterol may improve daily physical activity in chronic obstructive pulmonary disease. PMID:29104624

  5. Associations between eating meals, watching TV while eating meals and weight status among children, ages 10-12 years in eight European countries: the ENERGY cross-sectional study.

    Science.gov (United States)

    Vik, Frøydis N; Bjørnarå, Helga Birgit; Overby, Nina C; Lien, Nanna; Androutsos, Odysseas; Maes, Lea; Jan, Natasa; Kovacs, Eva; Moreno, Luis A; Dössegger, Alain; Manios, Yannis; Brug, Johannes; Bere, Elling

    2013-05-15

    To assess the association of eating meals, and never watching TV while eating meals, with weight status among children, ages 10-12 years across Europe. 7915 children (mean age: 11.5 years) in eight European countries (Belgium, Greece, Hungary, the Netherlands, Norway, Slovenia, Spain and Switzerland) completed a questionnaire at school. Data on meals eaten the day before questionnaire administration and the frequency of eating meals while watching TV were collected. Height and weight of the children were objectively assessed. Multinomial and binary regression analyses were conducted to test associations of eating meals (adjusted for gender and ethnicity) and never watching TV while eating meals (adjusted for gender, ethnicity and total TV time) with overweight/obesity, and to test for country- and socio-demographic differences. The proportions of children reporting eating breakfast, lunch and dinner were 85%, 96%, and 93% respectively, and 55%, 46% and 32% reported to never watch TV at breakfast, lunch and dinner respectively. The children who ate breakfast (OR = 0.6 (95% CI 0.5-0.7)) and dinner (OR = 0.4 (95% CI 0.3-0.5)), had lower odds of being overweight compared to those who did not. The children who never watched TV at lunch (OR = 0.7 (95% CI 0.7-0.8)) and dinner (OR = 0.8 (95% CI 0.7-0.9)) had lower odds of being overweight compared to those who watched TV at the respective meals. The odds of being overweight was lower for children who ate breakfast and dinner compared to those who did not eat the respective meals. The odds of being overweight was lower for children who reported to never watch TV at lunch and dinner compared to those who did. A focus towards meal frequency and watching TV during meals in longitudinal and interventions studies in prevention of overweight and obesity, may contribute to a better understanding of causality.

  6. Global Atmosphere Watch Workshop on Measurement-Model Fusion for Global Total Atmospheric Deposition (MMF-GTAD)

    Science.gov (United States)

    The World Meteorological Organization’s (WMO) Global Atmosphere Watch (GAW) Programme coordinates high-quality observations of atmospheric composition from global to local scales with the aim to drive high-quality and high-impact science while co-producing a new generation of pro...

  7. Television watching and the emotional impact on social modeling of food intake among children

    NARCIS (Netherlands)

    Bevelander, K.E.; Meiselman, H.L.; Anschutz, D.J.; Engels, R.C.M.E.

    2013-01-01

    The main goal of this study was to test whether exposure to happy, neutral, or sad media content influences social modeling effects of (snack) food intake in young children. The study was conducted at 14 Dutch urban and suburban primary schools. The participants (N = 112) were asked to watch a movie

  8. Subcentimeter hypervascular nodules with typical imaging findings of hepatocellular carcinoma on gadoxetic acid-enhanced MRI: Outcomes of early treatment and watchful waiting

    Energy Technology Data Exchange (ETDEWEB)

    Woo, Jung Han; Song, Kyoung Doo; Kim, Seong Hyun [Sungkyunkwan University School of Medicine, Department of Radiology and Center for Imaging Science, Samsung Medical Center, 81 Irwon-Ro, Gangnam-Gu, Seoul (Korea, Republic of)

    2017-10-15

    To compare treatment outcomes of subcentimeter hypervascular nodules at high risk for developing into hepatocellular carcinomas (SHNHR) between early treatment and watchful waiting until progression to overt hepatocellular carcinoma (HCC) groups. SHNHRs were defined as subcentimeter hypervascular nodules with the usual imaging features of HCC on gadoxetic acid-enhanced magnetic resonance imaging (MRI). Among 63 patients with 74 SHNHRs, 27 (37 SHNHRs) received early treatment (treatment of < 1 cm nodules), and 36 (37 SHNHRs) underwent watchful waiting until progression to overt HCC. Risk factor analysis was performed for recurrence-free and local recurrence-free survival. Among the 36 patients who adopted watchful waiting, 33 eventually underwent treatment because their SHNHRs progressed to overt HCC. For recurrence-free survival, significant risk factors included number of previous treatments (HR, 1.181; p < 0.001), tumour number (HR, 1.943; p = 0.009), and α-feto protein level (HR, 1.005; p = 0.037) in the multivariate analyses. Treatment strategy was not a significant risk factor for recurrence-free survival. For local recurrence-free survival from the date of treatment, only treatment modality (transarterial chemoembolization) (HR, 6.879; p = 0.002) was a significant risk factor. Recurrence-free survival was not significantly different between early treatment and watchful waiting for SHNHRs. (orig.)

  9. The WOODCARE project: Development of detection methods for Death watch beetle larvae and fungal decay

    NARCIS (Netherlands)

    Esser, P.M.; Staalduinen, P.C. van; Tas, A.C.

    1999-01-01

    Woodcare was a European project coordinated by English heritage. The aim of the research was to develop more targeted and more environmentally friendly treatment methods for Death watch beetle infections in Oak constructions of historical buildings. TNO has developed two new methods for fast and

  10. GUIDON-WATCH: A Graphic Interface for Viewing a Knowledge-Based System. Technical Report #14.

    Science.gov (United States)

    Richer, Mark H.; Clancey, William J.

    This paper describes GUIDON-WATCH, a graphic interface that uses multiple windows and a mouse to allow a student to browse a knowledge base and view reasoning processes during diagnostic problem solving. The GUIDON project at Stanford University is investigating how knowledge-based systems can provide the basis for teaching programs, and this…

  11. Trial watch: Immunogenic cell death induction by anticancer chemotherapeutics.

    Science.gov (United States)

    Garg, Abhishek D; More, Sanket; Rufo, Nicole; Mece, Odeta; Sassano, Maria Livia; Agostinis, Patrizia; Zitvogel, Laurence; Kroemer, Guido; Galluzzi, Lorenzo

    2017-01-01

    The expression "immunogenic cell death" (ICD) refers to a functionally unique form of cell death that facilitates (instead of suppressing) a T cell-dependent immune response specific for dead cell-derived antigens. ICD critically relies on the activation of adaptive responses in dying cells, culminating with the exposure or secretion of immunostimulatory molecules commonly referred to as "damage-associated molecular patterns". Only a few agents can elicit bona fide ICD, including some clinically established chemotherapeutics such as doxorubicin, epirubicin, idarubicin, mitoxantrone, bleomycin, bortezomib, cyclophosphamide and oxaliplatin. In this Trial Watch, we discuss recent progress on the development of ICD-inducing chemotherapeutic regimens, focusing on studies that evaluate clinical efficacy in conjunction with immunological biomarkers.

  12. Associations between eating meals, watching TV while eating meals and weight status among children, ages 10–12 years in eight European countries: the ENERGY cross-sectional study

    Science.gov (United States)

    2013-01-01

    Background To assess the association of eating meals, and never watching TV while eating meals, with weight status among children, ages 10–12 years across Europe. Methods 7915 children (mean age: 11.5 years) in eight European countries (Belgium, Greece, Hungary, the Netherlands, Norway, Slovenia, Spain and Switzerland) completed a questionnaire at school. Data on meals eaten the day before questionnaire administration and the frequency of eating meals while watching TV were collected. Height and weight of the children were objectively assessed. Multinomial and binary regression analyses were conducted to test associations of eating meals (adjusted for gender and ethnicity) and never watching TV while eating meals (adjusted for gender, ethnicity and total TV time) with overweight/obesity, and to test for country- and socio-demographic differences. Results The proportions of children reporting eating breakfast, lunch and dinner were 85%, 96%, and 93% respectively, and 55%, 46% and 32% reported to never watch TV at breakfast, lunch and dinner respectively. The children who ate breakfast (OR = 0.6 (95% CI 0.5-0.7)) and dinner (OR = 0.4 (95% CI 0.3-0.5)), had lower odds of being overweight compared to those who did not. The children who never watched TV at lunch (OR = 0.7 (95% CI 0.7-0.8)) and dinner (OR = 0.8 (95% CI 0.7-0.9)) had lower odds of being overweight compared to those who watched TV at the respective meals. Conclusions The odds of being overweight was lower for children who ate breakfast and dinner compared to those who did not eat the respective meals. The odds of being overweight was lower for children who reported to never watch TV at lunch and dinner compared to those who did. A focus towards meal frequency and watching TV during meals in longitudinal and interventions studies in prevention of overweight and obesity, may contribute to a better understanding of causality. PMID:23675988

  13. Seahorses in focus: local ecological knowledge of seahorse-watching operators in a tropical estuary.

    Science.gov (United States)

    Ternes, Maria L F; Gerhardinger, Leopoldo C; Schiavetti, Alexandre

    2016-11-08

    Seahorses are endangered teleost fishes under increasing human pressures worldwide. In Brazil, marine conservationists and policy-makers are thus often skeptical about the viability of sustainable human-seahorse interactions. This study focuses on local ecological knowledge on seahorses and the implications of their non-lethal touristic use by a coastal community in northeastern Brazil. Community-based seahorse-watching activities have been carried out in Maracaípe village since 1999, but remained uninvestigated until the present study. Our goal is to provide ethnoecological understanding on this non-extractive use to support seahorse conservation and management. We interviewed 32 informants through semi-structured questionnaires to assess their socioeconomic profile, their knowledge on seahorse natural history traits, human uses, threats and abundance trends. Seahorse-watching has high socioeconomic relevance, being the primary income source for all respondents. Interviewees elicited a body of knowledge on seahorse biology largely consistent with up-to-date research literature. Most informants (65.5 %) perceived no change in seahorse abundance. Their empirical knowledge often surpassed scientific reports, i.e. through remarks on trophic ecology; reproductive aspects, such as, behavior and breeding season; spatial and temporal distribution, suggesting seahorse migration related to environmental parameters. Seahorse-watching operators were aware of seahorse biological and ecological aspects. Despite the gaps remaining on biological data about certain seahorse traits, the respondents provided reliable information on all questions, adding ethnoecological remarks not yet assessed by conventional scientific surveys. We provide novel ethnobiological insight on non-extractive modes of human-seahorse interaction, eliciting environmental policies to integrate seahorse conservation with local ecological knowledge and innovative ideas for seahorse sustainable use. Our study

  14. Why does Retraction Watch continue to offer support to Jeffrey Beall, and legitimize his post-mortem “predatory” lists?

    Directory of Open Access Journals (Sweden)

    Jaime A. Teixeira da Silva

    2017-07-01

    Full Text Available Retraction Watch is a science watchdog that may give the impression of being both an anti-bad science and an anti-science blog. This blog has tried to legitimize its ethical stance by naming its parent organization The Center for Science Integrity Inc. (CSI, and by appointing a former Chair of the Committee on Publication Ethics (COPE, Elizabeth Wager, to the CSI board of directors. Jeffrey Beall, another science watchdog, often appears in public alongside Adam Marcus and Ivan Oransky, the CSI secretary and president, respectively, and participates in events with Wager. Beall became academically redundant on January 15, 2017. This is because his blog, which hosted a faulty, controversial and misleading list (and thus potentially libelous of “predatory” open access journals and publishers, suddenly went blank. Beall offered no apology or explanation to the public, but was offered intellectual asylum and protection by the University of Colorado, Denver, where he works as a librarian. After a grace period of almost two months, members of the global academic community have now largely lost respect for Beall because of his silence, which may be equated with irresponsibility and/or cowardice. Despite this near extinct academic status, Retraction Watch continues to laud Beall, refer to his now-defunct site and lists as valid, as many as 25 times, and even rely on the Beall blog and lists to support several of their journalistic claims. In the world of science publishing, the legitimization of a “fact” using a defunct or false (i.e., non-factual source, is equivalent to publishing misconduct, and feeds into the “false facts” and “alternative truths” epidemic in journalism that Retraction Watch is now impregnating into science publishing. Why then is Retraction Watch allowed to operate under an ethically superior platform, while expecting scientists and academics to respect basic rules of citing valid references, but while practicing

  15. Children aged 6-24 months like to watch YouTube videos but could not learn anything from them.

    Science.gov (United States)

    Yadav, Savita; Chakraborty, Pinaki; Mittal, Prabhat; Arora, Udit

    2018-03-20

    Parents sometimes show young children YouTube videos on their smartphones. We studied the interaction of 55 Indian children born between December 2014 and May 2015 who watched YouTube videos when they were 6-24 months old. The children were recruited by the researchers using professional and personal contacts and visited by the same two observers at four ages, for at least 10 minutes. The observers recorded the children's abilities to interact with touch screens and identify people in videos and noted what videos attracted them the most. The children were attracted to music at six months of age and were interested in watching the videos at 12 months. They could identify their parents in videos at 12 months and themselves by 24 months. They started touching the screen at 18 months and could press the buttons that appeared on the screen, but did not understand their use. The children preferred watching dance performances by multiple artists with melodical music, advertisements for products they used and videos showing toys and balloons. Children up to two years of age could be entertained and kept busy by showing them YouTube clips on smartphones, but did not learn anything from the videos. ©2018 Foundation Acta Paediatrica. Published by John Wiley & Sons Ltd.

  16. Results of gas monitoring of double-shell flammable gas watch list tanks

    International Nuclear Information System (INIS)

    Wilkins, N.E.

    1995-01-01

    Tanks 103-SY; 101-AW; 103-, 104-, and 105-AN are on the Flammable Gas Watch List. Recently, standard hydrogen monitoring system (SHMS) cabinets have been installed in the vent header of each of these tanks. Grab samples have been taken once per week, and a gas chromatograph was installed on tank 104-AN as a field test. The data that have been collected since gas monitoring began on these tanks are summarized in this document

  17. StopWatch: The preliminary evaluation of a smartwatch-based system for passive detection of cigarette smoking.

    Science.gov (United States)

    Skinner, Andrew L; Stone, Christopher J; Doughty, Hazel; Munafò, Marcus R

    2018-01-24

    Recent developments in smoking cessation support systems and interventions have highlighted the requirement for unobtrusive, passive ways to measure smoking behaviour. A number of systems have been developed for this that either use bespoke sensing technology, or expensive combinations of wearables and smartphones. Here we present StopWatch, a system for passive detection of cigarette smoking that runs on a low-cost smartwatch and does not require additional sensing or a connected smartphone. Our system uses motion data from the accelerometer and gyroscope in an Android smartwatch to detect the signature hand movements of cigarette smoking. It uses machine learning techniques to transform raw motion data into motion features, and in turn into individual drags and instances of smoking. These processes run on the smartwatch, and do not require a smartphone. We conducted preliminary validations of the system in daily smokers (n=13) in laboratory and free-living conditions running on an Android LG G-Watch. In free-living conditions, over a 24-hour period, the system achieved precision of 86% and recall of 71%. StopWatch is a system for passive measurement of cigarette smoking that runs entirely on a commercially available Android smartwatch. It requires no smartphone so the cost is low, and needs no bespoke sensing equipment so participant burden is also low. Performance is currently lower than other more expensive and complex systems, though adequate for some applications. Future developments will focus on enhancing performance, validation on a range of smartwatches, and detection of electronic cigarette use. We present a low-cost, smartwatch-based system for passive detection of cigarette smoking. It uses data from the motion sensors in the watch to identify the signature hand movements of cigarette smoking. The system will provide the detailed measures of individual smoking behaviour needed for context-triggered just-in-time smoking cessation support systems, and to

  18. LifeWatchGreece Portal development: architecture, implementation and challenges for a biodiversity research e-infrastructure.

    Science.gov (United States)

    Gougousis, Alexandros; Bailly, Nicolas

    2016-01-01

    Biodiversity data is characterized by its cross-disciplinary character, the extremely broad range of data types and structures, and the plethora of different data sources providing resources for the same piece of information in a heterogeneous way. Since the web inception two decades ago, there are multiple initiatives to connect, aggregate, share, and publish biodiversity data, and to establish data and work flows in order to analyze them. The European program LifeWatch aims at establishing a distributed network of nodes implementing virtual research environment in Europe to facilitate the work of biodiversity researchers and managers. LifeWatchGreece is one of these nodes where a portal was developed offering access to a suite of virtual laboratories and e-services. Despite its strict definition in information technology, in practice "portal" is a fairly broad term that embraces many web architectures. In the biodiversity domain, the term "portal" is usually used to indicate either a web site that provides access to a single or an aggregation of data repositories (like: http://indiabiodiversity.org/, http://www.mountainbiodiversity.org/, http://data.freshwaterbiodiversity.eu), a web site that gathers information about various online biodiversity tools (like http://test-eubon.ebd.csic.es/, http://marine.lifewatch.eu/) or a web site that just gathers information and news about the biodiversity domain (like http://chm.moew.government.bg). LifeWatchGreece's portal takes the concept of a portal a step further. In strict IT terms, LifeWatchGreece's portal is partly a portal, partly a platform and partly an aggregator. It includes a number of biodiversity-related web tools integrated into a centrally-controlled software ecosystem. This ecosystem includes subsystems for access control, traffic monitoring, user notifications and web tool management. These subsystems are shared to all the web tools that have been integrated to the portal and thereby are part of this

  19. Global Age Watch Index 2015, London, 2015, ch 8 Western Europe, North America and Australasia

    NARCIS (Netherlands)

    de Bruijn, J.G.M.

    2015-01-01

    The world’s population is ageing. As fertility declines and life expectancy increases, the proportion of people aged 60 and over is projected to grow in all regions of the world. Yet people’s experiences of later life vary enormously depending on where they live. The Global AgeWatch Index assesses

  20. Gulf of Mexico Hypoxia Watch Bottom Dissolved Oxygen Contours for June and July SEAMAP Cruise of 2008

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  1. Gulf of Mexico Hypoxia Watch Bottom Dissolved Oxygen Contours for June and July SEAMAP Cruise of 2003

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  2. Gulf of Mexico Hypoxia Watch Bottom Dissolved Oxygen Contours for June and July SEAMAP Cruise of 2001

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  3. Gulf of Mexico Hypoxia Watch Bottom Dissolved Oxygen Contours for June and July SEAMAP Cruise of 2005

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  4. Gulf of Mexico Hypoxia Watch Bottom Dissolved Oxygen Contours for June and July SEAMAP Cruise of 2015

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  5. Gulf of Mexico Hypoxia Watch Bottom Dissolved Oxygen Contours for June and July SEAMAP Cruise of 2009

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  6. Gulf of Mexico Hypoxia Watch Bottom Dissolved Oxygen Contours for June and July SEAMAP Cruise of 2004

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  7. Gulf of Mexico Hypoxia Watch Bottom Dissolved Oxygen Contours for June and July SEAMAP Cruise of 2007

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  8. Gulf of Mexico Hypoxia Watch Bottom Dissolved Oxygen Contours for June and July SEAMAP Cruise of 2012

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  9. Gulf of Mexico Hypoxia Watch Bottom Dissolved Oxygen Contours for June and July SEAMAP Cruise of 2002

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  10. Gulf of Mexico Hypoxia Watch Bottom Dissolved Oxygen Contours for June and July SEAMAP Cruise of 2010

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  11. Gulf of Mexico Hypoxia Watch Bottom Dissolved Oxygen Contours for June and July SEAMAP Cruise of 2006

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  12. Gulf of Mexico Hypoxia Watch Bottom Dissolved Oxygen Contours for June and July SEAMAP Cruise of 2013

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  13. Gulf of Mexico Hypoxia Watch Bottom Dissolved Oxygen Contours for June and July SEAMAP Cruise of 2014

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  14. Gulf of Mexico Hypoxia Watch Bottom Dissolved Oxygen Contours for October and November SEAMAP Cruise of 2008

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Hypoxia Watch project provides near-real-time, web-based maps of dissolved oxygen near the sea floor over the Texas-Louisiana continental shelf during a...

  15. Student cognition and motivation during the Classroom BirdWatch citizen science project

    Science.gov (United States)

    Tomasek, Terry Morton

    The purpose of this study was to examine and describe the ways various stakeholders (CBW project developer/coordinator, elementary and middle school teachers, and 5th through 8th grade students) envisioned, implemented and engaged in the citizen science project, eBird/Classroom BirdWatch. A multiple case study mixed-methods research design was used to examine student engagement in the cognitive processes associated with scientific inquiry as part of citizen science participation. Student engagement was described based on a sense of autonomy, competence, relatedness and intrinsic motivation. A goal of this study was to expand the taxonomy of differences between authentic scientific inquiry and simple inquiry to include those inquiry tasks associated with participation in citizen science by describing how students engaged in this type of science. This research study built upon the existing framework of cognitive processes associated with scientific inquiry described by Chinn and Malhotra (2002). This research provides a systematic analysis of the scientific processes and related reasoning tasks associated with the citizen science project eBird and the corresponding curriculum Classroom BirdWatch . Data consisted of responses to surveys, focus group interviews, document analysis and individual interviews. I suggest that citizen science could be an additional form of classroom-based science inquiry that can promote more authentic features of scientific inquiry and engage students in meaningful ways.

  16. Relationship between parental estimate and an objective measure of child television watching

    Directory of Open Access Journals (Sweden)

    Roemmich James N

    2006-11-01

    Full Text Available Abstract Many young children have televisions in their bedrooms, which may influence the relationship between parental estimate and objective measures of child television usage/week. Parental estimates of child television time of eighty 4–7 year old children (6.0 ± 1.2 years at the 75th BMI percentile or greater (90.8 ± 6.8 BMI percentile were compared to an objective measure of television time obtained from TV Allowance™ devices attached to every television in the home over a three week period. Results showed that parents overestimate their child's television time compared to an objective measure when no television is present in the bedroom by 4 hours/week (25.4 ± 11.5 vs. 21.4 ± 9.1 in comparison to underestimating television time by over 3 hours/week (26.5 ± 17.2 vs. 29.8 ± 14.4 when the child has a television in their bedroom (p = 0.02. Children with a television in their bedroom spend more objectively measured hours in television time than children without a television in their bedroom (29.8 ± 14.2 versus 21.4 ± 9.1, p = 0.003. Research on child television watching should take into account television watching in bedrooms, since it may not be adequately assessed by parental estimates.

  17. Male gays in the female gaze: women who watch m/m pornography

    OpenAIRE

    Neville, Lucy

    2015-01-01

    This paper draws on a piece of wide-scale mixed-methods research that examines the motivations behind women who watch gay male pornography. To date there has been very little interdisciplinary research investigating this phenomenon, despite a recent survey by PornHub (one of the largest online porn sites in the world) showing that gay male porn is the second most popular choice for women porn users out of 25+ possible genre choices. While both academic literature and popular culture have look...

  18. Intimate partner violence in the Canadian territorial north: perspectives from a literature review and a media watch.

    Science.gov (United States)

    Moffitt, Pertice; Fikowski, Heather; Mauricio, Marshirette; Mackenzie, Anne

    2013-01-01

    Family violence is a complex, multidimensional and pervasive presence in many Aboriginal communities. Although practitioners acknowledge that intimate partner violence (IPV) is a grave concern in the North, as in other jurisdictions in Canada, there is a paucity of literature about IPV and the local response to that violence. The purpose of this study is to report on a synthesis of Northern Territorial literature and a 3-year media watch conducted in the Canadian territories. This review is part of a multidisciplinary 5-year study occurring in the Northwest Territories (NT) and northern regions of the Prairie Provinces of Canada. The methods included a review of the literature through CINAHL, PubMed, Academic Search Complete, Social Sciences Index and JSTOR (1990-2012) combined with a media watch from 2009 to 2012. A thematic content analysis was completed. THEMES INCLUDED: colonization; alcohol and substance use; effects of residential schooling; housing inadequacies; help-seeking behaviors; and gaps within the justice system. Identified themes from the media watch were: murders from IPV; reported assaults and criminal charges; emergency protection orders; and awareness campaigns and prevention measures. When synthesized, the results of the literature review and media surveillance depict a starting context and description of IPV in the Canadian territories. There are many questions left unanswered which build support for the necessity of the current research, outline the public outcry for action in local media and identify the current published knowledge about IPV.

  19. Digital Media Platforms and the Use of TV Content: Binge Watching and Video-on-Demand in Germany

    Directory of Open Access Journals (Sweden)

    Lothar Mikos

    2016-07-01

    Full Text Available The advancing digitalization and media convergence demands TV broadcasting companies to adjust their content to various platforms and distribution channels. The internet, as convergent carrier medium, is increasingly taking on a central role for additional media. Classical linear TV is still important, but for some audiences it has been developing from a primary medium to a secondary medium. Owing to the growing melding of classical-linear TV contents with online offerings (e.g. video-on-demand platforms or Web–TV, a great dynamic can be seen which has triggered numerous discussions about the future of TV for some time now. This article will summarize the results of two different audience studies. Film and television shows are meanwhile distributed online via Video-on-Demand platforms such as Netflix or Amazon Prime Video. The first audience study has dealt with the use of VoD-platforms in Germany investigating user rituals, user motivation to watch films and TV shows on these platforms, and the meaning of VoD in everyday life. Most of the participants in this study reported that they mainly watch TV drama series at Netflix or Amazon Prime. Therefore, the second audience study focused the online use of television drama series of individuals and couples elaborating the phenomenon of binge watching. In relating the audience practice to the new structures of the television market the article will shed light on the future of television.

  20. Physical Activity, TV Watching Time, Sleeping, and Risk of Obesity and Hyperglycemia in the Offspring of Mothers with Gestational Diabetes Mellitus

    Science.gov (United States)

    Zhang, Tao; Wang, Peng; Liu, Huikun; Wang, Leishen; Li, Weiqin; Leng, Junhong; Li, Nan; Zhang, Shuang; Qi, Lu; Tuomilehto, Jaakko; Yu, Zhijie; Yang, Xilin; Hu, Gang

    2017-01-01

    We investigated the association of physical activity, TV watching time, sleeping time with the risks of obesity and hyperglycemia among 1263 offspring aged 1-5 years of mothers with gestational diabetes (GDM) in a cross-sectional study. Logistic regression models were used to obtain the odd ratios (ORs) (95% confidence intervals [CI]) of childhood obesity and hyperglycemia associated with different levels of indoor activity, outdoor activity, TV watching, and sleeping time. The multivariable-adjusted ORs of obesity based on different levels of TV watching time (0, <1.0, and ≥1.0 hour/day) were 1.00, 1.21 (95% CI 0.72-2.05), and 2.20 (95% CI 1.33-3.63) (Ptrend = 0.003), respectively. The multivariable-adjusted ORs of hyperglycemia based on different levels of indoor activity (<5.0, 5.0-6.9, and ≥7.0 hours/day) were 1.00, 0.74 (95% CI 0.45-1.21), and 0.49 (95% CI 0.28-0.84) (Ptrend = 0.034), respectively. The multivariable-adjusted ORs of hyperglycemia associated with different levels of sleeping time (<11.0, 11.0-11.9, and ≥12.0 hours/day) were 1.00, 0.67 (95% CI 0.42-1.05), and 0.39 (95% CI 0.23-0.67) (Ptrend = 0.003), respectively. The present study indicated a positive association of TV watching with the risk of obesity, and an inverse association of either indoor activity or sleeping time with the risk of hyperglycemia among offspring born to GDM mothers in Tianjin, China.

  1. The Application of School Watching Method to Increase the Earthquake Disaster Knowledge of Primary School Students

    Directory of Open Access Journals (Sweden)

    Sri Adelila Sari

    2015-08-01

    Full Text Available The study entitled "The Application of School Watching to Increase the Earthquake Disaster Knowledge of Primary School Students, MIN Blang Mancung, Aceh" was aimed to describe the students' knowledge of the different dangerous objects in the face of an earthquake. The approach used in this study was qualitative and quantitative. The type of study was descriptive. Subjects used were as many as 30 students MIN Blang Mancung, Aceh. The method used was an experimental, which was divided into two classes, namely the experimental and control classes. Data collection technique was using questionnaires, which included the questions about common dangerous objects, dangerous objects in the class and also in the school yard. The results showed that there was a significant effect on students' knowledge before and after the implementation of the method School Watching. In addition, the knowledge of students toward the dangerous objects was found to be significant different between control and experimental class.

  2. Social Factors in Aesthetics: Social Conformity Pressure and a Sense of Being Watched Affect Aesthetic Judgments.

    Science.gov (United States)

    Hesslinger, Vera M; Carbon, Claus-Christian; Hecht, Heiko

    2017-01-01

    The present study is a first attempt to experimentally test the impact of two specific social factors, namely social conformity pressure and a sense of being watched, on participants' judgments of the artistic quality of aesthetic objects. We manipulated conformity pressure with a test form in which a photograph of each stimulus was presented together with unanimously low (downward pressure) or high quality ratings (upward pressure) of three would-be previous raters. Participants' sense of being watched was manipulated by testing each of them in two settings, one of which contained an eyespots stimulus. Both social factors significantly affected the participants' judgments-unexpectedly, however, with conformity pressure only working in the downward direction and eyespots leading to an overall downward shift in participants' judgments. Our findings indicate the relevance of including explicit and implicit social factors in aesthetics research, thus also reminding us of the limitations of overly reductionist approaches to investigating aesthetic perception and experience.

  3. Low Carbon Footprint Routes for Bird Watching

    Directory of Open Access Journals (Sweden)

    Wei-Ta Fang

    2015-03-01

    Full Text Available Bird watching is one of many recreational activities popular in ecotourism. Its popularity, therefore, prompts the need for studies on energy conservation. One such environmentally friendly approach toward minimizing bird watching’s ecological impact is ensuring a reduced carbon footprint by using an economic travel itinerary comprising a series of connected routes between tourist attractions that minimizes transit time. This study used a travel-route planning approach using geographic information systems to detect the shortest path, thereby solving the problems associated with time-consuming transport. Based on the results of road network analyses, optimal travel-route planning can be determined. These methods include simulated annealing (SA and genetic algorithms (GA. We applied two algorithms in our simulation research to detect which one is an appropriate algorithm for running carbon-routing algorithms at the regional scale. SA, which is superior to GA, is considered an excellent approach to search for the optimal path to reduce carbon dioxide and high gasoline fees, thereby controlling travel time by using the shortest travel routes.

  4. Watchful waiting as a treatment strategy for patients with a ventral hernia appears to be safe

    DEFF Research Database (Denmark)

    Kokotovic, D; Sjølander, H; Gögenur, I

    2016-01-01

    PURPOSE: Due to risks of postoperative morbidity and recurrence some patients with a ventral hernia are not offered surgical repair. There is limited data on the rate and consequences of a watchful waiting (WW) strategy for these patients. The objective of this cohort study was to analyse outcome...

  5. Watching films with magical content facilitates creativity in children.

    Science.gov (United States)

    Subbotsky, Eugene; Hysted, Claire; Jones, Nicola

    2010-08-01

    Two experiments examined the possible link between magical thinking and creativity in preschool children. In Exp. 1, 4- and 6-yr.-old children were shown a film with either a magical or nonmagical theme. Results indicated that the mean scores of children shown the magical film was significantly higher than that of children watching the nonmagical film on the majority of subsequent creativity tests for both age groups. This trend was also found for 6-yr.-olds' drawings of impossible items. In Exp. 2, Exp. 1 was replicated successfully with 6- and 8-yr.-old children. Exposing children to a film with a magical theme did not affect their beliefs about magic. The results were interpreted to accentuate the role of magical thinking in children's cognitive development. Classroom implications of the results were also discussed.

  6. Biomonitoring of physiological status and cognitive performance of underway submariners undergoing a novel watch-standing schedule

    Science.gov (United States)

    Duplessis, C. A.; Cullum, M. E.; Crepeau, L. J.

    2005-05-01

    Submarine watch-standers adhere to a 6 hour-on, 12 hour-off (6/12) watch-standing schedule, yoking them to an 18-hr day, engendering circadian desynchronization and chronic sleep deprivation. Moreover, the chronic social crowding, shift work, and confinement of submarine life provide additional stressors known to correlate with elevated secretory immunoglobulin A (sIgA) and cortisol levels, reduced performance, immunologic dysfunction, malignancies, infections, gastrointestinal illness, coronary disease, anxiety, and depression. We evaluated an alternative, compressed, fixed work schedule designed to enhance circadian rhythm entrainment, sleep hygiene, performance, and health on 10 underway submariners, who followed the alternative and 6/12 schedules for approximately 2 weeks each. We measured subjects" sleep, cognitive performance, and salivary biomarker levels. Pilot analysis of the salivary data on one subject utilizing ELISA suggests elevated biomarker levels of stress. Average PM cortisol levels were 0.2 μg/L (normal range: nondetectable - 0.15 μg/L), and mean sIgA levels were 562 μg/ml (normal range: 100-500 μg/ml). Future research exploiting real-time salivary bioassays, via fluorescent polarimetry technology, identified by the Office of Naval Research (ONR) as a future Naval requirement, allows researchers to address correlations between stress-induced elaboration of salivary biomarkers with physiological and performance decrements, thereby fostering insight into the underway submariner"s psychoimmunological status. This may help identify strategies that enhance resilience to stressors. Specifically, empirically-based modeling can identify optimal watch-standing schedules and stress-mitigating procedures -- within the operational constraints of the submarine milieu and the mission --that foster improved circadian entrainment and reduced stress reactivity, enhancing physiological health, operational performance, safety, and job satisfaction.

  7. Watching Nanoscale Self-Assembly Kinetics of Gold Prisms in Liquids

    Science.gov (United States)

    Kim, Juyeong; Ou, Zihao; Jones, Matthew R.; Chen, Qian

    We use liquid-phase transmission electron microscopy to watch self-assembly of gold triangular prisms into polymer-like structures. The in situ dynamics monitoring enabled by liquid-phase transmission electron microscopy, single nanoparticle tracking, and the marked conceptual similarity between molecular reactions and nanoparticle self-assembly combined elucidate the following mechanistic understanding: a step-growth polymerization based assembly statistics, kinetic pathways sampling particle curvature dependent energy minima and their interconversions, and directed assembly into polymorphs (linear or cyclic chains) through in situ modulation of the prism bonding geometry. Our study bridges the constituent kinetics on the molecular and nanoparticle length scales, which enriches the design rules in directed self-assembly of anisotropic nanoparticles.

  8. Intimate partner violence in the Canadian territorial north: perspectives from a literature review and a media watch

    Directory of Open Access Journals (Sweden)

    Pertice Moffitt

    2013-08-01

    Full Text Available Introduction. Family violence is a complex, multidimensional and pervasive presence in many Aboriginal communities. Although practitioners acknowledge that intimate partner violence (IPV is a grave concern in the North, as in other jurisdictions in Canada, there is a paucity of literature about IPV and the local response to that violence. Objective. The purpose of this study is to report on a synthesis of Northern Territorial literature and a 3-year media watch conducted in the Canadian territories. Design. This review is part of a multidisciplinary 5-year study occurring in the Northwest Territories (NT and northern regions of the Prairie Provinces of Canada. The methods included a review of the literature through CINAHL, PubMed, Academic Search Complete, Social Sciences Index and JSTOR (1990–2012 combined with a media watch from 2009 to 2012. A thematic content analysis was completed. Results. Themes included: colonization; alcohol and substance use; effects of residential schooling; housing inadequacies; help-seeking behaviours; and gaps within the justice system. Identified themes from the media watch were: murders from IPV; reported assaults and criminal charges; emergency protection orders; and awareness campaigns and prevention measures. Conclusion. When synthesized, the results of the literature review and media surveillance depict a starting context and description of IPV in the Canadian territories. There are many questions left unanswered which build support for the necessity of the current research, outline the public outcry for action in local media and identify the current published knowledge about IPV.

  9. Local Recurrence After Complete Clinical Response and Watch and Wait in Rectal Cancer After Neoadjuvant Chemoradiation: Impact of Salvage Therapy on Local Disease Control

    Energy Technology Data Exchange (ETDEWEB)

    Habr-Gama, Angelita, E-mail: gamange@uol.com.br [Angelita and Joaquim Gama Institute, São Paulo (Brazil); University of São Paulo School of Medicine, São Paulo (Brazil); Gama-Rodrigues, Joaquim [Angelita and Joaquim Gama Institute, São Paulo (Brazil); University of São Paulo School of Medicine, São Paulo (Brazil); São Julião, Guilherme P. [Angelita and Joaquim Gama Institute, São Paulo (Brazil); Colorectal Surgery Division, University of São Paulo School of Medicine, São Paulo (Brazil); Proscurshim, Igor; Sabbagh, Charles; Lynn, Patricio B. [Angelita and Joaquim Gama Institute, São Paulo (Brazil); Perez, Rodrigo O. [Angelita and Joaquim Gama Institute, São Paulo (Brazil); Ludwig Institute for Cancer Research, São Paulo Branch (Brazil)

    2014-03-15

    Purpose: To review the risk of local recurrence and impact of salvage therapy after Watch and Wait for rectal cancer with complete clinical response (cCR) after chemoradiation therapy (CRT). Methods and Materials: Patients with cT2-4N0-2M0 distal rectal cancer treated with CRT (50.4-54 Gy + 5-fluorouracil-based chemotherapy) and cCR at 8 weeks were included. Patients with cCR were enrolled in a strict follow-up program with no immediate surgery (Watch and Wait). Local recurrence-free survival was compared while taking into account Watch and Wait strategy alone and Watch and Wait plus salvage. Results: 90 of 183 patients experienced cCR at initial assessment after CRT (49%). When early tumor regrowths (up to and including the initial 12 months of follow-up) and late recurrences were considered together, 28 patients (31%) experienced local recurrence (median follow-up time, 60 months). Of those, 26 patients underwent salvage therapy, and 2 patients were not amenable to salvage. In 4 patients, local re-recurrence developed after Watch and Wait plus salvage. The overall salvage rate for local recurrence was 93%. Local recurrence-free survival at 5 years was 69% (all local recurrences) and 94% (after salvage procedures). Thirteen patients (14%) experienced systemic recurrence. The 5-year cancer-specific overall survival and disease-free survival for all patients (including all recurrences) were 91% and 68%, respectively. Conclusions: Local recurrence may develop in 31% of patients with initial cCR when early regrowths (≤12 months) and late recurrences are grouped together. More than half of these recurrences develop within 12 months of follow-up. Salvage therapy is possible in ≥90% of recurrences, leading to 94% local disease control, with 78% organ preservation.

  10. Local Recurrence After Complete Clinical Response and Watch and Wait in Rectal Cancer After Neoadjuvant Chemoradiation: Impact of Salvage Therapy on Local Disease Control

    International Nuclear Information System (INIS)

    Habr-Gama, Angelita; Gama-Rodrigues, Joaquim; São Julião, Guilherme P.; Proscurshim, Igor; Sabbagh, Charles; Lynn, Patricio B.; Perez, Rodrigo O.

    2014-01-01

    Purpose: To review the risk of local recurrence and impact of salvage therapy after Watch and Wait for rectal cancer with complete clinical response (cCR) after chemoradiation therapy (CRT). Methods and Materials: Patients with cT2-4N0-2M0 distal rectal cancer treated with CRT (50.4-54 Gy + 5-fluorouracil-based chemotherapy) and cCR at 8 weeks were included. Patients with cCR were enrolled in a strict follow-up program with no immediate surgery (Watch and Wait). Local recurrence-free survival was compared while taking into account Watch and Wait strategy alone and Watch and Wait plus salvage. Results: 90 of 183 patients experienced cCR at initial assessment after CRT (49%). When early tumor regrowths (up to and including the initial 12 months of follow-up) and late recurrences were considered together, 28 patients (31%) experienced local recurrence (median follow-up time, 60 months). Of those, 26 patients underwent salvage therapy, and 2 patients were not amenable to salvage. In 4 patients, local re-recurrence developed after Watch and Wait plus salvage. The overall salvage rate for local recurrence was 93%. Local recurrence-free survival at 5 years was 69% (all local recurrences) and 94% (after salvage procedures). Thirteen patients (14%) experienced systemic recurrence. The 5-year cancer-specific overall survival and disease-free survival for all patients (including all recurrences) were 91% and 68%, respectively. Conclusions: Local recurrence may develop in 31% of patients with initial cCR when early regrowths (≤12 months) and late recurrences are grouped together. More than half of these recurrences develop within 12 months of follow-up. Salvage therapy is possible in ≥90% of recurrences, leading to 94% local disease control, with 78% organ preservation

  11. Seahorses in focus: local ecological knowledge of seahorse-watching operators in a tropical estuary

    OpenAIRE

    Ternes, Maria L. F.; Gerhardinger, Leopoldo C.; Schiavetti, Alexandre

    2016-01-01

    Background Seahorses are endangered teleost fishes under increasing human pressures worldwide. In Brazil, marine conservationists and policy-makers are thus often skeptical about the viability of sustainable human-seahorse interactions. This study focuses on local ecological knowledge on seahorses and the implications of their non-lethal touristic use by a coastal community in northeastern Brazil. Community-based seahorse-watching activities have been carried out in Maraca?pe village since 19...

  12. Learning Science Through Digital Video: Views on Watching and Creating Videos

    Science.gov (United States)

    Wade, P.; Courtney, A. R.

    2013-12-01

    In science, the use of digital video to document phenomena, experiments and demonstrations has rapidly increased during the last decade. The use of digital video for science education also has become common with the wide availability of video over the internet. However, as with using any technology as a teaching tool, some questions should be asked: What science is being learned from watching a YouTube clip of a volcanic eruption or an informational video on hydroelectric power generation? What are student preferences (e.g. multimedia versus traditional mode of delivery) with regard to their learning? This study describes 1) the efficacy of watching digital video in the science classroom to enhance student learning, 2) student preferences of instruction with regard to multimedia versus traditional delivery modes, and 3) the use of creating digital video as a project-based educational strategy to enhance learning. Undergraduate non-science majors were the primary focus group in this study. Students were asked to view video segments and respond to a survey focused on what they learned from the segments. Additionally, they were asked about their preference for instruction (e.g. text only, lecture-PowerPoint style delivery, or multimedia-video). A majority of students indicated that well-made video, accompanied with scientific explanations or demonstration of the phenomena was most useful and preferred over text-only or lecture instruction for learning scientific information while video-only delivery with little or no explanation was deemed not very useful in learning science concepts. The use of student generated video projects as learning vehicles for the creators and other class members as viewers also will be discussed.

  13. Is the "Idiot's Box" Raising Idiocy? Early and Middle Childhood Television Watching and Child Cognitive Outcome

    Science.gov (United States)

    Munasib, Abdul; Bhattacharya, Samrat

    2010-01-01

    There is widespread belief that exposure to television has harmful effects on children's cognitive development. Most studies that point to a negative correlation between hours of television watching and cognitive outcomes, fail to establish causality. Using the National Longitudinal Survey of Youth (NLSY) we study young children between 5 and 10…

  14. An analysis of CCD images of the coma of Comet Halley. Final report, October 1989-September 1990

    International Nuclear Information System (INIS)

    Combi, M.

    1990-12-01

    The analysis of selected CCD images of the coma of comet P/Halley is presented. The images were taken using specially designed filters that isolate regions of a comet's spectrum such that only sunlight which has been scattered by the dust in the coma is recorded. The modeling analysis objective is to make use of the skills developed in the development of Monte Carlo particle trajectory models for the distributions of gas species in cometary comae and to use those models as a basis for a new dust coma model. This model will include a self-consistant picture of the time-dependent dusty-gas dynamics of the inner coma and the three-dimensional time-dependent trajectories of the dust particles under the influence of solar gravity and solar radiation pressure in the outer coma. The model is intended to be used as a tool to analyze selected images from the two sets of CCD images with the hope that it will help the understanding of the effects of a number of important processes on the spatial morphology of the observed dust coma. The processes of importance to the observed dust coma include: (1) the dust particle size distribution function; (2) the terminal velocities of various sized dust particles in the inner coma; (3) the radiation scattering properties of dust particles, which are important both in terms of the observe scattered radiation and the radiation pressure acceleration on dust particles; (4) the fragmentation and/or vaporization of dust particles; and (5) the relative importance of CHON and silicate dust particles as they contribute both to the dusty-gasdynamics in the inner coma (that produce the dust particle terminal velocities) and to the observed spatial morphology on the outer dust coma

  15. Young children in urban areas: Links among neighborhood characteristics, weight status, outdoor play, and television watching

    Science.gov (United States)

    Kimbro, Rachel Tolbert; Brooks-Gunn, Jeanne; McLanahan, Sara

    2011-01-01

    Although research consistently demonstrates a link between residential context and physical activity for adults and adolescents, less is known about young children’s physical activity. Using data from the U.S. Fragile Families and Child Wellbeing Study (N=1822, 51% male), we explored whether outdoor play and television watching were associated with children’s body mass indexes (BMIs) at age five using OLS regression models, controlling for a wide array of potential confounders, including maternal BMI. We also tested whether subjective and objective neighborhood measures - socioeconomic status (from U.S. Census tract data), type of dwelling, perceived collective efficacy, and interviewer-assessed physical disorder of the immediate environment outside the home -were associated with children’s activities, using negative binomial regression models. Overall, 19% of the sample were overweight (between the 85th and 95th percentiles), and 16% were obese (≥95th percentile). Hours of outdoor play were negatively associated with BMI, and hours of television were positively associated with BMI. Moreover, a ratio of outdoor play to television time was a significant predictor of BMI. Higher maternal perceptions of neighborhood collective efficacy were associated with more hours of outdoor play, fewer hours of television viewing, and more trips to a park or playground. In addition, we found that neighborhood physical disorder was associated with both more outdoor play and more television watching. Finally, contrary to expectations, we found that children living in public housing had significantly more hours of outdoor play and watched more television, than other children. We hypothesize that poorer children may have more unstructured time, which they fill with television time but also with outdoor play time; and that children in public housing may be likely to have access to play areas on the grounds of their housing facilities. PMID:21324574

  16. Young children in urban areas: links among neighborhood characteristics, weight status, outdoor play, and television watching.

    Science.gov (United States)

    Kimbro, Rachel Tolbert; Brooks-Gunn, Jeanne; McLanahan, Sara

    2011-03-01

    Although research consistently demonstrates a link between residential context and physical activity for adults and adolescents, less is known about young children's physical activity. Using data from the U.S. Fragile Families and Child Wellbeing Study (N=1822, 51% male), we explored whether outdoor play and television watching were associated with children's body mass indexes (BMIs) at age five using OLS regression models, controlling for a wide array of potential confounders, including maternal BMI. We also tested whether subjective and objective neighborhood measures - socioeconomic status (from U.S. Census tract data), type of dwelling, perceived collective efficacy, and interviewer-assessed physical disorder of the immediate environment outside the home - were associated with children's activities, using negative binomial regression models. Overall, 19% of the sample were overweight (between the 85th and 95th percentiles), and 16% were obese (≥ 95th percentile). Hours of outdoor play were negatively associated with BMI, and hours of television were positively associated with BMI. Moreover, a ratio of outdoor play to television time was a significant predictor of BMI. Higher maternal perceptions of neighborhood collective efficacy were associated with more hours of outdoor play, fewer hours of television viewing, and more trips to a park or playground. In addition, we found that neighborhood physical disorder was associated with both more outdoor play and more television watching. Finally, contrary to expectations, we found that children living in public housing had significantly more hours of outdoor play and watched more television, than other children. We hypothesize that poorer children may have more unstructured time, which they fill with television time but also with outdoor play time; and that children in public housing may be likely to have access to play areas on the grounds of their housing facilities. Copyright © 2011 Elsevier Ltd. All rights

  17. Watching Faults Grow in Sand

    Science.gov (United States)

    Cooke, M. L.

    2015-12-01

    Accretionary sandbox experiments provide a rich environment for investigating the processes of fault development. These experiments engage students because 1) they enable direct observation of fault growth, which is impossible in the crust (type 1 physical model), 2) they are not only representational but can also be manipulated (type 2 physical model), 3) they can be used to test hypotheses (type 3 physical model) and 4) they resemble experiments performed by structural geology researchers around the world. The structural geology courses at UMass Amherst utilize a series of accretionary sandboxes experiments where students first watch a video of an experiment and then perform a group experiment. The experiments motivate discussions of what conditions they would change and what outcomes they would expect from these changes; hypothesis development. These discussions inevitably lead to calculations of the scaling relationships between model and crustal fault growth and provide insight into the crustal processes represented within the dry sand. Sketching of the experiments has been shown to be a very effective assessment method as the students reveal which features they are analyzing. Another approach used at UMass is to set up a forensic experiment. The experiment is set up with spatially varying basal friction before the meeting and students must figure out what the basal conditions are through the experiment. This experiment leads to discussions of equilibrium and force balance within the accretionary wedge. Displacement fields can be captured throughout the experiment using inexpensive digital image correlation techniques to foster quantitative analysis of the experiments.

  18. The Watching-Eye Effect on Prosocial Lying

    Directory of Open Access Journals (Sweden)

    Ryo Oda

    2015-07-01

    Full Text Available Evidence shows that people tend to behave prosocially when they are in the presence of images depicting eyes. There are two proximate causes of the eyes effect. One involves positive motivation to gain future reward and the other involves negative motivation to avoid violating a norm. Although several studies have suggested that positive motivation is a strong candidate, these studies were unable to distinguish between adherence to norms and prosocial behavior. We investigated the watching-eyes effect in an experimental setting to determine whether the tendency of humans to violate norms voluntarily could be understood as prosocial behavior. We compared the tendency to tell “prosocial lies” in the presence of a depiction of stylized eyes (eyes condition with that involving no such depiction (control condition. Under the control condition, participants tended to tell lies that benefitted others, whereas the tendency toward prosocial lying disappeared under the eyes condition. This suggests that the desire to avoid violating norms by being honest is stronger than the desire to pursue a good reputation by demonstrating generosity when such violation might lead to serious costs.

  19. Power Watch: Increasing Transparency and Accessibility of Data in the Global Power Sector to Accelerate the Transition to a Lower Carbon Economy

    Science.gov (United States)

    Hennig, R. J.; Friedrich, J.; Malaguzzi Valeri, L.; McCormick, C.; Lebling, K.; Kressig, A.

    2016-12-01

    The Power Watch project will offer open data on the global electricity sector starting with power plants and their impacts on climate and water systems; it will also offer visualizations and decision making tools. Power Watch will create the first comprehensive, open database of power plants globally by compiling data from national governments, public and private utilities, transmission grid operators, and other data providers to create a core dataset that has information on over 80% of global installed capacity for electrical generation. Power plant data will at a minimum include latitude and longitude, capacity, fuel type, emissions, water usage, ownership, and annual generation. By providing data that is both comprehensive, as well as making it publically available, this project will support decision making and analysis by actors across the economy and in the research community. The Power Watch research effort focuses on creating a global standard for power plant information, gathering and standardizing data from multiple sources, matching information from multiple sources on a plant level, testing cross-validation approaches (regional statistics, crowdsourcing, satellite data, and others) and developing estimation methodologies for generation, emissions, and water usage. When not available from official reports, emissions, annual generation, and water usage will be estimated. Water use estimates of power plants will be based on capacity, fuel type and satellite imagery to identify cooling types. This analysis is being piloted in several states in India and will then be scaled up to a global level. Other planned applications of of the Power Watch data include improving understanding of energy access, air pollution, emissions estimation, stranded asset analysis, life cycle analysis, tracking of proposed plants and curtailment analysis.

  20. Watch-and-Comment as an Approach to Collaboratively Annotate Points of Interest in Video and Interactive-TV Programs

    Science.gov (United States)

    Pimentel, Maria Da Graça C.; Cattelan, Renan G.; Melo, Erick L.; Freitas, Giliard B.; Teixeira, Cesar A.

    In earlier work we proposed the Watch-and-Comment (WaC) paradigm as the seamless capture of multimodal comments made by one or more users while watching a video, resulting in the automatic generation of multimedia documents specifying annotated interactive videos. The aim is to allow services to be offered by applying document engineering techniques to the multimedia document generated automatically. The WaC paradigm was demonstrated with a WaCTool prototype application which supports multimodal annotation over video frames and segments, producing a corresponding interactive video. In this chapter, we extend the WaC paradigm to consider contexts in which several viewers may use their own mobile devices while watching and commenting on an interactive-TV program. We first review our previous work. Next, we discuss scenarios in which mobile users can collaborate via the WaC paradigm. We then present a new prototype application which allows users to employ their mobile devices to collaboratively annotate points of interest in video and interactive-TV programs. We also detail the current software infrastructure which supports our new prototype; the infrastructure extends the Ginga middleware for the Brazilian Digital TV with an implementation of the UPnP protocol - the aim is to provide the seamless integration of the users' mobile devices into the TV environment. As a result, the work reported in this chapter defines the WaC paradigm for the mobile-user as an approach to allow the collaborative annotation of the points of interest in video and interactive-TV programs.

  1. 78 FR 44957 - Agency Information Collection Activities: BioWatch Filter Holder Log, Filter Holder Log DHS Form...

    Science.gov (United States)

    2013-07-25

    ... engaged in the process of determining if any criminal activity has taken place. The Federal Bureau of... of written records is included in Attachment 1. Collection of written records establishing chain of... (Attachment 2). The FBI requirement levied on the BioWatch Program is consistent with Section 7 of the FBI...

  2. Watching Eyes and Living up to Expectations: Unkind, Not Kind, Eyes Increase First Mover Cooperation in a Sequential Prisoner’s Dilemma

    Directory of Open Access Journals (Sweden)

    Loren Pauwels

    2017-04-01

    Full Text Available (1 Background: Why and when images of watching eyes encourage prosocial behavior is still subject to discussion, and two recent meta-analyses show no effect of watching eyes on generosity. This study aims to discern the effect of watching eyes of different valence on two separate aspects of prosocial behavior, and additionally investigates whether individuals’ social value orientation moderates the effect of eyes. (2 Methods: Individuals take on the role of either a first or second mover in an incentivized, anonymous sequential prisoner’s dilemma (n = 247, a two-person game which separates the need to form expectations about the other player (first mover cooperation, trust from the motive of greed (second mover cooperation, reciprocity. During decision-making, a picture of either kind eyes, unkind eyes, or a control picture is presented above each decision matrix. (3 Results: The results indicate that unkind eyes, and not kind eyes, significantly boost first mover cooperation. In contrast, neither type of eye cues increase second mover cooperation. Social value orientation does not moderate these effects. (4 Conclusions: Thus, the data suggest that the valence of eye cues matters, and we propose that unkind eyes urge first movers to live up to the interaction partner’s expectations.

  3. Design and Implementation of Ubiquitous Health System U-Health Using Smart-Watches Sensors

    Science.gov (United States)

    Razavi Termeh, V.; Sadeghi Niaraki, A.

    2015-12-01

    Today as diseases grow rapidly, the responsibilities of the health clinics in giving services to patients increase and patients have to be more monitored and controlled. Remote systems of monitoring patients result in reducing cost, ease of movement, and also persistent control of patients by their doctors, so that patient can be monitored without need to go to the clinic. Recent advances in the field of ubiquitous sciences as well as using smartphones have resulted in increasingly use of this devices in remote monitoring of patients. The aim of this paper is to design and implement a ubiquitous health system using smartphones and sensors of smart-watches. This is accomplished through the information sent to the smartphone from the sensors of the watch, e.g. heart beat measurement sensor and ultraviolet ray. Then, this information is analyzed in the smartphone and some information based on the position of the patient and the path of him/her using GIS analyses as well as the information about the health level of the patient is sent to the doctor via SMS or phone call. Unnatural heart beats can be resulted in diseases such as Heart Failure and Arterial Fibrillation. With the approach adopted in this study, the patient or the doctor could be aware of these diseases at any time. The proposed approach is a low cost, without need to complex and resilient equipment, system in ubiquitous health that does not limit the movement of the patient.

  4. The experience of adults who choose watchful waiting or active surveillance as an approach to medical treatment: a qualitative systematic review.

    Science.gov (United States)

    Rittenmeyer, Leslie; Huffman, Dolores; Alagna, Michael; Moore, Ellen

    2016-02-01

    "Watchful waiting" or "active surveillance" is an alternative approach in the medical management of certain diseases. Most often considered appropriate as an approach to treatment for low-risk prostate cancer, it is also found in the literature in breast cancer surveillance, urinary lithiasis, lymphocytic leukemia, depression and small renal tumors. This systematic review sought to:Identify and synthesize the best available international evidence on the experience of adults who choose watchful waiting or active surveillance as an approach to medical treatment. To this end the questions addressed in this review were:1. How do patients who have chosen watchful waiting or active surveillance describe the process of coming to the decision?2. What were the factors that influenced their decision to choose?3. How do patients who have chosen watchful waiting or active surveillance describe the experience? Male or female patients, 18 years or older, who experience the phenomenon of choosing or not choosing watchful waiting or active surveillance as a treatment approach.The phenomena of interest were accounts of the experiences of adult patients who choose watchful waiting or active surveillance as an approach to medical treatment.This review considered studies that focused on qualitative data including, but not limited to, designs such as phenomenology, grounded theory, ethnography, action research and critical theory. Mixed method studies with narrative description and patient voice were also considered. Grey literature such as research reports and dissertations were also included. The search strategy aimed to find both published and unpublished studies through electronic databases, reference lists, and the World Wide Web. Extensive searches were undertaken of relevant databases to include CINAHL, PubMed, SCOPUS and PsycINFO. A three-step search strategy was used in each component of the review. Studies were limited to English language papers. The search considered papers

  5. ANSTO radon monitoring within the WMO global atmosphere watch programme

    International Nuclear Information System (INIS)

    Zahorowski, W.; Chambers, S.; Sisoutham, O.; Werczynski, S.

    2003-01-01

    A brief overview of results from the ANSTO radon programmes at the Cape Grim (Tasmania) and Mauna Loa Observatory (Hawaii), World Meteorological Organisation Global Atmosphere Watch stations it presented. At Cape Grim, a 100 mBq m 3 threshold on radon concentration observations has proven to be a suitable criterion for Baseline monitoring. Furthermore, analysis of the Cape Grim Baseline radon data has enabled the characterisation of the oceanic radon flux over the Southern Ocean Cape Grim fetch region. Radon observations at the Mauna Loa Observatory, in conjunction with back trajectory analysis, have helped to identify the source regions of the most pervasive pollution events in the atmosphere of the Pacific Basin. The seasonal variability in the strength of terrestrial influence on Pacific air masses has also been characterised

  6. Fatores associados ao hábito de assistir TV em excesso entre adolescentes Factors associated with excessive television watching among adolescents

    Directory of Open Access Journals (Sweden)

    Paula Dal Bó Campagnolo

    2008-06-01

    Full Text Available OBJETIVO: Avaliar a freqüência com que os adolescentes assistem televis��o na região Sul do Brasil e quais fatores estão associados a esse comportamento. MÉTODOS: Estudo transversal, com 722 adolescentes entre 10 e 19 anos. Foi calculado a média de horas diárias que os adolescentes assistiam televisão. Foi realizada análise de regressão logística para analisar possível associação entre fatores sociodemográfico, antropométricos, atividade física, sexo e idade, com o hábito de assistir mais do que 4 horas diárias de televisão. RESULTADOS: Entre os adolescentes estudados, 41,1% assistiam mais do 4 horas de TV por dia. A prevalência de adolescentes que assistiam > 4h de TV foi maior entre aqueles com menos de 16 anos. Ser filho de mãe com escolaridade maior do que 8 anos (OR 1,9; IC 1,25-2,89 e possuir circunferência da cintura maior do que o percentil 80 (OR 2,77; IC 1,33-5,77 foi positivamente associado ao hábito de assistir televisão mais do que 4 horas diárias. CONCLUSÕES: Maior escolaridade materna e circunferência da cintura maior do que o percentil 80 estão associados ao comportamento de assistir TV em excesso entre os adolescentes. Esses achados devem ser utilizados para direcionar a elaboração de programas de saúde pública, especialmente por meio das escolas, enfocando adolescentes com faixa etária entre 10 e 15 anos, assim como devem servir de alerta para os profissionais de saúde e educadores.OBJECTIVE: to evaluate the frequency adolescents watch TV in southern Brazil and which factors are associated with this behavior. METHODS: This was a cross-sectional study. The sample consisted of 722 adolescents between 10 and 19 years of age. Logistic regression analysis was used to verify association between socio-demographic and anthropometric factors, physical activity, age and sex with the adolescents who watched TV for more than four daily hours. RESULTS: Forty-one percent of the adolescents watched more

  7. Part Two: Learning Science Through Digital Video: Student Views on Watching and Creating Videos

    Science.gov (United States)

    Wade, P.; Courtney, A. R.

    2014-12-01

    The use of digital video for science education has become common with the wide availability of video imagery. This study continues research into aspects of using digital video as a primary teaching tool to enhance student learning in undergraduate science courses. Two survey instruments were administered to undergraduate non-science majors. Survey One focused on: a) What science is being learned from watching science videos such as a "YouTube" clip of a volcanic eruption or an informational video on geologic time and b) What are student preferences with regard to their learning (e.g. using video versus traditional modes of delivery)? Survey Two addressed students' perspectives on the storytelling aspect of the video with respect to: a) sustaining interest, b) providing science information, c) style of video and d) quality of the video. Undergraduate non-science majors were the primary focus group in this study. Students were asked to view video segments and respond to a survey focused on what they learned from the segments. The storytelling aspect of each video was also addressed by students. Students watched 15-20 shorter (3-15 minute science videos) created within the last four years. Initial results of this research support that shorter video segments were preferred and the storytelling quality of each video related to student learning.

  8. Does feedback on daily activity level from a Smart watch during inpatient stroke rehabilitation increase physical activity levels? Study protocol for a randomized controlled trial.

    Science.gov (United States)

    Dong, Yun; Steins, Dax; Sun, Shanbin; Li, Fei; Amor, James D; James, Christopher J; Xia, Zhidao; Dawes, Helen; Izadi, Hooshang; Cao, Yi; Wade, Derick T

    2018-03-09

    Practicing activities improves recovery after stroke, but many people in hospital do little activity. Feedback on activity using an accelerometer is a potential method to increase activity in hospital inpatients. This study's goal is to investigate the effect of feedback, enabled by a Smart watch, on daily physical activity levels during inpatient stroke rehabilitation and the short-term effects on simple functional activities, primarily mobility. A randomized controlled trial will be undertaken within the stroke rehabilitation wards of the Second Affiliated hospital of Anhui University of Traditional Chinese Medicine, Hefei, China. The study participants will be stroke survivors who meet inclusion criteria for the study, primarily: able to participate, no more than 4 months after stroke and walking independently before stroke. Participants will all receive standard local rehabilitation and will be randomly assigned either to receive regular feedback about activity levels, relative to a daily goal tailored by the smart watch over five time periods throughout a working day, or to no feedback, but still wearing the Smart watch. The intervention will last up to 3 weeks, ending sooner if discharged. The data to be collected in all participants include measures of daily activity (Smart watch measure); mobility (Rivermead Mobility Index and 10-metre walking time); independence in personal care (Barthel Activities of Daily Living (ADL) Index); overall activities (the World Health Organization (WHO) Disability Assessment Scale, 12-item version); and quality of life (the Euro-Qol 5L5D). Data will be collected by assessors blinded to allocation of the intervention at baseline, 3 weeks or at discharge (whichever is the sooner); and a reduced data set will be collected at 12 weeks by telephone interview. The primary outcome will be change in daily accelerometer activity scores. Secondary outcomes are compliance and adherence to wearing the watch, and changes in mobility

  9. Connoisseurship as a Substitute for User Research? The Case of the Swiss Watch Industry

    OpenAIRE

    Matthew Sinclair

    2015-01-01

    Conventional wisdom holds that new product development is more successfully undertaken when design is user-led. An exception is the luxury goods sector, in which a common presentation of the brand is one where the customer should aspire to the vision of its designers. In such cases, the proprietor is often cast as a connoisseur, an expert in the brand’s history who is intuitively able to give vision and direction. Within the Swiss luxury watch industry, heritage and the illusion of exclusivit...

  10. Points of view: where do we look when we watch TV?

    Science.gov (United States)

    Brasel, S Adam; Gips, James

    2008-01-01

    How is our gaze dispersed across the screen when watching television? An exploratory eyetracker study with a custom-designed show indicated a very strong center-of-screen bias with gaze points following a roughly normal distribution peaked near screen center. Examining the show across time revealed that people were rarely all looking at the same location, and the amount of gaze dispersion within frames was highly variable. Different forms of programming yielded different levels of dispersion: static network 'bumpers' created the tightest visual groupings, and gaze dispersion for frames with show content was less than the dispersion for commercials. Advertising frames with brand logos generated higher dispersion than the non-branded advertisement portions, and repeated advertisements generated higher dispersion than their first-run counterparts.

  11. Antibodies to watch in 2018

    Science.gov (United States)

    Kaplon, Hélène; Reichert, Janice M.

    2018-01-01

    ABSTRACT The pace of antibody therapeutics development accelerated in 2017, and this faster pace is projected to continue through 2018. Notably, the annual number of antibody therapeutics granted a first approval in either the European Union (EU) or United States (US) reached double-digits (total of 10) for the first time in 2017. The 10 antibodies granted approvals are: brodalumab, dupilumab, sarilumab, guselkumab, benralizumab, ocrelizumab, inotuzumab ozogamicin, avelumab, duvalumab, and emicizumab. Brodalumab, however, had already been approved in Japan in 2016. As of December 1, 2017, nine antibody therapeutics (ibalizumab, burosumab, tildrakizumab, caplacizumab, erenumab, fremanezumab, galcanezumab, romosozumab, mogamulizumab) were in regulatory review in the EU or US, and regulatory actions on their marketing applications are expected by the end of 2018. Based on company announcements and estimated clinical study primary completion dates, and assuming the study results are positive, marketing applications for at least 12 antibody therapeutics that are now being evaluated in late-stage clinical studies may be submitted by the end of 2018. Of the 12 candidates, 8 are for non-cancer indications (lanadelumab, crizanlizumab, ravulizumab, eptinezumab, risankizumab, satralizumab, brolucizumab, PRO140) and 4 are for cancer (sacituzumab govitecan, moxetumomab pasudotox, cemiplimab, ublituximab). Additional antibody therapeutics to watch in 2018 include 19 mAbs undergoing evaluation in late-stage studies with primary completion dates in late 2017 or during 2018. Of these mAbs, 9 are for non-cancer indications (lampalizumab, roledumab, emapalumab, fasinumab, tanezumab, etrolizumab, NEOD001, gantenerumab, anifrolumab) and 10 are for cancer indications (tremelimumab, isatuximab, BCD-100, carotuximab, camrelizumab, IBI308, glembatumumab vedotin, mirvetuximab soravtansine, oportuzumab monatox, L19IL2/L19TNF). Positive clinical study results may enable marketing application

  12. The Parents' Parenting Patterns, Education, Jobs, and Assistance to Their Children in Watching Television, and Children's Aggressive Behavior

    Science.gov (United States)

    Purwati; Japar, Muhammad

    2016-01-01

    The objective of this present is to test the effects of the parents' parenting patterns, education, jobs, and assistance to children in watching television on the children's aggressive behavior. This present research employed a quantitative approach with an ex-post factor design. The data were collected from 175 parents of which the children…

  13. NOAA Coral Reef Watch Operational Near-real-time Twice-weekly Global 50 km Satellite Coral Bleaching Thermal Stress Monitoring Product Suite

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NOAA Coral Reef Watch program produces a suite of near-real-time global 50 km monitoring products, based on sea surface temperature (SST) observations from NOAA's...

  14. Oral steroids alone or followed by intranasal steroids versus watchful waiting in the management of otitis media with effusion.

    Science.gov (United States)

    Hussein, A; Fathy, H; Amin, S M; Elsisy, N

    2017-10-01

    To evaluate the effects of oral steroids alone or followed by intranasal steroids versus watchful waiting on the resolution of otitis media with effusion in children aged 2-11 years. A total of 290 children with bilateral otitis media with effusion were assigned to 3 groups: group A was treated with oral steroids followed by intranasal steroids, group B was treated with oral steroids alone and group C was managed with watchful waiting. Patients were evaluated with audiometry and tympanometry. The complete resolution rates of otitis media with effusion were higher in groups A and B than in group C at six weeks. There were no significant differences in otitis media with effusion resolution rates between the groups at three, six and nine months. Oral steroids lead only to a quick resolution of otitis media with effusion, with no long-term benefits. There was no benefit of using intranasal steroids in the management of otitis media with effusion.

  15. CropWatch agroclimatic indicators (CWAIs) for weather impact assessment on global agriculture

    Science.gov (United States)

    Gommes, René; Wu, Bingfang; Zhang, Ning; Feng, Xueliang; Zeng, Hongwei; Li, Zhongyuan; Chen, Bo

    2017-02-01

    CropWatch agroclimatic indicators (CWAIs) are a monitoring tool developed by the CropWatch global crop monitoring system in the Chinese Academy of Sciences (CAS; http://www.cropwatch.com.cn, Wu et al Int J Digital Earth 7(2):113-137, 2014, Wu et al Remote Sens 7:3907-3933, 2015). Contrary to most other environmental and agroclimatic indicators, they are "agronomic value-added", i.e. they are spatial values averaged over agricultural areas only and they include a weighting that enhances the contribution of the areas with the largest production potential. CWAIs can be computed for any time interval (starting from dekads) and yield one synthetic value per variable over a specific area and time interval, for instance a national annual value. Therefore, they are very compatible with socio-economic and other variables that are usually reported at regular time intervals over administrative units, such as national environmental or agricultural statistics. Two of the CWAIs are satellite-based (RAIN and Photosynthetically Active radiation, PAR) while the third is ground based (TEMP, air temperature); capitals are used when specifically referring to CWAIs rather than the climate variables in general. The paper first provides an overview of some common agroclimatic indicators, describing their procedural, systemic and normative features in subsequent sections, following the terminology of Binder et al Environ Impact Assess Rev 30:71-81 (2010). The discussion focuses on the systemic and normative aspects: the CWAIs are assessed in terms of their coherent description of the agroclimatic crop environment, at different spatial scales (systemic). The final section shows that the CWAIs retain key statistical properties of the underlying climate variables and that they can be compared to a reference value and used as monitoring and early warning variables (normative).

  16. CropWatch agroclimatic indicators (CWAIs) for weather impact assessment on global agriculture.

    Science.gov (United States)

    Gommes, René; Wu, Bingfang; Zhang, Ning; Feng, Xueliang; Zeng, Hongwei; Li, Zhongyuan; Chen, Bo

    2017-02-01

    CropWatch agroclimatic indicators (CWAIs) are a monitoring tool developed by the CropWatch global crop monitoring system in the Chinese Academy of Sciences (CAS; www.cropwatch.com.cn , Wu et al Int J Digital Earth 7(2):113-137, 2014, Wu et al Remote Sens 7:3907-3933, 2015). Contrary to most other environmental and agroclimatic indicators, they are "agronomic value-added", i.e. they are spatial values averaged over agricultural areas only and they include a weighting that enhances the contribution of the areas with the largest production potential. CWAIs can be computed for any time interval (starting from dekads) and yield one synthetic value per variable over a specific area and time interval, for instance a national annual value. Therefore, they are very compatible with socio-economic and other variables that are usually reported at regular time intervals over administrative units, such as national environmental or agricultural statistics. Two of the CWAIs are satellite-based (RAIN and Photosynthetically Active radiation, PAR) while the third is ground based (TEMP, air temperature); capitals are used when specifically referring to CWAIs rather than the climate variables in general. The paper first provides an overview of some common agroclimatic indicators, describing their procedural, systemic and normative features in subsequent sections, following the terminology of Binder et al Environ Impact Assess Rev 30:71-81 (2010). The discussion focuses on the systemic and normative aspects: the CWAIs are assessed in terms of their coherent description of the agroclimatic crop environment, at different spatial scales (systemic). The final section shows that the CWAIs retain key statistical properties of the underlying climate variables and that they can be compared to a reference value and used as monitoring and early warning variables (normative).

  17. NOAA Coral Reef Watch 25km Ocean Acidification Product Suite (OAPS) for January 1988 to the present covering the Greater Caribbean Region

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coral Reef Watch Experimental Ocean Acidification Product Suite (OAPS) offers an important synthesis of satellite and modeled environmental datasets to...

  18. Impact of the Heart WATCH Program on Patients at Risk of Developing Metabolic Syndrome, Prediabetes or Cardiovascular Disease

    Directory of Open Access Journals (Sweden)

    Jennifer Fink

    2015-04-01

    Full Text Available Purpose: Metabolic syndrome is a set of metabolic risk factors associated with increased risk of developing cardiovascular disease and type 2 diabetes mellitus. We retrospectively evaluated the effectiveness of a lifestyle modification program (Heart WATCH geared toward reducing development of chronic disease in women deemed at risk for metabolic syndrome, prediabetes and/or cardiovascular disease. Methods: Our institution’s Heart WATCH program consists of screening sessions with a multidisciplinary team (physician/nurse, nutritionist and psychologist, a minimum of three visits with a nurse practitioner and weekly follow-up phone calls for a 14-week period. Sociodemographic variables were obtained at initial visit. Biometric testing indices and self-reported clinical and behavioral health measures were recorded pre- and postintervention, and compared using paired t-tests or McNemar’s test as appropriate. Results: Heart WATCH enrolled 242 women from November 2006 to April 2014, and 193 (80% completed all phases of the 14-week lifestyle intervention. Postintervention, participants demonstrated improved health status in all areas and improved significantly in the following areas: diet/nutrition (P=0.014, exercise (P<0.001, stress (P<0.0001, quality of life (P=0.003, weight (P<0.0001, waist circumference (P=0.01 and total cholesterol (P=0.019. Clinically meaningful improvements were realized by participants who moved to a healthier classification in a number of vital signs and blood panel indices. Conclusions: These findings suggest the “elevated risk profile” for women with components of metabolic syndrome can be reversed through a lifestyle program focused on reducing risk factors associated with cardiovascular disease and prediabetes. Future research is needed to determine mechanisms of risk reduction as well as optimal patient-centered and culturally appropriate approaches to weight management.

  19. TV Watching and Computer Use in U.S. Youth Aged 12-15, 2012. NCHS Data Brief. Number 157

    Science.gov (United States)

    Herrick, Kirsten A.; Fakhouri, Tala H. I.; Carlson, Susan A.; Fulton, Janet E.

    2014-01-01

    Excessive screen-time behaviors, such as using a computer and watching TV, for more than 2 hours daily have been linked with elevated blood pressure, elevated serum cholesterol, and being overweight or obese among youth. Additionally, screen-time behavior established in adolescence has been shown to track into adulthood. The National Heart, Lung,…

  20. OverWatch: A Cross-Plane DDoS Attack Defense Framework with Collaborative Intelligence in SDN

    Directory of Open Access Journals (Sweden)

    Biao Han

    2018-01-01

    Full Text Available Distributed Denial of Service (DDoS attacks are one of the biggest concerns for security professionals. Traditional middle-box based DDoS attack defense is lack of network-wide monitoring flexibility. With the development of software-defined networking (SDN, it becomes prevalent to exploit centralized controllers to defend against DDoS attacks. However, current solutions suffer with serious southbound communication overhead and detection delay. In this paper, we propose a cross-plane DDoS attack defense framework in SDN, called OverWatch, which exploits collaborative intelligence between data plane and control plane with high defense efficiency. Attack detection and reaction are two key procedures of the proposed framework. We develop a collaborative DDoS attack detection mechanism, which consists of a coarse-grained flow monitoring algorithm on the data plane and a fine-grained machine learning based attack classification algorithm on the control plane. We propose a novel defense strategy offloading mechanism to dynamically deploy defense applications across the controller and switches, by which rapid attack reaction and accurate botnet location can be achieved. We conduct extensive experiments on a real-world SDN network. Experimental results validate the efficiency of our proposed OverWatch framework with high detection accuracy and real-time DDoS attack reaction, as well as reduced communication overhead on SDN southbound interface.

  1. Association of sleep disturbances with TV and satellite watching and video games playing in 14-17 years old high school students of Qazvin

    Directory of Open Access Journals (Sweden)

    Sh. Jalilolghadr

    2017-06-01

    Full Text Available Background: Sleep plays an important role in health. Reduced levels of attention, learning and memory are of adverse outcomes of sleep disorders in students. Objective: The aim of this study was to determine the association of sleep disturbances with watching TV and satellite and playing video games in 14-17 years old high school students of Qazvin. Methods: This cross sectional study was conducted in 653 high school students (14-17 years old in Qazvin that were selected by multistage cluster random sampling method (2013-2014. Data were collected through Pediatric Sleep Questionnaire (PSQ and BEARS questionnaires. Data were analyzed using Chi-square test, T-test, ANOVA and logistic regression analysis. Findings: From 653 students, 392 (60% were female. The mean age was 15.73±0.99 years. The most prevalent sleep disturbances were waking up at night (74.4%, daytime sleepiness (69.8%, napping after school (66.6%, and nightmare (51.1%, respectively. Daytime sleepiness, nightmares, sleep after waking up, falling asleep in school, and nap after school time had significant association with watching satellite. Conclusion: With regards to the results, prevalence of sleep disorders was high in high school students of Qazvin and sleep disturbances were associated with duration of watching satellite.

  2. Executive Functioning of Sexually Compulsive and Non-Sexually Compulsive Men Before and After Watching an Erotic Video.

    Science.gov (United States)

    Messina, Bruna; Fuentes, Daniel; Tavares, Hermano; Abdo, Carmita H N; Scanavino, Marco de T

    2017-03-01

    Despite the serious behavioral consequences faced by individuals with sexual compulsivity, related neuropsychological studies are sparse. To compare decision making and cognitive flexibility at baseline and after exposure to an erotic video in sexually compulsive participants and non-sexually compulsive controls. The sample consisted of 30 sexually compulsive men and 30 controls. Cognitive flexibility was investigated through the Wisconsin Card Sorting Test and decision making was examined through the Iowa Gambling Task. Wisconsin Card Sorting Test categories, correct responses, and perseverative errors and Iowa Gambling Task general trends and blocks. Sexually compulsive subjects and controls performed similarly at baseline. After watching an erotic video, controls performed better in block 1 of the Iowa Gambling Task (P = .01) and had more correct responses on the Wisconsin Card Sorting Test (P = .01). The controls presented fewer impulsive initial choices and better cognitive flexibility after exposure to erotic stimuli. Messina B, Fuentes D, Tavares H, et al. Executive Functioning of Sexually Compulsive and Non-Sexually Compulsive Men Before and After Watching an Erotic Video. J Sex Med 2017;14:347-354. Copyright © 2017. Published by Elsevier Inc.

  3. Global Atmosphere Watch Workshop on Measurement-Model ...

    Science.gov (United States)

    The World Meteorological Organization’s (WMO) Global Atmosphere Watch (GAW) Programme coordinates high-quality observations of atmospheric composition from global to local scales with the aim to drive high-quality and high-impact science while co-producing a new generation of products and services. In line with this vision, GAW’s Scientific Advisory Group for Total Atmospheric Deposition (SAG-TAD) has a mandate to produce global maps of wet, dry and total atmospheric deposition for important atmospheric chemicals to enable research into biogeochemical cycles and assessments of ecosystem and human health effects. The most suitable scientific approach for this activity is the emerging technique of measurement-model fusion for total atmospheric deposition. This technique requires global-scale measurements of atmospheric trace gases, particles, precipitation composition and precipitation depth, as well as predictions of the same from global/regional chemical transport models. The fusion of measurement and model results requires data assimilation and mapping techniques. The objective of the GAW Workshop on Measurement-Model Fusion for Global Total Atmospheric Deposition (MMF-GTAD), an initiative of the SAG-TAD, was to review the state-of-the-science and explore the feasibility and methodology of producing, on a routine retrospective basis, global maps of atmospheric gas and aerosol concentrations as well as wet, dry and total deposition via measurement-model

  4. Ver cine en TV: una ventana a la socialización familiar Watching movies at home: an overview to family socialization

    Directory of Open Access Journals (Sweden)

    Felicidad Loscertales Abril

    2008-10-01

    Full Text Available ¿Qué significa ir al cine y ver una película? La persona observadora se sitúa ante la narración audiovisual que ofrece la gran pantalla viendo ante todo la vida construida, la historia, el argumento, y luego, en un segundo plano, los elementos con los que los profesionales elaboraron el relato narrado. De esta forma, se aprende, se reflexiona y se adquieren valores. El cine ofrece un amplio campo al conocimiento humano y por ello, las autores proponen en este trabajo el visionado de este arte audiovisual en familia, usando la TV, dado que de esta forma se enriquecerá las relaciones personales, adquiriendo mayor consistencia, y además contribuirá a la socialización de la infancia y la adolescencia dentro del grupo familiar. What does watching a movie mean? In the first place the spectator places itself facing to a constructed reality, a story and a plot. In addition s/he also sees the elements used by professionals to build such story. Watching movies is one of the ways in which people learn, reflect and acquire values. Due to the fact that movies offer a wide field to obtain human knowledge, our proposal is that watching movies in family and using the TV will enrich the personal relations, giving them consistency, and thus contributing to the socialization of child and the adolescents within the familiar group.

  5. Women's television watching and reproductive health behavior in Bangladesh

    Directory of Open Access Journals (Sweden)

    Mizanur Rahman

    2017-12-01

    Full Text Available Bangladesh has made significant social, economic, and health progress in recent decades, yet many reproductive health indicators remain weak. Access to television (TV is increasing rapidly and provides a potential mechanism for influencing health behavior. We present a conceptual framework for the influence of different types of TV exposure on individual’s aspirations and health behavior through the mechanisms of observational learning and ideational change. We analyze data from two large national surveys conducted in 2010 and 2011 to examine the association between women’s TV watching and five reproductive health behaviors controlling for the effects of observed confounders. We find that TV watchers are significantly more likely to desire fewer children, are more likely to use contraceptives, and are less likely to have a birth in the two years before the survey. They are more likely to seek at least four antenatal care visits and to utilize a skilled birth attendant. Consequently, continued increase in the reach of TV and associated growth in TV viewing is potentially an important driver of health behaviors in the country.

  6. Comets in the space age

    International Nuclear Information System (INIS)

    Whipple, F.L.

    1989-01-01

    The historical development of the study of the nature of comets and their origin is discussed, emphasizing the use of aerospace technology in cometary science. The use of satellites to study the Comet Kohoutek 1973 XII, advances between Kohoutek and P/Halley, and studies of P/Halley during its 1986 return are examined. Consideration is given to data from ground, air, and space sensors, and from the Giotto and Vega spacecraft missions. Also, the physical structure of the nucleus of Comet Halley is described. 136 refs

  7. The elements of a consumer-based initiative in contributing to positive environmental change: Monterey Bay Aquarium's Seafood Watch program.

    Science.gov (United States)

    Kemmerly, Jennifer Dianto; Macfarlane, Victoria

    2009-09-01

    Monterey Bay Aquarium launched the Seafood Watch program in 2000. The program's Seafood Watch pocket guide is a simple tool that visitors can use to identify seafood from environmentally responsible sources. Since its inception, more than 2 million pocket guides have been distributed to Monterey Bay Aquarium visitors and 20 million have been distributed through partnerships across the United States. Partner institutions such as aquariums, conservation organizations, and businesses also conduct outreach and are working to influence their local seafood purveyors. An evaluation conducted in 2003 and 2004 assessed the program's strategies for increasing awareness and shifting consumer buying habits as they relate to sustainable seafood, including use of the pocket guide. Visitors who picked up pocket guides were surveyed immediately after their aquarium visit, and again four months later. The evaluation found that most visitors continued to use the guides and had changed their seafood buying habits in several respects. Those interviewed also reported some barriers to using the guides. The elements that appear to be critical to the success of the strategy with respect to changing consumer purchasing habits include: a focused distribution approach; providing credible and specific information on problems and solutions to increase action-related knowledge; providing a trigger or prompt that is available at the time of purchase; and reducing barriers to action, at the point of action, by working with seafood purveyors and the broader sustainable seafood movement to increase knowledge and available options. In response to the evaluation, Seafood Watch has strengthened these elements and expanded to help meet the needs of the broader sustainable seafood movement. A process of strategic planning, evaluation, cooperation among partners, and adaptability to the movement's natural evolution has proven to be critical to the program's success in contributing to the development of a

  8. 'Cycle thieves, we are watching you': impact of a simple signage intervention against bicycle theft.

    Science.gov (United States)

    Nettle, Daniel; Nott, Kenneth; Bateson, Melissa

    2012-01-01

    Bicycle theft is a serious problem in many countries, and there is a lack of evidence concerning effective prevention strategies. Displaying images of 'watching eyes' has been shown to make people behave in more socially desirable ways in a number of settings, but it is not yet clear if this effect can be exploited for purposes of crime prevention. We report the results of a simple intervention on a university campus where signs featuring watching eyes and a related verbal message were displayed above bicycle racks. We installed durable signs at three locations which had experienced high levels of bicycle theft, and used the rest of the university campus as a control location. Reported thefts were monitored for 12 months before and after the intervention. Bicycle thefts decreased by 62% at the experimental locations, but increased by 65% in the control locations, suggesting that the signs were effective, but displaced offending to locations with no signs. The Odds Ratio for the effect of the intervention was 4.28 (95% confidence interval 2.04-8.98), a large effect compared to other place-based crime prevention interventions. The effectiveness of this extremely cheap and simple intervention suggests that there can be considerable crime-reduction benefits to engaging the psychology of surveillance, even in the absence of surveillance itself. Simple interventions for high-crime locations based on this principle should be considered as an adjunct to other measures, although a possible negative consequence is displacement of offending.

  9. One Drop | Mobile on iPhone and Apple Watch: An Evaluation of HbA1c Improvement Associated With Tracking Self-Care.

    Science.gov (United States)

    Osborn, Chandra Y; van Ginkel, Joost R; Marrero, David G; Rodbard, David; Huddleston, Brian; Dachis, Jeff

    2017-11-29

    The One Drop | Mobile app supports manual and passive (via HealthKit and One Drop's glucose meter) tracking of self-care and glycated hemoglobin A 1c (HbA 1c ). We assessed the HbA 1c change of a sample of people with type 1 diabetes (T1D) or type 2 diabetes (T2D) using the One Drop | Mobile app on iPhone and Apple Watch, and tested relationships between self-care tracking with the app and HbA 1c change. In June 2017, we identified people with diabetes using the One Drop | Mobile app on iPhone and Apple Watch who entered two HbA 1c measurements in the app 60 to 365 days apart. We assessed the relationship between using the app and HbA 1c change. Users had T1D (n=65) or T2D (n=191), were 22.7% (58/219) female, with diabetes for a mean 8.34 (SD 8.79) years, and tracked a mean 2176.35 (SD 3430.23) self-care activities between HbA 1c entries. There was a significant 1.36% or 14.9 mmol/mol HbA 1c reduction (F=62.60, PApple Watch may favorably impact glycemic control. ©Chandra Y Osborn, Joost R van Ginkel, David G Marrero, David Rodbard, Brian Huddleston, Jeff Dachis. Originally published in JMIR Mhealth and Uhealth (http://mhealth.jmir.org), 29.11.2017.

  10. Watershed Watch: Using undergraduate student-driven inquiry-based research projects as a means of engaging undeclared students in the biogeosciences

    Science.gov (United States)

    Rock, B. N.; Hale, S.; Graham, K.; Hayden, L. B.

    2009-12-01

    Watershed Watch (NSF 0525433) engages early undergraduate students from two-year and four-year colleges in student-driven full inquiry-based instruction in the biogeosciences. Program goals for Watershed Watch are to test if inquiry-rich student-driven projects sufficiently engage undeclared students (or noncommittal STEM majors) to declare a STEM major (or remain with their STEM major). The program is a partnership between two four-year campuses - the University of New Hampshire (UNH), and Elizabeth City State University (ECSU, in North Carolina); and two two-year campuses - Great Bay Community College (GBCC, in New Hampshire) and the College of the Albemarle (COA, in North Carolina). The program focuses on two watersheds: the Merrimack Ricer Watershed in New Hampshire and Massachusetts, and the Pasquotank River Watershed in Virginia and North Carolina. Both the terrestrial and aquatic components of both watersheds are evaluated using the student-driven projects. A significant component of this program is an intensive two-week Summer Research Institute (SRI), in which undeclared freshmen and sophomores investigate various aspects of their local watershed. Two Summer Research Institutes have been held on the UNH campus (2006 and 2008) and two on the ECSU campus (2007 and 2009). Students develop their own research questions and study design, collect and analyze data, and produce a scientific oral or poster presentation on the last day of the SRI. The course objectives, curriculum and schedule are presented as a model for dissemination for other institutions and programs seeking to develop inquiry-rich programs or courses designed to attract students into biogeoscience disciplines. Data from self-reported student feedback indicate the most important factors explaining high-levels of student motivation and research excellence in the program are: 1) working with committed, energetic, and enthusiastic faculty mentors, and 2) faculty mentors demonstrating high degrees of

  11. Evaluation and validation of an automatic jaw movement recorder (RumiWatch) for ingestive and rumination behaviors of dairy cows during grazing and supplementation.

    Science.gov (United States)

    Rombach, M; Münger, A; Niederhauser, J; Südekum, K-H; Schori, F

    2018-03-01

    Observation of ingestive and rumination behaviors of dairy cows may assist in detecting diseases, controlling reproductive status, and estimating intake. However, direct observation of cows on pasture is time consuming and can be difficult to realize. Consequently, different systems have been developed to automatically record behavioral characteristics; among them is the RumiWatch System (RWS; Itin and Hoch GmbH, Liestal, Switzerland). Until now, the RWS has not been thoroughly validated under grazing conditions. The aim of the current study was to validate the RWS, against direct observation, in measuring ingestive and rumination behaviors of dairy cows during grazing and supplementation in the barn. A further objective was to examine whether it is possible to refine the algorithm used by the evaluation software RumiWatch Converter 0.7.3.2 to improve the accuracy of the RWS. The data were collected from an experiment carried out with 18 lactating Holstein cows in a crossover block design including 3 treatments and 3 measuring periods. All cows grazed night and day, 19 h/d, and were either unsupplemented or supplemented, with chopped whole-plant corn silage, or chopped whole-plant corn silage mixed with a protein concentrate. During the measuring periods, cows were equipped with the RumiWatch Halter, and their ingestive and rumination behaviors were recorded concurrently by the RumiWatch Halter and by direct observation (690 × 10 min). Comparison of concurrently measured data shows that the RWS detected jaw movements reliably, but classification errors occurred. A low relative prediction error of ≤0.10 for the number of rumination boluses, rumination chews, and total eating chews was found. A high relative prediction error of >0.10 was found for the number of prehension bites and time spent in prehension and eating. Both converter versions performed equally well in differentiating ingestive and rumination behaviors when cows were supplemented in the barn or when

  12. The CosmicWatch Desktop Muon Detector: a self-contained, pocket sized particle detector

    Science.gov (United States)

    Axani, S. N.; Frankiewicz, K.; Conrad, J. M.

    2018-03-01

    The CosmicWatch Desktop Muon Detector is a self-contained, hand-held cosmic ray muon detector that is valuable for astro/particle physics research applications and outreach. The material cost of each detector is under 100 and it takes a novice student approximately four hours to build their first detector. The detectors are powered via a USB connection and the data can either be recorded directly to a computer or to a microSD card. Arduino- and Python-based software is provided to operate the detector and an online application to plot the data in real-time. In this paper, we describe the various design features, evaluate the performance, and illustrate the detectors capabilities by providing several example measurements.

  13. NOAA Coral Reef Watch Monthly 25 km Ocean Acidification Product Suite from 1988-01-01 to 2012-01-31 covering the Greater Caribbean Region

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coral Reef Watch Experimental Ocean Acidification Product Suite (OAPS) offers an important synthesis of satellite and modeled environmental datasets to...

  14. Listening, watching, and reading: the structure and correlates of entertainment preferences.

    Science.gov (United States)

    Rentfrow, Peter J; Goldberg, Lewis R; Zilca, Ran

    2011-04-01

    People spend considerable amounts of time and money listening to music, watching TV and movies, and reading books and magazines, yet almost no attention in psychology has been devoted to understanding individual differences in preferences for such entertainment. The present research was designed to examine the structure and correlates of entertainment genre preferences. Analyses of the genre preferences of more than 3,000 individuals revealed a remarkably clear factor structure. Using multiple samples, methods, and geographic regions, data converged to reveal five entertainment-preference dimensions: Communal, Aesthetic, Dark, Thrilling, and Cerebral. Preferences for these entertainment dimensions were uniquely related to demographics and personality traits. Results also indicated that personality accounted for significant proportions of variance in entertainment preferences over and above demographics. The results provide a foundation for developing and testing hypotheses about the psychology of entertainment preferences. © 2011 The Authors. Journal of Personality © 2011, Wiley Periodicals, Inc.

  15. Low-power crystal and MEMS oscillators the experience of watch developments

    CERN Document Server

    Eric Vittoz

    2010-01-01

    Electronic oscillators using an electromechanical device as a frequency reference are irreplaceable components of systems-on-chip for time-keeping, carrier frequency generation and digital clock generation. With their excellent frequency stability and very large quality factor Q, quartz crystal resonators have been the dominant solution for more than 70 years. But new possibilities are now offered by micro-electro-mechanical (MEM) resonators, that have a qualitatively identical equivalent electrical circuit. Low-Power Crystal and MEMS Oscillators concentrates on the analysis and design of the most important schemes of integrated oscillator circuits. It explains how these circuits can be optimized by best exploiting the very high Q of the resonator to achieve the minimum power consumption compatible with the requirements on frequency stability and phase noise. The author has 40 years of experience in designing very low-power, high-performance quartz oscillators for watches and other battery operated systems an...

  16. Domestic Violence in Zora Neale Hurston's Their Eyes Were Watching God: A Feminist Reading

    Directory of Open Access Journals (Sweden)

    Parmis Tasharofi

    2014-07-01

    Full Text Available Zora Neale Hurston's Their Eyes Were Watching God is one of the acclaimed boldly feminist novels of the 20th century. In general, this article draws on feminism and what looms large in feminism which is called sexism. In particular it focuses on domestic violence as a major sexist oppression. Domestic violence aroused by jealousy, anger, coercion, humiliation, threatening is manifest in verbal and physical abusing of women. Hurston skillfully depicts her heroine's undergoing of domestic violence by her husbands, each in different ways. This article aims to show that how the black heroine's battling with this violence purports to feminism and self-discovery of women.

  17. Brief Report: Just-in-Time Visual Supports to Children with Autism via the Apple Watch®: A Pilot Feasibility Study

    Science.gov (United States)

    O'Brien, Amanda; Schlosser, Ralf W.; Shane, Howard C.; Abramson, Jennifer; Allen, Anna A.; Flynn, Suzanne; Yu, Christina; Dimery, Katherine

    2016-01-01

    Using augmented input might be an effective means for supplementing spoken language for children with autism who have difficulties following spoken directives. This study aimed to (a) explore whether JIT-delivered scene cues (photos, video clips) via the Apple Watch® enable children with autism to carry out directives they were unable to implement…

  18. Openness to Experience and Night-Sky Watching Interest as Predictors of Reading for Pleasure: Path Analysis of a Mediation Model

    Science.gov (United States)

    Kelly, William E.

    2010-01-01

    The relation between reading for pleasure, night-sky watching interest, and openness to experience were examined in a sample of 129 college students. Results of a path analysis examining a mediation model indicated that the influence of night-sky interest on reading for pleasure was not mediated by the broad personality domain openness to…

  19. 'Cycle thieves, we are watching you': impact of a simple signage intervention against bicycle theft.

    Directory of Open Access Journals (Sweden)

    Daniel Nettle

    Full Text Available Bicycle theft is a serious problem in many countries, and there is a lack of evidence concerning effective prevention strategies. Displaying images of 'watching eyes' has been shown to make people behave in more socially desirable ways in a number of settings, but it is not yet clear if this effect can be exploited for purposes of crime prevention. We report the results of a simple intervention on a university campus where signs featuring watching eyes and a related verbal message were displayed above bicycle racks.We installed durable signs at three locations which had experienced high levels of bicycle theft, and used the rest of the university campus as a control location. Reported thefts were monitored for 12 months before and after the intervention. Bicycle thefts decreased by 62% at the experimental locations, but increased by 65% in the control locations, suggesting that the signs were effective, but displaced offending to locations with no signs. The Odds Ratio for the effect of the intervention was 4.28 (95% confidence interval 2.04-8.98, a large effect compared to other place-based crime prevention interventions.The effectiveness of this extremely cheap and simple intervention suggests that there can be considerable crime-reduction benefits to engaging the psychology of surveillance, even in the absence of surveillance itself. Simple interventions for high-crime locations based on this principle should be considered as an adjunct to other measures, although a possible negative consequence is displacement of offending.

  20. Cancer risk assessment of azo dyes and aromatic amines from tattoo bands, folders of paper, toys, bed clothes, watch straps and ink

    NARCIS (Netherlands)

    Zeilmaker MJ; Kranen HJ van; Veen MP van; Janus J; LBM

    2000-01-01

    A quantitative assessment was performed to estimate the cancer risk to individuals using tattoo bands, folders of paper, toys, bed clothes, watch straps and ink which are coloured with azo dyes. In these products benzidine and the benzidine related amines o-anisidine, 2,4-toluenediamine,