WorldWideScience

Sample records for haliaeetus leucocephalus yt

  1. Absolute polycythemia in a bald eagle (Haliaeetus leucocephalus).

    Science.gov (United States)

    Fernandes, Andreia F; Fenton, Heather; Martinson, Shannon; Desmarchelier, Marion; Ferrell, Shannon T

    2014-12-01

    An approximately 6-mo-old female bald eagle (Haliaeetus leucocephalus) was presented for an inability to fly and bilateral drooped wings. Pectoral muscle atrophy with a moderate polycythemia was present. Over the course of 3 wk, there were no improvements in flight capacity, although the bird gained substantial weight. Further investigation revealed a prominent cyanosis that was responsive to oxygen therapy, a chronic respiratory acidosis with hypoxia, a cardiac murmur, and a persistent polycythemia. No obvious antemortem etiology for the clinical findings was discovered on computerized tomography, angiography, or echocardiography. The bird was euthanatized as a result of the poor prognosis. Necropsy and histopathology revealed no significant cardiovascular or pulmonary pathology. No myopathy was evident on electron microscopy of formalin-fixed tissues. Based on these diagnostics, a neuromuscular disorder is suspected as the cause for the blood gas abnormalities, with a resulting polycythemia from the hypoxia.

  2. To migrate, stay put, or wander? Varied movement strategies in bald eagles (Haliaeetus leucocephalus).

    Science.gov (United States)

    Wheat, Rachel E; Lewis, Stephen B; Wang, Yiwei; Levi, Taal; Wilmers, Christopher C

    2017-01-01

    Quantifying individual variability in movement behavior is critical to understanding population-level patterns in animals. Here, we explore intraspecific variation in movement strategies of bald eagles ( Haliaeetus leucocephalus ) in the north Pacific, where there is high spatiotemporal resource variability. We tracked 28 bald eagles (five immature, 23 adult) using GPS transmitters between May 2010 and January 2016. We found evidence of four movement strategies among bald eagles in southeastern Alaska and western Canada: breeding individuals that were largely sedentary and remained near nest sites year-round, non-breeding migratory individuals that made regular seasonal travel between northern summer and southern winter ranges, non-breeding localized individuals that displayed fidelity to foraging sites, and non-breeding nomadic individuals with irregular movement. On average, males traveled farther per day than females. Most nomadic individuals were immature, and all residential individuals (i.e. breeders and localized birds) were adults. Alternative movement strategies among north Pacific eagles are likely associated with the age and sex class, as well as breeding status, of an individual. Intraspecific variation in movement strategies within the population results in different space use patterns among contingents, which has important implications for conservation and management.

  3. Pharmacokinetics of intravenous and oral tramadol in the bald eagle (Haliaeetus leucocephalus).

    Science.gov (United States)

    Souza, Marcy J; Martin-Jimenez, Tomas; Jones, Michael P; Cox, Sherry K

    2009-12-01

    Analgesia is becoming increasingly important in veterinary medicine, and little research has been performed that examined pain control in avian species. Tramadol is a relatively new drug that provides analgesia by opioid (mu), serotonin, and norepinephrine pathways, with minimal adverse effects. To determine the pharmacokinetics of tramadol and its major metabolite O-desmethyltramadol (M1) in eagles, 6 bald eagles (Haliaeetus leucocephalus) were each dosed with tramadol administered intravenously (4 mg/kg) and orally (11 mg/kg) in a crossover study. Blood was collected at various time points between 0 and 600 minutes and then analyzed with high-performance liquid chromatography to determine levels of tramadol and M1, the predominate active metabolite. The terminal half-life of tramadol after intravenous dosing was 2.46 hours. The maximum plasma concentration, time of maximum plasma concentration, and terminal half life for tramadol after oral dosing were 2156.7 ng/ml, 3.75 hours, and 3.14 hours, respec vely. In addition, the oral bioavailability was 97.9%. Although plasma concentrations of ramadol and M1 associated with analgesia in any avian species is unknown, based on the obtained data and known therapeutic levels in humans, a dosage of 5 mg/kg PO q12h is recommended for bald eagles. Pharmacodynamic studies are needed to better determine plasma levels of tramadol and M1 associated with analgesia in birds.

  4. Bald eagle (Haliaeetus leucocephalus population increases in Placentia Bay, Newfoundland: evidence for habitat saturation?

    Directory of Open Access Journals (Sweden)

    Karla R. Letto

    2015-06-01

    Full Text Available Across North America, Bald Eagle (Haliaeetus leucocephalus populations appear to be recovering following bans of DDT. A limited number of studies from across North America have recorded a surplus of nonbreeding adult Bald Eagles in dense populations when optimal habitat and food become limited. Placentia Bay, Newfoundland is one of these. The area has one of the highest densities of Bald Eagles in eastern North America, and has recently experienced an increase in the proportion of nonbreeding adults within the population. We tested whether the observed Bald Eagle population trends in Placentia Bay, Newfoundland during the breeding seasons 1990-2009 are due to habitat saturation. We found no significant differences in habitat or food resource characteristics between occupied territories and pseudo-absence data or between nest sites with high vs. low nest activity/occupancy rates. Therefore there is no evidence for habitat saturation for Bald Eagles in Placentia Bay and alternative hypotheses for the high proportion of nonbreeding adults should be considered. The Newfoundland population provides an interesting case for examination because it did not historically appear to be affected by pollution. An understanding of Bald Eagle population dynamics in a relatively pristine area with a high density can be informative for restoration and conservation of Bald Eagle populations elsewhere.

  5. Epizootic vacuolar myelinopathy of the central nervous system of bald eagles (Haliaeetus leucocephalus) and American coots (Fulica americana)

    Science.gov (United States)

    Thomas, N.J.; Meteyer, C.U.; Sileo, L.

    1998-01-01

    Unprecedented mortality occurred in bald eagles (Haliaeetus leucocephalus) at DeGray Lake, Arkansas, during the winters of 1994-1995 and 1996-1997. The first eagles were found dead during November, soon after arrival from fall migration, and deaths continued into January during both episodes. In total, 29 eagles died at or near DeGray Lake in the winter of 1994-1995 and 26 died in the winter of 1996-1997; no eagle mortality was noted during the same months of the intervening winter or in the earlier history of the lake. During the mortality events, sick eagles were observed overflying perches or colliding with rock walls. Signs of incoordination and limb paresis were also observed in American coots (Fulica americana) during the episodes of eagle mortality, but mortality in coots was minimal. No consistent abnormalities were seen on gross necropsy of either species. No microscopic findings in organs other than the central nervous system (CNS) could explain the cause of death. By light microscopy, all 26 eagles examined and 62/77 (81%) coots had striking, diffuse, spongy degeneration of the white matter of the CNS. Vacuolation occurred in all myelinated CNS tissue, including the cerebellar folia and medulla oblongata, but was most prominent in the optic tectum. In the spinal cord, vacuoles were concentrated near the gray matter, and occasional swollen axons were seen. Vacuoles were uniformly present in optic nerves but were not evident in the retina or peripheral or autonomic nerves. Cellular inflammatory response to the lesion was distinctly lacking. Vacuoles were 8-50 microns in diameter and occurred individually, in clusters, or in rows. In sections stained by luxol fast blue/periodic acid-Schiff stain, the vacuoles were delimited and transected by myelin strands. Transmission electron microscopy revealed intramyelinic vacuoles formed in the myelin sheaths by splitting of one or more myelin lamellae at the intraperiodic line. This lesion is characteristic of

  6. The use of lead isotope analysis to identify potential sources of lead toxicosis in a juvenile bald eagle (Haliaeetus leucocephalus) with ventricular foreign bodies

    Science.gov (United States)

    Franzen-Klein, Dana; McRuer, David; Slabe, Vincent; Katzner, Todd

    2018-01-01

    A male juvenile bald eagle (Haliaeetus leucocephalus) was admitted to the Wildlife Center of Virginia with a left humeral fracture a large quantity of anthropogenic debris in the ventriculus, a blood lead level of 0.616 ppm, and clinical signs consistent with chronic lead toxicosis. Because of the poor prognosis for recovery and release, the eagle was euthanatized. Lead isotope analysis was performed to identify potential anthropogenic sources of lead in this bird. The lead isotope ratios in the eagle's femur (0.8773), liver (0.8761), and kidneys (0.8686) were most closely related to lead paint (0.8925), leaded gasoline (0.8450), and zinc smelting (0.8240). The lead isotope ratios were dissimilar to lead ammunition (0.8179) and the anthropogenic debris in the ventriculus. This case report documents foreign body ingestion in a free-ranging bald eagle and demonstrates the clinical utility of lead isotope analysis to potentially identify or exclude anthropogenic sources of lead poisoning in wildlife patients.

  7. INFLUENCE OF SNOWFALL ON BLOOD LEAD LEVELS OF FREE-FLYING BALD EAGLES (HALIAEETUS LEUCOCEPHALUS) IN THE UPPER MISSISSIPPI RIVER VALLEY.

    Science.gov (United States)

    Lindblom, Ronald A; Reichart, Letitia M; Mandernack, Brett A; Solensky, Matthew; Schoenebeck, Casey W; Redig, Patrick T

    2017-10-01

    Lead poisoning of scavenging raptors occurs primarily via consumption of game animal carcasses containing lead, which peaks during fall firearm hunting seasons. We hypothesized that snowfall would mitigate exposure by concealing carcasses. We categorized blood lead level (BLL) for a subsample of Bald Eagles (Haliaeetus leucocephalus) from the Upper Mississippi River Valley and described BLL with respect to age, sex, and snowfall. We captured Bald Eagles overwintering in the Upper Mississippi River Valley (n=55) between December 1999 and January 2002. Individual BLL ranged from nondetectable to 335 μg/dL, with 73% of the samples testing positive for acute exposure to lead. Eagle BLL did not significantly differ between age or sex, but levels were higher immediately following the hunting season, and they were lower when the previous month's snowfall was greater than 11 cm. This study suggests a window of time between the white-tailed deer (Odocoileus virginianus) hunting season and the onset of snow when the population experienced peak exposure to lead. Combining these findings with existing research, we offer a narrative of the annual lead exposure cycle of Upper Mississippi River Valley Bald Eagles. These temporal associations are necessary considerations for accurate collection and interpretation of BLL.

  8. Comparison of arsenic, cadmium, chromium, lead, manganese, mercury and selenium in feathers in bald eagle (Haliaeetus leucocephalus), and comparison with common eider (Somateria mollissima), glaucous-winged gull (Larus glaucescens), pigeon guillemot (Cepphus columba), and tufted puffin (Fratercula cirrhata) from the Aleutian Chain of Alaska

    Science.gov (United States)

    Burger, Joanna; Gochfeld, Michael

    2014-01-01

    There is an abundance of field data for levels of metals from a range of places, but relatively few from the North Pacific Ocean and Bering Sea. In this paper we examine the levels of arsenic, cadmium, chromium, lead, manganese, mercury and selenium in feathers from common eiders (Somateria mollissima), glaucous-winged gulls (Larus glaucescens), pigeon guillemots (Cepphus columba), tufted puffins (Fratercula cirrhata) and bald eagles (Haliaeetus leucocephalus) from the Aleutian Chain of Alaska. Our primary objective was to test the hypothesis that there are no trophic levels relationships for arsenic, cadmium, chromium, lead, manganese, mercury and selenium among these five species of birds breeding in the marine environment of the Aleutians. There were significant interspecific differences in all metal levels. As predicted bald eagles had the highest levels of arsenic, chromium, lead, and manganese, but puffins had the highest levels of selenium, and pigeon guillemot had higher levels of mercury than eagles (although the differences were not significant). Common eiders, at the lowest trophic level had the lowest levels of some metals (chromium, mercury and selenium). However, eiders had higher levels than all other species (except eagles) for arsenic, cadmium, lead, and manganese. Levels of lead were higher in breast than in wing feathers of bald eagles. Except for lead, there were no significant differences in metal levels in feathers of bald eagles nesting on Adak and Amchitka Island; lead was higher on Adak than Amchitka. Eagle chicks tended to have lower levels of manganese than older eagles. PMID:18521716

  9. Riparian Raptors on USACE Projects: Bald Eagle (Haliaeetus leucocephalus)

    National Research Council Canada - National Science Library

    Mitchell, Wilma

    2000-01-01

    ...) reservoir operations. For management purposes, these raptors are considered riparian generalists because they inhabit the riparian zones surrounding streams and lakes of Corps projects but may seasonally use adjacent...

  10. VPN-yhdyskäytävä

    OpenAIRE

    Syrjä, Lauri

    2011-01-01

    Lahden ammattikorkeakoulun tekniikan alan tietoverkkolaboratorion käyttämän VPN-yhdyskäytäväohjelmiston kehittänyt yritys siirtyi toisen yrityksen omistukseen loppuvuodesta 2008. Ohjelmiston tuki lopetettiin ja sen avoin kehitys jatkui toisella tuotenimellä ja siirtyi lopulta OpenVPN:n vastuulle. Tästä syystä käytössä olevalle VPN-yhdyskäytävälle tarvittiin korvaava ratkaisu. Tavoitteena oli tutustua erilaisiin VPN-yhdyskäytäväratkaisuihin ja valita ympäristöön parhaiten soveltuva tuote s...

  11. TOIMITUSKETJURATKAISUJA Case: Yhteinen pöytä

    OpenAIRE

    Metso, Kim

    2016-01-01

    Tämän tutkielman tutkimusongelma on löytää Yhteisen pöytäprojektiin toimitusketjuratkaisuja, jotka kehittävät ja tekevät toiminnasta kustannustehokkaampaa. Tutkielma käsittelee toimitusketjuratkaisuja Yhteiselle pöydälle, joka on Vantaan kaupungin hävikkiruoan jakeluun keskittynyt organisaatio. Tässä projektissa Vantaan seurakuntayhtymä ja Diakonia-ammattikorkeakoulu toimivat läheisessä yhteistyössä Vantaan kaupungin kanssa. Tutkielman tarkoituksena on perehtyä toimitusketjun liittyviin analy...

  12. Lockout/Tagout - Turvalukituskäytäntö

    OpenAIRE

    Juhala, Ville

    2017-01-01

    Tämän opinnäytetyön tarkoituksena oli laatia kattava ohjeistus kuparitehtaan turvalukituksista. Työ tehtiin Aurubis Finland Oy:n kuparivalssaamoon. Ohjeistuksista tuli käydä ilmi turvalukitusten vaikutus lukittaviin laitteisiin sekä mahdolliset työturvallisuusriskit joita koneiden kanssa toimiessa tulee huomioida. Työn tavoitteena oli lisätä kunnossapidon työturvallisuutta ja selkeyttää koneiden kanssa työskentelyyn liittyviä käytäntöjä. Ohjeistukset laadittiin vahinkokäynnistymisen estoa...

  13. Slik bør du trene hvis du har høyt blodtrykk

    DEFF Research Database (Denmark)

    Bjørkelund, Oline Anita

    2016-01-01

    Svært mange nordmenn lever med lavt eller høyt blodtrykk. Sistnevnte er et utbredt helseproblem i Norge, og Nasjonalforeningen for folkehelsen opplyser at over 100 000 nordmenn bruker medisiner mot det. Høyt blodtrykk er jo ingen sykdom i seg selv, men det krever at man må tenke gjennom vaner og ...

  14. Persistent pollutants in the white-tailed eagle (Haliaeetus albicilla) in the Federal Republic of Germany

    NARCIS (Netherlands)

    Koeman, J.H.; Hadderingh, R.H.; Bijleveld, M.F.I.J.

    1972-01-01

    A study was made of the possible relationship between persistent pollutants and the decline in reproductive success of the White-tailed Eagle (Haliaeetus albicilla) in Schleswig Holstein, Federal Republic of Germany. Chemical analyses were made of Eagle's eggs, of one adult Eagle which was found

  15. Subordinate Males Sire Offspring in Madagascar Fish-eagle (Haliaeetus Vociferoides) Polyandrous Breeding Groups

    OpenAIRE

    Tingay, Ruth E.; Culver, Melanie; Hallerman, Eric M.; Fraser, James D.; Watson, Richard T.

    2002-01-01

    The island endemic Madagascar Fish-Eagle (Haliaeetus vociferoides) is one of the most endangered birds of prey. Certain populations in west-central Madagascar sometimes exhibit a third, and sometimes a fourth, adult involved in breeding activities at a nest. We applied DNA fingerprinting to assess relatedness among 17 individuals at four nests. In all nests with young, a subordinate rather than the dominant male sired the offspring. Within-nest relatedness comparisons showed that some dominan...

  16. YT: A Multi-Code Analysis Toolkit for Astrophysical Simulation Data

    Energy Technology Data Exchange (ETDEWEB)

    Turk, Matthew J.; /San Diego, CASS; Smith, Britton D.; /Michigan State U.; Oishi, Jeffrey S.; /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Skory, Stephen; Skillman, Samuel W.; /Colorado U., CASA; Abel, Tom; /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Norman, Michael L.; /aff San Diego, CASS

    2011-06-23

    The analysis of complex multiphysics astrophysical simulations presents a unique and rapidly growing set of challenges: reproducibility, parallelization, and vast increases in data size and complexity chief among them. In order to meet these challenges, and in order to open up new avenues for collaboration between users of multiple simulation platforms, we present yt (available at http://yt.enzotools.org/) an open source, community-developed astrophysical analysis and visualization toolkit. Analysis and visualization with yt are oriented around physically relevant quantities rather than quantities native to astrophysical simulation codes. While originally designed for handling Enzo's structure adaptive mesh refinement data, yt has been extended to work with several different simulation methods and simulation codes including Orion, RAMSES, and FLASH. We report on its methods for reading, handling, and visualizing data, including projections, multivariate volume rendering, multi-dimensional histograms, halo finding, light cone generation, and topologically connected isocontour identification. Furthermore, we discuss the underlying algorithms yt uses for processing and visualizing data, and its mechanisms for parallelization of analysis tasks.

  17. yt: A MULTI-CODE ANALYSIS TOOLKIT FOR ASTROPHYSICAL SIMULATION DATA

    International Nuclear Information System (INIS)

    Turk, Matthew J.; Norman, Michael L.; Smith, Britton D.; Oishi, Jeffrey S.; Abel, Tom; Skory, Stephen; Skillman, Samuel W.

    2011-01-01

    The analysis of complex multiphysics astrophysical simulations presents a unique and rapidly growing set of challenges: reproducibility, parallelization, and vast increases in data size and complexity chief among them. In order to meet these challenges, and in order to open up new avenues for collaboration between users of multiple simulation platforms, we present yt (available at http://yt.enzotools.org/) an open source, community-developed astrophysical analysis and visualization toolkit. Analysis and visualization with yt are oriented around physically relevant quantities rather than quantities native to astrophysical simulation codes. While originally designed for handling Enzo's structure adaptive mesh refinement data, yt has been extended to work with several different simulation methods and simulation codes including Orion, RAMSES, and FLASH. We report on its methods for reading, handling, and visualizing data, including projections, multivariate volume rendering, multi-dimensional histograms, halo finding, light cone generation, and topologically connected isocontour identification. Furthermore, we discuss the underlying algorithms yt uses for processing and visualizing data, and its mechanisms for parallelization of analysis tasks.

  18. Osakeyhtiön sivuuttaminen nykyisessä tuloverotuskäytännössä

    OpenAIRE

    Kuha, Pia

    2015-01-01

    Opinnäytetyön tarkoituksena oli tutkia mikä on nykyinen käytäntö osakeyhtiöiden sivuuttamisissa verotuskäytännössä sekä mihin suuntaan tulevaisuudessa osakeyhtiöiden sivuuttamiskäytäntö on mahdollisesti muuttumassa. Idea opinnäytetyöhön lähti ollessani työharjoittelussa syksyllä 2013 toimeksiantajan kanssa käydyistä keskusteluista ja omasta kiinnostuksesta verotuskäytäntöihin. Toimeksiantaja on oululainen taloushallinnon palveluita tarjoava yritys, joka on vuodesta 2011 tarjonnut laadukkaita ...

  19. Tilintarkastusasiakkaan riskiluokittelu ja väärinkäytökset

    OpenAIRE

    Hieturi, Jonna

    2013-01-01

    Tilintarkastusasiakkaan riskiluokittelu on koko tilintarkastuksen ajan jatkuva prosessi. Riskiluokittelu alkaa toimeksiantosopimuksen solmimisesta ja päättyy tilintarkastuskertomuksen luovuttamiseen. Kyseisen luokittelun avulla yritetään vähentää riskiä mahdollisista väärinkäytöksistä. Erilaisia riskejä ovat väärinkäytösriskit, olennaisen virheellisyyden riskeihin lukeutuvat toiminta- ja kontrolliriski sekä merkittävät riskit. Yhdessä HTM-tilintarkastaja Jorma Nuutisen kanssa toteutimme haas...

  20. Low genetic diversity and strong population structure shaped by anthropogenic habitat fragmentation in a critically endangered primate, Trachypithecus leucocephalus.

    Science.gov (United States)

    Wang, W; Qiao, Y; Li, S; Pan, W; Yao, M

    2017-06-01

    Habitat fragmentation may strongly impact population genetic structure and reduce the genetic diversity and viability of small and isolated populations. The white-headed langur (Trachypithecus leucocephalus) is a critically endangered primate species living in a highly fragmented and human-modified habitat in southern China. We examined the population genetic structure and genetic diversity of the species and investigated the environmental and anthropogenic factors that may have shaped its population structure. We used 214 unique multi-locus genotypes from 41 social groups across the main distribution area of T. leucocephalus, and found strong genetic structure and significant genetic differentiation among local populations. Our landscape genetic analyses using a causal modelling framework suggest that a large habitat gap and geographical distance represent the primary landscape elements shaping genetic structure, yet high levels of genetic differentiation also exist between patches separated by a small habitat gap or road. This is the first comprehensive study that has evaluated the population genetic structure and diversity of T. leucocephalus using nuclear markers. Our results indicate strong negative impacts of anthropogenic land modifications and habitat fragmentation on primate genetic connectivity between forest patches. Our analyses suggest that two management units of the species could be defined, and indicate that habitat continuity should be enforced and restored to reduce genetic isolation and enhance population viability.

  1. Kahdeksasluokkalaisten kokemukset omasta puhelimen käytöstään

    OpenAIRE

    Nygård, Jessica

    2016-01-01

    Tutkimuksen tarkoituksena oli selvittää kahdeksasluokkalaisten kokemuksia omasta puhelimen käytöstään ja tutkia, kokivatko he puhelinriippuvuutta. Tavoitteena oli saada ajankohtaista tietoa nuorten mielipiteistä. Tutkimus suoritettiin kvalitatiivisena eli laadullisena tutkimuksena. Tutkimusaineisto kerättiin vaasalaisen yläasteen kahdeksasluokkalaisilta nuorilta toukokuussa 2016, ja kyselyyn osallistui kymmenen nuorta. Tutkimuksen aineistonkeruumenetelmänä käytettiin kyselytutkimusta. Tut...

  2. Biodegradation of Di-(2-ethylhexyl Phthalate by Rhodococcus ruber YC-YT1 in Contaminated Water and Soil

    Directory of Open Access Journals (Sweden)

    Ting Yang

    2018-05-01

    Full Text Available Di-(2-ethylehxyl phthalate (DEHP is one of the most broadly representative phthalic acid esters (PAEs used as a plasticizer in polyvinyl chloride (PVC production, and is considered to be an endocrine-disrupting chemical. DEHP and its monoester metabolites are responsible for adverse effects on human health. An efficient DEHP-degrading bacterial strain Rhodococcus ruber YC-YT1, with super salt tolerance (0–12% NaCl, is the first DEHP-degrader isolated from marine plastic debris found in coastal saline seawater. Strain YC-YT1 completely degraded 100 mg/L DEHP within three days (pH 7.0, 30 °C. According to high-performance liquid chromatography–mass spectrometry (HPLC-MS analysis, DEHP was transformed by strain YC-YT1 into phthalate (PA via mono (2-ethylehxyl phthalate (MEHP, then PA was used for cell growth. Furthermore, YC-YT1 metabolized initial concentrations of DEHP ranging from 0.5 to 1000 mg/L. Especially, YC-YT1 degraded up to 60% of the 0.5 mg/L initial DEHP concentration. Moreover, compared with previous reports, strain YC-YT1 had the largest substrate spectrum, degrading up to 13 kinds of PAEs as well as diphenyl, p-nitrophenol, PA, benzoic acid, phenol, protocatechuic acid, salicylic acid, catechol, and 1,2,3,3-tetrachlorobenzene. The excellent environmental adaptability of strain YC-YT1 contributed to its ability to adjust its cell surface hydrophobicity (CSH so that 79.7–95.9% of DEHP-contaminated agricultural soil, river water, coastal sediment, and coastal seawater were remedied. These results demonstrate that R. ruber YC-YT1 has vast potential to bioremediate various DEHP-contaminated environments, especially in saline environments.

  3. Growth and essential oil production by Martianthus leucocephalus grown under the edaphoclimatic conditions of Feira de Santana, Bahia, Brazil

    Directory of Open Access Journals (Sweden)

    Bianca Oliveira de Azevedo

    2015-01-01

    Full Text Available ABSTRACT: The semiarid region of Brazil holds a great richness of medicinal and aromatic plants with considerable potential for pharmaceutical, food, cosmetic and biopesticide industries. Martianthus leucocephalus (Mart. Ex Benth. J. F. B. Pastore is endemic to this region, and its essential oils contain a principle compound, isobornyl formate, which demonstrates antimicrobial activity against Bacilus cereus, Staphylococcus aureus and Candida albicans. In spite of its significant pharmacological potential, little is known about its growth. In light of the influence of seasonality on plant growth, development, and secondary metabolism, the present study evaluated the growth and essential oil content of M. leucocephalus grown and harvested during different months of the year in the edaphoclimatic conditions of Feira de Santana, Bahia State, Brazil. The experimental design was entirely randomized, with twelve harvesting periods and five replicates. The study acquired monthly data of mean temperatures, relative humidity, rainfall, irradiance, and photoperiod from the National Institute of Meteorology (INMET and quantified the fresh and dry weights of leaves, flowers and branches, as well as leaf area, and essential oil content. The data were submitted to Spearman correlation analysis and the means were compared using the Scott-Knott test. Total leaf masses and oil contents were higher during periods with longer photoperiods and higher solar irradiance. Rainfall and relative humidity reduced plant growth and essential oil content. Higher total mean dry masses were recorded from September to January (except October, while oil content was higher in March.

  4. Ammattiosaamisen näytöt : Pohjois-Karjalan Ammattiopisto Outokumpu, Radio- ja TV-työ

    OpenAIRE

    Dufva, Pilvi; Laatikainen, Mika

    2008-01-01

    Kehittämishankeraportissa kuvataan Pohjois-Karjalan Ammattiopisto Outokummun Radio- ja TV-työn linjan ensimmäisten ammattiosaamisen näyttöjen suunnittelua ja toteuttamista. Ammattiosaamisen näytöt toteutettiin maaliskuussa 2008. Kehittämishankkeen aiheena oli suunnitella ja toteuttaa Radio- ja TV-työn ensimmäiset ammattiosaamisen näytöt video-, televisio- ja elokuvailmaisun 15 opintoviikon kokonaisuuteen (VTE-ilmaisu). This project describes how the first vocational skills demonstration wa...

  5. The effect of support springs in ends welded gap hollow YT-joint

    Directory of Open Access Journals (Sweden)

    R. F. Vieira

    Full Text Available This paper presents an analysis on the effect of support springs in an ends circular hollow sections welded into a YT joint. The overall behavior and failure of the joint were characterized under axial compression of the lap brace. Two joint failure modes were identified: chord wall plastification (Mode A and cross-sectional chord buckling (Mode F in the region below the lap brace. The system was modeled with and without support springs using the numerical finite element program Ansys. Model results were compared with experimental data in terms of principal stress in the joint intersection. The finite element model without support springs proved to be more accurate than that with support springs.

  6. Modelling the impact of toxic and disturbance stress on white-tailed eagle (Haliaeetus albicilla) populations.

    Science.gov (United States)

    Korsman, John C; Schipper, Aafke M; Lenders, H J Rob; Foppen, Ruud P B; Hendriks, A Jan

    2012-01-01

    Several studies have related breeding success and survival of sea eagles to toxic or non-toxic stress separately. In the present investigation, we analysed single and combined impacts of both toxic and disturbance stress on populations of white-tailed eagle (Haliaeetus albicilla), using an analytical single-species model. Chemical and eco(toxico)logical data reported from laboratory and field studies were used to parameterise and validate the model. The model was applied to assess the impact of ∑PCB, DDE and disturbance stress on the white-tailed eagle population in The Netherlands. Disturbance stress was incorporated through a 1.6% reduction in survival and a 10-50% reduction in reproduction. ∑PCB contamination from 1950 up to 1987 was found to be too high to allow the return of white-tailed eagle as a breeding species in that period. ∑PCB and population trends simulated for 2006-2050 suggest that future population growth is still reduced. Disturbance stress resulted in a reduced population development. The combination of both toxic and disturbance stress varied from a slower population development to a catastrophical reduction in population size, where the main cause was attributed to the reduction in reproduction of 50%. Application of the model was restricted by the current lack of quantitative dose-response relationships between non-toxic stress and survival and reproduction. Nevertheless, the model provides a first step towards integrating and quantifying the impacts of multiple stressors on white-tailed eagle populations.

  7. The effects of wind turbines on white-tailed eagles (Haliaeetus Albicilla) in Hokkaido, Japan

    Energy Technology Data Exchange (ETDEWEB)

    Shiraki, Saiko; Kitano, Masato

    2011-07-01

    Full text: The recent growth of wind facilities in Japan has raised concerns about bird collisions, especially for white-tailed eagles in Hokkaido, northern part of Japan. Approx. 150 pairs of white-tailed eagles breed in Hokkaido in the latest survey (Shiraki unpub. data) and these pairs are considered as residents. On the other hand, ca.500-700 white-tailed eagles including migrants from the breeding areas in Russia winter in Hokkaido. The major objectives of this study are to (1) examine the impacts of wind turbines on white-tailed eagles by information analysis in the previous accident reports of the collisions and by field investigations at the wind facilities, and (2) explore the possible factors which relate to the collisions of the eagles with wind turbines A total of 24 collisions of sea eagles (Haliaeetus spp.) have been reported by both incidental discoveries and fatality searching since 2004 in Hokkaido. 22 of the 24 fatalities were white-tailed eagles and 23 of the 24 were immature birds. Field surveys to estimate of fatality rate of white-tailed eagles and observations of the flight behaviours were carried out at the wind facilities including a total of 42 turbines for one and half years. Annual mortality for white-tailed eagles was estimated at 0.08 fatalities / yr / MW and the Risk Index (Smallwood et Thelander 2004) was calculated at 0.058, the second highest value after common buzzards (Buteo buteo) in this survey. In addition, white-tailed eagles and common buzzards flew at the altitudes of rotor zones of the wind turbines more frequently than the other raptors. The effects of the collisions at wind turbines on white-tailed eagles in Hokkaido based on the results of this study, and on the ecological and the genetically information of the population will be considered in the presentation. (Author)

  8. 51Chromium survival of Yt(a+) red cells as a determinant of the in vivo significance of anti-Yta

    International Nuclear Information System (INIS)

    Davey, R.J.; Simpkins, S.S.

    1981-01-01

    A case is presented in which anti-Yta produced a moderately accelerated removal of chromium-labeled Yt(a+) red blood cells (T1/2, 96 hours). Other reported examples of anti-Yta either have rapidly removed transfused Yt(a+) red blood cells or have permitted apparently normal survival of these cells. In light of this wide variation in in vivo potency of anti-Yta, it is recommended that chromium red blood cell survival studies be done before transfusion of Yt(a+) red blood cells in sensitized individuals

  9. Role of disulphide bonds in a thermophilic serine protease aqualysin I from Thermus aquaticus YT-1.

    Science.gov (United States)

    Sakaguchi, Masayoshi; Takezawa, Makoto; Nakazawa, Rie; Nozawa, Kazutaka; Kusakawa, Taro; Nagasawa, Takeshi; Sugahara, Yasusato; Kawakita, Masao

    2008-05-01

    A thermophilic serine protease, Aqualysin I, from Thermus aquaticus YT-1 has two disulphide bonds, which are also found in a psychrophilic serine protease from Vibrio sp. PA-44 and a proteinase K-like enzyme from Serratia sp. at corresponding positions. To understand the significance of these disulphide bonds in aqualysin I, we prepared mutants C99S, C194S and C99S/C194S (WSS), in which Cys69-Cys99, Cys163-Cys194 and both of these disulphide bonds, respectively, were disrupted by replacing Cys residues with Ser residues. All mutants were expressed stably in Escherichia coli. The C99S mutant was 68% as active as the wild-type enzyme at 40 degrees C in terms of k(cat) value, while C194S and WSS were only 6 and 3%, respectively, as active, indicating that disulphide bond Cys163-Cys194 is critically important for maintaining proper catalytic site conformation. Mutants C194S and WSS were less thermostable than wild-type enzyme, with a half-life at 90 degrees C of 10 min as compared to 45 min of the latter and with transition temperatures on differential scanning calorimetry of 86.7 degrees C and 86.9 degrees C, respectively. Mutant C99S was almost as stable as the wild-type aqualysin I. These results indicate that the disulphide bond Cys163-Cys194 is more important for catalytic activity and conformational stability of aqualysin I than Cys67-Cys99.

  10. Tiiviisti yhdestä suusta : Tutkimus kertojan käytön merkityksestä dokumenttielokuvassa

    OpenAIRE

    Rahkola, Nina

    2009-01-01

    TIIVISTELMÄ Rahkola, Nina. Tiiviisti yhdestä suusta. Tutkimus kertojan käytön merkityksestä dokumenttielokuvassa. Turku, syksy 2009, 68 s. Diakonia‐ammattikorkeakoulu, Diak Länsi Turku. Viestinnän koulutusohjelma, monimediatoimittajan suuntautumisvaihtoehto, medianomi (AMK). Opinnäytetyön tavoitteena oli selvittää, mitä kertojan käyttö merkitsee dokumenttielokuvassa. Tutkielmassa perehdyttiin myös siihen, miten kertojan käyttö vaikuttaa dokumentin tekoprosessiin. Lisäksi tar...

  11. Biodegradation of Di-(2-ethylhexyl) Phthalate by Rhodococcus ruber YC-YT1 in Contaminated Water and Soil

    OpenAIRE

    Ting Yang; Lei Ren; Yang Jia; Shuanghu Fan; Junhuan Wang; Jiayi Wang; Ruth Nahurira; Haisheng Wang; Yanchun Yan

    2018-01-01

    Di-(2-ethylehxyl) phthalate (DEHP) is one of the most broadly representative phthalic acid esters (PAEs) used as a plasticizer in polyvinyl chloride (PVC) production, and is considered to be an endocrine-disrupting chemical. DEHP and its monoester metabolites are responsible for adverse effects on human health. An efficient DEHP-degrading bacterial strain Rhodococcus ruber YC-YT1, with super salt tolerance (0–12% NaCl), is the first DEHP-degrader isolated from marine plastic debris found in c...

  12. High-level expression, secretion, and purification of the thermostable aqualysin I from Thermus aquaticus YT-1 in Pichia pastoris

    DEFF Research Database (Denmark)

    Oledzka, G.; Dabrowski, Slawomir; Kur, J.

    2003-01-01

    Aqualysin I is a heat-stable subtilisin-type serine protease which is secreted into the culture medium by Thermus aquaticus YT-1, an extreme thermophile. We report the high-level expression of an aqualysin I protein using its native signal sequence for secretion in the methylotrophic yeast, Pichia...... to that of the native enzyme. We also explored the possibility of secreting the GAP expressed aqualysin I in P. pastoris by in-frame fusion of the Saccharomyces cerevisiae alpha-factor secretion signal. However, the levels of secreted pro-aqualysin I particles were approximately 10 times lower, possibly...

  13. Verkkoyhteisöpalveluiden käytön hyödyt ja haitat työllistyvyydelle

    OpenAIRE

    Toivonen, Julia

    2016-01-01

    Sosiaalisen median käyttö on kasvanut viime vuosina huomattavasti ja verkkoyhteisöpalveluiden käyttö työllistyvyyden edistämisen apuna on kasvussa. Verkkoyhteisöpalveluiden käytöllä voidaan katsoa olevan sekä positiivia että negatiivisia vaikutuksia yksilön työllistyvyydelle. Sosiaalisella medialla on suuri mahdollisuus toimia erityisen tehokkaana osana yksilön työllistyvyyden edistämistä, sillä sosiaalinen media tarjoaa paljon mahdollisuuksia rekrytointiin, omien taitojen esille tuomiseen se...

  14. Comparison of locomotor behaviour between white-headed langurs Trachypithecus leucocephalus and François’ langurs T. françoisi in Fusui, China

    OpenAIRE

    Jinrong XIONG; Shihua GONG; Chenggang QIU; Zhaoyuan LI

    2009-01-01

    We studied the locomotor behaviour of white-headed langurs Trachypithecus leucocephalus and François’ langurs T.françoisi to test two hypotheses: (1) these monkeys have evolved locomotor ability to support their activities on limestone hills, and (2) François’ langurs have evolved more diverse locomotor skills than white-headed langurs. Data were collected from 1996–1998 and in 2005 in Fusui Nature Reserve, Guangxi, and showed that the two species had similar locomotor types, but François’ l...

  15. Arkea, ammattitaitoa ja yhteistyötä : työntekijöiden kokemuksia käytöshäiriöisten nuorten hoidosta koulukodissa

    OpenAIRE

    Haunia, Henna

    2011-01-01

    TIIVISTELMÄ Haunia, Henna. Arkea, ammattitaitoa ja yhteistyötä : työntekijöiden kokemuksia käytöshäiriöisten nuorten hoidosta koulukodissa. Helsinki, syksy 2011. Diakonia-ammattikorkeakoulu, Diak Etelä, Helsinki. Sosiaalialan koulutusohjelma, sosionomi (YAMK). Tämän opinnäytetyön tarkoituksena oli tutkia koulukodissa tapahtuvaan käytöshäiriöisten nuorten hoitoon liittyviä työmenetelmiä ja kehittämisen tarpeita. Tässä laadullisessa tutkimuksessa tutkimusmenetelmänä oli toimintatutkimus....

  16. Ingestion of lead from ammunition and lead concentrations in white-tailed sea eagles (Haliaeetus albicilla) in Sweden

    International Nuclear Information System (INIS)

    Helander, B.; Axelsson, J.; Borg, H.; Holm, K.; Bignert, A.

    2009-01-01

    In this study we show for the first time that lead poisoning from ammunition is a significant mortality factor for white-tailed sea eagle (WSE) (Haliaeetus albicilla) in Sweden. We analyzed 118 WSEs collected between 1981 and 2004 from which both liver and kidney samples could be taken. A total of 22% of all eagles examined had elevated (> 6 μg/g d.w.) lead concentrations, indicating exposure to leaded ammunition, and 14% of the individuals had either liver or kidney lead concentrations diagnostic of lethal lead poisoning (> 20 μg/g d.w.). Lead concentrations in liver and kidney were significantly correlated. In individuals with lead levels 20 μg/g, concentrations were significantly higher in liver. The lead isotope ratios indicate that the source of lead in individuals with lethal concentrations is different from that of individuals exhibiting background concentrations of lead ( 10 times higher than concentrations reported for Baltic fish from the same time period. In contrast to other biota there was no decrease in lead concentrations in WSE over the study period. The proportion of lead poisoned WSE remained unchanged over the study period, including two years after a partial ban of lead shot was enforced in 2002 for shallow wetlands. The use of lead in ammunition poses a threat to all raptors potentially feeding on shot game or offal. The removal of offal from shot game and alternatives to leaded ammunition needs to be implemented in order to prevent mortality from lead in raptors and scavengers.

  17. Ingestion of lead from ammunition and lead concentrations in white-tailed sea eagles (Haliaeetus albicilla) in Sweden

    Energy Technology Data Exchange (ETDEWEB)

    Helander, B., E-mail: bjorn.helander@nrm.se [Department of Contaminant Research, Swedish Museum of Natural History, Box 50007, SE-104 05 Stockholm (Sweden); Axelsson, J., E-mail: jeanette.axelsson@hgen.slu.se [Department of Environmental Toxicology, Evolutionary Biology Centre, Uppsala University, SE-752 36 Uppsala (Sweden); Borg, H., E-mail: hans.borg@itm.su.se [Department of Applied Environmental Science/ITM, Stockholm University, SE-106 91 Stockholm (Sweden); Holm, K. [Department of Applied Environmental Science/ITM, Stockholm University, SE-106 91 Stockholm (Sweden); Bignert, A., E-mail: anders.bignert@nrm.se [Department of Contaminant Research, Swedish Museum of Natural History, Box 50007, SE-104 05 Stockholm (Sweden)

    2009-10-15

    In this study we show for the first time that lead poisoning from ammunition is a significant mortality factor for white-tailed sea eagle (WSE) (Haliaeetus albicilla) in Sweden. We analyzed 118 WSEs collected between 1981 and 2004 from which both liver and kidney samples could be taken. A total of 22% of all eagles examined had elevated (> 6 {mu}g/g d.w.) lead concentrations, indicating exposure to leaded ammunition, and 14% of the individuals had either liver or kidney lead concentrations diagnostic of lethal lead poisoning (> 20 {mu}g/g d.w.). Lead concentrations in liver and kidney were significantly correlated. In individuals with lead levels < 6 {mu}g/g, concentrations were significantly higher in kidney than in liver; in individuals with lead levels > 20 {mu}g/g, concentrations were significantly higher in liver. The lead isotope ratios indicate that the source of lead in individuals with lethal concentrations is different from that of individuals exhibiting background concentrations of lead (< 6 {mu}g/g d.w.) There were no significant sex or age differences in lead concentrations. A study from the Baltic reported in principle no biomagnification of lead, but background lead concentrations in WSE liver in this study were still four to > 10 times higher than concentrations reported for Baltic fish from the same time period. In contrast to other biota there was no decrease in lead concentrations in WSE over the study period. The proportion of lead poisoned WSE remained unchanged over the study period, including two years after a partial ban of lead shot was enforced in 2002 for shallow wetlands. The use of lead in ammunition poses a threat to all raptors potentially feeding on shot game or offal. The removal of offal from shot game and alternatives to leaded ammunition needs to be implemented in order to prevent mortality from lead in raptors and scavengers.

  18. Iodine chemistry effect on source term assessments. A MELCOR 186 YT study of a PWR severe accident sequence

    International Nuclear Information System (INIS)

    Herranz, Luis E.; Garcia, Monica; Otero, Bernadette

    2009-01-01

    Level-2 Probabilistic Safety Analysis has demonstrated to be a powerful tool to give insights into multiple aspects concerning severe accidents: phenomena with the greatest potential to lead to containment failure, safety systems performance and, even, to identify any additional accident management that could mitigate the consequences of such an even, etc. A major result of level-2 PSA is iodine content in Source Term since it is the main responsible for the radiological impact during the first few days after a hypothetical severe accident. Iodine chemistry is known to considerably affect iodine behavior and although understanding has improved substantially since the early 90's, a thorough understanding is still missing and most PSA studies do not address it when assessing severe accident scenarios. This paper emphasizes the quantitative and qualitative significance of considering iodine chemistry in level-2 PSA estimates. To do so a cold leg break, low pressure severe accident sequence of an actual pressurized water reactor has been analyzed with the MELCOR 1.8.6 YT code. Two sets of calculations, with and without chemistry, have been carried out and compared. The study shows that iodine chemistry could result in an iodine release to environment about twice higher, most of which would consist of around 60% of iodine in gaseous form. From these results it is concluded that exploratory studies on the potential effect of iodine chemistry on source term estimates should be carried out. (author)

  19. Effect of yield to tensile (Y/T) ratio on the structural integrity of offshore pipeline: advanced engineering assessment using limit state design approach

    Energy Technology Data Exchange (ETDEWEB)

    Malatesta, G; Mannucci, G; Demofonti, G [Centro Sviluppo Materiali S.p.A., Rome (Italy); Cumino, G [TenarisDalmine (Italy); Izquierdo, A; Tivelli, M [Tenaris Group (Mexico); Quintanilla, H [TENARIS Group (Mexico). TAMSA

    2005-07-01

    Nowadays specifications require strict Yield to Tensile ratio limitation, nevertheless a fully accepted engineering assessment of its influence on pipeline integrity is still lacking. Probabilistic analysis based on structural reliability approach (Limit State Design) aimed at quantifying the Y/T ratio influence on failure probabilities of offshore pipelines was made. In particular, Tenaris seamless pipe data were used as input for the probabilistic failure analysis. The LSD approach has been applied to two actual deep water design cases that have been on purpose selected, and the most relevant failure modes have been considered. Main result of the work is that the quantitative effect of the Y/T ratio on failure probabilities of a deep water pipeline resulted not so big as expected; it has a minor effect, especially when failure modes are governed by Y only. (author)

  20. Ammattikorkeakoulujen Julkaisuarkisto Theseus : käyttöönotto- ja perustamisvaiheet sekä nykyiset käytänteet ammattikorkeakouluissa

    OpenAIRE

    Ranta, Anna-Kaisa; Lahdenperä, Silja

    2012-01-01

    Tässä opinnäytetyössä perehdytään Julkaisuarkisto Theseuksen perustamisvaiheisiin ja käyttöönottoon Suomen ammattikorkeakouluissa. Theseuksen historia käydään läpi Open Access -hankkeen alkuvaiheista nykypäivään asti ja lopuksi luodaan katsaus myös tulevaisuuteen. Lisäksi työssä tutkitaan ammattikorkeakoulujen erilaisia käytänteitä Theseuksen käytön suhteen. Aloitteen työn tekemiseksi on tehnyt Theseus-ohjausryhmä ja työn toimeksiantaja on AMKIT-konsortion johtoryhmä. Tietolähteinä käytet...

  1. Survey for hemoparasites in imperial eagles (Aquila heliaca), steppe eagles (Aquila nipalensis), and white-tailed sea eagles (Haliaeetus albicilla) from Kazakhstan.

    Science.gov (United States)

    Leppert, Lynda L; Layman, Seth; Bragin, Evgeny A; Katzner, Todd

    2004-04-01

    Prevalence of hemoparasites has been investigated in many avian species throughout Europe and North America. Basic hematologic surveys are the first step toward evaluating whether host-parasite prevalences observed in North America and Europe occur elsewhere in the world. We collected blood smears from 94 nestling imperial eagles (Aquila heliaca), five nestling steppe eagles (Aquila nipalensis), and 14 nestling white-tailed sea eagles (Haliaeetus albicilla) at Naurzum Zapovednik (Naurzum National Nature Reserve) in Kazakhstan during the summers of 1999 and 2000. In 1999, six of 29 imperial eagles were infected with Lencocytozoon toddi. Five of 65 imperial eagles and one of 14 white-tailed sea eagle were infected with L. toddi in 2000. Furthermore, in 2000, one of 65 imperial eagles was infected with Haemoproteus sp. We found no parasites in steppe eagles in either year, and no bird had multiple-species infections. These data are important because few hematologic studies of these eagle species have been conducted.

  2. Molecular identification of Sarcocystis halieti n. sp., Sarcocystis lari and Sarcocystis truncata in the intestine of a white-tailed sea eagle (Haliaeetus albicilla in Norway

    Directory of Open Access Journals (Sweden)

    Bjørn Gjerde

    2018-04-01

    Full Text Available An emaciated white-tailed sea eagle (Haliaeetus albicilla from Western Norway was found and nursed briefly before it died. The necropsy revealed that the principal cause of death was an inflammation and occlusion of the bile ducts. A secondary finding was the presence in the intestinal mucosa of numerous sporulated Sarcocystis oocysts measuring 21.8–22.8 × 16.0–17.0 μm. The aim of this study was to identify these oocysts to species level using molecular methods. Genomic DNA was extracted from 10 mucosal scrapings containing oocysts and subjected to PCR amplification and sequencing of four DNA regions: the 18S and 28S rRNA genes, the ITS1 region and the cox1 gene. DNA of three previously known Sarcocystis spp. was identified, but only two of these, Sarcocystis halieti n. sp. and Sarcocystis lari, both employing sea birds as intermediate hosts, were considered to have used the sea eagle as a definitive host and to have formed oocysts in its intestine. The third species found, Sarcocystis truncata, employs red deer as intermediate hosts and seems to use felids as definitive hosts based on its phylogenetic position and prevalence. The sea eagle had probably recently ingested portions of one of the latter hosts (red deer or cat/lynx containing stages (sarcocysts/oocysts and thus DNA of S. truncata. The species S. halieti and S. lari could only be unambiguously separated from their most closely related congeners on the basis of their ITS1 sequences. This is the first report of Sarcocystis oocysts in sea eagles and the first identification to species level of Sarcocystis oocysts in any type of eagle. The sea eagle also acted as intermediate host of an unidentified Sarcocystis spp. as evidenced by the finding of six thin-walled sarcocysts in a histological section of cardiac muscle. Keywords: Sarcocystis, Haliaeetus albicilla, Oocysts, ITS1, Cox1, Phylogeny

  3. Physical characteristics of bald eagle eggs from Maine, 2000 to 2012

    Data.gov (United States)

    Department of the Interior — Between 2000 and 2012, 91 abandoned or non‐viable bald eagle (Haliaeetus leucocephalus) eggs were collected from55 nest territories in inland and coastal habitats in...

  4. Terminologia työvälineenä – aikamuotojärjestelmästä ja sen opetuskäytänteiden ergonomiasta S2-opetuksessa

    Directory of Open Access Journals (Sweden)

    Maria Kok

    2012-10-01

    Full Text Available Artikkeli käsittelee kahta ongelmalliseksi osoittautunutta verbien tempusnimitystä, perfektiä ja imperfektiä. Tarkastelen kirjoituksessani nimitysten välittämää informaatiota, jota vertaan S2-oppikirjoissa aikamuotojen käytöstä annettuun tietoon. Kriittisen katsauksen tavoitteena on osoittaa harhaanjohtavien termien haitta ja hyvän metakielen tarve sekä myös pohtia keinoja virheellisten nimitysten korjaamiseksi. Teoreettisena viitekehyksenä on työolosuhteita, työvälineitä ja työtapoja tutkiva ergonomia. Koska kielen opetus ja opiskelu ovat työtä ja metakieli on työväline, jolla opettaja ja opiskelijat yhdessä työskentelevät, on käytettävän termistön ammatillinen ja käytännönläheinen arviointi tarpeen. DOI: http://dx.doi.org/10.5128/LV22.04

  5. A comparison of non-destructive sampling strategies to assess the exposure of white-tailed eagle nestlings (Haliaeetus albicilla) to persistent organic pollutants.

    Science.gov (United States)

    Eulaers, Igor; Covaci, Adrian; Hofman, Jelle; Nygård, Torgeir; Halley, Duncan J; Pinxten, Rianne; Eens, Marcel; Jaspers, Veerle L B

    2011-12-01

    To circumvent difficulties associated with monitoring adult predatory birds, we investigated the feasibility of different non-destructive strategies for nestling white-tailed eagles (Haliaeetus albicilla). We were able to quantify polychlorinated biphenyls (PCBs), polybrominated diphenyl ethers (PBDEs) and organochlorinated pesticides (OCPs) in body feathers (16.92, 3.37 and 7.81ngg(-1) dw, respectively), blood plasma (8.37, 0.32 and 5.22ngmL(-1) ww, respectively), and preen oil (1157.95, 30.92 and 440.74ngg(-1) ww, respectively) of all nestlings (N=14). Strong significant correlations between blood plasma and preen oil concentrations (0.565≤r≤0.801; Pfeather and blood plasma concentrations, which were almost exclusively between PCB concentrations (0.554≤r≤0.737; Pnest, were possibly undergoing certain physiological changes that may have confounded the use of body feathers as biomonitor matrix. Finally, we provide an integrated discussion on the use of body feathers and preen oil as non-destructive biomonitor strategies for nestling predatory birds. Copyright © 2011 Elsevier B.V. All rights reserved.

  6. Some haltuun : Murrosikäisen sosiaalisen median käytön ohjaus terveydenhoitajan työssä

    OpenAIRE

    Paavola, Pinja; Haapala, Lotta

    2016-01-01

    Opinnäytetyön tavoitteena oli lisätä terveydenhoitajien tietämystä sosiaalisesta mediasta, jotta he osaavat ohjata murrosikäisiä sosiaalisen median turvallisessa käytössä ja, että murrosikäinen voi käyttää sosiaalista mediaa turvallisesti. Tarkoituksena oli selvittää, miten murrosikäinen käyttää sosiaalisen median sovelluksia ja miten terveydenhoitaja voisi ohjata sosiaalisen median turvalliseen käyttöön. Tutkimuskysymyksinä oli selvittää; mitä murrosikäinen tietää sosiaalisen median turvalli...

  7. Eihän "leikkitäti" voi väsyä, vai voiko? : Käytännön olosuhteet ja työstä aiheutuva stressi musiikkileikkikoulunopettajan työssä

    OpenAIRE

    Busk, Vilma

    2012-01-01

    TIIVISTELMÄ Tässä opinnäytetyössä tarkastellaan musiikkileikkikoulunopettajan työtä ja sen haasteita. Keskiössä ovat työn käytännön olosuhteet ja työstä aiheutuva stressi. Opinnäytetyötäni varten tein kyselytutkimuksen, jonka toteutin Internet-kyselynä Facebookissa, Muskari-ideoita-sivustolla. Kyselyyn vastasi 48 musiikkileikkikoulunopettajaa, joilla oli vaihteleva määrä kokemusta ja jotka olivat iältään 21—50-vuotiaita. Vastaajien taustatietojen lisäksi kartoitin mahdollisimman mon...

  8. Environmental Assessment: Space Innovation and Development Center Schriever AFB, Colorado

    Science.gov (United States)

    2006-03-01

    coloradensis T Greenback cutthroat trout Oncorhynchus clarki stomias T Least tern (interior population) .A Sterna antillarum E Mexican spotted owl Strix...Haliaeetus leucocephalus T Boreal toad Bufo boreas boreas c Canada lynx Lynx canadensis T Greenback cutthroat trout Oncorhynchus clarki stomias T Least...T CUSTER Bald eagle IIaliaeetus leucocephalus T Canada lynx Lynx canadensis T Greenback cutthroat trout Oncorhynchus clarki stomias T Mexican

  9. Lean jatkuvan kehittämisen ideataulu Herttoniemen päiväkirurgiseen yksikköön - Ideasta käytäntöön

    OpenAIRE

    Rapo, Jonna

    2016-01-01

    Lean jatkuvan kehittämisen ideataulu Herttoniemen päiväkirurgiseen yksikköön - Ideasta käytäntöön Opinnäytetyön tarkoituksena oli selvittää työntekijöiden keinoja kehittää hoitotyötä ennen Lean ideataulun käyttöönottoa ja selvittää onko ideataulu toimiva tapa kehittää hoitotyötä. Opinnäytetyön tavoitteena oli kehittää Herttoniemen päiväkirurgisen yksikön hoitotyötä potilaan parhaaksi Lean ideataulun avulla. Työntekijät voivat laittoivat kehittämisideoita ideatauluun, josta valittiin tote...

  10. Using nestling plasma to assess long-term spatial and temporal concentrations of organochlorine compounds in bald eagles within Voyageurs National Park, Minnesota, USA

    Science.gov (United States)

    H. Tyler Pittman; William W. Bowerman; Leland H. Grim; Teryl G. Grubb; William C. Bridges; Michael R. Wierda

    2015-01-01

    The bald eagle (Haliaeetus leucocephalus) population at Voyageurs National Park (VNP) provides an opportunity to assess long-term temporal and spatial trends of persistent environmental contaminants. Nestling bald eagle plasma samples collected from 1997 to 2010 were analyzed for polychlorinated biphenyls (PCBs) and organochlorine pesticides. Trends of total PCBs,...

  11. The effect of kleptoparasitic bald eagles and gyrfalcons on the kill rate of peregrine falcons hunting dunlins wintering in British Columbia

    NARCIS (Netherlands)

    Dekker, T.J.; Out, M.; Tabak, M.; Ydenberg, R.C.

    2012-01-01

    Kleptoparasitism in birds has been the subject of much research, and the Bald Eagle (Haliaeetus leucocephalus) is a known kleptoparasite. It has been reported to pirate ducks captured by Peregrine Falcons (Falco peregrinus), but ours is the first study to examine the effect of kleptoparasitic Bald

  12. The Bald and Golden Eagle Protection Act, species-based legal ...

    African Journals Online (AJOL)

    The Bald and Golden Eagle Protection Act of 1940 bestows legal protection on two North American eagle species in the United States of America. The Act was originally aimed at the legal protection of only one species: the Bald Eagle Haliaeetus leucocephalus, the national symbol of the USA. Later the Act was amended to ...

  13. Garrison Project - Lake Sakakawea Oil and Gas Management Plan, North Dakota

    Science.gov (United States)

    2012-11-01

    origin and specification of the sand, gravel, or stone that will be used for road construction must be included in this section. No construction...Haliaeetus leucocephalus Bald eagle Lanius ludovicianus Loggerhead shrike Limosa fedoa Marbled godwit Melanerpes...materials, such as sand, gravel, stone , and soil. BLM will approve use of construction materials on ac- quired lands for use off the installation

  14. 50 CFR 17.41 - Special rules-birds.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 2 2010-10-01 2010-10-01 false Special rules-birds. 17.41 Section 17.41 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT OF THE INTERIOR (CONTINUED... rules—birds. (a) Bald eagles (Haliaeetus leucocephalus) wherever listed as threatened under § 17.11(h...

  15. Final Report Bald and Golden Eagle Territory Surveys for the Lawrence Livermore National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Fratanduono, M. L. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2014-11-25

    Garcia and Associates (GANDA) was contracted by the Lawrence Livermore National Laboratory (LLNL) to conduct surveys for bald eagles (Haliaeetus leucocephalus) and golden eagles (Aquila chrysaetos) at Site 300 and in the surrounding area out to 10-miles. The survey effort was intended to document the boundaries of eagle territories by careful observation of eagle behavior from selected viewing locations throughout the study area.

  16. Food habits of Bald Eagles breeding in the Arizona desert

    Science.gov (United States)

    Teryl G. Grubb

    1995-01-01

    Of 1814 foraging attempts, prey captures, or nest deliveries by Bald Eagles (Haliaeetus leucocephalus) in 14 Arizona breeding areas during 1983-1985, 1471 observations were identifiable to at least class: fish (76%), mammal (18%), bird (4%), and reptile/amphibian (2%). Forty-five species were recorded: catfish (Ictalurus punctatus, Pylodictis olivaris), suckers (...

  17. Using nestling feathers to assess spatial and temporal concentrations of mercury in bald eagles at Voyageurs National Park, Minnesota, USA

    Science.gov (United States)

    H. T. Pittman; W. W. Bowerman; L. H. Grim; Teryl Grubb; W. C. Bridges

    2011-01-01

    Bald eagles (Haliaeetus leucocephalus) have been utilized as a biosentinel of aquatic ecosystem health in the Great Lakes Region since the early 1960s. Bald eagle populations have been monitored at Voyageurs National Park (VNP), Minnesota, since 1973. For the past 20 years, researchers have collected feathers from nestling bald eagles to assess their dietary exposure...

  18. Constructing bald eagle nests with natural materials

    Science.gov (United States)

    T. G. Grubb

    1995-01-01

    A technique for using natural materials to build artificial nests for bald eagles (Haliaeetus leucocephalus) and other raptors is detailed. Properly constructed nests are as permanently secured to the nest tree or cliff substrate as any eagle-built nest or human-made platform. Construction normally requires about three hours and at least two people. This technique is...

  19. ”Se on tärkeää, että sinä käyt ulkona, et istu vaan kotona ja teet erilaisia asioita.” : tutkimus harrastusten merkityksestä somalityttöjen vapaa-ajassa

    OpenAIRE

    Tikkanen, Noora

    2013-01-01

    Tämän opinnäytetyön tarkoituksena oli tutkia miten yksin Suomeen tulleet ja tälläkin hetkellä ilman perhettään asuvat somalitytöt viettävät vapaa-aikaansa, minkä merkityksen he antavat harrastuksille ja mitkä asiat vaikuttavat harrastustoimintaan osallistumiseen. Tutkimuksen tavoitteena oli löytää keinoja, joilla voitaisiin lisätä Turun ensi- ja turvakoti ry:n perheryhmäkodissa asuvien somalityttöjen harrastusaktiivisuutta, ja edistää näin heidän hyvinvointiaan ja kotoutumistaan. Tutkimus...

  20. Environmental Assessment: Implementation of the Tyndall Air Force Base Integrated Natural Resources Management Plan

    Science.gov (United States)

    2006-04-01

    follows U.S. Highway 98. This ridge divides the Base into the Beach Dunes and Wave- Cut Bluffs physiographic region to the west and the Flatwoods Forest...wild petunia Ruellia noctiflora E Wet prairie BIRDS American oystercatcher Haematopus palliates SSC Shoreline Bald eagle Haliaeetus leucocephalus...outdoor recreation activities, including boating, canoeing, fishing, fuel wood cutting , horseback riding, hunting, and trail walking. The Base has nine

  1. Wintering bald eagle trends in northern Arizona, 1975-2000

    Science.gov (United States)

    Teryl G. Grubb

    2003-01-01

    Between 1975 and 2000, 4,525 sightings of wintering bald eagles (Haliaeetus leucocephalus) were recorded at Mormon Lake in northern Arizona. Numbers of wintering eagles fluctuated little in the 20 years from 1975 through 1994 (5.5 ± 3.0 mean sightings per day). However, during the winters of 1995 through 1997 local record highs of 59 to 118 eagles...

  2. The 1996 Survey of Threatened and Endangered Species on Army Lands: A Summary Report.

    Science.gov (United States)

    1997-12-01

    TRISTIS) TOPEKA SHINER C FIS 1 ONCORHYNCHUS CLARKI STOMIAS GREENBACK CUTTHROAT TROUT T FIS 1 OREOMYSTIS (=LOXOPS) MANA CREEPER, HAWAII E BIR 2...PEREGRINE FORSCOM FT CARSON HALIAEETUS EAGLE, BALD T BIR B LEUCOCEPHALUS FORSCOM FT CARSON ONCORHYNCHUS CLARKI GREENBACK CUTTHROAT T FIS 0 STOMIAS TROUT...ONCORHYNCHUS CLARKI GREENBACK CUTTHROAT TROUT T FIS NR STOMIAS FORSCOM FT CARSON SPIRANTHES DILUVIALIS UTE LADIES’-TRESSES T PLA NR FORSCOM -FT CARSON STRIX

  3. Testing the role of contaminants in depressing avian numbers Evaluando el rol de los contaminantes sobre la disminución del número de aves

    OpenAIRE

    WILLIAM H. KARASOV; MICHAEL W. MEYER

    2000-01-01

    Environmental contaminants are ubiquitous and so are often key suspects in cases of lagging wildlife populations. How do we test hypotheses about cause-effect linkages between contaminants and wildlife health? We present three case studies in which different approaches were used to test hypotheses about effects of contaminants on wildlife. The cases involve the possible impacts of (1) polychlorinated biphenyl on Lake Superior bald eagles (Haliaeetus leucocephalus); (2) dioxin on osprey (Pandi...

  4. Virtuaalikuvat oppilaitosten käytössä

    OpenAIRE

    Jeskanen, Lauri

    2011-01-01

    Tämä opinnäytetyö käsittelee virtuaalikuvien, eli 360-asteisten panoraamojen, käyttöä oppilaitoksissa. Tärkeimpinä asioina on virtuaalikuvien sekä – kierrosten toiminnan selvittäminen sekä virtuaalikuvien tulevaisuuden käyttökohteiden arviointi. Tarkastelussa ovat myös virtuaalikuvien mahdollinen sisältö sekä käyttömediat. Opinnäytetyön tuloksena valmistui noin 40 virtuaalikuvaa kattava, toimeksiantajalle toimitettu, virtuaalikierros Tampereen ammattikorkeakoulun tiloista. Virtuaalikierro...

  5. Physical characteristics of the binary PHA 2003 YT1

    Czech Academy of Sciences Publication Activity Database

    Larson, S. M.; Grauer, A. D.; Beshore, E.; Christensen, E.; Pravec, Petr; Kaasalainen, M.; Nolan, M. C.; Howell, E. S.; Hine, A. A.; Galád, Adrián; Gajdoš, Š.; Kornoš, L.; Világi, J.

    2004-01-01

    Roč. 36, č. 4 (2004), s. 1139 ISSN 0002-7537 R&D Projects: GA AV ČR IAA3003204 Institutional research plan: CEZ:AV0Z1003909 Keywords : binary * asteroids * photometry Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  6. Ferromagnetic resonance relaxation processes in Zn2Yt

    International Nuclear Information System (INIS)

    Mita, M.; Shimizu, H.

    1975-01-01

    Experimentally obtained linewidth in FMR of Zn 2 Y is analyzed numerically on the basis of two-magnon, three-magnon and four-magnon relaxation processes. In the analysis procedure of three-magnon linewidth, the effective exchange constants are determined to be D = 0.15 x 10 -9 Oe cm 2 and D = 9.3 x 10 -9 Oe cm 2 within and between the crystallographic planes. The two-magnon linewidth induced by surface imperfections is discussed in consideration of scattering due to multipole demagnetizations of the imperfections. The four-magnon linewidth is observed for the first time and analyzed successfully

  7. Lockout tagout, turvalukituskäytäntö valimossa

    OpenAIRE

    Rouhiainen, Henri

    2017-01-01

    Tämän opinnäytetyön tarkoituksena oli käydä Aurubis Finland Oy:n kuparivalimon määriteltyjen laitteiden energialähteet läpi sekä tarkistaa laitteiden ja koneiden turvalukitukset ja tehdä ohjeistukset turvalukitusten osalta. Työssä käytettiin lockout/tagout-standardin mukaista vahinkokäynnistyksen eston toimintamallia. Tämä sama työ tehtiin Aurubiksen kuparivalssaamossa eri insinööriopiskelijan toimesta, jolloin ohjeiden tyylistä ja ulkonäöstä päätettiin yhteistyössä. Tiedon hankkimiseksi ...

  8. Ospreys Use Bald Eagle Nests in Chesapeake Bay Area

    OpenAIRE

    Therres, Glenn D.; Chandler, Sheri K.

    1993-01-01

    Ospreys (Pandion haliaetus) and Bald Eagles (Haliaeetus leucocephalus) share similar breeding habitat in the Chesapeake Bay area and elsewhere. The nests of these species are similar in size and appearance. Ospreys typically build large stick nests in dead trees or on man-made structures (C.J. Henny et al. 1974, Chesapeake Sci. 15:125-133; A.F. Poole 1989, Ospreys: a natural and unnatural history, Cambridge Univ. Press, NY), while Bald Eagles usually build larger nests in live trees (P.B. Woo...

  9. Suspected lead toxicosis in a bald eagle

    Science.gov (United States)

    Jacobson, E.; Carpenter, J.W.; Novilla, M.

    1977-01-01

    An immature bald eagle (Haliaeetus leucocephalus) was submitted to the University of Maryland, College Park, for clinical examination. The bird was thin, had green watery feces, and was unable to maintain itself in upright posture. Following radiography, the bird went into respiratory distress and died. Numerous lead shot were recovered from the gizzard, and chemical analysis of liver and kidney tissue revealed 22.9 and 11.3 ppm lead, respectively. The clinical signs, necropsy findings, and chemical analysis of the eagle were compatible with lead toxicosis.

  10. Long-term survival despite low genetic diversity in the critically endangered Madagascar fish-eagle

    Science.gov (United States)

    Johnson, J.A.; Tingay, R.E.; Culver, M.; Hailer, F.; Clarke, M.L.; Mindell, D.P.

    2009-01-01

    The critically endangered Madagascar fish-eagle (Haliaeetus vociferoides) is considered to be one of the rarest birds of prey globally and at significant risk of extinction. In the most recent census, only 222 adult individuals were recorded with an estimated total breeding population of no more than 100-120 pairs. Here, levels of Madagascar fish-eagle population genetic diversity based on 47 microsatellite loci were compared with its sister species, the African fish-eagle (Haliaeetus vocifer), and 16 of these loci were also characterized in the white-tailed eagle (Haliaeetus albicilla) and the bald eagle (Haliaeetus leucocephalus). Overall, extremely low genetic diversity was observed in the Madagascar fish-eagle compared to other surveyed Haliaeetus species. Determining whether this low diversity is the result of a recent bottleneck or a more historic event has important implications for their conservation. Using a Bayesian coalescent-based method, we show that Madagascar fish-eagles have maintained a small effective population size for hundreds to thousands of years and that its low level of neutral genetic diversity is not the result of a recent bottleneck. Therefore, efforts made to prevent Madagascar fish-eagle extinction should place high priority on maintenance of habitat requirements and reducing direct and indirect human persecution. Given the current rate of deforestation in Madagascar, we further recommend that the population be expanded to occupy a larger geographical distribution. This will help the population persist when exposed to stochastic factors (e.g. climate and disease) that may threaten a species consisting of only 200 adult individuals while inhabiting a rapidly changing landscape. ?? 2008 The Authors.

  11. Uusiomateriaalien käytön ohjeistuksen ja hankekäytäntöjen kehitystarpeet ja mahdollisuudet tierakentamisessa

    OpenAIRE

    Torniainen, S. (Sanna)

    2018-01-01

    Tiivistelmä Suomessa käytetään huomattava määrä neitseellistä luonnonkiviainesta tierakentamisessa vuosittain. Uusiomateriaalien soveltuvuutta ja käyttöä tierakentamisessa on tutkittu jo kymmenien vuosien ajan ja etenkin viimeisten vuosien aikana niiden käyttö on hiljalleen kasvanut. Tutkimuksista ja erilaisista kehitysohjelmista huolimatta uusiomateriaalien käyttö ei kuitenkaan ole lisääntynyt ja laajentunut toivotulla tav...

  12. Työkierto : Mielipiteitä käytännöstä

    OpenAIRE

    Hietala, Teija; Lehtonen, Anna

    2012-01-01

    Tämän opinnäytetyön tarkoituksena oli selvittää hoitajien kokemuksia työkierrosta eräillä yliopistollisen sairaalan osastoilla. Tavoitteena oli antaa tietoa osastojen henkilökunnalle työkierron toimivuudesta. Tavoitteena oli, että kyselyn tuloksia voitaisiin käyttää apuna työkierron toimivuuden arvioinnissa ja mahdollisessa kehittämisessä. Opinnäytetyön tehtävinä oli selvittää mitä työkierto on, miten osaston työntekijät kokivat työkierron toimivuuden osastoilla ja miten osastojen työntekijät...

  13. Etätyökäytäntöjen kehittäminen

    OpenAIRE

    Haverinen, Liisa

    2017-01-01

    Opinnäytetyön tavoitteena oli luoda selvitys kohdeyritykselle siihen, kannattaako yrityksessä tehdä etätöitä laajemmin. Lähtötilanne oli, että etätöitä tehdään yrityksessä osittain. Etätöitä tekeviä työntekijöitä on kuitenkin vähän, ja etätöitä tehdään myös määrällisesti vähän. Työn alussa kerrotaan etätyöstä ilmiönä ja käsitteenä. Teoriaosuudessa selvitetään vastuita, hyötyjä ja haasteita liittyen etätöihin. Selvitetään myös etäjohtamisen ominaispiirteitä. Teoriaosuudessa käydään läpi e...

  14. Kuntoutusta oppimassa, käytännöstä teoriaan

    OpenAIRE

    Similä, Markku

    2010-01-01

    Opinnäytetyön tavoitteena oli kehittää Kainuun ammattiopisto - liikelaitoksen tarpeisiin ammatillisen kuntoutuksen täydennyskoulutus. Tarve koulutuksen järjestämiseen tuli keväällä 2009 Kainuun alueella toimivalta Kumppaniksi ry:ltä. Täydennyskoulutuksen tavoitteena oli lisätä Kumppaniksi ry:n henkilökunnan osaamista ammatillisen kuntoutuksen käsitteistä ja toimintatavoista. Opiskelijaryhmä oli Kumppaniksi ry:n työntekijöitä. Opiskelijaryhmä koostui monen eri ammatin osaajista. Yhteistä ...

  15. Lantionpohjan toimintahäiriöt : Fysioterapeuttiset hoitokäytännöt

    OpenAIRE

    Halinen, Erika; Pulkkinen, Sari

    2011-01-01

    Lantionpohjan toimintahäiriöt ovat merkittävä naisten elämänlaatua heikentävä vaiva. Lantionpohjan toimintahäiriöitä ovat virtsaamiseen, ulostamiseen ja seksuaalitoimintoihin liittyvät häiriöt sekä laskeumat ja lantionpohjan alueen kiputilat. Suurimmat riskitekijät toimintahäiriöiden synnylle ovat raskauksien, synnytysten ja ikääntymisen mukanaan tuomat lantionpohjan lihas-, sidekudos- ja hermovauriot tai -muutokset. Lantionpohjan eri rakenteet ja toiminnat ovat läheisessä yhteydessä toisiins...

  16. Imatralaisten nuorten terveyskysely mielialasta ja päihteiden käytöstä

    OpenAIRE

    Markkanen, Jonna; Pinomaa, Suvi; Pajunen, Piia

    2010-01-01

    Tämä opinnäytetyö liittyy Sydän- ja verisuonitautien ennaltaehkäisyprojektiin (SYVE), joka toteutettiin Imatralla vuosina 2005–2008. Yksityisellä lahjoituksella toteutetun projektin avulla haluttiin vaikuttaa nuorten elämäntapoihin ja terveyskäyttäytymiseen sekä lisätä nuorten tietoa sydän- ja verisuonitautien riskitekijöistä. Yhteistyössä toimi Imatran Sydänyhdistys ry, Imatran koulutoimi, Etelä-Karjalan ammattikorkeakoulun ja ammattiopiston sosiaali- ja terveysala sekä Oppimiskeskus Motiivi...

  17. ZASTOSOWANIE FUNKCJONAŁU HU-WASHIZU W PLASTYCZNEJ ANALIZIE MES PŁYT GRUBYCH

    Directory of Open Access Journals (Sweden)

    Jakub LEWANDOWSKI

    2016-07-01

    Full Text Available W pracy sformułowano oryginalny, autorski funkcjonał dla zagadnień teorii plastyczności. Podstawą był funkcjonał Hu-Washizu z teorii sprężystości. Przyrostowa postać funkcjonału pozwala w prosty sposób budować algorytmy MES. Zastosowanie funkcjonału przedstawiono na przykładzie płyty grubej. Zastosowano model warstwowy aby uwzględnić częściowe uplastycznienie przekroju płyty. Algorytm MES dla płyty grubej zbudowano w oparciu o trójkątny trzy węzłowy element skończony z liniowymi funkcjami kształtu dla wszystkich przemieszczeń uogólnionych. Naprężenia i odkształcenia w tego typu elemencie przyjmuje się jako stałe. Przedstawiony algorytm nie wymaga żadnych dodatkowych równań teorii plastyczności i jest równoważny stowarzyszonemu prawu płynięcia plastycznego. Algorytm prowadzi do nieliniowego, przyrostowego układu równań algebraicznych, który rozwiązuje się metodą Newtona. Kilka prostych przykładów pozytywnie weryfikuje przyjęte założenia i stosowane algorytmy.

  18. Affiliate-markkinoinnin käytäntöjä ja haasteita

    OpenAIRE

    Rakkolainen, Oleg

    2016-01-01

    Jatkuvasti yhä enemmän digitalisoituvassa maailmassa yritykset etsivät parasta vastinetta markkinointibudjetilleen digitaalisista medioista. Affiliate-markkinointi tarjoaakin mainostajille vastinetta rahoilleen tulospohjaisella muodollaan; mitä enemmän tulosta kumppani, julkaisija, tuottaa, sitä suuremman palkkion hän saa. Affiliate-markkinoinnissa välikätenä toimivat usein affiliate-verkosto, jotka saattavat julkaisijat ja mainostajat tarjoamalla omia alustojaan kummankin osapuolen käyttöön....

  19. Sydänmerkki-aterian käytön laajentaminen Vaasan ruokapalveluissa

    OpenAIRE

    Ylä-Häkkinen, Terhi

    2013-01-01

    Jokainen ihminen nauttii eläkeikään mennessä noin 15500 ateriaa työaikana (Suomen Sydänliitto ry), joten ei ole samantekevää, millaisia ne ovat. Joukkoruokailu voi osaltaan ehkäistä kansansairauksia valmistamalla sydänystävällisiä aterioita. Sydänmerkki-ateria sisältää oikean määrän suolaa, hyviä pehmeitä rasvoja, vähän kovia rasvoja sekä paljon kuitua. Se sisältää lisäkkeinä vähäsuolaista ja runsaskuituista leipää, kasvimargariinia, rasvatonta maitoa tai piimää, salaattia ja salaatinkastiket...

  20. Onnellisuusvastuu : Tasapainon löytäminen itsen ja muiden auttamiseen olemaan onnellinen

    OpenAIRE

    Hartikainen, Mika

    2016-01-01

    Onnellisuusvastuu on oman itsen ja muiden auttamista olemaan onnellinen. Ihmisten olisi tärkeää auttaa ensiksi itseään ennen kuin auttaa liian monia muita. Oman itsen ja muiden auttaminen olisi tärkeää olla tasapainossa. Onnellisuusvastuu auttaa avaamaan ihmisten silmät näkemään auttamisen laajemmassa mittakaavassa tietoisesti. On olemassa monenlaisia tapoja ja tasoja auttaa. Onnellisuusvastuu elämäntavassa keskeistä on sisäisen ja ulkoisen ympyrän onnellisuusvastuun 20 portaan kehittäminen o...

  1. Ruotsinkielisten alkeistason suomenoppijoiden paikallissijojen käytöstä

    Directory of Open Access Journals (Sweden)

    Tuija Määttä

    2011-10-01

    Full Text Available This article presents the results of research on how Swedish-speaking students learning Finnish as a foreign language at the beginners’ level use the Finnish local cases in their writing. The research is based on the Swedish subcorpus of a larger electronic corpus entitled the International Corpus of Learner Finnish. At the time the survey work was conducted, the subcorpus contained 43 496 words. To find all occurrences of the six local cases, the corpus was analysed using a concord-programme as a tool. By inputting the case suffixes, e.g. the inessive suffixes ssa/sa and ssä/sä, as keywords, the programme found both the correct local case forms and the wrong ones.

  2. On the uniqueness of color patterns in raptor feathers

    Science.gov (United States)

    Ellis, D.H.

    2009-01-01

    For this study, I compared sequentially molted feathers for a few captive raptors from year to year and symmetrically matched feathers (left/right pairs) for many raptors to see if color patterns of sequential feather pairs were identical or if symmetrical pairs were mirror-image identical. Feather pairs were found to be identical only when without color pattern (e.g., the all-white rectrices of Bald Eagles [Haliaeetus leucocephalus]). Complex patterns were not closely matched, but some simple patterns were sometimes closely matched, although not identical. Previous claims that complex color patterns in feather pairs are fingerprint-identical (and therefore that molted feathers from wild raptors can be used to identify breeding adults from year to year with certainty) were found to be untrue: each feather is unique. Although it is unwise to be certain of bird of origin using normal feathers, abnormal feathers can often be so used. ?? 2009 The Raptor Research Foundation, Inc.

  3. Hemograms for and nutritional condition of migrant bald eagles tested for exposure to lead.

    Science.gov (United States)

    Miller, M J; Wayland, M E; Bortolotti, G R

    2001-07-01

    Plasma proteins, hematocrit, differential blood counts were examined and nutritional condition was estimated for bald eagles (Haliaeetus leucocephalus) trapped (n = 66) during antumn migration, 1994-95 at Galloway Bay (Saskatchewan, Canada), for the purposes of estimating prevalence of exposure to lead. Sex and age differences in hematocrit and plasma proteins were not observed; however, female eagles exhibited larger median absolute heterophil counts than males. Hematologic values were similar to those previously reported from eagles in captivity. Departures from expected hematological values from a healthy population of eagles were not observed in birds with elevated levels of blood lead (> or =0.200 microg/ml). Similarly, nutritional condition was not related to blood-lead concentrations. Therefore, it appears that lead exposure in this population was below a threshold required to indicate toxicological alteration in the hematological values and index of nutritional condition that we measured.

  4. Agonistic asymmetries and the foraging ecology of Bald Eagles

    Science.gov (United States)

    Knight, Richard L.; Skagen, Susan Knight

    1988-01-01

    We investigated the effects of both asymmetries and differing food levels on contest outcomes of wintering Bald Eagles (Haliaeetus leucocephalus) feeding on chum salmon (Oncorhynchus keta) carcasses. Large eagles, regardless of age, were more successful in pirating than smaller eagles. Small pirating eagles were usually unsuccessful unless they were adults attempting to supplant other small eagles. Feeding eagles were more successful in defeating pirating eagles according to (1) whether their heads were up to prior to a pirating attempt, (2) how long their heads had been up, and (3) whether they displayed. During periods of food scarcity pirating eagles were less successful, a fact attributed in a proximate sense to the increase incidence of retaliation by feeding birds. When food was scarce and eagles had a choice between scavenging the pirating, they chose to scavenge more often. Body size appears to be an important factor in determining social dominance and influencing differences in foraging modes of wintering Bald Eagles.

  5. Kleptoparasitism by bald eagles wintering in south-central Nebraska

    Science.gov (United States)

    Jorde, Dennis G.; Lingle, G.R.

    1988-01-01

    Kleptoparasitism on other raptors was one means by which Bald Eagles (Haliaeetus leucocephalus) secured food along the North Platte and Platte rivers during the winters of 1978-1980. Species kelptoparasitized were Ferruginous Hawk (Buteo regalis), Red-tailed Hawk (B. jamaicensis), Rough-legged Hawk (B. lagopus), Golden Eagle (Aquila chrysaetos), and Bald Eagle. Stealing of prey occurred more often during the severe winter of 1978-1979 when ice cover restricted eagles from feeding on fish than during the milder winter of 1979-1980. Kleptoparasitism occurred principally in agricultural habitats where large numbers of Mallards (Anas platyrhynchos) were foraging. Subadults watched adults steal food and participated in food-stealing with adults, which indicated interspecific kleptoparasitism may be a learned behavior. We suggest factors that may favor interspecific kleptoparasitism as a foraging strategy of Bald Eagles in obtaining waterfowl during severe winters.

  6. [Digenea of Haliaeetus albicilla (Linnaeus, 1758) and Pandion haliaetus (Linnaeus, 1758) from middle and north-western Poland].

    Science.gov (United States)

    Kalisińska, Elzbieta; Rzad, Izabella; Sitko, Jilji; Kavetska, Katarzyna M; Królaczyk, Katarzyna; Budis, Halina

    2008-01-01

    In 2003-2008 eight white-tailed eagles and two ospreys from middle and north-western Poland were examined for the presence of parasites. Nine birds were infected with 5 digenean species: Conodiplostomum perlatum, Paracoenogonimus ovatus, Strigeafalconis, Metorchis crassiusculus and Nematostrigea serpens. M. crassiusculus was found for the first time in an eagle from Poland.

  7. Kolme : opinnäytetyö jalokivien kierrätyksestä ja uusiokäytöstä

    OpenAIRE

    Corneh, Susana

    2016-01-01

    Tämän opinnäytetyön teema on jalokivien kierrätys. Työllä haluttiin osoittaa, että eettinen vastuunkanto muotoilijana on tärkeää ja että jalokivet voivat olla täysin käyttökelpoisia viallisuuksistaan huolimatta. Aihetta lähestyttiin tarkastelemalla jalokiviä ja jalokiviteollisuutta muutamasta näkökulmasta,sekä tunnistamalla niihin liittyviä kriittisiä ongelmakohtia. Tutkimuksessa hyödynnettiin saatavilla olevaa tietoa. Opinnäytetyössä kiteytyy myös yksilön ratkaisu vastuullisempaan jalokiv...

  8. Testing the role of contaminants in depressing avian numbers Evaluando el rol de los contaminantes sobre la disminución del número de aves

    Directory of Open Access Journals (Sweden)

    WILLIAM H. KARASOV

    2000-09-01

    Full Text Available Environmental contaminants are ubiquitous and so are often key suspects in cases of lagging wildlife populations. How do we test hypotheses about cause-effect linkages between contaminants and wildlife health? We present three case studies in which different approaches were used to test hypotheses about effects of contaminants on wildlife. The cases involve the possible impacts of (1 polychlorinated biphenyl on Lake Superior bald eagles (Haliaeetus leucocephalus; (2 dioxin on osprey (Pandion halieatus; and (3 methyl mercury on common loons (Gavia immer. The different approaches were dictated by legal, logistic, and financial limitations, but the relative strengths of experimental and mechanistic approaches over correlative approaches is underscored. For all three species, the simple correlation between a single contaminant and performance was confounded by covariation with other types of contaminants and/or natural ecological factors such as food availability and predationLos contaminantes ambientales son ubicuos y a menudo los principales sospechosos en los casos de disminución en las poblaciones de fauna silvestre. ¿Cómo probamos las hipótesis sobre las relaciones causa - efecto entre los contaminantes y la salud de la fauna silvestre? Presentamos tres estudios de caso en que se usaron diferentes aproximaciones para someter a prueba las hipótesis sobre los efectos de los contaminantes sobre la fauna silvestre. Los casos involucran los posibles impactos de (1 el bifenilos policlorados en el águila calva (Haliaeetus leucocephalus en el Lago Superior; (2 las dioxinas sobre el águila pescadora (Pandion halieatus; y (3 el mercurio de metilo en colimbo grande (Gavia immer. Las limitaciones legales, logísticas y financieras, determinaron diferentes aproximaciones en estos estudios, pero se destaca que la fuerza relativa de las aproximaciones experimentales y mecanicistas es superior a la de un acercamiento correlacional. Se demuestra que, en

  9. A spatially-dynamic preliminary risk assessment of the bald eagle at the Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Gonzales, G.J.; Gallegos, A.F.; Foxx, T.S.; Fresquez, P.R.; Mullen, M.A.; Pratt, L.E.; Gomez, P.E.

    1998-04-01

    The Endangered Species Act of 1973 and the Record of Decision on the Dual Axis Radiographic Hydrodynamic Test Facility at the Los Alamos National Laboratory (LANL) require that the Department of Energy protect the bald eagle (Haliaeetus leucocephalus), a state and federally listed species, from stressors such as contaminants. A preliminary risk assessment of the bald eagle was performed using a custom FORTRAN code, ECORSK5, and the geographical information system. Estimated exposure doses to the eagle for radionuclide, inorganic metal, and organic contaminants were derived for varying ratios of aquatic vs. terrestrial simulated diet and compared against toxicity reference values to generate hazard indices (His). HI results indicate that no appreciable impact to the bald eagle is expected from contaminants at LANL from soil ingestion and food consumption pathways. This includes a measure of cumulative effects from multiple contaminants that assumes linear additive toxicity. Improving model realism by weighting simulated eagle foraging based on distance from potential roost sites increased the HI by 76%, but still to inconsequential levels. Information on risk by specific geographical location was generated, which can be used to manage contaminated areas, eagle habitat, facility siting, and/or facility operations in order to maintain risk from contaminants at low levels.

  10. Lead and mercury in fall migrant golden eagles from western North America.

    Science.gov (United States)

    Langner, Heiko W; Domenech, Robert; Slabe, Vincent A; Sullivan, Sean P

    2015-07-01

    Lead exposure from ingestion of bullet fragments is a serious environmental hazard to eagles. We determined blood lead levels (BLL) in 178 golden eagles (Aquila chrysaetos) captured during fall migration along a major North American flyway. These eagles spent the breeding season distributed over a large range and are the best currently available representation of free flying golden eagles on the continent. We found 58 % of these eagles containing increased BLL > 0.1 mg/L; 10 % were clinically lead poisoned with BLL > 0.6 mg/L; and 4 % were lethally exposed with BLL > 1.2 mg/L. No statistical difference in BLL existed between golden and bald eagles (Haliaeetus leucocephalus). Golden eagles captured on carrion had higher BLL than those captured using live bait suggesting differences in feeding habits among individuals. Median BLL increased with age class. We propose a conceptual model for the long-term increase in BLL after ingestion of lead particles. The mean blood mercury level in golden eagles was 0.023 mg/L. We evaluate a field test for BLL that is based on anodic stripping voltammetry. This cost-effective and immediate method correlated well with results from inductively coupled plasma-mass spectrometry, although results needed to be corrected for each calibration of the test kit.

  11. Reproduction and distribution of bald eagles in Voyageurs National Park, Minnesota, 1973-1993

    Science.gov (United States)

    Grim, Leland H.; Kallemeyn, Larry W.

    1995-01-01

    The bald eagle (Haliaeetus leucocephalus) is classified as a threatened species in Minnesota. In 1973, the National Park Service began monitoring the distribution and reproduction of bald eagles in and immediately adjacent to Voyageurs National Park to obtain data that park management could use to protect bald eagles from the effects of use of the park by visitors and from the expansion of park facilities. Thirty-seven breeding areas were identified during 1973-93. Annual productivity ranged from 0.00 to 1.42 fledglings/occupied nest and averaged 0.68 during the 21 breeding seasons. The annual number of breeding pairs tripled, the mean number of fledged eaglets increased 5 times, and reproductive success doubled during the study. However, in more than 15 of the breeding seasons, the mean productivity and the annual reproductive success in Voyageurs National Park were below the 1 fledgling/occupied nest and the 70% reproductive success that are representative of healthy bald eagle populations. We suspect that toxic substances, human disturbance, severe weather, and lack of food in early spring may have kept bald eagles in Voyageurs National Park from achieving a breeding success that was similar to that of conspecifics in the nearby Chippewa National Forest. The cumulative effect of these variables on reproduction and on habitat of bald eagles in Voyageurs National Park is unknown and should be determined.

  12. Predation rates, timing, and predator composition for Scoters (Melanitta spp.) in marine habitats

    Science.gov (United States)

    Anderson, Eric J.; Esler, Daniel N.; Sean, Boyd W.; Evenson, Joseph; Nysewander, David R.; Ward, David H.; Dickson, Rian D.; Uher-Koch, Brian D.; Vanstratt, C.S.; Hupp, Jerry

    2012-01-01

    Studies of declining populations of sea ducks have focused mainly on bottom-up processes with little emphasis on the role of predation. We identified 11 potential predators of White-winged Scoters (Melanitta fusca (L., 1758)) and Surf Scoters (Melanitta perspicillata (L., 1758)) in North American marine habitats. However, of 596 Scoters marked with VHF transmitters along the Pacific coast, mortalities were recovered in association with just two identifiable categories of predators: in southeast Alaska recoveries occurred mainly near mustelid feeding areas, while those in southern British Columbia and Washington occurred mainly near feeding areas of Bald Eagles (Haliaeetus leucocephalus (L., 1766)). Determining whether marked Scoters had been depredated versus scavenged was often not possible, but mortalities occurred more frequently during winter than during wing molt (13.1% versus 0.7% of both species combined, excluding Scoters that died within a postrelease adjustment period). In two sites heavily used by Scoters, diurnal observations revealed no predation attempts and low rates of predator disturbances that altered Scoter behavior (≤ 0.22/h). These and other results suggest that predation by Bald Eagles occurs mainly at sites and times where densities of Scoters are low, while most predation by mustelids probably occurs when Scoters are energetically compromised.

  13. Effect of lipid extraction on analyses of stable carbon and stable nitrogen isotopes in coastal organisms of the Aleutian archipelago

    Science.gov (United States)

    Ricca, M.A.; Miles, A.K.; Anthony, R.G.; Deng, X.; Hung, S.S.O.

    2007-01-01

    We tested whether extracting lipids reduced confounding variation in ??13C and ??15N values by analyzing paired lipid-extracted (LE) and non-lipid-extracted (NLE) samples of bald eagle (Haliaeetus leucocephalus (L., 1766)) whole eggs, muscle tissue from nine seabird and one terrestrial bird species, muscle tissue from four marine fish species, and blue mussels (Mytilus edulis L., 1758) collected from the Aleutian archipelago, Alaska. Lipid extraction significantly increased ??13C by an average of 2.0??? in whole eggs, 0.8??? in avian muscle, 0.2??? in fish muscle, and 0.6??? in blue mussels. Lower ??13C values in NLE samples covaried positively with lipid content across all sample types. Lower ??13C values in NLE samples were not correlated with lipid content within bald eagle eggs and blue mussels, but covaried positively with percent lipid in avian and fish muscles. Neither lipid extraction nor percent lipid significantly changed ??15N values for any sample type. Lower ??13C values in most NLE avian and fish muscle tissues should not confound interpretation of pelagic versus nearshore sources of primary production, but lipid extraction may be necessary when highly precise estimates of ??13C are needed. Lipid extraction may not be necessary when only ??15N is of interest. ?? 2007 NRC.

  14. Density and productivity of bald eagles in Prince William Sound, Alaska, after the Exxon Valdez oil spill

    International Nuclear Information System (INIS)

    White, C.M.; Ritchie, R.J.; Cooper, B.A.

    1995-01-01

    Helicopter surveys were conducted in Prince William Sound (PWS) to assess the effects of the 1989 Exxon Valdez oil spill on the reproductive success and densities of bald eagles (Haliaeetus leucocephalus) one and two years after the spill (1990 and 1991). Densities of bald eagles were compared between an oiled area in southwestern PWS and an unoiled area in northern PWS. In all surveys (four in 1990, one in 1991) densities of eagles in the oiled areas generally were similar to or higher than those in the unoiled area. Reproductive success was compared between nesting territories that were oiled within 1 km of nests and nesting territories that were unoiled. In 1990, all measures of nest productivity, nest occupancy, and nesting success were similar between oiled and unoiled territories. In 1991, however, the number of young per successful nest was lower in oiled territories. The number of successful nests was slightly lower in 1991 than in 1990 in oiled territories but was significantly lower in 1991 in unoiled territories. Comparisons of nest occupancy and nesting success could not be made in 1991 because early surveys were not conducted. Differences between areas, territories, and years could not be attributed to oil, but rather appeared to be related to natural annual variability. Overall, no demonstrable effects of the oil spill on eagle density or reproduction could be detected in PWS one and two years after the spill. 70 refs., 1 fig., 3 tabs

  15. Decreasing prevalence and seasonal variation of gunshot trauma in raptors admitted to the wildlife center of Virginia: 1993-2002.

    Science.gov (United States)

    Richards, Jean; Lickey, Adrienne; Sleeman, Jonathan M

    2005-09-01

    A retrospective study was conducted to identify the epidemiologic factors associated with gunshot injuries in raptors presented to the Wildlife Center of Virginia from 1993 to 2002. Of the 3,156 raptors admitted, 118 raptors (3.7%), representing 15 species, were admitted with gunshot trauma as the primary cause of morbidity and mortality. The majority of cases consisted of four species: red-tailed hawk (Buteo jamaicensis; 47%), red-shouldered hawk (Buteo lineatus; 14%), turkey vulture (Cathartes aura; 10%), and bald eagle (Haliaeetus leucocephalus; 8%). For species with greater than 40 admissions during the study period, the proportion of gunshot trauma of all causes of morbidity and mortality ranged from raptors with gunshot trauma were admitted during the fall and winter months (75%) compared with the spring and summer (25%). A significant decrease in the absolute number of gunshot cases per year was observed over the time period studied. The population-level effect of gunshot trauma is unknown for these species; however, it appears to be minor compared with other causes of morbidity and mortality.

  16. Natality and calf mortality of the Northern Alaska Peninsula and Southern Alaska Peninsula caribou herds

    Directory of Open Access Journals (Sweden)

    Richard A. Sellers

    2003-04-01

    Full Text Available We studied natality in the Northern Alaska Peninsula (NAP and Southern Alaska Peninsula (SAP caribou (Rangifer tarandus granti herds during 1996-1999, and mortality and weights of calves during 1998 and 1999- Natality was lower in the NAP than the SAP primarily because most 3-year-old females did not produce calves in the NAP Patterns of calf mortality in the NAP and SAP differed from those in Interior Alaska primarily because neonatal (i.e., during the first 2 weeks of life mortality was relatively low, but mortality continued to be significant through August in both herds, and aggregate annual mortality was extreme (86% in the NAP Predators probably killed more neonatal calves in the SAP, primarily because a wolf den (Canis lupus was located on the calving area. Despite the relatively high density of brown bears (Ursus arctos and bald eagles (Haliaeetus leucocephalus, these predators killed surprisingly few calves. Golden eagles (Aquila chrysaetos were uncommon on the Alaska Peninsula. At least 2 calves apparently died from pneu¬monia in the range of the NAP but none were suspected to have died from disease in the range of the SAP. Heavy scav¬enging by bald eagles complicated determining cause of death of calves in both the NAP and SAP.

  17. Overview of a comprehensive environmental monitoring and surveillance program: The role of fish and wildlife

    International Nuclear Information System (INIS)

    Gray, R.H.

    1988-05-01

    Concern about the effects of potential releases from nuclear and non-nuclear activities on the US Department of Energy's Hanford Site in southeastern Washington has evolved over four decades into a comprehensive environmental monitoring and surveillance program. The program includes field sampling, and chemical and physical analyses of air, surface and ground water, fish and wildlife, soil, foodstuffs, and natural vegetation. In addition to monitoring radioactivity in fish and wildlife, population numbers of key species are determined, usually during the breeding season. Data from monitoring efforts are used to assess the environmental impacts of Hanford operations and calculate the overall radiological dose to humans onsite, at the Site perimeter, or residing in nearby communities. Chinook salmon spawning in the Columbia River at Hanford has increased in recent years with a concomitant increase in winter nesting activity of bald eagles (Haliaeetus leucocephalus). An elk (Cervus elaphus) herd, established by immigration in 1972, is also increasing. Nesting Canada goose (Branta canadensis) and great blue heron (Ardea herodias), and various other animals, e.g., mule deer (Odocoileus hemionus) and coyotes (Canis latrans) are common. Measured exposure to penetrating radiation and calculated radiation doses to the public are well below applicable regulatory limits

  18. Prevalence of encysted apicomplexans in muscles of raptors.

    Science.gov (United States)

    Lindsay, D S; Blagburn, B L

    1999-01-28

    An acid-pepsin digestion technique was used to examine portions of breast muscle and heart from raptors for encysted protozoans. Apicomplexan zoites were present in 52 (45.6%) of the 114 samples examined: 11 of 12 (91.7%) red-shouldered hawks (Buteo lineatus), 20 of 34 (58.8%) red-tailed hawks (Buteo jamaicensis), two of seven (28.6%) Cooper's hawks (Accipiter cooperi), three of four (75%) sharp-shinned hawks (Accipiter striatus), one (100%) Mississippi kites (Ictinia misisippiensis), one of two (50%) American kestrels (Falco sparverius), one bald eagle (Haliaeetus leucocephalus), one of two (50%) golden eagles (Aquila chrysaetos), one of three (33%) turkey vultures (Cathartes aura), two of three (66.7%) black vultures (Coragyps atratus), three of six (50%) great-horned owls (Bubo virginianus), five of 15 (33.3%) barred owls (Strix varia), and one of 12 (8.3%) screech owls (Asio otus). Encysted protozoans were not observed in digests of tissues from three broad-winged hawks (Buteo platypterus), four ospreys (Pandion haliaetus), and five barn owls (Tyto alba). Apicomplexan cysts resembling Sarcocystis species were observed in tissue sections of muscles from 28 (37.8%) of 74 raptors.

  19. Ecotoxicology of organochlorine chemicals in birds of the Great Lakes

    Science.gov (United States)

    Tillitt, Donald E.; Giesy, John P.

    2013-01-01

    Silent Spring was fulfilled in the United States with passage of environmental legislation such as the Clean Water Act, the Federal Insecticide, Fungicide, and Rodenticide Act, and the Toxic Substance Control Act in the 1970s. Carson's writings, television interviews, and testimony before Congress alerted a nation and the world to the unintended effects of persistent, bioaccumulative chemicals on populations of fish, wildlife, and possibly humans. Her writings in the popular press brought attention to scientific findings that declines in populations of a variety of birds were directly linked to the widespread use of dichlorodiphenyltrichloroethane (DDT) in agriculture, public health, and horticulture. By the 1970s, DDT and other persistent organic pollutants (POPs) were being banned or phased out, and the intent of these regulatory acts became apparent in a number of locations across the United States, including the Great Lakes. Concentrations of DDT and its major product of transformation, dichlorodiphenylchloroethane (DDE), were decreasing in top predators, such as bald eagles (Haliaeetus leucocephalus), osprey (Pandion haliaetus), colonial waterbirds, and other fish-eating wildlife. Eggshell thinning and the associated mortality of bird embryos caused by DDE had decreased in the Great Lakes and elsewhere by the early 1980s.

  20. Prevalence of encysted Toxoplasma gondii in raptors from Alabama.

    Science.gov (United States)

    Lindsay, D S; Smith, P C; Hoerr, F J; Blagburn, B L

    1993-12-01

    Little is known about the prevalence of encysted Toxoplasma gondii in wild birds. We examined the hearts and breast muscles from 101 raptors for encysted T. gondii. All of the raptors had been submitted for necropsy to the State Veterinary Diagnostic Laboratory, Auburn, Alabama. Tissues were digested in acid-pepsin solution and inoculated into groups of 3-5 laboratory mice. Toxoplasma gondii was isolated from 27 of 101 (26.7%) raptors: 8 of 12 (66.7%) red-shouldered hawks (Buteo lineatus), 13 of 27 (41.1%) red-tailed hawks (Buteo jamaicensis), 1 of 4 (25%) Cooper's hawks (Accipiter cooperi), 1 of 5 (20%) great horned owls (Bubo virginianus), 4 of 15 (26.7%) barred owls (Strix varia), and 1 of 3 (33.3%) kestrels (Falco sparverius). Toxoplasma gondii was not isolated from 3 broad-winged hawks (Buteo platypterus), 3 sharp-shinned hawks (Accipiter striatus), 6 barn owls (Tyto alba), 9 screech owls (Asio otus), a Mississippi kite (Ictinia misisippiensis), 2 golden eagles (Aquila chrysaetos), a bald eagle (Haliaeetus leucocephalus), 4 ospreys (Pandion haliaetus), 4 turkey vultures (Cathartes aura), or 2 black vultures (Coragyps atratus). No significant difference (P > 0.05) in prevalence was detected based on sex using chi-square analysis. Chi-square analysis of the data demonstrated that adult raptors had encysted stages of T. gondii significantly (P < 0.05) more often than did immature raptors.

  1. Recent trends in counts of migrant hawks from northeastern North America

    Science.gov (United States)

    Titus, K.; Fuller, M.R.

    1990-01-01

    Using simple regression, pooled-sites route-regression, and nonparametric rank-trend analyses, we evaluated trends in counts of hawks migrating past 6 eastern hawk lookouts from 1972 to 1987. The indexing variable was the total count for a season. Bald eagle (Haliaeetus leucocephalus), peregrine falcon (Falco peregrinus), merlin (F. columbarius), osprey (Pandion haliaetus), and Cooper's hawk (Accipiter cooperii) counts increased using route-regression and nonparametric methods (P 0.10). We found no consistent trends (P > 0.10) in counts of sharp-shinned hawks (A. striatus), northern goshawks (A. gentilis) red-shouldered hawks (Buteo lineatus), red-tailed hawks (B. jamaicensis), rough-legged hawsk (B. lagopus), and American kestrels (F. sparverius). Broad-winged hawk (B. platypterus) counts declined (P < 0.05) based on the route-regression method. Empirical comparisons of our results with those for well-studied species such as the peregrine falcon, bald eagle, and osprey indicated agreement with nesting surveys. We suggest that counts of migrant hawks are a useful and economical method for detecting long-term trends in species across regions, particularly for species that otherwise cannot be easily surveyed.

  2. Situation report: Heavy DDT contamination at Wheeler National Wildlife Refuge

    Science.gov (United States)

    Fleming, W.J.; Atkeson, T.Z.

    1980-01-01

    A DDT manufacturing plant that operated on the Redstone Arsenal near Huntsville, Alabama discharged DDT-Iaden effluent from 1947 to 1970 into a creek on Wheeler National Wildlife Refuge. Seven to 9 years after the plant closed, high DDT, DDE, and DDD levels were reported in soils, river sediments, and fish in the area. Eleven of 27 mallards (Anas platyrhynchos) collected on the Refuge during February 1979 had carcass DDE residues that exceeded levels associated with eggshell thinning. DDE residues in a smaller number of mallards exceeded levels associated with egg breakage, poor hatchability, and abnormal hehavior and poor survival of offspring. Several avian species have disappeared from the Refuge since 1950, probably due to both industrial discharges of DDT from the plant and insecticidal use of DDT in the area. The contamination still presents a threat to herons, waterfowl, and raptors including occasional wintering or migrant eagles (Haliaeetus leucocephalus), and probably many other avian species. A maternity colony of endangered gray bats (Myotis grisescens) is also threatened by this contamination.

  3. Long-term ecosystem monitoring and assessment of the Detroit River and Western Lake Erie.

    Science.gov (United States)

    Hartig, J H; Zarull, M A; Ciborowski, J J H; Gannon, J E; Wilke, E; Norwood, G; Vincent, A N

    2009-11-01

    Over 35 years of US and Canadian pollution prevention and control efforts have led to substantial improvements in environmental quality of the Detroit River and western Lake Erie. However, the available information also shows that much remains to be done. Improvements in environmental quality have resulted in significant ecological recovery, including increasing populations of bald eagles (Haliaeetus leucocephalus), peregrine falcons (Falco columbarius), lake sturgeon (Acipenser fulvescens), lake whitefish (Coregonus clupeaformis), walleye (Sander vitreus), and burrowing mayflies (Hexagenia spp.). Although this recovery is remarkable, many challenges remain, including population growth, transportation expansion, and land use changes; nonpoint source pollution; toxic substances contamination; habitat loss and degradation; introduction of exotic species; and greenhouse gases and global warming. Research/monitoring must be sustained for effective management. Priority research and monitoring needs include: demonstrating and quantifying cause-effect relationships; establishing quantitative endpoints and desired future states; determining cumulative impacts and how indicators relate; improving modeling and prediction; prioritizing geographic areas for protection and restoration; and fostering long-term monitoring for adaptive management. Key management agencies, universities, and environmental and conservation organizations should pool resources and undertake comprehensive and integrative assessments of the health of the Detroit River and western Lake Erie at least every 5 years to practice adaptive management for long-term sustainability.

  4. Hanford, Washington: Monitoring to assess the state of the environment

    International Nuclear Information System (INIS)

    Gray, R.H.

    1992-01-01

    Environmental monitoring has been ongoing at the US Department of Energy's Hanford Site for almost 5 years. Concentrations of airborne radionuclides at the Site perimeter, and concentrations of radionuclides and nonradiological water quality in the Columbia River are in compliance with applicable standards. Radionuclide levels in food stuffs irrigated with river water taken downstream of the Site, most onsite wildlife samples, and soils and vegetation from both on- and off-site locations are typical of those attributable to worldwide fallout. The calculated dose potentially received by a maximally exposed individual, using worst-case assumptions for all routes of exposure, was 0.05 mrem/yr in 1989. The average per capita whole-body effective dose to people, based on a population of 340,000 living within 80 km (50 mi) of the Site, was <0.01 to 0.03 mrem annually from 1985 through 1989. Chinook salmon (Oncorhynchus tshawytscha) spawning in Hanford Reach of the Columbia River has increased in recent years with a con-comitant increase in winter roosting activity of bald eagles (Haliaeetus leucocephalus). An elk (Cervus elaphus) herd, established by immigration in 1972, is also increasing. Nesting Canada goose (Branta canadensis), great blue heron (Ardea herodias), various plants and other animals, e.g., mule deer (Odocoileus hemionus), and coyotes (Canis latrans) are common

  5. Bald eagles of the Hanford National Environmental Research Park

    Energy Technology Data Exchange (ETDEWEB)

    Fitzner, R.E.; Watson, D.G.; Rickard, W.H.

    1980-06-01

    Since 1961, near-yearly aerial surveys of bald eagles along the Hanford reach of the Columbia River have been conducted. Prey resources available to the eagles have also been monitored and we have thus been able to examine predator-prey relationships in a statistical fashion. We report on a unique set of data which provides insight into one of the factors (prey availability) controlling bald eagle wintering populations. The winter distribution of the bald eagle (Haliaeetus leucocephalus) has been reported to closely follow the availability of prey (Servheen 1975, Southern 1963, Shea 1973, Spencer 1976). Fitzner and Hanson (1979) compared twelve years of eagle winter survey data on the Hanford DOE Site with waterfowl numbers and salmon redd densities over the same period and provided some statistical evidence that eagle wintering numbers varied somewhat dependently with changing salmon redd numbers but not with changing waterfowl numbers. This report re-examines Fitzner and Hanson's (1979) twelve year data set and supplies two additional years of data for the Hanford DOE Site in order to gain additional insight into predator-prey interactions.

  6. Bald Eagle nestling mortality associated with Argas radiatus and Argas ricei tick infestation and successful management with nest removal in Arizona, USA

    Science.gov (United States)

    Justice-Allen, Anne; Orr, Kathy; Schuler, Krysten L.; McCarty, Kyle; Jacobson, Kenneth; Meteyer, Carol U.

    2016-01-01

    Eight Bald Eagle (Haliaeetus leucocephalus) nestlings heavily infested with larval ticks were found in or under a nest near the confluence of the Verde and Salt rivers in Arizona in 2009-11. The 8-12-wk-old nestlings were slow to respond to stimuli and exhibited generalized muscle weakness or paresis of the pelvic limbs. Numerous cutaneous and subcutaneous hemorrhages were associated with sites of tick attachment. Ticks were identified as Argas radiatus and Argas ricei. Treatment with acaricides and infection with West Nile virus (WNV) may have confounded the clinical presentation in 2009 and 2010. However, WNV-negative birds exhibited similar signs in 2011. One nestling recovered from paresis within 36 h after the removal of all adult and larval ticks (>350) and was released within 3 wk. The signs present in the heavily infested Bald Eagle nestlings resembled signs associated with tick paralysis, a neurotoxin-mediated paralytic syndrome described in mammals, reptiles, and wild birds (though not eagles). Removal of the infested nest and construction of a nest platform in a different tree was necessary to break the cycle of infection. The original nesting pair constructed a new nest on the man-made platform and successfully fledged two Bald Eagles in 2012.

  7. Mycobacterium avium subsp. avium found in raptors exposed to infected domestic fowl.

    Science.gov (United States)

    Kriz, Petr; Kaevska, Marija; Bartejsova, Iva; Pavlik, Ivo

    2013-09-01

    We report a case of a falcon breeding facility, where raptors (both diurnal and nocturnal) were raised in contact with domestic fowl (Gallus gallus f. domesticus) infected by Mycobacterium avium subsp. avium. Fecal and environmental samples from 20 raptors and four common ravens (Corvus corax) were collected. Mycobacterium a. avium DNA was detected in feces of four raptors (bald eagle [Haliaeetus leucocephalus], eagle owl [Bubo bubo], barn owl [Tyto alba], and little owl [Athene noctua]) using triplex quantitative real-time PCR. As both the flock of domestic fowl and one of the infected raptors had the same origin (zoological collection), they might have had a common source of colonization/infection. However, the detection of M. a. avium in feces of three other raptors may point at transmission of the agent between the birds in the facility. Contact of raptors with domestic fowl infected by M. a. avium may pose a risk for transmission of the infection for them; however, raptors from the falcon breeding facility seemed to be relatively resistant to the infection.

  8. Winter habitat associations of diurnal raptors in Californias Central Valley

    Science.gov (United States)

    Pandolrno, E.R.; Herzog, M.P.; Hooper, S.L.; Smith, Z.

    2011-01-01

    The wintering raptors of California's Central Valley are abundant and diverse. Despite this, little information exists on the habitats used by these birds in winter. We recorded diurnal raptors along 19 roadside survey routes throughout the Central Valley for three consecutive winters between 2007 and 2010. We obtained data sufficient to determine significant positive and negative habitat associations for the White-tailed Kite (Elanus leucurus), Bald Eagle {Haliaeetus leucocephalus), Northern Harrier (Circus cyaneus), Red-tailed Hawk (Buteo jamaicensis), Ferruginous Hawk (Buteo regalis), Rough-legged Hawk (Buteo lagopus), American Kestrel (Falco sparverius), and Prairie Falcon (Falco mexicanus). The Prairie Falcon and Ferruginous and Rough-legged hawks showed expected strong positive associations with grasslands. The Bald Eagle and Northern Harrier were positively associated not only with wetlands but also with rice. The strongest positive association for the White-tailed Kite was with wetlands. The Red-tailed Hawk was positively associated with a variety of habitat types but most strongly with wetlands and rice. The American Kestrel, Northern Harrier, and White-tailed Kite were positively associated with alfalfa. Nearly all species were negatively associated with urbanized landscapes, orchards, and other intensive forms of agriculture. The White-tailed Kite, Northern Harrier, Redtailed Hawk, Ferruginous Hawk, and American Kestrel showed significant negative associations with oak savanna. Given the rapid conversion of the Central Valley to urban and intensive agricultural uses over the past few decades, these results have important implications for conservation of these wintering raptors in this region.

  9. Fonofos poisons raptors and waterfowl several months after granular application.

    Science.gov (United States)

    Elliott, John E; Birmingham, Anna L; Wilson, Laurie K; McAdie, Malcolm; Trudeau, Suzanne; Mineau, Pierre

    2008-02-01

    From 1994 to 1999 in the Lower Fraser Valley region of southwest Canada, fonofos (Dyfonate G) was recommended for control of introduced wireworm (Agriotes spp.) pests on potato and other root crops. As part of a wildlife-monitoring program, we collected 15 raptors, including 12 bald eagles (Haliaeetus leucocephalus), found dead or debilitated on or near agricultural lands with severely inhibited brain and/or plasma cholinesterase activity and fonofos residues in ingesta. Bird remains, in nine cases waterfowl, were identified in the ingesta samples. Another seven bald eagles had severe cholinesterase inhibition, but without evidence of fonofos residues. During two winters from 1996 to 1998, 420 ha of potato fields, half of which had been treated the previous spring with fonofos and the remainder untreated, were searched weekly for evidence of wildlife mortality. Search efficiency was assessed with placed duck carcasses. Waterfowl outnumbered other species in field-use counts and comprised the greatest proportion of birds found dead. We found 211 wildlife remains, most scavenged; 35 intact carcasses were suitable for postmortem examination and/or toxicology analyses. Cholinesterase activity was assayed in brains of 18 waterfowl, five of which had severely depressed activity (average inhibition 74%; range, 69-78%). The gastrointestinal tract of a mallard found in a field treated with granular product contained 49 microg/g fonofos residues, linking waterfowl mortality with labelled use of the product. These findings demonstrate the risk of both primary and secondary poisoning by anticholinesterase insecticides where wildlife make intensive use of farmed fields.

  10. Bald eagle predation on common loon egg

    Science.gov (United States)

    DeStefano, Stephen; McCarthy, Kyle P.; Laskowski, Tom

    2010-01-01

    The Common Loon (Gavia immer) must defend against many potential egg predators during incubation, including corvids, Herring Gulls (Larus argentatus), raccoons (Procyon lotor), striped skunk (Mephitis mephitis), fisher (Martes pennanti), and mink (Neovison vison) (McIntyre 1988, Evers 2004, McCann et al. 2005). Bald Eagles (Haliaeetus leucocephalus) have been documented as predators of both adult Common Loons and their chicks (Vliestra and Paruk 1997, Paruk et al. 1999, Erlandson et al. 2007, Piper et al. 2008). In Wisconsin, where nesting Bald Eagles are abundant (>1200 nesting pairs, >1 young/pair/year), field biologists observed four instances of eagle predation of eggs in loon nests during the period 2002–2004 (M. Meyer pers. comm.). In addition, four cases of eagle predation of incubating adult loons were inferred from evidence found at the loon nest (dozens of plucked adult loon feathers, no carcass remains) and/or loon leg, neck, and skull bones beneath two active eagle nests, including leg bones containing the bands of the nearby (nest surveillance video camera on Lake Umbagog, a large lake (32 km2) at Umbagog National Wildlife Refuge (UNWR) in Maine.

  11. Monitoring fish, wildlife, radionuclides and chemicals at Hanford, Washington

    International Nuclear Information System (INIS)

    Gray, R.H.

    1989-02-01

    Concern about the effects of potential releases from nuclear and non-nuclear activities on the US Department of Energy's Hanford Site in southeastern Washington has evolved over four decades into a comprehensive environmental monitoring and surveillance program. The program includes field sampling, and chemical and physical analyses of air, surface and ground water, fish, wildlife, soil, foodstuffs, and natural vegetation. In addition to monitoring radioactivity in fish and wildlife, population numbers of key species are determined, usually during the breeding season. Data from monitoring efforts are used to assess the environmental impacts of Hanford operations and calculate the overall radiological dose to humans onsite, at the Site perimeter, or residing in nearby communities. Chinook salmon (Oncorhynchus tshawytscha) spawning in the Columbia River at Hanford has increased in recent years with a concomitant increase in winter nesting activity of bald eagles (Haliaeetus leucocephalus). An elk (Cervus elaphus) herd, established by immigration in 1972, is also increasing. Nesting Canada goose (Branta canadensis) and great blue heron (Ardea herodias), and various other animals, e.g., mule deer (Odocoileus hemionus) and coyotes (Canis latrans) are common. Measured exposure to penetrating radiation and calculated radiation doses to the public are well below applicable regulatory limits. 35 refs., 4 figs

  12. Geography and Timing of Cases of Eastern Equine Encephalitis in New York State from 1992 to 2012.

    Science.gov (United States)

    Oliver, JoAnne; Lukacik, Gary; Kramer, Laura D; Backenson, P Bryon; Sherwood, James A; Howard, John J

    2016-04-01

    In New York State (NYS), Eastern equine encephalitis (EEE) was first reported in a human in 1971, in horses in 1970, and in pheasants in 1952. Following work for the interval from 1970 to 1991, we identified cases in vertebrates from 1992 to 2012, through a passive surveillance system involving veterinarians in clinical practice, county health departments, and the Departments of Agriculture and Markets, Environmental Conservation, and Health, of the State of New York. During an 11-year hiatus, from 1992 to 2002, no case in any vertebrate was observed. In a re-emergence, from 2003 to 2012, disease occurred in 12 counties, including 7 counties where disease had never been documented. Vertebrate cases included 4 cases in humans and 77 nonhuman occurrences; in 58 horses, Equus ferus caballus L.; 2 deer, Odocoileus virginianus Zimmermann; 6 dogs, Canis familiaris; 10 birds; and 1 flock of pheasants, Phasianus colchicus L. These were the first reported cases in NYS in white-tailed deer, the domestic dog, and in five species of birds: American crow, Corvus brachyrhynchos Brehm; American goldfinch, Carduelis tristis L.; bald eagle, Haliaeetus leucocephalus L.; blue jay, Cyanocitta cristata (L.); and red-tailed hawk, Buteo jamaicensis Gmelin. One crow was dually infected with EEE virus and West Nile virus. The northern, southern, and southeastern borders of the state were newly affected. The geographic area, time periods, and vertebrate species with risk of EEE disease expanded from 1992 to 2012.

  13. Long-term monitoring studies of pollutants on public lands: Bald Eagles in the Midwest

    Energy Technology Data Exchange (ETDEWEB)

    Bowerman, W.W. [Eagle Environmental Inc., Haslett, MI (United States)

    1995-12-31

    The role of public agencies to monitor the populations of wildlife species with protected status is paramount to the recovery of these species. Since the early 1960s, the bald eagle (Haliaeetus leucocephalus) populations within the Midwest have been monitored to determine number of breeding pairs, nest occupancy, and success rates. In addition to the reproductive outcome studies, abandoned eggs, blood samples, and feather samples have been collected to determine concentrations of organochlorine pesticides, PCBs, and heavy metals. These surveys give an actual measure of population dynamics of a top-predator species in aquatic systems that integrates the effects of many different environmental pollutants. As concentrations of the organochlorine compounds have declined, bald eagle populations have increased in numbers and their reproductive success has improved. The recovery of this species has not been uniform however. In regions where DDT and PCB concentrations are still above thresholds associated with reproductive impairment, eagles still have impaired reproduction. These areas include the shorelines of the Great Lakes and Voyageurs National Park. Some areas such as the Chippewa National Forest have begun to show declines in reproduction due to density dependent factors. Recent proposals for ecosystem management and reclassification of the bald eagle have led to reduced emphasis for maintaining these long-term data sets. The utility and importance of maintaining surveys of top-predators that can give a measure of population-level effects of pollutants rather than an index will be discussed using examples from the Midwest.

  14. Tidal salt marshes of the southeast Atlantic Coast: A community profile

    Energy Technology Data Exchange (ETDEWEB)

    Wiegert, R.G.; Freeman, B.J.

    1990-09-01

    This report is part of a series of community profiles on the ecology of wetland and marine communities. This particular profile considers tidal marshes of the southeastern Atlantic coast, from North Carolina south to northern Florida. Alone among the earth's ecosystems, coastal communities are subjected to a bidirectional flooding sometimes occurring twice each day; this flooding affects successional development, species composition, stability, and productivity. In the tidally influenced salt marsh, salinity ranges from less than 1 ppt to that of seawater. Dominant plant species include cordgrasses (Spartina alterniflora and S. cynosuroides), black needlerush (Juncus romerianus), and salt marsh bulrush (Scirpus robustus). Both terrestrail and aquatic animals occur in salt marshes and include herons, egrets ospreys (Pandion haliaetus), bald eagles (Haliaeetus leucocephalus), alligators (Alligator Mississippiensis), manatees (Trichecus manatus), oysters, mussels, and fiddler crabs. Currently, the only significant direct commercial use of the tidal salt marshes is by crabbers seeking the blue crab Callinectes sapidus, but the marshes are quite important recreationally, aesthetically, and educationally. 151 refs., 45 figs., 6 tabs.

  15. Improved reproductive success in otters (Lutra lutra), grey seals (Halichoerus grypus) and sea eagles (Haliaeetus albicilla) from Sweden in relation to concentrations of organochlorine contaminants

    International Nuclear Information System (INIS)

    Roos, Anna M.; Bäcklin, Britt-Marie V.M.; Helander, Björn O.; Rigét, Frank F.; Eriksson, Ulla C.

    2012-01-01

    We studied indices of reproductive outcome in three aquatic species in relation to organochlorine concentrations during four decades. In female otters, the frequency of signs of reproduction increased after 1990. In grey seals, pregnancy rate increased 1990–2010 and uterine obstructions ceased after 1993. The frequency of uterine tumours was highest 1980–2000. The number of sea eagle nestlings per checked nest increased 1985–2000, while the frequency of desiccated eggs decreased. Organochlorine concentrations decreased at annual rates between 3.5 and 10.2%. The estimated mean concentration (mg/kg lw) for total-PCB decreased from 70 to 8 (otters), from 110 to 15 (seals) and from 955 to 275 (eagles). The corresponding concentrations for ΣDDT decreased from 3.4 to 0.2 (otters), from 192 to 2.8 (seals) and from 865 to 65 (eagles). This study adds evidence to support the hypothesis that PCBs and DDTs have had strong negative effects on the reproduction and population levels of these species. - Highlights: ► We compared trends of reproductive success in three aquatic top predators in Sweden. ► The study period covers four decades. ► Similar, increasing trends are seen from the end of the 1980s for otters, grey seals and sea eagles. ► Concentrations of total-PCB and DDTs have decreased in these species at similar rates. ► PCBs and DDTs have severely affected reproductive success in these species. - The reproductive success in otters, grey seals and white-tailed sea eagles has increased as the concentrations of PCBs and ΣDDT have decreased supporting a causative relationship.

  16. Persistent organic pollutants and methoxylated polybrominated diphenyl ethers in different tissues of white-tailed eagles (Haliaeetus albicilla) from West Greenland

    DEFF Research Database (Denmark)

    Jaspers, V L B; Sonne, C; Soler-Rodriguez, F

    2013-01-01

    Greenland sampled between 1997 and 2009. High inter-individual variation in contamination was found (PCBs: 0.49-1500 μg/g lipid weight (lw), DDTs: 0.23-910 μg/g lw, PBDEs: 0.01-24 μg/g lw, MeO-PBDEs: 0.001-0.59 μg/g lw), mostly due to age-related differences and not to temporal trends. One adult female (age...

  17. Silmästä silmään : pohdintaa animaatiohahmon silmän käytöstä

    OpenAIRE

    Jokinen, Heta

    2011-01-01

    Käsittelen opinnäytetyössäni hahmon silmiä ja kuinka niitä voi hyödyntää animaatioelokuvassa. Silmistä on olemassa suuri määrä tietoa ja pohdiskelevalla käsittelyllä pyrin selkeyttämään tiedon animaatioalan näkökulmaan sopivaksi. Aluksi käsittelen silmien merkitystä ja niillä kommunikointia. Silmillä kommunikointi on meille aikojen saatossa kehittynyt vahvoja emotionaalisia viestejä sisältävä kommunikointikeino. Ihmissilmät ja kasvot ovat kuin luotu keskustelemaan keskenään. Animaatiohahm...

  18. HAAGA-HELIA ammattikorkeakoulun opetuskeittiön käytännön toimintojen kehittämissuunnitelma

    OpenAIRE

    Heikkilä, Piia

    2013-01-01

    Tämän produktityyppisen opinnäytetyön tarkoituksena oli tehdä Helsingin Haagassa sijaitsevaan HAAGA-HELIA ammattikorkeakoulun opetuskeittiöön kehittämissuunnitelma. Koulussa koulutetaan liike-elämän ja palveluelinkeinojen asiantuntijoita ja lisäksi se tutkii ja kehittää näihin aloihin liittyvää osaamista ja toimintaa. Kehittämissuunnitelman lähtökohtana oli opettajakunnan esittämä toive. Kehittämissuunnitelma toteutettiin siten, että se soveltuu opetuskeittiön käyttäjäkunnalle ja voisi toimia...

  19. Muovisten pakkausmateriaalien kierrätyksen ja hyötykäytön kehittäminen : case Alkon viinipussit ja lavasidosmuovit

    OpenAIRE

    Helle, Solja

    2012-01-01

    Muovi on paljon käytetty pakkausmateriaali ja sen käyttö on lisääntynyt räjähdysmäisesti viimeisten vuosikymmenien aikana. Muovien kierrätys on haasteellista erilaisten muovilaatujen suuren kirjon sekä hajanaisten jätevirtojen vuoksi. Muovit ovat yleisesti ottaen kestävää ja pitkäikäistä materiaalia, joten ne soveltuvat näiltä ominaisuuksiltaan hyvin kierrätettäväksi. Luontoon päätyessään muovijäte hajoaa erittäin heikosti ja aiheuttaa merkittäviä ympäristöhaittoja. Opinnäytetyössä selvit...

  20. Tekoäly varallisuuden hoitajana : Nuorten aikuisten mielipiteitä tekoälyn käytöstä sijoitusneuvonnassa ja varainhoidossa

    OpenAIRE

    Tynjälä, Tuomas

    2017-01-01

    Opinnäytetyön tavoitteena oli selvittää tekoälyn käyttöä sijoitusneuvonnassa ja varainhoidossa sekä tutkia suuntaa antavasti nuorten aikuisten mielipiteitä aiheesta. Tarkoituksena oli esitellä robottisijoitusneuvojien toimintaa ja menestystä sijoitusmarkkinoilla sekä selvittää, miten nuoret aikuiset potentiaalisina asiakkaina suhtautuvat tällaiseen palveluun. Koska tekoälyn tarjoamat sijoituspalvelut ovat olleet suuri puheenaihe sijoitusmarkkinoilla viime aikoina, opinnäytetyö on hyvin ajanko...

  1. Lead and eagles: demographic and pathological characteristics of poisoning, and exposure levels associated with other causes of mortality

    Science.gov (United States)

    Franson, J. Christian; Russell, Robin E.

    2014-01-01

    We conducted a retrospective analysis to evaluate demographic and pathologic characteristics in 484 bald eagles (Haliaeetus leucocephalus) and 68 golden eagles (Aquila chrysaetos) diagnosed with lead poisoning at the U.S. Geological Survey National Wildlife Health Center. As part of our analysis, we compared characteristics of lead poisoned eagles with those that died of other causes. Odds of lead poisoning were greater for bald eagles versus golden eagles, females versus males, adults versus juveniles, and eagles from the Mississippi and Central flyways versus the Atlantic and Pacific flyways. In addition to spatial, species, and demographic associations, we detected a distinct temporal trend in the collection date of lead poisoned bald eagle carcasses. These carcasses were found at greater frequency in late autumn and winter than spring and summer. Lesions in lead poisoned birds included emaciation, evidence of bile stasis, myocardial degeneration and necrosis, and renal tubular nephrosis and necrosis. Ingested lead ammunition or fragments were found in 14.2 % of bald eagles and 11.8 % of golden eagles. The overall mean liver lead concentration (wet weight basis) for eagles diagnosed with lead poisoning was 28.9 ± 0.69 SE mg/kg in bald eagles and 19.4 ± 1.84 SE mg/kg in golden eagles. In eagles diagnosed with collision trauma, electrocution, poisoning (other than lead), emaciation, infectious disease, trapping death, other, and undetermined causes, average liver lead concentrations were low (<1 mg/kg) and did not differ among causes of mortality. Thus, based on our data, we found no evidence that lead exposure of eagles predisposed them to other causes of mortality.

  2. Utilization Probability Map for Migrating Bald Eagles in Northeastern North America: A Tool for Siting Wind Energy Facilities and Other Flight Hazards.

    Directory of Open Access Journals (Sweden)

    Elizabeth K Mojica

    Full Text Available Collisions with anthropogenic structures are a significant and well documented source of mortality for avian species worldwide. The bald eagle (Haliaeetus leucocephalus is known to be vulnerable to collision with wind turbines and federal wind energy guidelines include an eagle risk assessment for new projects. To address the need for risk assessment, in this study, we 1 identified areas of northeastern North America utilized by migrating bald eagles, and 2 compared these with high wind-potential areas to identify potential risk of bald eagle collision with wind turbines. We captured and marked 17 resident and migrant bald eagles in the northern Chesapeake Bay between August 2007 and May 2009. We produced utilization distribution (UD surfaces for 132 individual migration tracks using a dynamic Brownian bridge movement model and combined these to create a population wide UD surface with a 1 km cell size. We found eagle migration movements were concentrated within two main corridors along the Appalachian Mountains and the Atlantic Coast. Of the 3,123 wind turbines ≥100 m in height in the study area, 38% were located in UD 20, and 31% in UD 40. In the United States portion of the study area, commercially viable wind power classes overlapped with only 2% of the UD category 20 (i.e., the areas of highest use by migrating eagles and 4% of UD category 40. This is encouraging because it suggests that wind energy development can still occur in the study area at sites that are most viable from a wind power perspective and are unlikely to cause significant mortality of migrating eagles. In siting new turbines, wind energy developers should avoid the high-use migration corridors (UD categories 20 & 40 and focus new wind energy projects on lower-risk areas (UD categories 60-100.

  3. PCBs and DDE, but not PBDEs, increase with trophic level and marine input in nestling bald eagles

    International Nuclear Information System (INIS)

    Hamish Elliott, Kyle; Cesh, Lillian S.; Dooley, Jessica A.; Letcher, Robert J.; Elliott, John E.

    2009-01-01

    Concentrations of persistent contaminants often vary widely among individuals within a population. We hypothesized that such variation was caused mainly by differences in diet (biomagnification) and in coastal systems by the tendency of marine systems to act as contaminant sinks. We examined the relationship between contaminant concentrations and stable isotope ratios in nestling plasma from an apex predator with a particularly broad diet. Our study included freshwater, estuarine, inshore and pelagic breeding sites. Bald eagles (Haliaeetus leucocephalus) at the pelagic marine sites showed high trophic level and marine input, eagles at the freshwater sites showed low trophic level and marine input, and eagles at the estuarine and inshore marine sites had intermediate values. The relationship between trophic level and marine input may reflect longer food chains in pelagic compared to terrestrial ecosystems. ΣPCBs and DDE concentrations generally increased with trophic level and marine input, with the exception of the freshwater sites, while ΣPBDEs, hydroxylated-PBDEs and hydroxylated-PCBs increased with marine input, but were independent of trophic level. The relationships for ΣPCBs and DDE were often slightly stronger with marine input than trophic level, suggesting that oceanographic processes may be more important than trophic level. At freshwater locations, spatial variation may be more important than trophic level due to the heterogeneity of contaminant profiles between feeding locations (lakes, rivers, agricultural fields). Adults had similar isotopic composition to their chicks but higher contamination. Based on nests where prey composition was determined independently, isotopic enrichment values for nestling plasma were 1.6 ± 0.1 (δ 15 N) and - 0.4 ±0.2 (δ 13 C). We conclude that trophic level and marine influence are significant factors influencing PCB and DDE concentrations in eagles. However, trophic level in particular did not influence PBDEs

  4. Movements and foraging effort of Steller's Eiders and Harlequin Ducks wintering near Dutch Harbor, Alaska

    Science.gov (United States)

    Reed, J.A.; Flint, Paul L.

    2007-01-01

    We studied the movements and foraging effort of radio-marked Steller's Eiders (Polysticta stelleri) and Harlequin Ducks (Histrionicus histrionicus) to evaluate habitat quality in an area impacted by industrial activity near Dutch Harbor, Alaska. Foraging effort was relatively low, with Steller's Eiders foraging only 2.7 ± 0.6 (SE) hours per day and Harlequin Ducks 4.1 ± 0.5 hours per day. Low-foraging effort during periods of high-energetic demand generally suggests high food availability, and high food availability frequently corresponds with reductions in home range size. However, the winter ranges of Harlequin Ducks did not appear to be smaller than usual, with the mean range size in our study (5.5 ± 1.1 km2) similar to that reported by previous investigators. The mean size of the winter ranges of Steller's Eiders was similar (5.1 ± 1.3 km2), but no comparable estimates are available. Eutrophication of the waters near Dutch Harbor caused by seafood processing and municipal sewage effluent may have increased populations of the invertebrate prey of these sea ducks and contributed to their low-foraging effort. The threat of predation by Bald Eagles (Haliaeetus leucocephalus) that winter near Dutch Harbor may cause Steller's Eiders and Harlequin Ducks to move further offshore when not foraging, contributing to an increase in range sizes. Thus, the movement patterns and foraging behavior of these ducks likely represent a balance between the cost and benefits of wintering in a human-influenced environment.

  5. The Bald And Golden Eagle Protection Act, Species-Based Legal Protection And The Danger Of Misidentification

    Directory of Open Access Journals (Sweden)

    Johann C Knobel

    2015-12-01

    Full Text Available The Bald and Golden Eagle Protection Act of 1940 bestows legal protection on two North American eagle species in the United States of America. The Act was originally aimed at the legal protection of only one species: the Bald Eagle Haliaeetus leucocephalus, the national symbol of the USA. Later the Act was amended to extend protection also to the Golden Eagle Aquila chrysaetos. The Bald Eagle was an Endangered Species, but the Golden Eagle was not formally listed as Endangered nationwide in the USA. One of the reasons for extending legal protection to the Golden Eagle under the Act was to strengthen the legal protection of the Bald Eagle, because immature Bald Eagles were being misidentified as Golden Eagles and shot. Additional factors relating to Golden Eagle mortality also made legal protection of the Golden Eagle desirable. The danger that a rare and legally protected species can be misidentified and mistaken for a more common and unprotected species can therefore serve as a reason for bestowing legal protection on the more common species as well. Other factors may also indicate that legal protection of the more common species is desirable, making the case more compelling. If this line of reasoning is applied in respect of South African birds of prey, a strong case can be made in favour of extending legal protection under the national biodiversity legislation to more species than the small number of species currently enjoying such protection. Species that are listed as Vulnerable under South African national biodiversity legislation may be misidentified as species that are not subject to such protection. Additional factors are also present that make such an extension of legal protection desirable.

  6. Productivity, embryo and eggshell characteristics, and contaminants in bald eagles from the Great Lakes, USA, 1986 to 2000

    Science.gov (United States)

    Best, David A.; Elliott, Kyle; Bowerman, William; Shieldcastle, Mark C.; Postupalsky, Sergej; Kubiak, Timothy J.; Tillitt, Donald E.; Elliott, John E.

    2010-01-01

    Chlorinated hydrocarbon concentrations in eggs of fish-eating birds from contaminated environments such as the Great Lakes of North America tend to be highly intercorrelated, making it difficult to elucidate mechanisms causing reproductive impairment, and to ascribe cause to specific chemicals. An information- theoretic approach was used on data from 197 salvaged bald eagle (Haliaeetus leucocephalus) eggs (159 clutches) that failed to hatch in Michigan and Ohio, USA (1986–2000). Contaminant levels declined over time while eggshell thickness increased, and by 2000 was at pre-1946 levels. The number of occupied territories and productivity increased during 1981 to 2004. For both the entire dataset and a subset of nests along the Great Lakes shoreline, polychlorinated biphenyls (ΣPCBs, fresh wet wt) were generally included in the most parsimonious models (lowest-Akaike's information criterion [AICs]) describing productivity, with significant declines in productivity observed above 26 µg/g ΣPCBs (fresh wet wt). Of 73 eggs with a visible embryo, eight (11%) were abnormal, including three with skewed bills, but they were not associated with known teratogens, including ΣPCBs. Eggs with visible embryos had greater concentrations of all measured contaminants than eggs without visible embryos; the most parsimonious models describing the presence of visible embryos incorporated dieldrin equivalents and dichlorodiphenyldichloroethylene (DDE). There were significant negative correlations between eggshell thickness and all contaminants, with ΣPCBs included in the most parsimonious models. There were, however, no relationships between productivity and eggshell thickness or Ratcliffe's index. The ΣPCBs and DDE were negatively associated with nest success of bald eagles in the Great Lakes watersheds, but the mechanism does not appear to be via shell quality effects, at least at current contaminant levels, while it is not clear what other mechanisms were involved.

  7. Vulnerability of birds to climate change in California's Sierra Nevada

    Directory of Open Access Journals (Sweden)

    Rodney B. Siegel

    2014-06-01

    Full Text Available In a rapidly changing climate, effective bird conservation requires not only reliable information about the current vulnerability of species of conservation concern, but also credible projections of their future vulnerability. Such projections may enable managers to preempt or reduce emerging climate-related threats through appropriate habitat management. We used NatureServe's Climate Change Vulnerability Index (CCVI to predict vulnerability to climate change of 168 bird species that breed in the Sierra Nevada mountains of California, USA. The CCVI assesses species-specific exposure and sensitivity to climate change within a defined geographic area, through the integration of (a species' range maps, (b information about species' natural history traits and ecological relationships, (c historic and current climate data, and (d spatially explicit climate change projections. We conducted the assessment under two different downscaled climate models with divergent projections about future precipitation through the middle of the 21st century. Assessments differed relatively little under the two climate models. Of five CCVI vulnerability ranking categories, only one species, White-tailed Ptarmigan (Lagopus leucura, received the most vulnerable rank, Extremely Vulnerable. No species received the second-highest vulnerability ranking, Highly Vulnerable. Sixteen species scored as Moderately Vulnerable using one or both climate models: Common Merganser (Mergus merganser, Osprey (Pandion haliaetus, Bald Eagle (Haliaeetus leucocephalus, Northern Goshawk (Accipiter gentilis, Peregrine Falcon (Falco peregrinus, Prairie Falcon (Falco mexicanus, Spotted Sandpiper (Actitis macularius, Great Gray Owl (Strix nebulosa, Black Swift (Cypseloides niger, Clark's Nutcracker (Nucifraga columbiana, American Dipper (Cinclus mexicanus, Swainson's Thrush (Catharus ustulatus, American Pipit (Anthus rubescens, Gray-crowned Rosy-Finch (Leucosticte tephrocotis, Pine Grosbeak

  8. Potential hazards of environmental contaminants to avifauna residing in the Chesapeake Bay estuary

    Science.gov (United States)

    Rattner, Barnett A.; McGowan, Peter C.

    2007-01-01

    A search of the Contaminant Exposure and Effects-Terrestrial Vertebrates (CEE-TV) database revealed that 70% of the 839 Chesapeake Bay records deal with avian species. Studies conducted on waterbirds in the past 15 years indicate that organochlorine contaminants have declined in eggs and tissues, although p,p'-DDE, total polychlorinated biphenyls (PCBs) and coplanar PCB congeners may still exert sublethal and reproductive effects in some locations. There have been numerous reports of avian die-off events related to organophosphorus and carbamate pesticides. More contemporary contaminants (e.g., alkylphenols, ethoxylates, perfluorinated compounds, polybrominated diphenyl ethers) are detectable in bird eggs in the most industrialized portions of the Bay, but interpretation of these data is difficult because adverse effect levels are incompletely known for birds. Two moderaterized oil spills resulted in the death of several hundred birds, and about 500 smaller spill events occur annually in the watershed. With the exception of lead, concentrations of cadmium, mercury, and selenium in eggs and tissues appear to be below toxic thresholds for waterbirds. Fishing tackle and discarded plastics, that can entangle and kill young and adults, are prevalent in nests in some Bay tributaries. It is apparent that exposure and potential effects of several classes of contaminants (e.g., dioxins, dibenzofurans, rodenticides, pharmaceuticals, personal care products, lead shot, and some metals) have not been systematically examined in the past 15 years, highlighting the need for toxicological evaluation of birds found dead, and perhaps an avian ecotoxicological monitoring program. Although oil spills, spent lead shot, some pesticides, and industrial pollutants occasionally harm Chesapeake avifauna, contaminants no longer evoke the population level effects that were observed in Ospreys (Pandion haliaetus) and Bald Eagles (Haliaeetus leucocephalus) through the 1970s.

  9. Retrospective: Adjusting contaminant concentrations in bird eggs to account for moisture and lipid Loss during their incubation

    Science.gov (United States)

    Rattner, Barnett A.; Wiemeyer, Stanley N.; Blus, Lawrence J.

    2016-01-01

    By the 1960s, research and monitoring efforts on chlorinated pesticide residues in tissues of wildlife were well underway in North America and Europe. Conservationists and natural resource managers were attempting to resolve whether pesticide exposure and accumulated residues were related to population declines in several species of predatory and scavenging birds (e.g., bald eagle Haliaeetus leucocephalus, peregrine falcon Falco peregrinus, brown pelican Pelecanus occidentalis and osprey Pandion haliaetus). The avian egg was a favored sampling matrix even before the realization that eggshell thinning was linked to population declines (Ratcliffe 1967; Hickey and Anderson 1968) and that the concentration of p,p’-DDE in an egg was associated with the shell thinning phenomenon (e.g., Blus et al. 1972; Wiemeyer et al. 1988). The necessity for making wet-weight concentration adjustments to account for natural moisture loss during incubation of viable eggs was realized. Correction for the more dramatic moisture loss in non-viable decaying eggs was recognized as being paramount. For example, the ∑DDT residues in osprey eggs were reported to vary by as much as eightfold without accounting for moisture loss adjustments (Stickel et al. 1965). In the absence of adjusting concentrations to the fresh wet-weight that was present at the time of egg laying, the uncorrected values exaggerated contaminant concentrations, yielding artifactual results and ultimately incorrect conclusions. The adjustment to fresh wet-weight concentration is equally important for many other persistent contaminants including PCBs, dioxins, furans, and brominated diphenyl ethers.

  10. Dependence of waterbirds and shorebirds on shallow-water habitats in the Mid-Atlantic coastal region: An ecological profile and management recommendations

    Science.gov (United States)

    Erwin, R.M.

    1996-01-01

    Waterbirds (waterfowl, colonially nesting wading and seabirds, ospreys [Pandion haliaetus], and bald eagles [Haliaeetus leucocephalus]) and shorebirds (sandpipers, plovers, and relatives) may constitute a large fraction of the top level carnivore trophic component in many shallow-water areas of the mid-Atlantic region. The large biomass of many species (>1 kg body mass for the two raptors and some waterfowl) and enormous populations (e.g., >1 million shorebirds in late May in parts of Delaware Bay) reveal the importance of waterbirds as consumers and as linkages in nutrient flux in many shallow-water habitats. Salt and brackish marsh shallow-water habitats, including marsh pannes and tidal pools and creeks as well as constructed impoundments, are used intensively during most months of the year; in fall and winter, mostly by dabbling ducks, in spring and summer by migrant shorebirds and breeding colonial wading birds and seabirds. In adjacent estuaries, the intertidal flats and littoral zones of shallow embayments are heavily used by shorebirds, raptors, and colonial waterbirds in the May to September periods, with use by duck and geese heaviest from October to March. With the regional degradation of estuarine habitats and population declines of many species of waterbirds in the past 20 yr, some management recommendations relevant to shallow waters include: better protection, enhancement, and creation of small bay islands (small and isolated to preclude most mammalian predators) for nesting and brooding birds, especially colonial species; establishment of sanctuaries from human disturbance (e.g., boating, hunting) both in open water (waterfowl) and on land, better allocation of sandy dredged materials to augment islands or stabilize eroding islands; improvement in water management of existing impoundments to ensure good feeding, resting, and nesting opportunities for all the waterbirds, support for policies to preclude point and nonpoint source runoff of chemicals

  11. Osprey: worldwide sentinel species for assessing and monitoring environmental contamination in rivers, lakes, reservoirs, and estuaries.

    Science.gov (United States)

    Grove, Robert A; Henny, Charles J; Kaiser, James L

    2009-01-01

    In the United States, many fish and wildlife species have been used nationwide to monitor environmental contaminant exposure and effects, including carcasses of the bald eagle (Haliaeetus leucocephalus), the only top avian predator regularly used in the past. Unfortunately, bald eagles are sensitive to investigator intrusion at the nest. Thus, the osprey (Pandion haliaetus) is evaluated as a potential sentinel species for aquatic ecosystems. Several characteristics support the choice of the osprey as a sentinel species, including: (1) fish-eating diet atop the aquatic food web, (2) long-lived with strong nest fidelity, (3) adapts to human landscapes (potentially the most contaminated), (4) tolerates short-term nest disturbance, (5) nests spatially distributed at regular intervals, (6) highly visible nests easily located for study, (7) ability to accumulate most, if not all, lipophilic contaminants, (8) known sensitivity to many contaminants, and (9) nearly a worldwide distribution. These osprey traits have been instrumental in successfully using the species to understand population distribution, abundance, and changes over time; the effects of various contaminants on reproductive success; how contaminants in prey (fish on biomass basis) contribute to egg concentrations (i.e., biomagnification factors); and spatial residue patterns. Data summarized include nesting population surveys, detailed nesting studies, and chemical analyses of osprey egg, organ, blood, and feather samples for contaminants that bioaccumulate and/or biomagnify in aquatic food webs; and biochemical evaluations of blood and various organs. Studies in the United States, Canada, Mexico, Europe, and elsewhere have shown the osprey to be a useful sentinel species for monitoring selected environmental contaminants, including some emerging contaminants in lakes, reservoirs, rivers, and estuaries.

  12. High risk of lead contamination for scavengers in an area with high moose hunting success.

    Science.gov (United States)

    Legagneux, Pierre; Suffice, Pauline; Messier, Jean-Sébastien; Lelievre, Frédérick; Tremblay, Junior A; Maisonneuve, Charles; Saint-Louis, Richard; Bêty, Joël

    2014-01-01

    Top predators and scavengers are vulnerable to pollutants, particularly those accumulated along the food chain. Lead accumulation can induce severe disorders and alter survival both in mammals (including humans) and in birds. A potential source of lead poisoning in wild animals, and especially in scavengers, results from the consumption of ammunition residues in the tissues of big game killed by hunters. For two consecutive years we quantified the level lead exposure in individuals of a sentinel scavenger species, the common raven (Corvus corax), captured during the moose (Alces alces) hunting season in eastern Quebec, Canada. The source of the lead contamination was also determined using stable isotope analyses. Finally, we identified the different scavenger species that could potentially be exposed to lead by installing automatic cameras targeting moose gut piles. Blood lead concentration in ravens increased over time, indicating lead accumulation over the moose-hunting season. Using a contamination threshold of 100 µg x L(-1), more than 50% of individuals were lead-contaminated during the moose hunting period. Lead concentration was twice as high in one year compared to the other, matching the number of rifle-shot moose in the area. Non-contaminated birds exhibited no ammunition isotope signatures. The isotope signature of the lead detected in contaminated ravens tended towards the signature from lead ammunition. We also found that black bears (Ursus americanus), golden eagles and bald eagles (Aquila chrysaetos and Haliaeetus leucocephalus, two species of conservation concern) scavenged heavily on moose viscera left by hunters. Our unequivocal results agree with other studies and further motivate the use of non-toxic ammunition for big game hunting.

  13. High risk of lead contamination for scavengers in an area with high moose hunting success.

    Directory of Open Access Journals (Sweden)

    Pierre Legagneux

    Full Text Available Top predators and scavengers are vulnerable to pollutants, particularly those accumulated along the food chain. Lead accumulation can induce severe disorders and alter survival both in mammals (including humans and in birds. A potential source of lead poisoning in wild animals, and especially in scavengers, results from the consumption of ammunition residues in the tissues of big game killed by hunters. For two consecutive years we quantified the level lead exposure in individuals of a sentinel scavenger species, the common raven (Corvus corax, captured during the moose (Alces alces hunting season in eastern Quebec, Canada. The source of the lead contamination was also determined using stable isotope analyses. Finally, we identified the different scavenger species that could potentially be exposed to lead by installing automatic cameras targeting moose gut piles. Blood lead concentration in ravens increased over time, indicating lead accumulation over the moose-hunting season. Using a contamination threshold of 100 µg x L(-1, more than 50% of individuals were lead-contaminated during the moose hunting period. Lead concentration was twice as high in one year compared to the other, matching the number of rifle-shot moose in the area. Non-contaminated birds exhibited no ammunition isotope signatures. The isotope signature of the lead detected in contaminated ravens tended towards the signature from lead ammunition. We also found that black bears (Ursus americanus, golden eagles and bald eagles (Aquila chrysaetos and Haliaeetus leucocephalus, two species of conservation concern scavenged heavily on moose viscera left by hunters. Our unequivocal results agree with other studies and further motivate the use of non-toxic ammunition for big game hunting.

  14. Comparison of metabolic substrates in alligators and several birds of prey.

    Science.gov (United States)

    Sweazea, Karen L; McMurtry, John P; Elsey, Ruth M; Redig, Patrick; Braun, Eldon J

    2014-08-01

    On average, avian blood glucose concentrations are 1.5-2 times those of mammals of similar mass and high concentrations of insulin are required to lower blood glucose. Whereas considerable data exist for granivorous species, few data are available for plasma metabolic substrate and glucoregulatory hormone concentrations for carnivorous birds and alligators. Birds and mammals with carnivorous diets have higher metabolic rates than animals consuming diets with less protein whereas alligators have low metabolic rates. Therefore, the present study was designed to compare substrate and glucoregulatory hormone concentrations in several birds of prey and a phylogenetically close relative of birds, the alligator. The hypothesis was that the combination of carnivorous diets and high metabolic rates favored the evolution of greater protein and fatty acid utilization leading to insulin resistance and high plasma glucose concentrations in carnivorous birds. In contrast, it was hypothesized that alligators would have low substrate utilization attributable to a low metabolic rate. Fasting plasma substrate and glucoregulatory hormone concentrations were compared for bald eagles (Haliaeetus leucocephalus), great horned owls (Bubo virginianus), red-tailed hawks (Buteo jamaicensis), and American alligators (Alligator mississippiensis). Avian species had high circulating β-hydroxybutyrate (10-21 mg/dl) compared to alligators (2.81 ± 0.16 mg/dl). In mammals high concentrations of this byproduct of fatty acid utilization are correlated with insulin resistance. Fasting glucose and insulin concentrations were positively correlated in eagles whereas no relationship was found between these variables for owls, hawks or alligators. Additionally, β-hydroxybutyrate concentrations were low in alligators. Similar to carnivorous mammals, ingestion of a high protein diet may have favored the utilization of fatty acids and protein for energy thereby promoting the development of insulin

  15. Utilization Probability Map for Migrating Bald Eagles in Northeastern North America: A Tool for Siting Wind Energy Facilities and Other Flight Hazards.

    Science.gov (United States)

    Mojica, Elizabeth K; Watts, Bryan D; Turrin, Courtney L

    2016-01-01

    Collisions with anthropogenic structures are a significant and well documented source of mortality for avian species worldwide. The bald eagle (Haliaeetus leucocephalus) is known to be vulnerable to collision with wind turbines and federal wind energy guidelines include an eagle risk assessment for new projects. To address the need for risk assessment, in this study, we 1) identified areas of northeastern North America utilized by migrating bald eagles, and 2) compared these with high wind-potential areas to identify potential risk of bald eagle collision with wind turbines. We captured and marked 17 resident and migrant bald eagles in the northern Chesapeake Bay between August 2007 and May 2009. We produced utilization distribution (UD) surfaces for 132 individual migration tracks using a dynamic Brownian bridge movement model and combined these to create a population wide UD surface with a 1 km cell size. We found eagle migration movements were concentrated within two main corridors along the Appalachian Mountains and the Atlantic Coast. Of the 3,123 wind turbines ≥100 m in height in the study area, 38% were located in UD 20, and 31% in UD 40. In the United States portion of the study area, commercially viable wind power classes overlapped with only 2% of the UD category 20 (i.e., the areas of highest use by migrating eagles) and 4% of UD category 40. This is encouraging because it suggests that wind energy development can still occur in the study area at sites that are most viable from a wind power perspective and are unlikely to cause significant mortality of migrating eagles. In siting new turbines, wind energy developers should avoid the high-use migration corridors (UD categories 20 & 40) and focus new wind energy projects on lower-risk areas (UD categories 60-100).

  16. Role of raptors in contaminant research

    Science.gov (United States)

    Henny, Charles J.

    2017-01-01

    This chapter reviews the history of and approaches used in studies focused on the effects of contaminants on raptors and raptor populations at the Patuxent Wildlife Research Center (Patuxent) in Laurel, MD. Worldwide raptor declines following World War II were unprecedented and resulted in a sequence of major efforts at Patuxent to understand their cause(s). The peregrine falcon (Falco peregrinus), bald eagle (Haliaeetus leucocephalus), and osprey (Pandion haliaetus) were the species of most concern in North America. Laboratory and field studies at Patuxent complemented each other and yielded timely results of national and international importance, including some findings published in the journals “Science” and “Nature.” Concern about contaminant effects on wildlife populations came to the forefront during the years immediately following World War II. This concern was worldwide and not limited to one taxonomic group or to personnel and investigations at Patuxent. Contaminant studies of raptors were only part of the story, but this review, with minor exceptions, is limited to raptor studies and the role Patuxent played in this research. Indeed, many important nonraptor contaminant studies done at Patuxent, as well as raptor studies conducted elsewhere, are not mentioned here. For other reviews of contaminant-wildlife issues in the 1950s and 1960s, the reader is referred to “Silent Spring” by Rachel Carson (1962), “Pesticides and the Living Landscape” by Robert Rudd (1964), and “Return of the Peregrine: A North American Saga of Tenacity and Teamwork” by Tom Cade and Bill Burnham (Cade and Burnham, 2003).

  17. Antibody Prevalence and Isolation of Viable Toxoplasma gondii from Raptors in the Southeastern USA.

    Science.gov (United States)

    Love, David; Kwok, Oliver C; Verma, Shiv Kumar; Dubey, Jitender P; Bellah, Jamie

    2016-07-01

    Raptors are good indicators of the prevalence of Toxoplasma gondii in the environment because they prey on small mammals and birds. These prey species are a major source of infection in domestic cats ( Felis catus ), which shed the environmentally resistant oocysts. We assessed T. gondii infection in 281 opportunistically available raptors at a rehabilitation facility between 2012 and 2014. Antibodies to T. gondii were assayed by a modified agglutination test (cutoff 1:25) and found in serum of 22/71 Red-tailed Hawks ( Buteo jamaicensis ), 25/54 Barred Owls ( Strix varia ), 9/41 Red-shouldered Hawks ( Buteo lineatus ), 13/28 Great Horned Owls ( Bubo virginianus ), 6/20 Broad-winged Hawks ( Buteo platypterus ), 2/16 Eastern Screech Owls (Megascops asio), 12/13 Bald Eagles ( Haliaeetus leucocephalus ), 6/12 Cooper's Hawks ( Accipiter cooperii ), 1/8 Black Vultures ( Coragyps atratus ), and 1/1 Golden Eagle ( Aquila chrysaetos ). Antibodies were not detected in 5 Barn Owls ( Tyto alba ), 3 American Kestrels ( Falco sparverius ), 1 Mississippi Kite ( Ictinia mississippiensis ), and 1 Osprey ( Pandion haliaetus ). Viable T. gondii was isolated from the tissues of 1 antibody-positive Barred Owl and identified as a strain having type II alleles at all 10 loci tested, except one (ToxoDB polymerase chain reaction-restriction fragment length polymorphism genotype 3). Type II strain is the most common strain in the US. Results of this study indicate a high prevalence of T. gondii in some raptor species and the first reported genotyping from a Barred Owl.

  18. ALTERNATE FOOD-CHAIN TRANSFER OF THE TOXIN LINKED TO AVIAN VACUOLAR MYELINOPATHY AND IMPLICATIONS FOR THE ENDANGERED FLORIDA SNAIL KITE (ROSTRHAMUS SOCIABILIS).

    Science.gov (United States)

    Dodd, Shelley R; Haynie, Rebecca S; Williams, Susan M; Wilde, Susan B

    2016-04-28

    Avian vacuolar myelinopathy (AVM) is a neurologic disease causing recurrent mortality of Bald Eagles ( Haliaeetus leucocephalus ) and American Coots ( Fulica americana ) at reservoirs and small impoundments in the southern US. Since 1994, AVM is considered the cause of death for over 170 Bald Eagles and thousands of American Coots and other species of wild birds. Previous studies link the disease to an uncharacterized toxin produced by a recently described cyanobacterium, Aetokthonos hydrillicola gen. et sp. nov. that grows epiphytically on submerged aquatic vegetation (SAV). The toxin accumulates, likely in the gastrointestinal tract of waterbirds that consume SAV, and birds of prey are exposed when feeding on the moribund waterbirds. Aetokthonos hydrillicola has been identified in all reservoirs where AVM deaths have occurred and was identified growing abundantly on an exotic SAV hydrilla ( Hydrilla verticillata ) in Lake Tohopekaliga (Toho) in central Florida. Toho supports a breeding population of a federally endangered raptor, the Florida Snail Kite ( Rostrhamus sociabilis ) and a dense infestation of an exotic herbivorous aquatic snail, the island applesnail ( Pomacea maculata ), a primary source of food for resident Snail Kites. We investigated the potential for transmission in a new food chain and, in laboratory feeding trials, confirmed that the AVM toxin was present in the hydrilla/A. hydrillicola matrix collected from Toho. Additionally, laboratory birds that were fed apple snails feeding on hydrilla/A. hydrillicola material from a confirmed AVM site displayed clinical signs (3/5), and all five developed brain lesions unique to AVM. This documentation of AVM toxin in central Florida and the demonstration of AVM toxin transfer through invertebrates indicate a significant risk to the already diminished population of endangered Snail Kites.

  19. Secondary toxicity in raptors caused by white phosphorus

    Science.gov (United States)

    Sparling, D.W.

    1995-01-01

    White phosphorus (WP) has caused waterfowl die-offs in a tidal saltmarsh used by the U.S. Army for artillery practice for > 40 years. Bald (Haliaeetus leucocephalus)and golden (Aquila chrysaetos) eagles have been observed feeding on dead and dying waterfowl on the marsh and may be exposed to WP through ingestion of contaminated birds. One carcass of each eagle species has been found with measurable levels of WP in fat. To determine if raptors can become intoxicated by ingesting prey that have been exposed to WP we fed live, 10-day-old white leghorn chicks three sublethal doses of WP. Six hrs after the last dose we euthanized the chicks and separated them into two groups--one with the digestive system from gizzard anteriorly removed (NoGut) and one with the digestive system intact and a 1.1 mg pellet of WP implanted deep into the crop (Pel). A third group of same-aged chicks unexposed to WP was used for controls. Fifteen kestrels (Fa/co sparverius) were randomly assigned to each of the treatments and 10 to the control diet. By 7 d of the study 8 of the kestrels had died on the Pel and 3 on the NoGut diet. Survivors on the Pel diet had significantly lower hematocrit, hemoglobin, final body weights and greater liver/body weight ratios and weight loss than control birds. The study showed that raptors and possibly other predators are at risk both when consuming flesh of prey that have succumbed to WP poisoning and when ingesting WP pellets that are incorporated in body parts but that the risk is greater when pellets are present.

  20. Managing individual nests promotes population recovery of a top predator

    Science.gov (United States)

    Cruz, Jennyffer; Windels, Steve K.; Thogmartin, Wayne E.; Crimmins, Shawn M.; Grim, Leland; Zuckerberg, Benjamin

    2018-01-01

    Threatened species are managed using diverse conservation tactics implemented at multiple scales ranging from protecting individuals, to populations, to entire species. Individual protection strives to promote recovery at the population‐ or species‐level, although this is seldom evaluated.After decades of widespread declines, bald eagles, Haliaeetus leucocephalus, are recovering throughout their range due to legal protection and pesticide bans. However, like other raptors, their recovery remains threatened by human activities. Bald eagle nests are commonly managed using buffer zones to minimize human disturbance, but the benefits of this practice remain unquantified.Within Voyageurs National Park (VNP), Minnesota, USA, managers have monitored bald eagle populations for over 40 years, and since 1991, have protected at‐risk nests from human disturbance using buffer zones (200 and 400 m radius). We aimed to (1) quantify the recovery of bald eagles in VNP (1973–2016), and (2) provide a first‐ever evaluation of the individual‐ and population‐level effects of managing individual nests. To do so, we developed Bayesian Integrated Population Models combining observations of nest occupancy and reproductive output (metrics commonly collected for raptors) to estimate nest‐level probabilities of occupancy, nest success, and high productivity (producing ≥2 nestlings), as well as population‐level estimates of abundance and growth.The breeding population of bald eagles at VNP increased steadily from management significantly improved occupancy and success. At the population‐level, management led to 8% and 13% increases in nest success and productivity rates, respectively, resulting in a 37% increase in breeding pair abundance.Synthesis and applications. There is a clear need to evaluate how management approaches at multiple scales assist in species recovery. Our study uses an Integrated Population Model to reveal the population‐level benefits of a widely

  1. Secondary toxicity in raptors caused by white phosphorus

    Energy Technology Data Exchange (ETDEWEB)

    Sparling, D.W. [Patuxent Environmental Science Center, Laurel, MD (United States)

    1995-12-31

    White phosphorus (WP) has caused waterfowl die-offs in a tidal saltmarsh used by the US Army for artillery practice for > 40 years. Bald (Haliaeetus leucocephalus)and golden (Aquila chrysaetos) eagles have been observed feeding on dead and dying waterfowl on the marsh and may be exposed to WP through ingestion of contaminated birds. One carcass of each eagle species has been found with measurable levels of WP in fat. To determine if raptors can become intoxicated by ingesting prey that have been exposed to WP the authors fed live, 10-day-old white leghorn chicks three sublethal doses of WP. Six hrs after the last dose the authors euthanized the chicks and separated them into two groups one with the digestive system from gizzard anteriorly removed (NoGut) and one with the digestive system intact and a 1.1 mg pellet of WP implanted deep into the crop (Pel). A third group of same-aged chicks unexposed to WP was used for controls. Fifteen kestrels (Falco sparverius) were randomly assigned to each of the treatments and 1 0 to the control diet. By 7 d of the study 8 of the kestrels had died on the Pel and 3 on the NoGut diet. Survivors on the Pel diet had significantly lower hematocrit, hemoglobin, final body weights and greater liver/body weight ratios and weight loss than control birds. The study showed that raptors and possibly other predators are at risk both when consuming flesh of prey that have succumbed to WP poisoning and when ingesting WP pellets that are incorporated in body parts but that the risk is greater when pellets are present.

  2. Dicty_cDB: VSD225 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available yt*imskaqavgsnyrvslglpvgavmnsadnsgaknlyviavkgikgrlnrlpsagvgd mvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnp...nsadnsgaknlyviavkgikgrlnrlpsag vgdmvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgni lgpvakecsdlwpkva

  3. Forvaltning av seksualitet blant mannlige innsatte under soning : en kvalitativ undersøkelse med intervju av 5 innsatte i fengsel med høyt sikkerhetsnivå (lukket fengsel)

    OpenAIRE

    Kvalevåg, Ståle

    2017-01-01

    Masteroppgave psykisk helsearbeid ME504 - Universitetet i Agder 2017 The purpose of this qualitative investigation was to identify how inmates manage their sexuality during the atonement. I have also looked at how the possibilities of communication, with sexuality as content, between inmates and staff. Finally, we talked about how the informants think a prison stay among male fellow inmates will affect their sexuality and possibly how their sexuality will be after release. As a...

  4. ytä päätäsi - Päätä rajasi : Tampereen kristillisen koulun 8.-luokkalaisille suunnattu terveystiedon tunti seksuaaliterveyden edistämiseksi

    OpenAIRE

    Vartiamäki, Riikka; Laitinen, Sirpa

    2015-01-01

    Opinnäytetyön keskeisimmäksi tavoitteeksi asetettiin nuorten seksuaaliterveyden vahvistaminen. Tavoitteina oli myös tarkastella seksuaalioikeuksia ja seksuaalisen häirinnän kriteereitä sairaanhoitajan ammatillisen kasvun tukemiseksi. Oppitunnin sisällössä nostetaan esille seksuaaliterveyttä rikkovia ja sitä vahvistavia tekijöitä, jotta nuori saa tietoa omien rajojensa määrittelemiseksi tervettä aikuisuutta varten. Opinnäytetyö koostuu oppitunnilla esitetystä materiaalista sekä seksuaalite...

  5. ANGDelMut – a web-based tool for predicting and analyzing functional loss mechanisms of amyotrophic lateral sclerosis-associated angiogenin mutations [v3; ref status: indexed, http://f1000r.es/2yt

    Directory of Open Access Journals (Sweden)

    Aditya K Padhi

    2014-02-01

    Full Text Available ANGDelMut is a web-based tool for predicting the functional consequences of missense mutations in the angiogenin (ANG protein, which is associated with amyotrophic lateral sclerosis (ALS. Missense mutations in ANG result in loss of either ribonucleolytic activity or nuclear translocation activity or both of these functions, and in turn cause ALS. However, no web-based tools are available to predict whether a newly identified ANG mutation will possibly lead to ALS. More importantly, no web-implemented method is currently available to predict the mechanisms of loss-of-function(s of ANG mutants. In light of this observation, we developed the ANGDelMut web-based tool, which predicts whether an ANG mutation is deleterious or benign. The user selects certain attributes from the input panel, which serves as a query to infer whether a mutant will exhibit loss of ribonucleolytic activity or nuclear translocation activity or whether the overall stability will be affected. The output states whether the mutation is deleterious or benign, and if it is deleterious, gives the possible mechanism(s of loss-of-function. This web-based tool, freely available at http://bioschool.iitd.ernet.in/DelMut/, is the first of its kind to provide a platform for researchers and clinicians, to infer the functional consequences of ANG mutations and correlate their possible association with ALS ahead of experimental findings.

  6. Seroepidemiology of Toxoplasma gondii in zoo animals in selected zoos in the midwestern United States.

    Science.gov (United States)

    de Camps, Silvia; Dubey, J P; Saville, W J A

    2008-06-01

    eagles (Haliaeetus leucocephalus) were seropositive. Among 7 possible risk factors, sex, freezing meat temperature (above -13 C vs. below -13 C), washing vegetables thoroughly, frequency of feral cat sightings on zoo grounds (occasionally vs. frequently), frequency of feral cat control programs, capability of feral cats to enter hay/grain barn, and type of animal exhibit, exhibiting animals in open enclosures was the only factor identified as a significant risk (OR 3.22, P = 0.00).

  7. Recent population size, trends, and limiting factors for the double-crested Cormorant in Western North America

    Science.gov (United States)

    Adkins, Jessica Y.; Roby, Daniel D.; Lyons, Donald E.; Courtot, Karen N.; Collis, Ken; Carter, Harry R.; Shuford, W. David; Capitolo, Phillip J.

    2014-01-01

    colonies by bald eagles (Haliaeetus leucocephalus) and humans are likely limiting factors on the growth of the western population at present. Because of differences in biology and management, the western population of double-crested cormorants warrants consideration as a separate management unit from the population east of the Continental Divide.

  8. Genetics Home Reference: 3-beta-hydroxysteroid dehydrogenase deficiency

    Science.gov (United States)

    ... for This Page Lutfallah C, Wang W, Mason JI, Chang YT, Haider A, Rich B, Castro-Magana ... A, Copeland KC, Chang YT, Lutfallah C, Mason JI. Carriers for type II 3beta-hydroxysteroid dehydrogenase (HSD3B2) ...

  9. Dicty_cDB: VSD614 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available agvgd mvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnilgp vakecsdlwpkvatnagtiv*INTHKVKTXXKK--- ---V...kpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnilgp vakecsdlwpkvatnagtiv*INTHKVKTXXKK--- ---yt*imskaqavgsnyr

  10. Environmental Assessment, Change in C-17 Flight Training Operations at Grant County International Airport, Washington by Joint Base Lewis-McChord

    Science.gov (United States)

    2011-10-01

    young in the ocean. Resident and juvenile bull trout prey on invertebrates and small fish. Adult migratory bull trout primarily eat fish. Resident...Federal Status Amphibians 1 Northern leopard frog Rana pipiens Endangered None Birds 2 Bald eagle Haliaeetus

  11. Research Article

    African Journals Online (AJOL)

    2017-09-01

    Sep 1, 2017 ... (y=at+b) cloud point (t, Yt) which minimizes the distance is determined Σ (Yt - (at + b)). 2 . This ... Ct0 and Ctf initial and final values calculated using the regression at time t0 (January 2003) and tf. (December 2012) ... 2003 to 2012 gen in water reservoir has recorded a negative trend of 2%, this is con.

  12. Delay or anticipatory synchronization in one-way coupled systems ...

    Indian Academy of Sciences (India)

    1Department of Physics, Indian Institute of Science Education and Research, Pune 411 ... Synchronization; variable time delay; time delay systems; secure communication. .... scheme can be defined as y(t − τ2) = x(t − τ1) or y(t) = x(t − τ1 + τ2).

  13. Motivation and treatment credibility predict alliance in cognitive behavioral treatment for youth with anxiety disorders in community clinics.

    Science.gov (United States)

    Fjermestad, K W; Lerner, M D; McLeod, B D; Wergeland, G J H; Haugland, B S M; Havik, O E; Öst, L-G; Silverman, W K

    2017-11-16

    We examined whether motivation and treatment credibility predicted alliance in a 10-session cognitive behavioral treatment delivered in community clinics for youth anxiety disorders. Ninety-one clinic-referred youths (mean age  = 11.4 years, standard deviation = 2.1, range 8-15 years, 49.5% boys) with anxiety disorders-rated treatment motivation at pretreatment and perceived treatment credibility after session 1. Youths and therapists (YT) rated alliance after session 3 (early) and session 7 (late). Hierarchical linear models were applied to examine whether motivation and treatment credibility predicted YT early alliance, YT alliance change, and YT alliance agreement. Motivation predicted high early YT alliance, but not YT alliance change or alliance agreement. Youth-rated treatment credibility predicted high early youth alliance and high YT positive alliance change, but not early therapist alliance or alliance agreement. Conclusion Efforts to enhance youth motivation and treatment credibility early in treatment could facilitate the formation of a strong YT alliance. © 2017 Wiley Periodicals, Inc.

  14. Stability analysis of a class of fractional delay differential equations

    Indian Academy of Sciences (India)

    Abstract. In this paper we analyse stability of nonlinear fractional order delay differential equa- tions of the form Dα y(t) = af (y(t − τ )) − by(t), where Dα is a Caputo fractional derivative of order 0 < α ≤ 1. We describe stability regions using critical curves. To explain the proposed theory, we discuss fractional order logistic ...

  15. A non-standard optimal control problem arising in an economics application

    Directory of Open Access Journals (Sweden)

    Alan Zinober

    2013-04-01

    Full Text Available A recent optimal control problem in the area of economics has mathematical properties that do not fall into the standard optimal control problem formulation. In our problem the state value at the final time the state, y(T = z, is free and unknown, and additionally the Lagrangian integrand in the functional is a piecewise constant function of the unknown value y(T. This is not a standard optimal control problem and cannot be solved using Pontryagin's Minimum Principle with the standard boundary conditions at the final time. In the standard problem a free final state y(T yields a necessary boundary condition p(T = 0, where p(t is the costate. Because the integrand is a function of y(T, the new necessary condition is that y(T should be equal to a certain integral that is a continuous function of y(T. We introduce a continuous approximation of the piecewise constant integrand function by using a hyperbolic tangent approach and solve an example using a C++ shooting algorithm with Newton iteration for solving the Two Point Boundary Value Problem (TPBVP. The minimising free value y(T is calculated in an outer loop iteration using the Golden Section or Brent algorithm. Comparative nonlinear programming (NP discrete-time results are also presented.

  16. Kaisafestin digitaalisen markkinoinnin suunnitelma

    OpenAIRE

    Vepsä, Johanna

    2010-01-01

    Opinnäytetyöni on Kaisafestin digitaalisen markkinoinnin suunnitelma. Suunnitelman tavoitteena oli edistää tapahtuman kokonaisvaltaista onnistumista tehostetuilla ja tarkennetuilla markkinointitoimenpiteillä. Ensisijaisena tarkoituksenani oli sekä löytää uusia ja toimivia markkinointikäytäntöjä ja –malleja että kehittää ja vahvistaa jo käytössä olevia toimintoja. Toisena tavoitteenani oli tuottaa siirrettävissä oleva malli, jota voidaan käyttää varioiden muiden tapahtumien digitaalisen markki...

  17. Potilasohjauksen osaamisen johtaminen terveydenhuollossa : hoitotyön johtajien näkemyksiä

    OpenAIRE

    Lehtoranta, Marja

    2013-01-01

    Tutkimuksen tarkoituksena oli selvittää potilasohjauksen osaamisen johtamista käytännössä. Tutkimuksessa kuvattiin osaamisen johtamisesta erityisesti käytössä olevia potilasohjauksen rakenteita, käytäntöjä ja viestintää, potilasohjauksen osaamisen tunnistamista, kartoittamista ja mittaamista sekä osaamisen kehittämistä ja ylläpitämistä. Tutkimusaineisto kerättiin vuonna 2011 osana Keski-Suomen sairaanhoitopiirin Potilasohjaus vaikuttavaksi (PoiJu) –kehittämishanketta haastattelemalla 22 hoito...

  18. Projektioppaan suunnittelu ja toteutus : case: projektiopas Turun ammattikorkeakoulun opiskelijoille

    OpenAIRE

    Toivonen, Minna

    2010-01-01

    Tämän opinnäytetyön tavoitteena on tuottaa opiskelijoille projektiopas, johon voi turvautua käytännön työn rinnalla. Opas on kirjoitettu omien kokemusten perusteella opiskelijalta opiskelijalle. Työn on hyvin käytännönläheinen, vain yksittäisiä sanoja ja termejä teoreettisesti selitellen. Toimeksiantajana oli Osuuskunta Zemi Finlandin ohjaava opettaja Jaana Kallio-Gerlander, ensisijaisena tavoitteena oli saada opas auttamaan opiskelijoiden projektityöskentelyä. Prosessi oli hyvin käytännön...

  19. Solution matching for a three-point boundary-value problem on atime scale

    Directory of Open Access Journals (Sweden)

    Martin Eggensperger

    2004-07-01

    Full Text Available Let $mathbb{T}$ be a time scale such that $t_1, t_2, t_3 in mathbb{T}$. We show the existence of a unique solution for the three-point boundary value problem $$displaylines{ y^{DeltaDeltaDelta}(t = f(t, y(t, y^Delta(t, y^{DeltaDelta}(t, quad t in [t_1, t_3] cap mathbb{T},cr y(t_1 = y_1, quad y(t_2 = y_2, quad y(t_3 = y_3,. }$$ We do this by matching a solution to the first equation satisfying a two-point boundary conditions on $[t_1, t_2] cap mathbb{T}$ with a solution satisfying a two-point boundary conditions on $[t_2, t_3] cap mathbb{T}$.

  20. An invariance property of the common trends under linear transformations of the data

    DEFF Research Database (Denmark)

    Johansen, Søren; Juselius, Katarina

    It is well known that if X(t) is a nonstationary process and Y(t) is a linear function of X(t), then cointegration of Y(t) implies cointegration of X(t). We want to find an analogous result for common trends if X(t) is generated by a finite order VAR. We first show that Y(t) has an infinite order...... VAR representation in terms of its prediction errors, which are a linear process in the prediction error for X(t). We then apply this result to show that the limit of the common trends for Y(t) are linear functions of the common trends for X(t)....

  1. Genetics Home Reference: isobutyryl-CoA dehydrogenase deficiency

    Science.gov (United States)

    ... An Y, Weavil SD, Chaing SH, Bali D, McDonald MT, Kishnani PS, Chen YT, Millington DS. Rare ... 10 All Bulletins Features What is direct-to-consumer genetic testing? What are genome editing and CRISPR- ...

  2. Genetics Home Reference: short-chain acyl-CoA dehydrogenase deficiency

    Science.gov (United States)

    ... An Y, Weavil SD, Chaing SH, Bali D, McDonald MT, Kishnani PS, Chen YT, Millington DS. Rare ... 10 All Bulletins Features What is direct-to-consumer genetic testing? What are genome editing and CRISPR- ...

  3. Yoga for High‑Risk Pregnancy: A Randomized Controlled Trial

    African Journals Online (AJOL)

    assess yoga therapy (YT) module on maternal stress level in high risk pregnancy. .... i.e., 35 years, (6) BMI > 30, (7) family history (sister, ... neurosis, addictions, etc. ... 68 patients were allocated to two treatment groups: Yoga (n= 30),.

  4. IPv6:n käyttöönotto PK-yrityksessä

    OpenAIRE

    Salonen, Arttu Petteri

    2011-01-01

    Tämän opinnäytetyön tarkoituksena on selvittää, kuinka IPv6-yhteydet otetaan käyt-töön PK-yrityksessä. Työssä selvitetään minkälaiset vaatimukset IPv6 asettaa lait-teistolle ja minkälaisia käytännön asioita yrityksen täytyy huomioida IPv6:n käyt-töönotossa. Lisäksi työssä on laboratoriosimulaation avulla havainnollistettu eri käyt-töjärjestelmien tukea IPv6:lle ja käyttöönottoon liittyviä reititin- ja osoitekonfiguraati-oita. Käyttöönoton lisäksi opinnäytetyössä esitellään IPv6-protokoll...

  5. An Invariance Property of the Common Trends under Linear Transformations of the Data

    DEFF Research Database (Denmark)

    Johansen, Søren; Juselius, Katarina

    It is well known that if X(t) is a nonstationary process and Y(t) is a linear function of X(t), then cointegration of Y(t) implies cointegration of X(t). We want to find an analogous result for common trends if X(t) is generated by a finite order VAR. We first show that Y(t) has an infinite order...... VAR representation in terms of its prediction errors, which are a linear process in the prediction error for X(t). We then apply this result to show that the limit of the common trends for Y(t) are linear functions of the common trends for X(t). We illustrate the findings with a small analysis...... of the term structure of interest rates....

  6. Galactosemia

    Science.gov (United States)

    ... and Rector's The Kidney. 10th ed. Philadelphia, PA: Elsevier; 2016:chap 45. Broomfield A, Brain C, Grunewald S. ... Neurology in Clinical Practice. 7th ed. Philadelphia, PA: Elsevier; 2016:chap 91. Kishnani PS, Chen Y-T. ...

  7. Von Gierke disease

    Science.gov (United States)

    ... sugar test Genetic testing Lactic acid blood test Triglyceride level Uric acid blood test If a person ... 45. Kishnani PS, Chen Y-T. Defects in metabolism of carbohydrates. In: Kliegman RM, Stanton BF, St. ...

  8. Status review of the Marbled Murrelet (Brachyramphus marmoratus) in Alaska and British Columbia

    Science.gov (United States)

    Piatt, John F.; Kuletz, K.J.; Burger, A.E.; Hatch, Shyla A.; Friesen, Vicki L.; Birt, T.P.; Arimitsu, Mayumi L.; Drew, G.S.; Harding, A.M.A.; Bixler, K.S.

    2007-01-01

    have lost about 15 percent of their suitable nesting habitat in Southeast Alaska, and 33 to 49 percent in British Columbia, from industrial-scale logging within the past half century. Increased predation also may be a threat to murrelet populations, related to fragmentation and edge effects from logging and development, and recent population increases observed for some important murrelet predators, including Bald Eagles (Haliaeetus leucocephalus), Common Ravens (Corvus corax), and Steller?s Jays (Cyanocitta stelleri). Nesting habitat losses cannot explain the declines observed in areas where industrial logging has not occurred on a large scale (e.g., Prince William Sound) or at all (Glacier Bay). The apparent change in population size and rates of decline reported for the Marbled Murrelet are large, and we therefore considered alternative explanations and precedents for changes of similar magnitude in other marine wildlife populations in the Northeastern Pacific Ocean. The declines are likely real, and related to combined and cumulative effects from climate-related changes in the marine ecosystem (most likely the 1977 regime shift) and human activities (logging, gillnet bycatch, oil pollution). Much uncertainty about the decline could be alleviated by continuing to repeat boat surveys in Prince William Sound and lower Cook Inlet, and by repeating the boat survey of Southeast Alaska that was conducted in 1994. This survey used a statistically sound design and covered the region that has been and likely remains the center of the species? abundance. Important questions remain to be addressed about methods for measuring population status and change, adult mortality (major sources, density dependence, seasonal concordance), and the movements of wintering populations.

  9. Hyers-Ulam stability of linear second-order differential equations in complex Banach spaces

    Directory of Open Access Journals (Sweden)

    Yongjin Li

    2013-08-01

    Full Text Available We prove the Hyers-Ulam stability of linear second-order differential equations in complex Banach spaces. That is, if y is an approximate solution of the differential equation $y''+ alpha y'(t +eta y = 0$ or $y''+ alpha y'(t +eta y = f(t$, then there exists an exact solution of the differential equation near to y.

  10. Phenotypic Characterization of a Novel Virulence-Factor Deletion Strain of Burkholderia mallei that Provides Partial Protection against Inhalational Glanders in Mice

    Science.gov (United States)

    2016-02-26

    Fort Detrick, MD, USA, 2 Telemedicine and Advanced Technology Research Center, Biotechnology HPC Software Applications Institute, United States Army...allelic exchange mutants, we grew the Bm cointegrate strain in yeast- extract tryptone (YT) broth medium and then serially diluted it onto YT agar...indicated. Cells were fixed with 4% paraformaldehyde and then blocked in PBS containing 0.25% saponin , 0.2% Bovine Serum Albumin (BSA) fraction V

  11. Measuring the Non-Line-of-Sight Ultra-High-Frequency Channel in Mountainous Terrain: A Spread-Spectrum, Portable Channel Sounder

    Science.gov (United States)

    2018-03-01

    5), correlating each side of equation (3) with a transmit- ted signal, x [t], yields [] = ℎ[] ∗ []. (6) Here...i.e., input), x [t], and the complex-valued received signal (i.e., output), y[t], via the convolution function (Papazian and Lemmon 2011), which is...Rxy is the cross-correlation function of x [t] and y[t], and Rxx is the autocorrelation function of x [t]. The additive noise component is dropped

  12. Annealed asymptotics for the parabolic Anderson model with a moving catalyst

    NARCIS (Netherlands)

    Gärtner, J.; Heydenreich, M.O.

    2006-01-01

    This paper deals with the solution u to the parabolic Anderson equation ¿u/¿t=¿¿u+¿u on the lattice . We consider the case where the potential ¿ is time-dependent and has the form ¿(t,x)=d0(x-Yt) with Yt being a simple random walk with jump rate 2d. The solution u may be interpreted as the

  13. Food habits of bald eagles wintering in northern Arizona

    Science.gov (United States)

    Teryl G. Grubb; Roy G. Lopez

    2000-01-01

    We used pellets collected from roosts to supplement incidental foraging observations to identify prey species of Bald Eagles (Haliaeetus leucoughalus) and to evaluate spatial and temporal trends in their food habits while wintering in northern Arizona between 1994-96. We analyzed 1057 pellets collected from 14 roosts, and identified five mammal and...

  14. Final Supplemental Environmental Impact Statement for Airborne Laser Program at Kirtland AFB, White Sands Missile Range/ Holloman AFB, New Mexico; Edwards AFB, Vandenberg AFB, California

    Science.gov (United States)

    2003-06-01

    Sneed pincushion cactus T Kuen_zler hedgehog cactus - Sacramento oricklv ooppy - I Sacramento Mountains checkerspot - ! butterfly . . Federal Status E...caiifomicus Coho salmon ~_j_Pncorhynchus kisutch , Unarmoured three- spined 1 C~asterosleus aculeatus- ----: stickleback , wi/liamsoni 1 E T E...septentrionalis) Kuenzler hedgehog cachts (Echinocereus fendleri var. kuenzleri) THREATENED Bald eagle (Haliaeetus /.:ucocephalus) Mexican spotted owl (Strix

  15. Final Environmental Assessment for Wide Area Coverage Construct Land Mobile Network Communications Infrastructure Malmstrom Air Force Base, Montana

    Science.gov (United States)

    2008-02-01

    Comunication Site ...................................................................................................2-29 3-1 Pallid Sturgeon Habitat...and Endangered Species within the ROI Common Name Scientific Name Federal Status Fish Pallid Sturgeon Scaphirynchus albus E Birds Bald Eagle...listed in Table 1. 2 --’ Common Name Scientific Name Fish I Scaphirhynchus albus Haliaeetus leucoce halus Charadrius melodus m Grizzly Bear Ursus

  16. [A Survey for Colton and Other 3 Rare Blood Group Systems in Chinese Nanjing Han Population].

    Science.gov (United States)

    Chen, Yan; Ma, Ling; Liu, Yan-Chun

    2015-10-01

    To investigate the distribution of Colton, Diego, Kell and Yt rare blood groups in Chinese Nanjing Han population, so as to improve the transfusion capability of patients with rare blood group and to further enrich the rare-blood-donor bank. A total of 2 015 blood samples from the blood donors were selected randomly to screen the presence of K⁺ and Kp(c+) (Kell), Yt(b+) (Yt), Co(b+) (Colton), Di(a+b+) and Di(a+b-) (Digeo) antigen allele by using PCR and multiplex PCR. Out of 2005 samples, 1 case with K⁺ gene, 8 cases with Yt(b+) gene and 100 cases with Di(a+b+) gene, 2 cases with Di(a+b-) were identified, while no Kp(c+) and Co(b+) were detected. The frequencies of K⁺, Yt(b+) and Di(a+), Di(b+) are 0.0003, 0.0013 and 0.0258, 0.9742, respectively. They are very rare blood groups in Chinese Nanjing Han population.

  17. Karvian seurakunnan henkilöstötilinpäätös

    OpenAIRE

    Vaskela, Soila

    2008-01-01

    Tässä opinnäytetyössä tutkittiin yleisesti sekä käytännössä henkilöstötilinpäätöksen tarkoitusta ja sisältöä. Kohdeorganisaation eli Karvian seurakunnan avulla rakennettiin käytännön esimerkki seurakunnan ensimmäisestä henkilöstötilinpäätöksestä. Tutkimuksen tavoitteena oli löytää oikeat ratkaisut henkilöstötilinpäätöksen rakentamiseen organisaatiossa, jossa kyseinen asiakirja ei vielä ole tunnettu. Lisäksi tavoitteena oli laatia seurakunnalle käyttökelpoinen henkilöstötilinpäätösmalli, jota ...

  18. Preserved glucagon-like peptide-1 responses to oral glucose, but reduced incretin effect, insulin secretion and sensitivity in young Asians with type 2 diabetes mellitus

    DEFF Research Database (Denmark)

    Yeow, Toh Peng; Pacini, Giovanni; Tura, Andrea

    2017-01-01

    are scarce. We examined the insulin resistance, β-cell function (BC), glucagon-like peptide (GLP)-1 hormone and incretin effect in Asian YT2DM. RESEARCH DESIGN AND METHODS: This case-control study recruited 25 Asian YT2DM and 15 healthy controls, matched for gender, ethnicity and body mass index. Serum......OBJECTIVE: Youth onset type 2 diabetes mellitus (YT2DM) is a globally rising phenomenon with substantial Asians representation. The understanding of its pathophysiology is derived largely from studies in the obese African-American and Caucasian populations, while studies on incretin effect...... glucose, insulin, C peptide and GLP-1 were sampled during 2-hour oral glucose tolerance tests (OGTTs) and 1-hour intravenous glucose tolerance tests (IVGTTs). Insulin sensitivity was derived from the Quantitative Insulin Sensitivity Check Index (QUICKI), Oral Glucose Insulin Sensitivity Index (OGIS...

  19. Social CRM -kehitysprojekti

    OpenAIRE

    Pohjoismäki, Lauri

    2017-01-01

    Työn tavoitteena oli löytää ratkaisu digitaaliseen markkinointiin erikoistuneen yrityksen ongelmaan ajankäytöstä sosiaalisen median hallinnassa. Yrityksen nykyisellä asiakasmäärällä ei ole enää kannattavaa ajankäytännöllisesti hallita jokaista asiakasyrityksen sosiaalisen median tiliä erikseen, vaan niille on löydettävä keskitetty hallintaympäristö. Työssäni käsiteltiin erilaisia Social CRM -sovelluksia sekä pohdittiin niiden käyttöarvoa ja soveltuvuutta yrityksen käyttöön. Työ myös sivua...

  20. Habitat Requirements and Foraging Ecology of the Madagascar Fish-Eagle

    OpenAIRE

    Berkelman, James

    1997-01-01

    With a population estimate of 99 pairs, the Madagascar fish-eagle (Haliaeetus vociferoides) is one of the rarest birds of prey in the world. I investigated the ecological requirements of the Madagascar fish-eagle in 1994 and 1995 to help determine management action to prevent its extinction. I investigated fish-eagle foraging ecology in 1996 to determine its prey preference and whether fish abundance and availabi...

  1. Breeding of the White-Tailed Eagle in the Omsk Region, Russia

    Directory of Open Access Journals (Sweden)

    Boris Yu. Kassal

    2014-11-01

    Full Text Available The White-Tailed Eagle (Haliaeetus albicilla in the Omsk region prefers to breed within the Irtysh River floodplain and its tributaries, as well as along Rahtovo lake and large lake systems (Bolshie Krutinskie, Tyukalinskie, Ilyinskie. Its nests are built mainly on silver birch, aspen, Scots and Siberian pines, white willow and poplars, at a height of 6–15 m with zonal.

  2. Vesicle-associated membrane protein 7 (VAMP-7) is essential for target cell killing in a natural killer cell line

    International Nuclear Information System (INIS)

    Marcet-Palacios, Marcelo; Odemuyiwa, Solomon O.; Coughlin, Jason J.; Garofoli, Daniella; Ewen, Catherine; Davidson, Courtney E.; Ghaffari, Mazyar; Kane, Kevin P.; Lacy, Paige; Logan, Michael R.; Befus, A. Dean; Bleackley, R. Chris; Moqbel, Redwan

    2008-01-01

    Natural killer cells recognize and induce apoptosis in foreign, transformed or virus-infected cells through the release of perforin and granzymes from secretory lysosomes. Clinically, NK-cell mediated killing is a major limitation to successful allo- and xenotransplantation. The molecular mechanisms that regulate the fusion of granzyme B-containing secretory lysosomes to the plasma membrane in activated NK cells, prior to target cell killing, are not fully understood. Using the NK cell line YT-Indy as a model, we have investigated the expression of SNAP REceptors (SNAREs), both target (t-) and vesicular (v-) SNAREs, and their function in granzyme B-mediated target cell killing. Our data showed that YT-Indy cells express VAMP-7 and SNAP-23, but not VAMP-2. VAMP-7 was associated with granzyme B-containing lysosomal granules. Using VAMP-7 small interfering RNA (siRNA), we successfully knocked down the expression of VAMP-7 protein in YT-Indy to less than 10% of untreated cells in 24 h. VAMP7-deficient YT-Indy cells activated via co-culture with Jurkat cells released <1 ng/mL of granzyme B, compared to 1.5-2.5 μg/mL from controls. Using Jurkat cells as targets, we showed a 7-fold reduction in NK cell-mediated killing by VAMP-7 deficient YT-Indy cells. Our results show that VAMP-7 is a crucial component of granzyme B release and target cell killing in the NK cell line YT-Indy. Thus, targeting VAMP-7 expression specifically with siRNA, following transplantation, may be a viable strategy for preventing NK cell-mediated transplant rejection, in vivo

  3. Case VILA Clothes : Unelmasta toteutukseen

    OpenAIRE

    Vidgren, Petri; Virtanen, Suvi

    2007-01-01

    Työn tarkoituksena oli perehtyä franchising-toimintaan käytännön kokemuksen kautta. Näiden kokemusten kautta tutkittiin franchising-teoriaa suhteessa käytännön esimerkkiin. Työ on jatkossa hyödyksi toimeksiantajalle perustaessaan uusia franchising-liikkeitä. Työn toimeksiantajana toimi Stylehunter Oy Teoriaosassa tuotiin esille franchising-toiminnan eri muodot. Osiossa käsiteltiin myös franchisingterminologiaa, franchising-yrittäjyyden mahdollisuuksia ja riskejä, sopimuksia, koulutusjärjestel...

  4. Production of vanillin by metabolically engineered Escherichia coli.

    Science.gov (United States)

    Yoon, Sang-Hwal; Li, Cui; Kim, Ju-Eun; Lee, Sook-Hee; Yoon, Ji-Young; Choi, Myung-Suk; Seo, Weon-Taek; Yang, Jae-Kyung; Kim, Jae-Yeon; Kim, Seon-Won

    2005-11-01

    E. coli was metabolically engineered to produce vanillin by expression of the fcs and ech genes from Amycolatopsis sp. encoding feruloyl-CoA synthetase and enoyl-CoA hydratase/aldolase, respectively. Vanillin production was optimized by leaky expression of the genes, under the IPTG-inducible trc promoter, in complex 2YT medium. Supplementation with glucose, fructose, galactose, arabinose or glycerol severely decreased vanillin production. The highest vanillin production of 1.1 g l(-1) was obtained with cultivation for 48 h in 2YT medium with 0.2% (w/v) ferulate, without IPTG and no supplementation of carbon sources.

  5. The Utility of Handheld Programmable Calculators in Aircraft Life Cycle Cost Estimation.

    Science.gov (United States)

    1982-09-01

    YtX 95* 96 GTO 10 97.LBL 1 1 AFTERBURNER TURBOJET 98 "FMIL" 99 XEQ 02 100 STO 37 101 .96 102 YtX 103 64 68 104 * 105 " FMA ’-" 106 XEO 0l 107 RCL 37...3500 RU N AF 750=3,819 .126.892 RUN EN LR .9000 RU N FIIIL? 11,000.0000 RUN BPP ? 1.0000 R LIN FMAX? 19,000.0000 RUN PU 1000=1,29 4,040.200 RUN N

  6. Mainosideoista sähköisiin sisältöihin : sisältöstrategian merkitys mainostoimistojen digitaalisissa palveluissa

    OpenAIRE

    Pasanen, Riikka

    2012-01-01

    Sisältöstrategia on suunnittelukäytäntö, jonka tähtää liiketoiminnallisiin tavoitteisiin vaikuttavan verkkosisällön avulla. Tutkimuksessa tarkastellaan hyvän verkkosisällön kriteerejä ja pohditaan, voisiko mainostoimisto ottaa oppia sisältöstrategian käytännöistä ja tarjota sen avulla parempaa palvelua asiakkailleen. Tutkimusta varten on haastateltu neljää mainonnan strategisen suunnittelun ja asiakasjohdon ammattilaista, joiden näkemyksiä on peilattu tutkijan pitkään kokemukseen alalta sekä ...

  7. Suunnittelutiedon hallinta omaperusteisessa toimitilatuotannossa

    OpenAIRE

    Koljonen, Karoliina

    2013-01-01

    Tämän opinnäytetyön tavoitteena oli löytää keinoja suunnittelutiedon hallintaan omaperusteisissa toimitilakohteissa suunnittelu- ja toteutusvaiheen aikana. Työn tarkoituksena oli järjestelmällistää ja kehittää toimeksiantajan suunnittelunohjauskäytäntöjä. Työ on tehty perustajaurakoitsijan näkökulmasta ja opinnäytetyön aiheen on antanut YIT Rakennus Oy. Työssä tutustuttiin YIT:n tapaan rakentaa omaperusteisia toimistokohteita ja ohjata suunnitteluprosessia. Osana työtä tehtiin 15 haastatt...

  8. VAS-diagnostiikkatestereiden käyttö ajoneuvojen huolto- ja korjaustöissä

    OpenAIRE

    Pilvi, Juha

    2014-01-01

    Tämän insinöörityön aiheena on Volkswagen-konsernissa käytössä olevat VAS- diagnostiikkatesterit. Työssä tarkastellaan VAS-diagnostiikkatestereiden käyttöä ajoneuvojen huolto- ja korjaustoiminnassa. Pääpaino tulee olemaan päivittäisen korjaamotyöskentelyn kannalta olennaisimmissa toiminnoissa ja ominaisuuksissa. Työssä perehdytään myös diagnostiikkatestereiden historiaan ja ohjelmistojen tulevaisuuden näkymiin. Loppuosassa kuvataan kaksi käytännön vianhakua käyttäen VAS5051B- diagnostiikk...

  9. Full simulation study of the top Yukawa coupling at the ILC at $\\sqrt{s}$ = 1 TeV

    CERN Document Server

    Price, Tony; Strube, Jan; Tanabe, Tomohiko

    2015-01-01

    We present a study of the expected precision for measurement of the top Yukawa coupling, yt, in e+e- collisions at a center-of-mass energy of 1 TeV and assuming a beam polarization of P (e-, e+) = (-0.8,+0.2). Independent analyses of ttH final states containing at least six hadronic jets are performed, based on detailed simulations of SiD and ILD, the two candidate detector concepts for the ILC. We estimate that a statistical precision of yt of 4% can be obtained with an integrated luminosity of 1 $\\mathrm{ab}^{-1}$.

  10. Tervetuloa röntgenosastolle Varkauteen : Röntgenhoitajaopiskelijoiden perehdytysopas

    OpenAIRE

    Koivunen, Sanna; Mäkelä, Laura

    2013-01-01

    Opinnäytetyönä tuotettiin röntgenhoitajaopiskelijoille perehdytysmateriaali Varkauden sairaalan röntgenosastolle. Työn tarkoituksena oli tehdä käytännön harjoitteluun tuleville röntgenhoitajaopiskelijoille perehdytysopas ja tutkimushuonekohtaiset perehdytyslomakkeet. Tavoitteena oli auttaa röntgenhoitajaopiskelijoita perehtymään työyksikköön ja kehittää käytännön harjoittelua. Perehdyttämismateriaalin ansiosta osastolla työskentelevä henkilökunta ja opiskelijat saavat yhteiset toimintata...

  11. "Äiti, sä oot niin paras äiti" : - Ihmeelliset vuodet - ryhmän vaikutus vanhemmuustaitoihin

    OpenAIRE

    Pylkkönen, Taru

    2011-01-01

    ”Äiti, sä oot niin paras äiti”: Ihmeelliset vuodet – ryhmän vaikutus vanhempien vanhem-muustaitoihin Vuosi 2011 Sivumäärä 51+ 12 Opinnäytetyön tarkoituksena oli selvittää miten Ihmeelliset vuodet koulussa – projektin yhteydessä toiminut vanhemmuusryhmä vaikutti siihen osallistuvien vanhempien vanhemmuustaitoihin. Ihmeelliset vuodet – ohjelman vanhemmuusryhmät ovat käytöshäiriöisten lasten vanhemmille suunnattuja perheinterventioita, joissa lasten käytökseen pyr...

  12. Hevostalouden pesuvesien laatu ja soveltuvat puhdistusmenetelmät

    OpenAIRE

    Loisa, Leena

    2010-01-01

    Hevostalous on Suomessa muuttunut merkittävästi viimeisten vuosikymmenien aikana. Hevosten käyttö on muuttunut työhevoskäytöstä urheilu- ja vapaa-ajankäytöksi ja uusia hevosharrastusmuotoja kehitetään jatkuvasti. Näin ollen hevostallien lukumäärä ja myös niiden tuottamat jätevesimäärät ovat jatkuvassa kasvussa. Vuoden 2004 alussa voimaan tullut Valtioneuvoston asetus 542/2003 talousjätevesien käsittelystä vesihuoltolaitosten viemäriverkostojen ulkopuolisilla alueilla edellyttää saostuskaivokä...

  13. Kitaristin vasen käsi

    OpenAIRE

    Lindsberg, Maija

    2015-01-01

    Tässä opinnäytetyössä käsitellään klassisen kitaristin vasemman käden tekniikkaa. Aluksi esitellään kitaransoiton perusteita ja tekniikoita, jonka jälkeen annetaan kappalekohtaisia esimerkkejä niiden käytöstä. Tutkimuksen alla olevat kappaleet on valittu sen perusteella, että soitan ne B-tutkinto-ohjelmassani. Kiinnostuksen kohteena ovat erityisesti kohdat, jotka itse olen kokenut hankaliksi tai mielenkiintoisiksi vasemman käden osalta. Pyrin löytämään ratkaisuja ongelmiin ja lisäämään tietoi...

  14. Development of tungsten coatings for the corrosion protection of alumina-based ceramics

    International Nuclear Information System (INIS)

    Arons, R.M.; Dusek, J.T.; Hafstrom, J.W.

    1979-01-01

    A means of applying tungsten coatings to an alumina based ceramic is described. A slurry of pure tungsten was prepared and applied by brush coating or slip casting on the alumina-3 wt % Yt small crucible. The composite was fired and a very dense ceramic crucible with a crack free tungsten coating was produced

  15. Determination of antidepressant activity of Cyperus rotundus L ...

    African Journals Online (AJOL)

    Tropical Journal of Pharmaceutical Research April 2017; 16 (4): 867-871 ... 1Shandong University School of Medicine, Jinan, 250012, 2Department of Psychology, People's Hospital of Linyi City, Linyi,. 276003 ..... Academic Press, 1977: 692-698. 8. Porsolt RD, Bertin A ... Lim DW, Jung JW, Park JH, Baek NI, Kim YT, Kim IH,.

  16. Development of a New Class of Drugs to Inhibit All Forms of Androgen Receptor in Castration Resistant Prostate Cancers

    Science.gov (United States)

    2016-10-01

    titration methods (protein in the syringe, ligand in the cell), we were able to obtain a reproducible thermogram for the ligand binding reaction...to VPC-14449 as a model drug to assist on other related projects. 1. Tam, K., Dalal, K., Hsing, M., Cheng, C.W., Chiang, Y.T., Sharma, A., Peacock

  17. Rare earth oxyhydrides and preparation process

    International Nuclear Information System (INIS)

    Diaz, H.

    1986-01-01

    Rare earth oxyhydrides of formula RE 1-q Th q Ni 5-p M p O x H y are claimed. RE is a rare earth, Th can be replaced by Yt, M is Cu, Mn, Al, Fe, Cr or Co, o O C and the hydrides are oxidized. They are catalysts for various chemical reactions [fr

  18. Social media and scientific research are complementary-YouTube and shrikes as a case study.

    Science.gov (United States)

    Dylewski, Łukasz; Mikula, Peter; Tryjanowski, Piotr; Morelli, Federico; Yosef, Reuven

    2017-06-01

    Fascination with animals and their behaviour is one the most prominent patterns persisting in all human cultures. During the last decades, however, technological development and public access to the Internet have increased the speed and the extent of information sharing at an unprecedented rate, in some cases even challenging the traditional methods used in science. In order to understand the extent of this influence, we focused on the behaviour of shrikes. Shrikes are an enigmatic group of songbirds with a unique behaviour of impaling prey. We employed an extensive Internet search on YouTube (YT), a very popular and increasingly important source of information worldwide, for videos recording shrikes. Our analyses revealed that the number of shrike videos on YT is strongly positively correlated with classical knowledge on shrikes from books and scientific articles. Our results also suggest that in some cases YT may provide an alternative source of information on shrike ecology and behaviour. YT videos may thus provide new insights into the study of certain species or subjects and help identify gaps in ecological studies, especially in poorly studied species.

  19. Plastid DNA analysis reveals cryptic hybridization in invasive dalmatian toadflax populations

    Science.gov (United States)

    Andrew Boswell; Sharlene E. Sing; Sarah M. Ward

    2016-01-01

    Gene flow between Dalmatian toadflax (DT) and yellow toadflax (YT), both aggressive invaders throughout the Intermountain West, is creating hybrid populations potentially more invasive than either parent species. To determine the direction of gene flow in these hybrid populations, species-diagnostic cytoplasmic markers were developed. Markers were based on...

  20. Improvements in medium range weather forecasting system of India

    Indian Academy of Sciences (India)

    system is based on the latest Grid Statistical Interpolation (GSI) scheme and it has the provision to use most of .... ified Simplified-Arakawa Scheme (SAS) (Han and. Pan 2010). ..... Kim Y-J and Arakawa A 1995 Improvement of orographic gravity wave ... Yang F, Mitchell K, Hou Y-T, Dai Y, Deng X, Wang Z and. Liang X-Z ...

  1. The Dickey-Fuller test for exponential random walks

    NARCIS (Netherlands)

    Davies, P.L.; Krämer, W.

    2003-01-01

    A common test in econometrics is the Dickey–Fuller test, which is based on the test statistic . We investigate the behavior of the test statistic if the data yt are given by an exponential random walk exp(Zt) where Zt = Zt-1 + [sigma][epsilon]t and the [epsilon]t are independent and identically

  2. Flexure of Thick Plates Resting on Elastic Foundation Using Two-Variable Refined Plate Theory

    Directory of Open Access Journals (Sweden)

    Rouzegar Jafar

    2015-06-01

    Full Text Available Wpublikacji wykorzystano udoskonalona teorie płyty z dwiema zmiennymi do analizy grubych płyt spoczywajacych na sprezystym podłozu. Teoria ta, która zawiera tylko dwa nieznane parametry, pozwala przewidziec paraboliczna zmiennosc naprezen scinajacych. W teorii jest spełniony warunek zerowej trakcji na powierzchni płyty bez uzycia współczynnika korekcyjnego dla scinania. Stosujac zasade minimum energii potencjalnej wyprowadzono równania rzadzace dla płyt prostokatnych o prostym podparciu spoczywajacych na sprezystym podłozu Winklera. Do rozwiazania otrzymanego układu równan sprzezonych zaadoptowano metode Naviera. Obecna teoria pozwoliła rozwiazac szereg przykładowych problemów płyt przy róznych warunkach obciazenia. Porównanie otrzymanych rezultatów z uzyskanymi w innych znanych teoriach wykazuje doskonala efektywnosc stosowanej teorii w modelowaniu grubych płyt spoczywajacych na podłozu sprezystym. Przestudiowano takze wpływ modułu sprezystosci podłoza, grubosci płyty i typu obciazenia. Wyniki pokazuja, ze ugiecia płyty maleja przy wzroscie modułu sprezystosci podłoza i grubosci płyty

  3. A block Krylov subspace time-exact solution method for linear ordinary differential equation systems

    NARCIS (Netherlands)

    Bochev, Mikhail A.

    2013-01-01

    We propose a time-exact Krylov-subspace-based method for solving linear ordinary differential equation systems of the form $y'=-Ay+g(t)$ and $y"=-Ay+g(t)$, where $y(t)$ is the unknown function. The method consists of two stages. The first stage is an accurate piecewise polynomial approximation of

  4. Genetic diversity and germplasm resource research on tung tree ...

    African Journals Online (AJOL)

    SERVER

    2008-04-17

    Apr 17, 2008 ... a 2720 Thermal Cycler under the following cycle profile: 5 min at. 94oC ; followed by 45 cycles of 45 s at 94oC , 1 min at annealing temperature (Ta, depend on primers used, Table 2), .... chrome b5 to Either Endoplasmic Reticulum or Mitochondria. Plant. Cell. 16: 3002-3019. Henderson MP, Hwang YT, ...

  5. Deconvoluting preferences and errors: a model for binomial panel data

    DEFF Research Database (Denmark)

    Fosgerau, Mogens; Nielsen, Søren Feodor

    2010-01-01

    In many stated choice experiments researchers observe the random variables Vt, Xt, and Yt = 1{U + δxs22A4Xt + εt

  6. Superhero Comics and the Popular Geopolitics of American Identity

    OpenAIRE

    MIETTINEN, MERVI

    2011-01-01

    Englantilaisen filologian oppialaan kuuluvassa lisensiaatintutkielmassani erittelen ja analysoin supersankarisarjakuvien roolia Yhdysvaltojen populaarisen geopoliittisen identiteetin rakentumisessa. Tutkimuksessani keskityn etenkin siihen, miten supersankarisarjakuvien kautta muodostuva populaari kansallinen identiteetti tarkemmin analysoituna paljastaa useita ristiriitoja supersankarin edustamien kansallisten ihanteiden ja hahmon käytännön toimien välillä. Yhdeksi keskeisimmistä ristiriidois...

  7. Study of the $H \\rightarrow b\\bar{b}$ in association with a single top quark

    CERN Document Server

    AUTHOR|(CDS)2266532

    2017-01-01

    The production of the Higgs boson in association with a single top quark. $tH$ is a very important process for testing the Standard Model theory. There are three production channels: associated production with $W$, t-channel and s-channel. In this study only $tHq$ production with $H\\rightarrow b\\bar{b}$ decay and top leptonic decay has been generated and analyzed. The $tH$ production is important for probing the sign of the Higgs-top Yukawa coupling, $y_{t}$. Namely, there is an interference between diagrams which depends on the relative sign of $y_{t}$. LO Madgraph is used as a tool for generating events, calculating the cross-sections and Feynmann diagrams. The cross-section is parameterized as a continuous function of $y_{t}$. The kinematics of the process appears to be dependent on the $y_{t}$ used. In addition, the dominant background from $t\\bar{t}$ production with heavy flavor jets has been generated and potential discriminating variables to separate $tH$ from this background have been analyzed and dis...

  8. East African Medical Journal

    African Journals Online (AJOL)

    2002-07-01

    Jul 1, 2002 ... PREVALENCE OF VITAMIN A DEFICIENCY AMONG PRE-SCHOOL AND SCHOOL-AGED CHILDREN IN ARSSI ZONE. ETHIOPIA. YT Asrat, BSc. MSc ... in the “low” range (<20ttl/dl) in 51% of the children. Conclusion: The results ... of Arssi zone Dodotana Sire district was selected at random for this study.

  9. On norm equivalence between the displacement and velocity vectors for free linear dynamical systems

    Directory of Open Access Journals (Sweden)

    Ludwig Kohaupt

    2015-12-01

    Full Text Available As the main new result, under certain hypotheses, for free vibration problems, the norm equivalence of the displacement vector $ y(t $ and the velocity vector $ \\dot{y}(t $ is proven. The pertinent inequalities are applied to derive some two-sided bounds on $ y(t $ and $ \\dot{y}(t $ that are known so far only for the state vector $ x(t=[y^T(t, \\dot{y}^T(t]^T $. Sufficient algebraic conditions are given such that norm equivalence between $ y(t $ and $ \\dot{y}(t $ holds, respectively, does not hold, as the case may be. Numerical examples illustrate the results for vibration problems of n degrees of freedom with $ n \\in \\{ 1, 2, 3, 4, 5 \\} $ by computing the mentioned algebraic conditions and by plotting the graphs of $ y(t $ and $ \\dot{y}(t $. Some notations and definitions of References Kohaupt (2008b, 2011 are necessary and are therefore recapitulated. The paper is of interest to Mathematicians and Engineers.

  10. Report of Accomplishments under the Airport Improvement Program.

    Science.gov (United States)

    1983-09-30

    0) RUNLWAYMLhy>, FRIEDMAN MEMORIA :. ACCESLS WAY :fHppjV’EMO;:tr, * (COMMERCIAL, HAIILEY U.. 43t, 1% ISCELLAINiAUS SA!L: :v -YT;;:- FRIEDMAN MEMORIA ...airport no. funds Description of work K= 5 0 I S (CONTINUED) CHAMPAIGN/ URBANA 02 $ 423,364 TAXIWAY IMPROVEMEN’:’S; A’WVESS WAY UNIVERSITY OF CONSTRUCTION

  11. Journal of Applied Sciences and Environmental Management - Vol ...

    African Journals Online (AJOL)

    Variability with depth of some physico-chemical and biological parameters of Atlantic Ocean water in part of the coastal area of Nigeria · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. YT Puyate, A Rim-Rukeh. http://dx.doi.org/10.4314/jasem.v12i1.55578 ...

  12. Journal of Applied Sciences and Environmental Management - Vol ...

    African Journals Online (AJOL)

    Some physico-chemical and biological characteristics of soil and water samples of part of the Niger Delta area, Nigeria · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. YT Puyate, A Rim-Rukeh. http://dx.doi.org/10.4314/jasem.v12i2.55551 ...

  13. Thermal evolution of the Kramer radiating star

    Indian Academy of Sciences (India)

    as pressure anisotropy, shear, heat flow and bulk viscosity. The study of .... where m(v) is the Newtonian mass of the star as measured by an observer at infinity. The junction .... Adiabatic index ( = (dp/dρ)) as a function of y(t). of collapse ...

  14. A randomised controlled trial of adjunctive yoga and adjunctive physical exercise training for cognitive dysfunction in schizophrenia.

    Science.gov (United States)

    Bhatia, Triptish; Mazumdar, Sati; Wood, Joel; He, Fanyin; Gur, Raquel E; Gur, Ruben C; Nimgaonkar, Vishwajit L; Deshpande, Smita N

    2017-04-01

    Yoga and physical exercise have been used as adjunctive intervention for cognitive dysfunction in schizophrenia (SZ), but controlled comparisons are lacking. Aims A single-blind randomised controlled trial was designed to evaluate whether yoga training or physical exercise training enhance cognitive functions in SZ, based on a prior pilot study. Consenting, clinically stable, adult outpatients with SZ (n=286) completed baseline assessments and were randomised to treatment as usual (TAU), supervised yoga training with TAU (YT) or supervised physical exercise training with TAU (PE). Based on the pilot study, the primary outcome measure was speed index for the cognitive domain of 'attention' in the Penn computerised neurocognitive battery. Using mixed models and contrasts, cognitive functions at baseline, 21 days (end of training), 3 and 6 months post-training were evaluated with intention-to-treat paradigm. Speed index of attention domain in the YT group showed greater improvement than PE at 6 months follow-up (pattention domain showed greater improvement than TAU alone at 6-month follow-up (pattention and additional cognitive domains well past the training period, supporting our prior reported beneficial effect of YT on speed index of attention domain. As adjuncts, YT or PE can benefit individuals with SZ.

  15. Yoga Therapy for Abdominal Pain-Related Functional Gastrointestinal Disorders in Children: A Randomized Controlled Trial

    NARCIS (Netherlands)

    Korterink, Judith J.; Ockeloen, Lize E.; Hilbink, Mirrian; Benninga, Marc A.; Deckers-Kocken, Judith M.

    2016-01-01

    The aim of the present study was to compare effects of 10 weeks of yoga therapy (YT) and standard medical care (SMC) on abdominal pain and quality of life (QoL) in children with abdominal pain-related functional gastrointestinal disorders (AP-FGIDs). Sixty-nine patients, ages 8 to 18 years, with

  16. The effectiveness of different instruction methods for risk and safety management in relation to medical profession and seniority

    NARCIS (Netherlands)

    Navot Pikkel, Dvora

    2017-01-01

    The study, which was guided by Prof.dr J.b. Rijsman as promotor and by Dr. Y.T. Tal as co- promotor, was a comparative interventional study that was designed to evaluate the effectiveness of different teaching & educational strategies of risk management and patient's safety in medicine. Eventually,

  17. Remote Patient Management in a Mammographic Screening Environment in Underserved Areas

    Science.gov (United States)

    2005-09-01

    of 4,945 paired examinations. Radiology 2001; 218:873-880. 10. Malich A, Marx C, Facius M, Boehm T, Fleck M, Kaiser WA. Tumour 24. Venta LA, Hendrick...218:873-880. KF, Sickles EA. Mammographic character- factor determining the quality of com- 15. Venta LA, Hendrick RE, Adler YT, et al. iSicks of 115

  18. Chromosome Banding in Amphibia. XXXVI. Multimorphic Sex Chromosomes and an Enigmatic Sex Determination in Eleutherodactylus johnstonei (Anura, Eleutherodactylidae).

    Science.gov (United States)

    Schmid, Michael; Steinlein, Claus

    2018-01-01

    A detailed cytogenetic study on the leaf litter frog Eleutherodactylus johnstonei from 14 different Caribbean islands and the mainlands of Venezuela and Guyana revealed the existence of multimorphic XY♂/XX♀ sex chromosomes 14. Their male sex determination and development depends either on the presence of 2 telocentric chromosomes 14 (XtYt), or on 1 submetacentric chromosome 14 (Xsm) plus 1 telocentric chromosome 14 (Yt), or on the presence of 2 submetacentric chromosomes 14 (XsmYsm). The female sex determination and development requires either the presence of 2 telocentric chromosomes 14 (XtXt) or 2 submetacentric chromosomes 14 (XsmXsm). In all individuals analyzed, the sex chromosomes 14 carry a prominent nucleolus organizer region in their long arms. An explanation is given for the origin of the (XtYt)♂, (XsmYt)♂, (XsmYsm)♂, (XtXt)♀, and (XsmXsm)♀ in the different populations of E. johnstonei. Furthermore, the present study gives detailed data on the chromosome banding patterns, in situ hybridization experiments, and the genome size of E. johnstonei. © 2018 S. Karger AG, Basel.

  19. Forenkling av tekniske systemer

    DEFF Research Database (Denmark)

    Førland-Larsen, Arne; Bramslev, Katharina; Halderaker, Ingrid

    De fleste moderne kontorbygg har omfattende tekniske installasjoner. Mange byggeiere opplever at dagens kompliserte tekniske anlegg ikke fungerer som de skal. De ender med å få reklamasjoner, høyt energiforbruk og klager på inneklima. Kan en kraftig forenkling av ventilasjons-, oppvarmings- og...

  20. Social media and scientific research are complementary—YouTube and shrikes as a case study

    Science.gov (United States)

    Dylewski, Łukasz; Mikula, Peter; Tryjanowski, Piotr; Morelli, Federico; Yosef, Reuven

    2017-06-01

    Fascination with animals and their behaviour is one the most prominent patterns persisting in all human cultures. During the last decades, however, technological development and public access to the Internet have increased the speed and the extent of information sharing at an unprecedented rate, in some cases even challenging the traditional methods used in science. In order to understand the extent of this influence, we focused on the behaviour of shrikes. Shrikes are an enigmatic group of songbirds with a unique behaviour of impaling prey. We employed an extensive Internet search on YouTube (YT), a very popular and increasingly important source of information worldwide, for videos recording shrikes. Our analyses revealed that the number of shrike videos on YT is strongly positively correlated with classical knowledge on shrikes from books and scientific articles. Our results also suggest that in some cases YT may provide an alternative source of information on shrike ecology and behaviour. YT videos may thus provide new insights into the study of certain species or subjects and help identify gaps in ecological studies, especially in poorly studied species.

  1. Composting of food and yard wastes by locally isolated fungal strains

    African Journals Online (AJOL)

    GREGORY

    2011-12-16

    Dec 16, 2011 ... 74% total organic matter (TOM), 7.2 pH and 132% germination index (GI) further showed the potentials of the produced compost. Based on this, food waste (FW) and yard trimmings (YT) showed an economic potential for sustainable production of compost using low technology. Key words: Lignocellulolytic ...

  2. Two distinct affinity binding sites for IL-1 on human cell lines

    International Nuclear Information System (INIS)

    Bensimon, C.; Wakasugi, N.; Tagaya, Y.; Takakura, K.; Yodoi, J.; Tursz, T.; Wakasugi, H.

    1989-01-01

    We used two human cell lines, NK-like YT-C3 and an EBV-containing B cell line, 3B6, as models to study the receptor(s) for IL-1. Two distinct types of saturable binding sites were found on both cell lines at 37 degrees C. Between 1 pM and 100 pM of 125I-IL-1-alpha concentration, saturable binding sites were detected on the YT-C3 cells with a K of 4 x 10(-11) M. The K found for the IL-1-alpha binding sites on 3B6 cells was 7.5 x 10(-11) M. An additional binding curve was detected above 100 pM on YT-C3 cells with a K of 7 x 10(-9) M and on 3B6 cells with a K of 5 x 10(-9) M. Scatchard plot analysis revealed 600 sites/cell with high affinity binding and 7000 sites/cell with low affinity for YT-C3 cells and 300 sites/cell with high affinity binding and 6000 sites/cell with low affinity for 3B6 cells. At 37 degrees C, the internalization of 125I-labeled IL-1 occurred via both high and low affinity IL-1R on both YT-C3 and 3B6 cells, whereas the rates of internalization for high affinity binding sites on YT-C3 cells were predominant in comparison to that of low affinity binding sites. In chemical cross-linking studies of 125 I-IL-1-alpha to 3B6 and YT-C3 cells, two protein bands were immunoprecipitated with Mr around 85 to 90 kDa leading to an estimation of the Mr of the IL-1R around 68 to 72 kDa. In similar experiments, the Mr found for the IL-1R expressed on the murine T cell line EL4 was slightly higher (around 80 kDa). Whether these distinct affinity binding sites are shared by a single molecule or by various chains remains to be elucidated

  3. Effects of Resistance Training on Matrix Metalloproteinase Activity in Skeletal Muscles and Blood Circulation During Aging

    Directory of Open Access Journals (Sweden)

    Ivo V. de Sousa Neto

    2018-03-01

    Full Text Available Aging is a complex, multifactorial process characterized by the accumulation of deleterious effects, including biochemical adaptations of the extracellular matrix (ECM. The purpose of this study was to investigate the effects of 12 weeks of resistance training (RT on metalloproteinase 2 (MMP-2 activity in skeletal muscles and, MMP-2 and MMP-9 activity in the blood circulation of young and old rats. Twenty-eight Wistar rats were randomly divided into four groups (n = 7 per group: young sedentary (YS; young trained (YT, old sedentary (OS, and old trained (OT. The stair climbing RT consisted of one training session every 2 other day, with 8–12 dynamic movements per climb. The animals were euthanized 48 h after the end of the experimental period. MMP-2 and MMP-9 activity was measured by zymography. There was higher active MMP-2 activity in the lateral gastrocnemius and flexor digitorum profundus muscles in the OT group when compared to the OS, YS, and YT groups (p ≤ 0.001. Moreover, there was higher active MMP-2 activity in the medial gastrocnemius muscle in the OT group when compared to the YS and YT groups (p ≤ 0.001. The YS group presented lower active MMP-2 activity in the soleus muscle than the YT, OS, OT groups (p ≤ 0.001. With respect to active MMP-2/9 activity in the bloodstream, the OT group displayed significantly reduced activity (p ≤ 0.001 when compared to YS and YT groups. In conclusion, RT up-regulates MMP-2 activity in aging muscles, while down-regulating MMP-2 and MMP-9 in the blood circulation, suggesting that it may be a useful tool for the maintenance of ECM remodeling.

  4. Davis Pond freshwater prediversion biomonitoring study: freshwater fisheries and eagles

    Science.gov (United States)

    Jenkins, Jill A.; Bourgeois, E. Beth; Jeske, Clint W.

    2008-01-01

    In January 2001, the construction of the Davis Pond freshwater diversion structure was completed by the U.S. Army Corps of Engineers. The diversion of freshwater from the Mississippi River is intended to mitigate saltwater intrusion from the Gulf of Mexico and to lessen the concomitant loss of wetland areas. In addition to the freshwater inflow, Barataria Bay basin would receive nutrients, increased flows of sediments, and water-borne and sediment-bound compounds. The purpose of this biomonitoring study was, therefore, to serve as a baseline for prediversion concentrations of selected contaminants in bald eagle (Haliaeetus leucocephalus) nestlings (hereafter referred to as eaglets), representative freshwater fish, and bivalves. Samples were collected from January through June 2001. Two similarly designed postdiversion studies, as described in the biological monitoring program, are planned. Active bald eagle nests targeted for sampling eaglet blood (n = 6) were generally located southwest and south of the diversion structure. The designated sites for aquatic animal sampling were at Lake Salvador, at Lake Cataouatche, at Bayou Couba, and along the Mississippi River. Aquatic animals representative of eagle prey were collected. Fish were from three different trophic levels and have varying feeding strategies and life histories. These included herbivorous striped mullet (Mugil cephalus), omnivorous blue catfish (Ictalurus furcatus), and carnivorous largemouth bass (Micropterus salmoides). Three individuals per species were collected at each of the four sampling sites. Freshwater Atlantic rangia clams (Rangia cuneata) were collected at the downstream marsh sites, and zebra mussels (Dreissena spp.) were collected on the Mississippi River. The U.S. Geological Survey (USGS) Biomonitoring of Environmental Status and Trends (BEST) protocols served as guides for fish sampling and health assessments. Fish are useful for monitoring aquatic ecosystems because they accumulate

  5. High-sensitivity C-reactive protein does not improve the differential diagnosis of HNF1A-MODY and familial young-onset type 2 diabetes: A grey zone analysis.

    Science.gov (United States)

    Bellanné-Chantelot, C; Coste, J; Ciangura, C; Fonfrède, M; Saint-Martin, C; Bouché, C; Sonnet, E; Valéro, R; Lévy, D-J; Dubois-Laforgue, D; Timsit, J

    2016-02-01

    Low plasma levels of high-sensitivity C-reactive protein (hs-CRP) have been suggested to differentiate hepatocyte nuclear factor 1 alpha-maturity-onset diabetes of the young (HNF1A-MODY) from type 2 diabetes (T2D). Yet, differential diagnosis of HNF1A-MODY and familial young-onset type 2 diabetes (F-YT2D) remains a difficult challenge. Thus, this study assessed the added value of hs-CRP to distinguish between the two conditions. This prospective multicentre study included 143 HNF1A-MODY patients, 310 patients with a clinical history suggestive of HNF1A-MODY, but not confirmed genetically (F-YT2D), and 215 patients with T2D. The ability of models, including clinical characteristics and hs-CRP to predict HNF1A-MODY was analyzed, using the area of the receiver operating characteristic (AUROC) curve, and a grey zone approach was used to evaluate these models in clinical practice. Median hs-CRP values were lower in HNF1A-MODY (0.25mg/L) than in F-YT2D (1.14mg/L) and T2D (1.70mg/L) patients. Clinical parameters were sufficient to differentiate HNF1A-MODY from classical T2D (AUROC: 0.99). AUROC analyses to distinguish HNF1A-MODY from F-YT2D were 0.82 for clinical features and 0.87 after including hs-CRP. For the grey zone analysis, the lower boundary was set to missMODY with F-YT2D, 65% of patients were classified in between these categories - in the zone of diagnostic uncertainty - even after adding hs-CRP to clinical parameters. hs-CRP does not improve the differential diagnosis of HNF1A-MODY and F-YT2D. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

  6. Venäläinen tytäryritys suomalaisessa konsernitilinpäätöksessä - Case Inlook Oy

    OpenAIRE

    Romanova, Julia

    2009-01-01

    Työn keskeisin käsite on konsernin tilinpäätöstietojen yhdisteleminen ja tilinpäätöskäytäntö. Tilinpäätöskäytäntö voidaankin ajatella taloudellisen kommunikoinnin välineenä – taloudelli-sena kielenä. Kielen tehtävänä on kiteyttää informaatio tai ajatukset merkkeihin, jotka ym-märretään tietyssä kirjanpitoympäristössä samalla tavalla. Ongelmana on se, että taloudelli-nen kieli sisältää paljon kulttuurille ominaisia asioita, mikä tekee jokaisesta eri kirjanpitoym-päristön taloudellisesta kieles...

  7. The multiplicity dependence of inclusive pt spectra from p-p collisions at sqrt s = 200 GeV

    International Nuclear Information System (INIS)

    Adams, J.; Aggarwal, M.M.; Ahammed, Z.; Amonett, J.; Anderson, B.D.; Anderson, M.; Arkhipkin, D.; Averichev, G.S.; Bai, Y.; Balewski, J.; Barannikova, O.; Barnby, L.S.; Baudot, J.; Bekele, S.; Belaga, V.V.; Bellingeri-Laurikainen, A.; Bellwied, R.; Benedosso, F.; Bhardwaj, S.; Bhasin, A.; Bhati, A.K.; Bichsel, H.; Bielcik, J.; Bielcikova, J.; Bland, L.C.; Blyth, S.-L.; Bonner, B.E.; Botje, M.; Bouchet, J.; Brandin, A.V.; Bravar, A.; Bystersky, M.; Cadman, R.V.; Cai, X.Z.; Caines, H.; Calderonde la Barca Sanchez, M.; Castillo, J.; Catu, O.; Cebra, D.; Chajecki, Z.; Chaloupka, P.; Chattopadhyay, S.; Chen, H.F.; Chen, J.H.; Cheng, J.; Cherney, M.; Chikanian, A.; Christie, W.; Coffin, J.P.; Cormier, T.M.; Cosentino, M.R.; Cramer, J.G.; Crawford, H.J.; Das, D.; Das, S.; Daugherity, M.; de Moura, M.M.; Dedovich, T.G.; DePhillips, M.; Derevschikov, A.A.; Didenko, L.; Dietel, T.; Djawotho, P.; Dogra, S.M.; Dong, W.J.; Dong, X.; Draper, J.E.; Du, F.; Dunin, V.B.; Dunlop, J.C.; Dutta Mazumdar, M.R.; Eckardt, V.; Edwards, W.R.; Efimov, L.G.; Emelianov, V.; Engelage, J.; Eppley, G.; Erazmus, B.; Estienne, M.; Fachini, P.; Fatemi, R.; Fedorisin, J.; Filimonov, K.; Filip, P.; Finch, E.; Fine, V.; Fisyak, Y.; Fu, J.; Gagliardi, C.A.; Gaillard, L.; Ganti, M.S.; Ghazikhanian, V.; Ghosh, P.; Gonzalez, J.S.; Gorbunov, Y.G.; Gos, H.; Grebenyuk, O.; Grosnick, D.; Guertin, S.M.; Guimaraes, K.S.F.F.; Guo, Y.; Gupta, N.; Gutierrez, T.D.; Haag, B.; Hallman, T.J.; Hamed, A.; Harris, J.W.; He, W.; Heinz, M.; Henry, T.W.; Hepplemann, S.; Hippolyte, B.; Hirsch, A.; Hjort, E.; Hoffman, A.M.; Hoffmann, G.W.; Horner, M.J.; Huang, H.Z.; Huang, S.L.; Hughes, E.W.; Humanic, T.J.; Igo, G.; Jacobs, P.; Jacobs, W.W.; Jakl, P.; Jia, F.; Jiang, H.; Jones, P.G.; Judd, E.G.; Kabana, S.; Kang, K.; Kapitan, J.; Kaplan, M.; Keane, D.; Kechechyan, A.; Khodyrev, V.Yu.; Kim, B.C.; Kiryluk, J.; Kisiel, A.; Kislov, E.M.; Klein, S.R.; Kocoloski, A.; Koetke, D.D.; Kollegger, T.

    2006-01-01

    We report measurements of transverse momentum pt spectra for ten event multiplicity classes of p-p collisions at sqrt s = 200$ GeV. By analyzing the multiplicity dependence we find that the spectrum shape can be decomposed into a part with amplitude proportional to multiplicity and described by a Levy distribution on transverse mass mt, and a part with amplitude proportional to multiplicity squared and described by a gaussian distribution on transverse rapidity yt. The functional forms of the two parts are nearly independent of event multiplicity. The two parts can be identified with the soft and hard components of a two-component model of p-p collisions. This analysis then provides the first isolation of the hard component of the pt spectrum as a distribution of simple form on yt

  8. Reality-tv leikkaajan silmin

    OpenAIRE

    Hietaniemi, Tommi

    2012-01-01

    Opinnäytetyössäni tutkin 2000-luvulla television ohjelmatarjonnan vallannutta realitya, myös tosi-tv:ksi kutsuttua ohjelmagenreä leikkaajan näkökulmasta. Käytännön esimerkkeinä ja laajan aiheen rajaajana käytän leikkaamiani televisiosarjoja Iceblock, Linnan tähdet sekä Supermarjo ja tytöt. Miten leikkaajan työnkuva erottuu erityyppisissä projekteissa ja erikokoisissa työryhmissä? Tai sisällöllisesti, mitkä seikat leikkaajan on hyvä ottaa huomioon realitya rakentaessa? In my thesis I a...

  9. The cointegrated vector autoregressive model with general deterministic terms

    DEFF Research Database (Denmark)

    Johansen, Søren; Nielsen, Morten Ørregaard

    2017-01-01

    In the cointegrated vector autoregression (CVAR) literature, deterministic terms have until now been analyzed on a case-by-case, or as-needed basis. We give a comprehensive unified treatment of deterministic terms in the additive model X(t)=Z(t) Y(t), where Z(t) belongs to a large class...... of deterministic regressors and Y(t) is a zero-mean CVAR. We suggest an extended model that can be estimated by reduced rank regression and give a condition for when the additive and extended models are asymptotically equivalent, as well as an algorithm for deriving the additive model parameters from the extended...... model parameters. We derive asymptotic properties of the maximum likelihood estimators and discuss tests for rank and tests on the deterministic terms. In particular, we give conditions under which the estimators are asymptotically (mixed) Gaussian, such that associated tests are X 2 -distributed....

  10. The cointegrated vector autoregressive model with general deterministic terms

    DEFF Research Database (Denmark)

    Johansen, Søren; Nielsen, Morten Ørregaard

    In the cointegrated vector autoregression (CVAR) literature, deterministic terms have until now been analyzed on a case-by-case, or as-needed basis. We give a comprehensive unified treatment of deterministic terms in the additive model X(t)= Z(t) + Y(t), where Z(t) belongs to a large class...... of deterministic regressors and Y(t) is a zero-mean CVAR. We suggest an extended model that can be estimated by reduced rank regression and give a condition for when the additive and extended models are asymptotically equivalent, as well as an algorithm for deriving the additive model parameters from the extended...... model parameters. We derive asymptotic properties of the maximum likelihood estimators and discuss tests for rank and tests on the deterministic terms. In particular, we give conditions under which the estimators are asymptotically (mixed) Gaussian, such that associated tests are khi squared distributed....

  11. CRM-järjestelmän käytettävyystutkimus

    OpenAIRE

    Paavilainen, Mikko

    2015-01-01

    Opinnäytetyön aiheena oli käytettävyys ja käytettävyystutkimus. Opinnäytetyö sisältää käytettävyyden perusteita ja käytettävyystestin suunnittelua, toteutusta ja tuloksia. Käytettävyystesti koskee CGI:n CRM-järjestelmän projektin luonti ja hallintatoimintoja. Nalli CRM–järjestelmä on yrityksellä käytössä oleva asiakkuuksienhallintajärjestelmä. Käytettävyystutkimuksen tavoitteena oli löytää käytettävyysongelmia ja kehittää ratkaisuja niiden korjaamiseksi. Käytettävyystestiin osallistui järjest...

  12. Liikkuva kuva ja ääni digitaalisessa sarjakuvassa : säilyttäen sarjakuvamainen pysähtynyt hetki

    OpenAIRE

    Veijalainen, Roni

    2013-01-01

    Tarkastelen digitaalisuuden tuomia mahdollisuuksia elävöittää sarjakuvaa, sekä käyn läpi sarjakuvan ominaispiirteitä. Keskityn nimenomaan pohtimaan vaihtoehtoehtoja elävöittää digitaalista sarjakuvaa liikkuvilla elementeillä ja äänellä. Haluan löytää vaihtoehtoja käyttää näitä tehosteita siten, että tunne pysähtyneestä hetkestä säilyisi. Tarkastelen myös internetin avulla löytämiäni erilaisia digitaalisia sarjakuvia, joissa on käytetty digitaalisuuden mahdollistamia tehosteita. Tulen miet...

  13. Linear Pursuit Differential Game under Phase Constraint on the State of Evader

    Directory of Open Access Journals (Sweden)

    Askar Rakhmanov

    2016-01-01

    Full Text Available We consider a linear pursuit differential game of one pursuer and one evader. Controls of the pursuer and evader are subjected to integral and geometric constraints, respectively. In addition, phase constraint is imposed on the state of evader, whereas pursuer moves throughout the space. We say that pursuit is completed, if inclusion y(t1-x(t1∈M is satisfied at some t1>0, where x(t and y(t are states of pursuer and evader, respectively, and M is terminal set. Conditions of completion of pursuit in the game from all initial points of players are obtained. Strategy of the pursuer is constructed so that the phase vector of the pursuer first is brought to a given set, and then pursuit is completed.

  14. Oscillation of two-dimensional linear second-order differential systems

    International Nuclear Information System (INIS)

    Kwong, M.K.; Kaper, H.G.

    1985-01-01

    This article is concerned with the oscillatory behavior at infinity of the solution y: [a, ∞) → R 2 of a system of two second-order differential equations, y''(t) + Q(t) y(t) = 0, t epsilon[a, ∞); Q is a continuous matrix-valued function on [a, ∞) whose values are real symmetric matrices of order 2. It is shown that the solution is oscillatory at infinity if the largest eigenvalue of the matrix integral/sub a//sup t/ Q(s) ds tends to infinity as t → ∞. This proves a conjecture of D. Hinton and R.T. Lewis for the two-dimensional case. Furthermore, it is shown that considerably weaker forms of the condition still suffice for oscillatory behavior at infinity. 7 references

  15. Musiikki muistisairaan vanhuksen hyvinvoinnin edistäjänä : Hoitonetti

    OpenAIRE

    Haapamäki, Tiina

    2013-01-01

    Iäkkäämpien ikäryhmien osuuden kasvaessa myös muistisairauksia sairastavien määrä moninkertaistuu. Muistisairaudet ovat isoin riskitekijä, joka johtaa iäkkään ihmisen pois kodistaan ympärivuorokautiseen hoitopaikkaan. Muistisairauksiin liittyvät käytösoireet heikentävät elämänlaatua ja lisäävät palvelujen tarvetta. Ne ovat myös merkittävin pitkäaikaishoidon alkamisen syy. Muistisairauksien aiheuttamia käytösoireita voidaan lievittää lääkehoidolla. Toisin kuin muistisairaan lääkehoitoon, musii...

  16. Päihteitä käyttävä nainen ja raskaus : kirjallisuuskatsaus

    OpenAIRE

    Sainio, Marianna; Simula, Sonja

    2017-01-01

    Naisten päihteiden kulutus on kasvanut Suomessa viime vuosikymmeninä ja tästä johtuen myös raskaana olevien naisten päihteiden käyttö on ajankohtainen ongelma. Tämän opinnäytetyön tarkoituksena oli käsitellä päihteiden käytön vaikutuksia sikiöön ja vastasyntyneeseen lapseen. Tavoitteena oli tuoda esiin raskaana olevan päihteitä käyttävän naisen hoidollisia erityispiirteitä sekä nostaa esille raskaudenaikaisen päihteiden käytön riskejä. Opinnäytetyö toteutettiin kirjallisuuskatsauksena. Tu...

  17. Keskihurun tilan uudelleenkäynnistäminen

    OpenAIRE

    Leiviskä, Jaakko

    2014-01-01

    Tämän opinnäytetyön tarkoituksena oli tutkia Keskihurun maatilan, eli kotitilani uudelleenkäynnistämisen toteutuksen kannattavuutta ja pellonkäyttövaihtoehtoja. Tilan päätuotantosuunnaksi on kaavailtu mansikanviljelyä. Tämän osalta työssä tutkittiin viljelyn toteuttamisvaihtoehtoja, viljelykierron järjestämistä sekä välikasvien viljelyä. Toinen päätarkoitus oli löytää mansikanviljelyn ulkopuolelle jääville pelloille taloudellisesti ja työajankäytön kannalta järkevin vaihtoehto. Työn tavoi...

  18. Hoitajien kokemuksia Theraplay-ryhmäsovelluksesta lastenpsykiatrisessa hoitotyössä

    OpenAIRE

    Manninen, Niina; Ollikainen, Laura

    2011-01-01

    Tämän opinnäytetyön tarkoituksena oli selvittää hoitajien kokemuksia ja ajatuksia Theraplay-ryhmäsovelluksesta lastenpsykiatrisessa hoitotyössä sekä kartoittaa hoitajien mielipiteitä mahdollisesta tanssin ja musiikin käytöstä osana tätä sovellusta. Opinnäytetyön tehtävänä oli selvittää millaisia kokemuksia hoitajilla on Theraplay-ryhmäsovelluksesta, mitä ajatuksia mahdollinen musiikin ja tanssin käyttö osana Theraplay-ryhmäsovellusta herättää sekä mitä kehitettävää tämän sovelluksen käytössä ...

  19. Työn ja vapaa-ajan tasapaino

    OpenAIRE

    Yoshida, Teemu

    2013-01-01

    Tämän opinnäytetyön aiheena oli työn ja vapaa-ajan tasapainon hallinta. Työssä paneuduttiin työn ja vapaa-ajan tasapainon määrittelyn vaikeuteen sekä tasapainon löytämisen mukanaan tuomiin hyötyihin. Tavoitteena oli selvittää, mitkä tekijät vaikuttavat työntekijän elämän tasapainoon. Tutkimus on rajattu organisaation näkökulmasta niihin tunnusmerkkeihin ja käytäntöihin, jotka määrittelevät perheystävällisen organisaatiokulttuurin unohtamatta kuitenkaan yksineläviä työntekijöitä. Työntekijän ...

  20. Työskentely Norjassa : maassa työskennelleiden kokemuksia

    OpenAIRE

    Mäkäläinen, Teressa

    2013-01-01

    Tämän opinnäytetyön tarkoituksena oli antaa käytännönläheistä tietoa Norjaan muuttamisesta, työnhausta ja muista asuinmaan vaihdossa huomioon otettavista asioista, kuten verotuksesta ja sosiaaliturvasta, elinkustannuksista, asunnon hankinnasta ja käytännön elämästä. Opinnäytetyö on tarkoitettu avuksi kaikille Norjaan töihin lähteville tai sitä suunnitteleville. Tarkoituksena on tutustuttaa lukija Norjan työelämään ja maahanmuuttoa koskeviin säännöksiin, sekä auttaa Suomesta muuttamisen järjes...

  1. Determining the Critical Point of a Sigmoidal Curve via its Fourier Transform

    International Nuclear Information System (INIS)

    Bilge, Ayse Humeyra; Ozdemir, Yunus

    2016-01-01

    A sigmoidal curve y(t) is a monotone increasing curve such that all derivatives vanish at infinity. Let t_n be the point where the nth derivative of y(t) reaches its global extremum. In the previous work on sol-gel transition modelled by the Susceptible-Infected- Recovered (SIR) system, we observed that the sequence { t_n } seemed to converge to a point that agrees qualitatively with the location of the gel point [2]. In the present work we outline a proof that for sigmoidal curves satisfying fairly general assumptions on their Fourier transform, the sequence { t_n } is convergent and we call it “the critical point of the sigmoidal curve”. In the context of phase transitions, the limit point is interpreted as a junction point of two different regimes where all derivatives undergo their highest rate of change. (paper)

  2. Pk-yrityksen aggressiivinen verosuunnittelu

    OpenAIRE

    Koivisto, Milla

    2015-01-01

    Opinnäytetyössä tarkastellaan pienten ja keskisuurten yritysten ja näiden yrittäjäomistajien verotusta ja sen suunnittelua. Työn tarkoituksena ja tärkeimpänä tavoitteena pidetään aggressiivisen verosuunnittelun keinojen pohdintaa sekä tulkitsemista erityisesti osakeyhtiö-muotoisten yritysten kannalta. Ensin selvitetään yleisesti verotuskäytäntöjä sekä eri yritysmuotojen verotuksellista eroavaisuutta. Tämän jälkeen käsitellään varsinaisen verosuunnittelun teoreettista pohjaa sekä käytäntö...

  3. Quantum influence in the criticality of the spin- {1}/{2} anisotropic Heisenberg model

    Science.gov (United States)

    Ricardo de Sousa, J.; Araújo, Ijanílio G.

    1999-07-01

    We study the spin- {1}/{2} anisotropic Heisenberg antiferromagnetic model using the effective field renormalization group (EFRG) approach. The EFRG method is illustrated by employing approximations in which clusters with one ( N'=1) and two ( N=2) spins are used. The dependence of the critical temperature Tc (ferromagnetic-F case) and TN (antiferromagnetic-AF case) and thermal critical exponent, Yt, are obtained as a function of anisotropy parameter ( Δ) on a simple cubic lattice. We find that, in our results, TN is higher than Tc for the quantum anisotropic Heisenberg limit and TN= Tc for the Ising and quantum XY limits. We have also shown that the thermal critical exponent Yt for the isotropic Heisenberg model shows a small dependence on the type of interaction (F or AF) due to finite size effects.

  4. Physiological Plausibility and Boundary Conditions of Theories of Risk Sensitivity

    DEFF Research Database (Denmark)

    Marchiori, Davide; Elqayam, Shira

    2012-01-01

    dilatation, which in turn positively correlates with a risk aversion behavior. They hypothesize that participants’ attention is increased in decision problems involving losses, which trigger an innate prudent behavior in situations entailing danger and/or hazard. Interestingly, Y&T find that the nature...... of attention is not selective, i.e., when losses are present, participants are shown to devote more attention to the task as a whole rather than to the single negative outcomes, in contrast to Prospect Theory's loss aversion....... and physiological underpinnings of one of the central topics in judgment and decision-making (JDM) research – choice behavior in decisions from experience. Y&T successfully contributes to this goal by demonstrating a novel effect that losses increase experimental participants’ arousal as measured by pupil...

  5. Millaisia TVT-taitoja on valmistuvilla aineenopettajilla

    OpenAIRE

    Kolu, Mika

    2012-01-01

    Tässä pro gradu -tutkielmassa tutkitaan, millaisia TVT-taitoja on Jyväskylän yliopistosta valmistuvilla aineenopettajilla. Lisäksi selvitetään millainen merkitys TVT:lla on yhteiskunnassa ja opetuskäytössä yleisesti. Toisessa luvussa kerrotaan miten Opetushallitus ja -ministeriö on määritellyt TVT:n tavoitetilan yhteiskunnassa, ja sen hyödyntämisen opetuksessa. Samalla käydään läpi eri kuntien käytänteitä TVT:n käyttöönotossa. Kolmannessa luvussa selvitetään millaisia opettajien TVT-taitoja o...

  6. Selvitys HR House Oy:n vuokratyöntekijöiden työtyytyväisyydestä

    OpenAIRE

    Kaskela, Leeni

    2011-01-01

    Opinnäytetyön tarkoituksena oli selvittää HR House Oy:n palveluksessa olevien vuokratyöntekijöiden työtyytyväisyyteen vaikuttavia asioita. Opinnäytetyö on laadullinen tutkielma, jossa käytän tutkimusmenetelmänä teemahaastattelua. Tutkimuskysymykseni selvittävät, mitkä asiat vaikuttavat työntekijöiden työ- tyytyväisyyteen ja mitä he kertovat työtyytyväisyyteen vaikuttavista tekijöistä. Toimeksianto opinnäytetyön tekemiseen on tullut HR House Oy Henkilöstöpalveluilta. Tavoitteena oli löytää kei...

  7. Tietoa kosketuksen päässä : NFC-teknologia innovatiivisten käyttötapausten kautta

    OpenAIRE

    Toivanen, Sanna

    2012-01-01

    Opinnäytetyöni tutkii vähittäiskauppaa, NFC-teknologiaa, sekä innovointia prosessien kautta käytäntöön. Tavoitteena oli löytää uusia ideoita NFC-teknologian käyttöön, pää-asiassa vähittäiskauppakontekstissa. Työn tutkimuksellinen osuus koostuu tutkimus-haastatteluista, innovaatiotyöpajoista, sekä kirjallisuuskatsauksesta edellä mainittuihin aiheisiin liittyen. NFC tulee sanoista Near Field Communication ja suomeksi se on kääntynyt lähitunnis-tamiseksi tai lähitunnistusteknologiaksi. NFC-t...

  8. Urkintalaki

    OpenAIRE

    Kivioja, Elina

    2010-01-01

    Tämän opinnäytetyön tavoite on antaa kattava kuva siitä, millä keinoilla työnantaja voi lukea työntekijöidensä sähköpostiviestejä, valvoa Internetin ja intranetin käyttöä työpaikoilla, ja näin estää yrityssalaisuuksiensa oikeudettomat paljastumiset ja tietoverkon väärinkäytökset. Tietoverkon väärinkäytösten osalta työni perustuu pääasiassa sähköisen viestinnän tietosuojalain säännöksiin ja lain esitöihin. Työnantajan oikeuksien osalta hakea esille ja lukea työntekijöiden sähköpostiviestejä pe...

  9. Autokorikorjaamon perustaminen

    OpenAIRE

    Ronkainen, Tapio

    2017-01-01

    Tässä opinnäytetyössä suunnitellaan autokorikorjaamon perustamista kirjoittajan kotipaikkakunnalle Kuusamoon. Työssä kuvataan korikorjaamon perustamistoimenpiteitä ja suunnittelua teoriassa sekä sovellettuna perustettavaan korikorjaamoon. Käytännön tavoitteena on oman korikorjaamon suunnittelu ja toteutus sekä yrityksen liiketoiminnan aloittaminen ja ennen kaikkea kannattavan liiketoiminnan pyörittäminen. Aluksi yritykselle täytyy valita paras sekä toimivin yritysmuoto. Seuraavaksi tar...

  10. Numerical Electromagnetic Code (NEC)-Basic Scattering Code. Part 2. Code Manual

    Science.gov (United States)

    1979-09-01

    imaging of source axes for magnetic source. Ax R VSOURC(1,1) + 9 VSOURC(1,2) + T VSOURC(1,3) 4pi = x VIMAG(I,1) + ^ VINAG (1,2)+ VIMAG(l,3) An =unit...VNC A. yt and z components of the end cap unit normal OUTPUT VARIABLE VINAG X.. Y, and z components defining thesource image coordinate system axesin

  11. Algevekstpotensialmålinger i Hoffselva og Mærradalsbekken, mars 1986

    OpenAIRE

    Källqvist, T.

    1986-01-01

    Algevekstpotensialet i vannprøver fra forskjellige stasjoner i vassdragene ble undersøkt med og uten tilsetning av vekstmedium. I Hoffselva var vekstpotensialet lavt på de øverste stasjonene, men økte til et maksimum ved Nedre Smestaddam. Veksthemning ble påvist i Skådalsbekken, men vannet var ikke toksisk overfor vannlopper. I Mærradalsbekken var vekstpotensialet meget høyt. Oslo kommune

  12. Autoteippaus

    OpenAIRE

    Tanskanen, Joonas

    2013-01-01

    Insinöörityö tehtiin Metropolia Ammattikorkeakoululle, ja työn tarkoituksena oli tutustua autoteippaamiseen sekä pohtia autoteippauksen harjoittelun soveltuvuutta yhdeksi mediatekniikan käytännön opetustunnin aiheeksi. Autoteippi on polyvinyylikloridista eli PVC:stä valmistettu joustava muovikalvo, jossa on akryyliliimapinta toisella puolella. Teippikalvon raaka-aineena käytettävä muovi pehmennetetään pehmittimillä, esimerkiksi ftalaateilla, ennen kuin siitä valmistetaan puhaltamalla, v...

  13. Multiple Microcomputer Control Algorithm.

    Science.gov (United States)

    1979-09-01

    3350 ; 3360 SYT4 EOU 63101000 1 INSTRUCTION TYPE OF LONOWORD. 3370 I4 EOU 68001000 1 NOT LONGWORD. 3330 8 3390 9YT8 EOU 63101001 a INSTRUCTION TYPE OF...8217000GC ’)00O00O00000OOAz4.itE000 ALU PEG . DST.. DST .AODR.FLu. RO.DC2&RO*SHFYO FLAGS CONY ADFC ALU.REG. ..OSTADDaS. FLO -LIRD. CZERO. SNTO FLAGS fXPCD

  14. Energy requirements for growth in the Yorkshire terrier.

    Science.gov (United States)

    Alexander, Janet E; Colyer, Alison; Morris, Penelope J

    2017-01-01

    The 2006 National Research Council (NRC) equation calculating puppy energy requirements does not account for reported breed differences in growth pattern. Energy requirements of toy breed puppies are unknown and it is unclear whether feeding guidelines should differ between breeds. Energy requirements of Yorkshire terrier (YT) puppies were observed over their first year of life and compared with those predicted by the NRC and those previously observed in large (Labrador retriever) and medium (miniature Schnauzer; MS) breed puppies. Twenty-two puppies (from eight litters) were offered complete and balanced diets to maintain ideal body condition score (BCS). Energy intake, body weight and BCS were recorded from 10 to 52 weeks of age. Every 12 weeks, health was monitored by veterinary examination, routine haematology and plasma biochemistry. Puppies remained clinically healthy with normal skeletal development throughout. After analysis by linear mixed models it was observed that the NRC equation overestimates YT energy requirements between 10 and 20 weeks of age by up to 324·3 (95 % CI 390·4, 258·2) kJ/kg 0·75 . Energy intake was lower ( P  < 0·05) in YT than Labradors until 29 weeks by up to 376·6 (95 % CI 477·4, 275·3) kJ/kg 0·75 and lower than MS between 16 and 25 weeks by up to 216·3 (95 % CI 313·0, 119·7) kJ/kg 0·75 ( P  < 0·05). Data indicate differences in toy, medium and large breed energy requirements for growth. The NRC equation for puppy energy requirements overestimated the requirements of this YT population, suggesting the need for breed-specific feeding guides for growth to avoid overfeeding.

  15. Some Econometric Results for the Blanchard-Watson Bubble Model

    DEFF Research Database (Denmark)

    Johansen, Soren; Lange, Theis

    The purpose of the present paper is to analyse a simple bubble model suggested by Blanchard and Watson. The model is defined by y(t) =s(t)¿y(t-1)+e(t), t=1,…,n, where s(t) is an i.i.d. binary variable with p=P(s(t)=1), independent of e(t) i.i.d. with mean zero and finite variance. We take ¿>1 so...

  16. Asiakastyytyväisyystutkimus : Case: Lady Line Kirkkonummi

    OpenAIRE

    Leppänen, Pauliina; Hartikainen, Sanna

    2011-01-01

    Aidosti asiakaslähtöinen yritys ymmärtää asiakkaidensa arvon ja merkityksen yrityksen liiketoiminnan perustana. Asiakkaan ehdoilla toimiva yritys pystyy täten saavuttamaan vahvaa kilpailuetua alan muihin toimijoihin nähden. Asiakastyytyväisyystutkimukset tarjoavat yrityksille toimialasta riippumatta arvokasta tietoa asiakkaan tarpeiden, käyt-täytymismallien ja mielipiteiden analysoimiseksi. Asiakastyytyväisyystutkimuksen vaati-mat ajalliset ja taloudelliset resurssit pystytään saamaan moninke...

  17. Proceedings of the Discussion Meeting on Thermodynamics of Alloys Held in Barcelona, Spain on 23-26 May 1999. Series B. Volume 86

    Science.gov (United States)

    1990-05-01

    V.T.K., Schubert K (1967): energye agency). Zeitsch. Metallk., 58, 558. - Meschter P.J., Worrel W.L.(1977): - Colinet C., Pasturel A., Hicter P...expressions. One Gibbs phase rail , reason why the sublattice model is not used more frequently is that it may not be obvious how to The G;ibbs energy in...from the mathematical surface. This dual representation allows efficiency of file storage y-t highly precise representations for display and combined

  18. Kuljetuskustannusten vertailu vientitoimituksissa Ruotsista Venäjälle : case: Yritys X, lohituotteet

    OpenAIRE

    Manner, Tatjana

    2013-01-01

    Tämä opinnäytetyö käsittelee kuljetuskustannusten vertailua vientitoimituksissa Ruotsista Venäjälle. Työn tarkoituksena on löytää case-yritykselle edulliset huolitsijat autokuljetuksin ja ovelta ovelle -lentokuljetuksin vietäviin lohituotteiden toimituksiin. Tutkimuksen osatavoitteena on kuvailla vientiin tarvittavia kuljetusasiakirjoja ja selvittää asiakirjojen laadinnasta aiheutuvia kustannuksia. Työn teoreettisessa osuudessa käsitellään logistiikkapalvelujen hankintaa, huolintaliikkeit...

  19. Chaotic time series prediction: From one to another

    International Nuclear Information System (INIS)

    Zhao Pengfei; Xing Lei; Yu Jun

    2009-01-01

    In this Letter, a new local linear prediction model is proposed to predict a chaotic time series of a component x(t) by using the chaotic time series of another component y(t) in the same system with x(t). Our approach is based on the phase space reconstruction coming from the Takens embedding theorem. To illustrate our results, we present an example of Lorenz system and compare with the performance of the original local linear prediction model.

  20. Digitaalisen markkinoinnin suunnitelma

    OpenAIRE

    Peura, Mikko

    2014-01-01

    Opinnäytetyön tarkoituksena oli perehtyä digitaalisen markkinoinnin kanaviin, sekä markkinointiviestintään ja toteuttaa elokuvateatteri Y-kinon markkinointiviestintäsuunnitelma digitaalisen markkinoinnin kanaville. Elokuvateatterin liiketoiminnasta on vuodesta 2012 alkaen vastannut IPE Oy. Y-kino pyrkii laajentamaan elokuvateatterin palvelutuotevalikoimaa, esimerkkinä yksityisnäytökset ja suorat lähetykset. Teoria osuudessa haluttiin selvittää markkinointiviestinnän suunniteluun vaadittav...

  1. Joulumarkkinoinnin suunnittelu : Ravintola.fi-mobiiliapplikaatio

    OpenAIRE

    Kinnunen, Sarita

    2013-01-01

    Opinnäytetyön aiheena oli Ravintola.fi-mobiiliapplikaation joulumarkkinointikampanjan suunnittelu. Kampanjan tarkoituksena oli kasvattaa mobiiliapplikaation latausmääriä. Kohdeyritys Restamax julkaisi kanta-asiakkailleen tarkoitetun Ravintola.fi-mobiiliapplikaation keväällä 2013. Opinnäytteen teoriaosassa perehdytään markkinoinnin suunnitteluun ja digitaalisen markkinoinnin eri osa-alueisiin, erityisesti mobiilimarkkinointiin sekä yrityksen käyt-tämiin sosiaalisen median muotoihin. Markki...

  2. PARAMETER IDENTIFICATION AND STOCHASTIC CONTROL ...

    African Journals Online (AJOL)

    parameta identification examples treated in PART I. OPTIMAL PREDICTION. As aJ.ady discussed in PART I, a discrete linear system cm be modeled by the polynomial. A(z-1)y., = z°""B(z-1)ut + C(z-1)wt (15) where Yt is the output seq~. u the control. ""'l'mcc. IOl:l ~a 2m>-lDC8ll white process noise with variance q. dis the ...

  3. Laser Resurfacing

    OpenAIRE

    Janik, Joseph P.; Markus, Jodi L.; Al-Dujaili, Zeena; Markus, Ramsey F.

    2007-01-01

    In a society desiring images of beauty and youthfulness, the world of cutaneous surgery offers the gifts of facial rejuvenation for those determined to combat the signs of aging. With the development of novel laser and plasma technology, pigmentary changes, scarring, and wrinkles can be conquered providing smoother, healthier, younger-looking skin. This review highlights five of the most popular resurfacing technologies in practice today including the carbon dioxide (CO2) laser, the erbium:yt...

  4. Toimintaterapeuttinen nukkekoti CP-vammaisille lapsille

    OpenAIRE

    Ruotsalainen, Ulla; Tokola, Eveliina

    2009-01-01

    Toiminnallisen opinnäytetyön tarkoitus oli suunnitella ja rakentaa toimintaterapeuttinen nukkekoti CP-vammaisille lapsille. Työn toimeksiantajana oli toimintaterapeutti Päivi Raitanen Terapiapajalta. Työn tavoitteena oli toteuttaa mukana kuljetettava ja lapsen pyörätuolin pöytälevylle sopiva nukkekoti, jolla leikkiminen tukee CP-vammaisen lapsen toimintaterapiaa. Yleisimpiä tavoitteita ovat muun muuassa hienomotoristen taitojen, leikkitaitojen, syy-seuraussuhteiden ja visuaalisen hahmott...

  5. USSR Report, Military Affairs, No. 1711.

    Science.gov (United States)

    1982-10-05

    Meet iqmortantlYt that they becose real personsi, that they’ learn to love work and that they wol4 be able to look anyone straiqht in the ee gut don’t... human quality we call purposefulness. were is another passage from a letter written by the commander of the unit in which Vladivlav serves: *Be likes...replenish them, to ensure compliance with sanitary norma in shelters, to conduct current disinfection of buildings and to render first aid to shelter

  6. Myyntistrategian laatiminen tietoliikennesegmentille

    OpenAIRE

    Moilanen, Tomi

    2015-01-01

    Opinnäytetyön tavoitteena oli laatia yrityksen tietoliikennetoiminnan myyntistrategia vuodelle 2015. Strategian laadinnan kannalta oleellista oli selvittää yrityksen myyntiprosessin tekijät ja myyntiprosessin vaiheet. Lisäksi tunnistettiin myyntiprosessimallit ja selvitettiin myynnin johdon merkitys myyntitiimin osana. Tietoperustan ja käytännön tiedon avulla laadittiin tietoliikennesegmentin myyntistrategia. Myyntistrategian laatimisessa oleellista oli tunnistaa yrityksen toimintaympäris...

  7. Markkinointi murroksessa: Mistä on toimiva Facebook-markkinointi tehty? : Case: Infokone Oy

    OpenAIRE

    Korhonen, Taneli

    2010-01-01

    Opinnäytetyön tavoitteena oli kartoittaa Facebook-markkinoinnin toimivia käytänteitä B2B-yritykselle. Tutkimuksessa saatuja tuloksia on tarkoitus käyttää apuna toimeksiantaja Infokone Oy:n Facebook-strategian suunnittelussa. Käytetty tutkimusote oli kvalitatiivinen eli laadullinen tutkimus ja tutkimusmenetelmä teemahaastattelu. Tutkimukseen haastateltiin syys–lokakuussa 2010 kolmea B2B-yrityksen edustajaa, jotka olivat olleet mukana toteuttamassa edustamansa yrityksen Facebook-markkinoint...

  8. Perehdyttämisopas turvallisuuteen Break Sokos Hotel Edenin vastaanottoon

    OpenAIRE

    Rosenström, Nina-Maria

    2014-01-01

    Opinnäytetyön tavoitteena oli tuottaa perehdyttämisopas turvallisuuteen Break Sokos Hotel Edenin vastaanottoon. Tarkoituksena oli luoda käytännöllinen ja mahdollisimman kattava apuväline perehdyttämiseen ja tukemaan vastaanoton henkilökuntaa turvallisuustietoisessa työskentelyssä. Tarkoituksena oli koota hotellin turvallisuuteen oleellisesti liittyvä tietous eri kansioista ja paikoista yhteen konkreettiseen kansioon. Lisäksi oppaan laatimisessa pyrittiin saamaan hotellin turvallisuuteen liitt...

  9. Postoperatiivisen tetraplegiapotilaan asento-hoito Töölön sairaalan Traumatologisella Teho- ja Tehostetun valvonnan osastolla – Ohjeistus uusille sairaanhoitajille ja opiskelijoille

    OpenAIRE

    Suominen, Terhi; Pyrhönen, Niina

    2011-01-01

    Postoperatiivisen tetraplegiapotilaan asentohoito Töölön sairaalan Traumatologisella Teho- ja Tehostetun valvonnan osastolla – ohjeistus uusille sairaanhoitajille ja opiskelijoille Tämä projektiraportti on osa Laurea-ammattikorkeakoulun sekä Helsingin ja Uudenmaan sai-raanhoitopiirin (HUS) Helsingin yliopistollisen keskussairaalan (HYKS) operatiivisen tulosyksikön laadunkehittämishanketta. Hoitotyönlaadun kehittämishanke sijoittuu vuosille 2007–2012. Hankkeen pyrkimyksenä on parantaa näyt...

  10. Kohti palveluliiketoimintaa, palvelumuotoilulla palvelua teollisuusyritykselle. : Tapaus KiiltoClean Oy

    OpenAIRE

    Turpeinen, Pekka

    2017-01-01

    Suuret muutokset maailmassa vaikuttavat suomalaiseen yrityselämään. Näitä muutoksia ovat muun muassa globalisaatio ja teknologioiden nopea kehittyminen. Muutokseen vaikuttavat digitalisaation tuomat mahdollisuudet liiketoiminnalle, kuten asioiden internet, Internet of Things (IoT) ja keinoälyn kehitys. Yrityksen kilpailuetuihin tulisi löytää uusia keinoja. Kehitys on antanut yrityksille mahdollisuuden luoda asiakkailleen entistä vaivattomammin palveluita. Useimmat asiakkaat eivät hae enää tuo...

  11. Asiakkaan palvelupolkuun perustuva verkkokaupan kehittäminen

    OpenAIRE

    Tennberg, Nora

    2016-01-01

    Verkosta on tullut merkittävin kauppapaikka. Yhä useammat yritys- ja kuluttaja-asiakkaat tekevät pääasiassa ostoksensa verkossa, koska se ei ole sidottu aikaan tai paikkaan ja tarjoaa laajan valikoiman tuotteita sekä palveluita. Yritysten kannalta kilpailu verkossa on kiivasta ja verkossa toimivien yritysten tuleekin löytää keinoja, joilla ne voivat erottautua kilpailijoistaan. Verkkokaupan onnistunut asiakaskokemus on keino, jolla voidaan vaikuttaa asiakkaiden ostoaikeisiin, parantaa asiakas...

  12. Yhdessä oleminen, toimiminen ja yhteyden tunteminen: Perheen kokemus lapsen syntymisestä kotona

    OpenAIRE

    Jouhki, Maija-Riitta

    2017-01-01

    Suomessa muutamat kymmenet naiset valitsevat vuosittain lapsensa syntymäpaikaksi oman kotinsa. Kotisynnytys ei kuulu Suomessa julkisen terveydenhuollon palveluihin, jotka ovat kaikille ilmaisia ja tulostensa perusteella tarkasteltuna laadukkaita. Palvelut eivät kuitenkaan näytä vastaavan kaikkien perheiden tarpeita. Tämän tutkimuksen tarkoituksena oli tuottaa kuvailevaa ja tulkitsevaa tietoa perheen kokemuksesta liittyen lapsen tai sisaruksen kotona syntymiseen ja muodostaa täs...

  13. Postmodernin kontekstit maantieteessä

    OpenAIRE

    Vilkko, Suvi

    2005-01-01

    Vaikeaselkoisuus ja kiistanalaisuus lyövät leimansa moniin yhteiskunta- ja sosiaalitieteiden kentillä nyt 2000-luvun taitteessa käytäviin keskusteluihin. Aivan erityisen hyvin tämä tieteellisen keskustelun hajanaisuus tulee ilmi käsiteltäessä sitä, mitä postmodernilla ajattelulla tarkkaan ottaen tarkoitetaan. Postmodernia ajattelua on totunnaisesti pidetty eräänlaisena käsitekuminauhana, jolla on viitattu esimerkiksi nykyisen taideteorian abstraktiuteen, yhteiskunnan nopeaan moniarvoistumiske...

  14. On the Asymptotic Behavior of Positive Solutions of Certain Fractional Differential Equations

    OpenAIRE

    Said R. Grace

    2015-01-01

    This paper deals with the asymptotic behavior of positive solutions of certain forced fractional differential equations of the form DcαCyt=et+ft, xt, c>1, α∈0,1, where yt=atx′t′, c0=y(c)/Γ(1) =yc, and c0 is a real constant. From the obtained results, we derive a technique which can be applied to some related fractional differential equations.

  15. Kytkimen valinta pinta-aaltoenergialaitteistoon

    OpenAIRE

    Pennonen, Antti

    2014-01-01

    Tässä työssä on tarkoituksena tarkastella ASWEC -2014 pinta-aaltoenergialaitteistoon mahdollisesti soveltuvia kytkimiä tai korvaavia ratkaisuja momentin siirtoon. Työn tarkoitus on valita soveltuva toteutustapa tai mahdollisesti olemassa oleva komponentti laitteiston momentin siirtoon. Aaltovoima on aurinko-, tuuli- ja vesivoiman rinnalla suhteellisen uusi tapa sähkön tuottamiseksi. Kuitenkin merkittävä osa maapallon energiasta voitaisiin menetelmien kehittyessä tuottaa aaltoenergiaa käyt...

  16. Adomian decomposition method for nonlinear Sturm-Liouville problems

    Directory of Open Access Journals (Sweden)

    Sennur Somali

    2007-09-01

    Full Text Available In this paper the Adomian decomposition method is applied to the nonlinear Sturm-Liouville problem-y" + y(tp=λy(t, y(t > 0, t ∈ I = (0, 1, y(0 = y(1 = 0, where p > 1 is a constant and λ > 0 is an eigenvalue parameter. Also, the eigenvalues and the behavior of eigenfuctions of the problem are demonstrated.

  17. Targeting Tim-1 to Circumvent Immune Tolerance in Prostate Cancer

    Science.gov (United States)

    2012-09-01

    responses to PSA self- antigen in transgenic mice. Prostate 70:1002. 7. Koh, Y. T., A. Gray, S. A. Higgins, B. Hubby, and W. M. Kast . 2009. Androgen...15766662] 14. Koh YT, Gray A, Higgins SA, Hubby B, Kast WM. Androgen ablation augments prostate cancer vaccine immunogenicity only when applied after...Mercader M, Bodner BK, Moser MT, Kwon PS, Park ES, Manecke RG, Ellis TM, Wojcik EM, Yang D, Flanigan RC, Waters WB, Kast WM, Kwon ED. T cell

  18. ACD-Tool Mobile : Diagnostiikkasovelluksen siirtäminen mobiiliympäristöön

    OpenAIRE

    Kokkonen, Lauri

    2015-01-01

    Tämän työn tavoitteena oli suunnitella ja toteuttaa Andritz Oy:lle jo olemassa olevan, tietokoneella ajettavan ACD-Tool-työpöytäsovelluksen pohjalta mobiililaitteella, kuten tablettitietokoneella tai matkapuhelimella ajettava sovellus. ACD-Tool on diagnostiikkasovellus, jonka avulla voidaan tehdä laitoksen mittausautomaation tuottaman prosessidatan perusteella muun muassa trendejä, laskentaa ja erilaisia analyysejä. Sovelluksen erilaisista toteutustavoista tehtiin toimeksiantajan toiveest...

  19. Elucidation of the Mechanisms and Environmental Relevance of cis-Dichloroethene and Vinyl Chloride Biodegradation

    Science.gov (United States)

    2012-11-01

    thus appears that Polaromonas sp. JS666 is a safe candidate for use in bioremediation , bioaugmentation or monitored natural attenuation. 3.1.6...of multiple chlorinated ethene sources in an industrialized area. A forensic field study using compound-specific isotope analysis." Environmental ...Degrading Bacterium, and Features of Relevance to Biotechnology .” Applied and Environmental Microbiology 74(20): 6405-6416. Maymó-Gatell, X., Y.-t

  20. TrashionTrick : Naistenvaatekokoelma rekonstruoimalla ja nollajätemetodia soveltamalla

    OpenAIRE

    Haukka, Matleena

    2011-01-01

    Opinnäytetyön tavoitteena oli naistenvaatekokoelman luominen miesten puvuista rekonstruointi ja nollajätteen soveltaminen metodeina. Työssä suunniteltu kokoelma toimii pohjana tekijän omalle tuotemerkille, jolle on tarkoitus löytää vuoden 2011 aikana jälleenmyyjiä. Kokoelman tuli olla uutuusarvoa omaava, uniikki ja persoonallinen. Kokoelman suunnitteluprosessin eteneminen on kuvattu Checklandin pehmeän systeemisuunnittelun mallin kautta. Ideointi tapahtui pohjamateriaalin innoi...

  1. Liikennesuunnittelu eri kaavoitusvaiheissa

    OpenAIRE

    Verkamo, Harri

    2008-01-01

    Tässä insinöörityössä kartoitettiin eri kaavavaiheiden liikennesuunnitelmia ja niiden sisältöä. Kartoituksen pohjalta laadittiin ohjeistus Helsingin kaupunkisuunnitteluviraston liikennesuunnitteluosastolle. Nykyään kaupunkisuunnitteluvirastossa ei ole ohjeita suunnittelijoiden avuksi eri kaavavaiheiden liikennesuunnitelmien laadintaan, mutta sellaiselle on selkeä tarve. Johdonmukaisella ohjeistuksella saadaan luotua yhtenäisempi käytäntö eri kaavavaiheiden liikennesuunnitelmien laatimiselle. ...

  2. Sosiaalisen median riskit yritysmaailmassa

    OpenAIRE

    Kilpinen, Joni

    2015-01-01

    Sosiaalisen median palveluista on kirjoitettu lukuisia kirjoja ja artikkeleita, joissa niitä ylistetään varsinkin yritysnäkökulmasta. Vaikka sosiaalinen media on muuttanut olennaisesti tapaa, jolla keskustella, mainostaa, etsiä ja jakaa tietoa, piilee sen palveluiden käytössä kuitenkin erilaisia uhkakuvia. Yritykset ja asiantuntijat pelkäävät sosiaalisen median avoimuuden aiheuttavan suuria tietoturvariskejä. Lisäksi asiantuntijat ovat varoitelleet sosiaalisessa mediassa olevista haittaohjelm...

  3. Platelets Orchestrate Remote Tissue Damage After Mesenteric Ischemia-Reperfusion

    Science.gov (United States)

    2012-02-02

    Platelet Depletion Two days before I/R injury, mice received a single intraperitoneal injection of a titred affinity purified endotoxin-free rabbit...Egan R, Chen J, le Lucca JJ, Juang YT, Tsokos GC. IL-17 producing CD4 T cells mediate accelerated ischemia/reperfusion- induced injury in...activation in rheumatoid arthritis. Clin Rheumatol 26: 768–771, 2007. 77. Wang Y, Li Y, le Lucca SL, Simovic M, Tsokos GC, le Lucca JJ. Decay accelerating

  4. The relationship between fat depot-specific preadipocyte differentiation and metabolic syndrome in obese women

    Directory of Open Access Journals (Sweden)

    N V Mazurina

    2013-03-01

    Full Text Available Реферат по материалам статьи The relationship between fat depot-specific preadipocyte differentiation and metabolic syndrome in obese women. Park HТ, Lee ES, Cheon EP, Lee DR, Yang K-S, Kim YT, Hur JY, Kim SH, Lee KW, Kim T. Clinical Endocrinology 2012; 76, 59-66.

  5. Lead exposure in raptors from Japan and source identification using Pb stable isotope ratios.

    Science.gov (United States)

    Ishii, Chihiro; Nakayama, Shouta M M; Ikenaka, Yoshinori; Nakata, Hokuto; Saito, Keisuke; Watanabe, Yukiko; Mizukawa, Hazuki; Tanabe, Shinsuke; Nomiyama, Kei; Hayashi, Terutake; Ishizuka, Mayumi

    2017-11-01

    Lead (Pb) poisoning is widespread among raptors and water birds. In Japan, fragments of Pb ammunition are still found in endangered eagles although more than 10 years have passed since legislation regarding use of Pb ammunition was introduced. This study was performed to investigate Pb exposure in raptors from various locations in Japan. We measured hepatic and renal Pb concentrations and hepatic Pb isotope ratios of Steller's sea eagles (Haliaeetus pelagicus), white-tailed sea eagles (Haliaeetus albicilla), golden eagles (Aquila chrysaetos), and 13 other species (total 177 individuals) that were found dead, as well as blood samples from three eagles found in a weakened state during 1993-2015 from Hokkaido (northern part), Honshu (the main island), and Shikoku (a southern island) of Japan. In the present study in Hokkaido, one quarter of the sea eagles showed a high Pb concentration, suggesting exposure to abnormally high Pb levels and Pb poisoning. Pb isotope ratios indicated that endangered Steller's sea eagle and white-tailed sea eagle were poisoned by Pb ammunition that was used illegally in Hokkaido. In other areas of Japan, both surveillance and regulations were less extensive than in Hokkaido, but Pb poisoning in raptors was also noted. Therefore, Pb poisoning is still a serious problem in raptors in various areas of Japan due to accidental ingestion of materials containing Pb, especially Pb ammunition. Copyright © 2017. Published by Elsevier Ltd.

  6. Implementation of special engineering safety features for severe accident management. New SAMG approach

    International Nuclear Information System (INIS)

    Grigorov, D.; Borisov, E.; Mancheva, K.

    2012-01-01

    Conclusions: As a result of the thermohydraulic analysis conducted the following main conclusions are formulated: The operator actions for accident management are effective and allow reaching conditions for application of the new engineering safety features for SAMG; The new engineering safety features application is effective and prevents severe core damage for Scenario 1. For the Scenario 2 they prevents degradation and relocation of the reactor core for a long period of time (in the analysis this period is 10 h, but the unit could be kept in safe condition for longer time which is not specifically analysed).The maximal fuel cladding temperature for Scenario 1 reaches 558 o C. This low fuel cladding temperature gradient is achieved by applying a complex of operator actions which prevent any core damage. If the additional discharge line with DN 100 mm from the PRZ is not opened then a severe core damage occurs; The maximal fuel cladding temperature for Scenario 2 reaches 1307 o C. One of the possibilities for keeping this temperature below 1200 o C is to mount second line (the first SFP line is between YT12S03.S04) from the SFP to the TQ22 pipeline which is connected to YT14B01 hydroaccumulator line, between the check valves YT14S03.S04

  7. An updated checklist of birds of Sariska Tiger Reserve, Rajasthan, India

    Directory of Open Access Journals (Sweden)

    A. Sultana

    2013-09-01

    Full Text Available Surveys were carried out at 10 sites in the buffer and core zones of Sariska Tiger Reserve during 2007-2011. MacKinnon species listing method was used to compile a checklist of birds. A total of 224 bird species was recorded including 36 new records. Ashy Drongo Dicrurus leucophaeus, Marshall Iora Aegithina nigrolutea, Eurasian Eagle Owl Bubo bubo, Brown-headed Barbet Megalaima zeylanica, Indian Nightjar Caprimulgus asiaticus, Long-legged Buzzard Buteo rufinus, Northern Goshawk Accipiter gentilis, Red-necked Falcon Falco chicquera, Pheasant-tailed Jacana Hydrophasianus chirurgus, Red-whiskered Bulbul Pycnonotus jocosus, White-capped Water Redstart Chaimarrornis leucocephalus were some new records. Some important observations are given in detail.

  8. Mitochondrial control region I and microsatellite analyses of endangered Philippine hornbill species (Aves; Bucerotidae) detect gene flow between island populations and genetic diversity loss.

    Science.gov (United States)

    Sammler, Svenja; Ketmaier, Valerio; Havenstein, Katja; Krause, Ulrike; Curio, Eberhard; Tiedemann, Ralph

    2012-10-12

    The Visayan Tarictic Hornbill (Penelopides panini) and the Walden's Hornbill (Aceros waldeni) are two threatened hornbill species endemic to the western islands of the Visayas that constitute - between Luzon and Mindanao - the central island group of the Philippine archipelago. In order to evaluate their genetic diversity and to support efforts towards their conservation, we analyzed genetic variation in ~ 600 base pairs (bp) of the mitochondrial control region I and at 12-19 nuclear microsatellite loci. The sampling covered extant populations, still occurring only on two islands (P. panini: Panay and Negros, A. waldeni: only Panay), and it was augmented with museum specimens of extinct populations from neighboring islands. For comparison, their less endangered (= more abundant) sister taxa, the Luzon Tarictic Hornbill (P. manillae) from the Luzon and Polillo Islands and the Writhed Hornbill (A. leucocephalus) from Mindanao Island, were also included in the study. We reconstructed the population history of the two Penelopides species and assessed the genetic population structure of the remaining wild populations in all four species. Mitochondrial and nuclear data concordantly show a clear genetic separation according to the island of origin in both Penelopides species, but also unravel sporadic over-water movements between islands. We found evidence that deforestation in the last century influenced these migratory events. Both classes of markers and the comparison to museum specimens reveal a genetic diversity loss in both Visayan hornbill species, P. panini and A. waldeni, as compared to their more abundant relatives. This might have been caused by local extinction of genetically differentiated populations together with the dramatic decline in the abundance of the extant populations. We demonstrated a loss in genetic diversity of P. panini and A. waldeni as compared to their sister taxa P. manillae and A. leucocephalus. Because of the low potential for gene flow

  9. Processing and microstructure characterisation of oxide dispersion strengthened Fe–14Cr–0.4Ti–0.25Y2O3 ferritic steels fabricated by spark plasma sintering

    International Nuclear Information System (INIS)

    Zhang, Hongtao; Huang, Yina; Ning, Huanpo; Williams, Ceri A.; London, Andrew J.; Dawson, Karl; Hong, Zuliang; Gorley, Michael J.; Grovenor, Chris R.M.; Tatlock, Gordon J.; Roberts, Steve G.; Reece, Michael J.; Yan, Haixue; Grant, Patrick S.

    2015-01-01

    Highlights: • Nanostructured ODS steels were successfully produced by SPS. • Presence of Y 2 Ti 2 O 7 nanoclusters was confirmed by synchrotron XRD and microscopy. • The chemistry of nanoclusters tested by ATP indicated they are Y–Ti–O oxides. - Abstract: Ferritic steels strengthened with Ti–Y–O nanoclusters are leading candidates for fission and fusion reactor components. A Fe–14Cr–0.4Ti + 0.25Y 2 O 3 (14YT) alloy was fabricated by mechanical alloying and subsequently consolidated by spark plasma sintering (SPS). The densification of the 14YT alloys significantly improved with an increase in the sintering temperature. Scanning electron microscopy and electron backscatter diffraction revealed that 14YT SPS-sintered at 1150 °C under 50 MPa for 5 min had a high density (99.6%), a random grain orientation and a bimodal grain size distribution (<500 nm and 1–20 μm). Synchrotron X-ray diffraction patterns showed bcc ferrite, Y 2 Ti 2 O 7 , FeO, and chromium carbides, while transmission electron microscopy and atom probe tomography showed uniformly dispersed Y 2 Ti 2 O 7 nanoclusters of <5 nm diameter and number density of 1.04 × 10 23 m −3 . Due to the very much shorter consolidation times and lower pressures used in SPS compared with the more usual hot isostatic pressing routes, SPS is shown to be a cost-effective technique for oxide dispersion strengthened (ODS) alloy manufacturing with microstructural features consistent with the best-performing ODS alloys

  10. Soil Salt Distribution and Tomato Response to Saline Water Irrigation under Straw Mulching.

    Directory of Open Access Journals (Sweden)

    Yaming Zhai

    Full Text Available To investigate better saline water irrigation scheme for tomatoes that scheduling with the compromise among yield (Yt, quality, irrigation water use efficiency (IWUE and soil salt residual, an experiment with three irrigation quotas and three salinities of irrigation water was conducted under straw mulching in northern China. The irrigation quota levels were 280 mm (W1, 320 mm (W2 and 360 mm (W3, and the salinity levels were 1.0 dS/m (F, 3.0 dS/m (S1 and 5.0 dS/m (S2. Compared to freshwater, saline water irrigations decreased the maximum leaf area index (LAIm of tomatoes, and the LAIm presented a decline tendency with higher salinity and lower irrigation quota. The best overall quality of tomato was obtained by S2W1, with the comprehensive quality index of 3.61. A higher salinity and lower irrigation quota resulted in a decrease of individual fruit weight and an increase of the blossom-end rot incidence, finally led to a reduction in the tomato Yt and marketable yield (Ym. After one growth season of tomato, the mass fraction of soil salt in plough layer under S2W1 treatment was the highest, and which presented a decline trend with an increasing irrigation quota. Moreover, compared to W1, soil salts had a tendency to move to the deeper soil layer when using W2 and W3 irrigation quota. According to the calculation results of projection pursuit model, S1W3 was the optimal treatment that possessed the best comprehensive benefit (tomato overall quality, Yt, Ym, IWUE and soil salt residual, and was recommended as the saline water irrigation scheme for tomatoes in northern China.

  11. Soil Salt Distribution and Tomato Response to Saline Water Irrigation under Straw Mulching.

    Science.gov (United States)

    Zhai, Yaming; Yang, Qian; Wu, Yunyu

    2016-01-01

    To investigate better saline water irrigation scheme for tomatoes that scheduling with the compromise among yield (Yt), quality, irrigation water use efficiency (IWUE) and soil salt residual, an experiment with three irrigation quotas and three salinities of irrigation water was conducted under straw mulching in northern China. The irrigation quota levels were 280 mm (W1), 320 mm (W2) and 360 mm (W3), and the salinity levels were 1.0 dS/m (F), 3.0 dS/m (S1) and 5.0 dS/m (S2). Compared to freshwater, saline water irrigations decreased the maximum leaf area index (LAIm) of tomatoes, and the LAIm presented a decline tendency with higher salinity and lower irrigation quota. The best overall quality of tomato was obtained by S2W1, with the comprehensive quality index of 3.61. A higher salinity and lower irrigation quota resulted in a decrease of individual fruit weight and an increase of the blossom-end rot incidence, finally led to a reduction in the tomato Yt and marketable yield (Ym). After one growth season of tomato, the mass fraction of soil salt in plough layer under S2W1 treatment was the highest, and which presented a decline trend with an increasing irrigation quota. Moreover, compared to W1, soil salts had a tendency to move to the deeper soil layer when using W2 and W3 irrigation quota. According to the calculation results of projection pursuit model, S1W3 was the optimal treatment that possessed the best comprehensive benefit (tomato overall quality, Yt, Ym, IWUE and soil salt residual), and was recommended as the saline water irrigation scheme for tomatoes in northern China.

  12. Optimal investment for enhancing social concern about biodiversity conservation: a dynamic approach.

    Science.gov (United States)

    Lee, Joung Hun; Iwasa, Yoh

    2012-11-01

    To maintain biodiversity conservation areas, we need to invest in activities, such as monitoring the condition of the ecosystem, preventing illegal exploitation, and removing harmful alien species. These require a constant supply of resources, the level of which is determined by the concern of the society about biodiversity conservation. In this paper, we study the optimal fraction of the resources to invest in activities for enhancing the social concern y(t) by environmental education, museum displays, publications, and media exposure. We search for the strategy that maximizes the time-integral of the quality of the conservation area x(t) with temporal discounting. Analyses based on dynamic programming and Pontryagin's maximum principle show that the optimal control consists of two phases: (1) in the first phase, the social concern level approaches to the final optimal value y(∗), (2) in the second phase, resources are allocated to both activities, and the social concern level is kept constant y(t) = y(∗). If the social concern starts from a low initial level, the optimal path includes a period in which the quality of the conservation area declines temporarily, because all the resources are invested to enhance the social concern. When the support rate increases with the quality of the conservation area itself x(t) as well as with the level of social concern y(t), both variables may increase simultaneously in the second phase. We discuss the implication of the results to good management of biodiversity conservation areas. 2012 Elsevier Inc. All rights reserved

  13. Lounaslistan kehittäminen ja markkinointi : Ravintola Huviretki Kuopio

    OpenAIRE

    Mehtonen, Heli

    2017-01-01

    ”Markkinointi on vastuullinen, suhteisiin ja yhteisöllisyyteen pohjautuva ajattelu- ja toimintatapa, jonka avulla luodaan myyvä, kilpailukykyinen ja eri osapuolille arvoa tuottava tarjooma vuorovaikutteisesti toimien.” Yrityksen perustehtävänä on tuottaa voittoa omistajilleen ja markkinoinnin osuus tästä on lisätä myyntivolyymiä ja mahdollistaa parempi myyntikate. On tärkeää tuoda asiakaskeskeisyys käytäntöön eikä vain ajatella olevansa asiakaskeskeinen. Lisäksi on tärkeää saada asiakkaat ost...

  14. Det «overbestemte» livet?: Balansering av arbeid og familieliv i IT-bransjen i Norge, Malaysia og California

    OpenAIRE

    Singstad, Birgit Nestvold

    2011-01-01

    Det “overbestemte” livet? Balansering av arbeid og familieliv i IT-bransjen i Norge, Malaysia og California. Denne avhandlingen undersøker hvordan ansatte i IT-bransjen balanserer arbeid og familieliv i Norge, Malaysia og California. Jeg har valgt å undersøke dette i en gruppe høyt utdannede arbeidstakere, og har spurt: Er det slik at et interessant, morsomt og fleksibelt, men krevende arbeidsliv skaper tidsklemmer og balanseproblemer? Eller er det vårt senmoderne samfunn som skaper for m...

  15. YouTube osuuskaupan markkinointiviestinnässä

    OpenAIRE

    Lindevall, Tytti

    2014-01-01

    Tämän opinnäytetyön tavoitteena on luoda toimeksiantaja Suur-Seudun Osuuskauppa SSO:lle suunnitelma YouTuben hyödyntämiseksi markkinointiviestinnässään. Työn avulla on tarkoitus löytää keino, miten SSO voisi hyödyntää YouTubea markkinointiviestinnässään ja mitä asioita tulisi huomioida omaa kanavaa perustettaessa. Tarkoituksena on tuottaa raportti mahdollisista käyttötarkoituksista sekä ohjeistus oman kanavan perustamiseen ja hallinnointiin liittyvistä asioista. Työn alkupuolella taustoite...

  16. RFID-tunnisteiden havaitseminen liikkuvasta ajoneuvosta : case: Fidera Oy

    OpenAIRE

    Artukka, Riku

    2016-01-01

    Tämän opinnäytetyön tarkoituksena on testata ja dokumentoida suoritettuja RFID- ajoneuvomittauksia eli ajoneuvojen ja henkilöiden automaattista tunnistusta hyödyntämällä RFID-tunnisteita. Opinnäytetyö on tehty toimeksiantona Fidera Oy:lle. Yrityksellä on jo käytössä automaattinen henkilötunnistusjärjestelmä, tarve olikin soveltaa samaa tekniikkaa ajoneuvojen ja niiden sisällä olevien henkilöiden tunnistukseen. Opinnäytetyön tavoitteena on luoda kuva RFID-tekniikan perusteista ja toimia s...

  17. Yksityisestä elinkeinonharjoittajasta osakeyhtiöksi

    OpenAIRE

    Laurila, Pietari

    2015-01-01

    Opinnäytetyön aiheena oli tutkia yritysmuodon muutosta toiminimestä osakeyhtiöksi. Toimeksianto tuli kiinteistönhuoltoalalla toimivalta yksityiseltä elinkeinonharjoittajalta. Tutkimusongelmana oli selvittää, onko kohdeyrityksen taloudellisesti kannattavaa muuttaa yritysmuotoaan yksityisestä elinkeinonharjoittajasta osakeyhtiöksi ja kuinka se käytännössä tapahtuu. Kirjallisten dokumenttien lisäksi aineistoa opinnäytetyöhön saatiin haastattelemalla yrittäjää sekä aiheeseen erikoistunutta yr...

  18. Vähittäismyymälän markkinoinnin kehittäminen : case Mattomies Oy

    OpenAIRE

    Hellstén, Maren

    2015-01-01

    Opinnäytetyön tavoitteena oli löytää toimeksiantajana toimineelle Mattomies Oy Ruohola & Ruoholalle konkreettisia keinoja yrityksen vähittäismyymälän markkinoinnin kehittämiseksi. Teoriaosassa käytiin läpi 4P-mallin mukaiset markkinoinnin kilpailukeinot. Toteutusosassa analysoitiin Mattomies Oy Ruohola & Ruoholan myymälän nykytilaa, myymälän merkitystä liiketoiminnalle sekä koottiin myymälälle markkinointimix, jossa annettiin konkreettisia ehdotuksia markkinoinnin kehittämiseksi. Ehdo...

  19. Matkailuyhteistyö Siikaisten kunnassa

    OpenAIRE

    Jaakkola, Sanna

    2010-01-01

    Tämän opinnäytetyön aiheena oli tutkia Siikaisten kunnan alueen matkailuyhteistyötä. Tutkimuksen päätehtävänä oli löytää vastaus kysymykseen: Miten Siikaisten matkailualan toimijat suhtautuvat yhteistyöhön? Tutkimuksen alatehtävinä pyrittiin selvittämään onko matkailualan yrittäjillä halua ja tarvetta yhteistyöhön, millaisessa roolissa he haluaisivat kunnan toimivan, millaisia esteitä he kokevat matkailuyhteistyölle olevan ja miten he ovat kokeneet kehityshankkeet. Lisäksi selvitettiin matkai...

  20. WOM ja eWOM : pankit ja negatiivinen eWOM

    OpenAIRE

    Stigzelius, Teemu

    2015-01-01

    Tämä opinnäytetyö käsittelee Word of Mouth ja electronic Word of Mouth –viestintää. Word of Mouthin tehokkuus perinteiseen markkinointiin on jo pitkään ollut yritysten ja tutkijoiden tiedossa. Internetin käytön yleistyminen avaa yrityksille uusia mahdollisuuksia edulliseen ja tehokkaaseen markkinointiin. Toisaalta se aiheuttaa yrityksille myös uusia uhkia mahdollisten negatiivisten viestien levitessä arvaamattomasti ja hallitsemattomasti verkossa. Opinnäytetyö on tehty osana NEMO-hanketta...

  1. Pearl : konsepti ekologiselle puuteripakkaukselle

    OpenAIRE

    Nurmi, Susann

    2016-01-01

    Opinnnäytetyössäni tutkin ekologisuutta sekä kosmetiikan että pakkausmuotoilun näkökulmasta. Kosmetiikan puolella kerron luonnonkosmetiikasta ja sen nykyisistä tuottajista. Materiaalitutkimuksen osuudessa tutkin keinoja luoda pakkauksesta ekologisempaa uusien materiaalien avulla. Pohdin myös mitkä seikat vahvistavat tai heikentävät kuluttajan mielikuvaa ekologisuudesta pakkauksessa. Muotoiluprosessissani käytän paljon käyttäjätestausta suunnitteluni apuna. Suunnittelun tavoitteena on luod...

  2. Instagram-kuvaohjeisto brändille : Instagram muotimarkkinoinnin välineenä

    OpenAIRE

    Tolkki, Enni

    2016-01-01

    Opinnäytetyössä tutkittiin Instagramia muotimarkkinoinnin välineenä vuonna 2016. Tarkoituksena oli löytää vastaus siihen, millaiset Instagram-kuvat olisivat tehokkaimpia pohjoismaisia vapaa-ajanvaatteita tarjoavan muotibrändin markkinointitarpeisiin. Tutkimuksessa etsittiin keinoja, joilla aktivoida useampia brändin seuraajia tykkäämään kuvista, sekä tehtyjen parannusten myötä kasvattaa asiakkaan seuraajamäärää ja asiakaskuntaa. Tutkimusmenetelminä työssä olivat benchmarking ja kuva-analy...

  3. Ongelmajätepalveluiden toiminnanohjauskäsikirja

    OpenAIRE

    Helminen, Tapio

    2011-01-01

    Tässä opinnäytetyössä on pyritty luomaan toimiva ja käytännöllinen toiminnanohjauskäsikirja Lassila & Tikanoja Oyj:n Maalahden ongelmajätepalvelutoimipisteeseen. Tarkoituksena oli selvittää ja kerätä yleisimpien ongelmajätelajien käsittely ja tunnistamisohjeet yhteen, jotta kaikki ohjeet olisivat yhdessä paikassa ja helposti saatavilla. Työn teoriaosassa on perehdytty ongelmajätteen määrittelyyn, luokitteluun ja velvollisuuksiin ongelmajätteiden käsittelyprosessissa. Valtaosa ongelmajättei...

  4. Kioton hankemekanismit ja jätehuoltosektori – tietopaketti yrityksille. Uudet jätteenkäsittelykonseptit kasvihuonekaasupäästöjen vähentämisessä ja niiden kehittäminen liiketoiminnaksi keskipitkällä aikavälillä (UJKON)

    OpenAIRE

    Ahonen, Hanna-Mari

    2006-01-01

    Tämän julkaisun tavoitteena on esitellä Kioton pöytäkirjan hankemekanismit eli yhteistoteutus (JI) ja puhtaan kehityksen mekanismi (CDM) niiltä osin kuin ne kytkeytyvät jätehuoltoratkaisuihin. Hankemekanismit tarjoavat mahdollisuuksia kestävän kehityksen edistämiseen ja kasvihuonekaasujen kustannustehokkaaseen vähentämiseen. Nämä mekanismit parantavat ilmastonmuutosta hillitsevien teknologioiden ja toimenpiteiden kilpailukykyä sallimalla niitä koskevien hankkeiden tuottamien päästövähennysten...

  5. Markkinointiviestintäsuunnitelma Case: MK Kivipiha Oy

    OpenAIRE

    Ruohomaa, Sami

    2011-01-01

    Tämän opinnäytetyön tarkoituksena on ollut markkinointiviestintäsuunnitelman laatiminen MK Kivipiha Oy:lle. Opinnäytetyö toteutettiin projektityönä, jonka lisäksi benchmarkkaus osiossa hyödynnettiin kvalitatiivista eli laadullista analyysiä. Lähtökohtana pidettiin suunnitelman realistisuutta ja käytännön toteuttamisen mahdollisuutta. Opinnäytetyö rakentuu kahdesta eri osiosta: teoreettisesta viitekehyksestä sekä empiirisestä osuudesta. Teoriana käytettiin katsausta perinteisen markkinointivie...

  6. On the Logical Development of Statistical Models.

    Science.gov (United States)

    1983-12-01

    1978). "Modelos con parametros variables en el analisis de series temporales " Questiio, 4, 2, 75-87. [25] Seal, H. L. (1967). "The historical...example, a classical state-space representation of a simple time series model is: yt = it + ut Ut = *It-I + Ct (2.2) ut and et are independent normal...on its past values is displayed in the structural equation. This approach has been particularly useful in time series models. For example, model (2.2

  7. Selvitys palkanlaskennan ulkoistamisen hyödyistä ja haasteista

    OpenAIRE

    Pohjonen, Anna

    2013-01-01

    Opinnäytetyön tavoitteena oli selvittää sekä oman palkanlaskennan että ulkoistetun palkanlaskennan hyödyt ja haasteet. Analyysin pohjalta oli tarkoituksena ehdottaa toimeksiantajan tarpeisiin sopivaa toimintamallia palkanlaskennan toteuttamiseen. Selvityshetkellä oli käytössä sisäinen palkanlaskentapalvelu, jonka toteuttamisesta vastasi yksi henkilö. Ulkoistetun palkanlaskennan vaihtoehto oli noussut toimeksiantajayrityksessä esille nykyisen palkanlaskijan eläkeiän lähestyessä. Myös muiden sa...

  8. GLOBAALI PALKKAHALLINTO : CASE: Yritys Oy

    OpenAIRE

    Salo, Paula

    2017-01-01

    Kehittämistyössä tutkittiin globaalia palkkahallintoa, sen käsitettä, vaatimuksia ja globaalin palkkahallinnon käyttöönottoa kansainvälisesti toimivassa yrityksessä. Tavoitteena oli löytää keinoja, joilla kohdeyritys pääsee tavoitteisiinsa palkkahallinnon toteuttamisessa. Kehittämistyö tehtiin kevään 2016 ja kevään 2017 välisenä aikana haastatellen ja havainnoiden käynnissä olevaa palkkahallinnon projektia. Kehittämistyön teoreettisessa osuudessa käydään läpi ulkoistamisen syyt lyhyesti ...

  9. Selvitys palkanlaskennan ongelmatilanteista : case: UPM-Kymmene Oyj

    OpenAIRE

    Rantanen, Marjaana

    2010-01-01

    Tässä opinnäytetyössä tutustuttiin UPM-Kymmene Oyj:n palkkahallinnon kehitysprojektiin ja projektin vaikutuksiin yrityksen palkkahallinnossa. Palkkahallinnon kehitysprojekti kattaa palkkahallinnon keskittämisen yhteen palvelukeskukseen ja uuden palkkajärjestelmän käyttöönottoprosessin. Tämän raportin tavoite oli selvittää projektiin liittyen palkanlaskijoiden ongelmatilanteet jokaisen palkanlaskijan oman palkkajärjestelmän ja omien käytäntöjen kautta. Ilmi tulleet ongelmatilanteet koottiin lo...

  10. Sähköinen palkkahallinto yrityksen, tilitoimiston ja palkanlaskijan kannalta

    OpenAIRE

    Majava, Tero

    2010-01-01

    Opinnäytetyön tavoitteena oli tutkia sähköisen palkkahallinnon vaikutuksia ja näkökulmia yrityksen, tilitoimiston ja palkanlaskijan kannalta verrattuna perinteiseen palkkahallintoon. Tarkoituksena oli kartoittaa sähköisen palkkahallinnon hyödyt ja haitat kaikista kolmesta eri näkökulmasta ja sitä, onko kannattavaa siirtyä sähköisen palkkahallinnon pariin. Tutkimus on tehty kvalitatiivista tutkimusmenetelmää käyttäen, pohjautuen kirjoituspöytätyöhön, tutkien ja analysoiden aiheeseen liitty...

  11. Selvitys hampaiden valkaisumenetelmistä

    OpenAIRE

    Seppälä, Stiina

    2015-01-01

    Tämä opinnäytetyö käsittelee hampaiden valkaisua sekä sen erilaisia menetelmiä. Hampaiden valkaisun suosio on kasvanut viime vuosien aikana huimasti. Hampaiden valkaisusta on kuitenkin ollut vaikea löytää luotettavaa, puolueetonta ja ajankohtaista tietoa, ja tämän työn tarkoituksena oli tarttua tähän ongelmaan. Työ on kirjallisuuskatsaus, joka toteutettiin etsimällä tietoa eri kirjallisuus- ja Internet-lähteistä. Uusia valkaisumenetelmiä tulee markkinoille koko ajan. Opinnäytetyössä pere...

  12. RFID- TEKNIIKAN MAHDOLLISTAMAT TYÖAIKASÄÄSTÖT HUONEKALUTEOLLISUUDESSA : - CASE INCAP FURNITURE OY

    OpenAIRE

    Taskinen, Jarkko

    2009-01-01

    Opinnäytetyön tarkoituksena oli selvittää RFID- tekniikan eli radiotaajuudella toimivan etätunnistamisen mahdollistamia työaikasäästöjä huonekaluteollisuudessa. Toimeksiantaja oli Incap Furniture Oy. Incap Furniture Oy on yksi suurimmista mäntyhuonekalusopimusvalmistajista maailmassa. Pääasiakas on Ikea. Incap Furniture Oy on aloittanut projektin, jonka tarkoitus on tutkia RFID- tekniikan mahdollisuuksia ja hyötyjä tehtaiden toiminnassa. Opinnäytetyö oli osa projektia. Opinnäyt...

  13. Taloushallinnon ohjelmistorobotiikan käyttöönotto Joensuun alueen tilitoimistoissa

    OpenAIRE

    Pietarinen, Petra; Parviainen, Taina

    2017-01-01

    Opinnäytetyön tarkoituksena on selvittää taloushallinnon ohjelmistorobotiikan käytön nykytilannetta Joensuun alueen tilitoimistoissa. Tutkimus on kvalitatiivinen eli laadullinen ja aineistonkeruumenetelmänä käytetään teemahaastattelua. Tutkimustulos osoittaa, että kaikki haastateltavat pitivät sähköisen taloushallinnon kehittymistä positiivisena muutoksena. Ohjelmistorobotiikan käyttöönotto on vielä alkuvaiheessa ja sitä hyödynnetään toistaiseksi vain isommissa tilitoimistoissa. Ohjelmist...

  14. Kehonkuvaa eheyttämässä - kehonkuva psykofyysisessä fysioterapiassa

    OpenAIRE

    Härkälä, Emilia

    2014-01-01

    Kuntoutuslainsäädännön mukaan fysioterapia kuuluu lääkinnälliseen kuntoutukseen, jonka tavoitteena on vaikuttaa ihmisen toimintakykyyn ja normaalin elämän edellytyksiin. Käytännössä ihmisen toimintakykyä arvioidaan sen mukaan, millaiset fyysiset, psyykkiset ja sosiaaliset edellytykset yksilöllä on selviytyä päivittäisistä toiminnoista ja askareista, kuten työstä, opiskelusta, sosiaalisista suhteista ja vapaa-ajan toimista. Toimintakyky on siis laaja käsite, ja tähän kuuluvat oleellisesti fyys...

  15. Alumnitoiminnan kehittäminen

    OpenAIRE

    Linko, Susanna

    2016-01-01

    Tämän opinnäytetyön toimeksiantaja oli Lahden ammattikorkeakoulu. Opinnäytetyön tarkoitus oli selvittää alumnitoiminnan parhaimmat ja toimivimmat käytänteet suomalaisissa ammattikorkeakouluissa ja yliopistoissa sekä miten ja millä keinoin alumnitoiminta Lahden ammattikorkeakoulussa saadaan aktiiviseksi. Tuloksia hyödynnetään alumnitoiminnan aloittamiseksi, ylläpitämiseksi ja kehittämiseksi sekä opiskelijoiden sitouttamiseksi alumneiksi jo opintojen aikana. Erittäin tärkeänä osana alumnitoimin...

  16. 5S-toimintamallin kehittäminen nostintuotannossa

    OpenAIRE

    Laine, Atte

    2017-01-01

    TIIVISTELMÄ Opinnäytetyön aiheena oli kehittää 5S-toimintamallia Konecranes Finland Oy:n nostintuotannossa Hämeenlinnan nostintehtaalla. Konecranesilla käytetään Lean Six Sigma -menetelmiä prosessien ja liiketoiminnan kehittämiseen ja 5S-toimintamalli on yksi näistä Lean Six Sigmaan kuuluvista menetelmistä. Se on jo osittain käytössä Hämeenlinnan nostintehtaalla ja nyt tehtaan nostinkokoonpanoon oli saatava sama toimintamalli kuin muillakin tehtaan osastoilla. Opinnäytetyössä perehdyttiin...

  17. Metropolialueen matkailun wellness –palveluiden kehitysympäristöselvitys

    OpenAIRE

    Taivassalo, Emma

    2010-01-01

    Kehitysympäristöselvityksessä kartoitetaan Metropolialueen wellness -matkailun toimijoita, nykyistä toimintaa, kehittämistilannetta ja tulevia kehittämisen tarpeita. Selvityksen tavoitteena on kartoittaa yritysten yhteistyön tilannetta, yhteistyöhalukkuutta ja osaamista kehittämistoimintaan sekä kehittämishaluja wellness -palveluja alueen matkailuelinkeinon tarpeita vastaaviksi. Tavoitteena on myös löytää Metropolialueen kehittäjien ja mahdollistajien kannalta ensisijaisia kehittämiskohteita....

  18. Varainhoitopalveluiden edut ja haitat piensijoittajalle verrattuna suoriin osakesijoituksiin

    OpenAIRE

    Viitanen, Mikko

    2014-01-01

    Rahoitusmarkkinoilla yleisen alhaisen korkotason vuoksi moni suomalainen miettii vaihtoehtoa tilisäästämiselle ja määräaikaan sidotuille korkeakorkoisille tileille. Tämän opinnäytetyön tarkoituksena on tarjota tietoa suhteellisen uusien varainhoitopalveluiden hyödyistä ja haitoista piensijoittajalle. Työssä vertaillaan suoraa osakesijoittamista ja varainhoitopalveluita piensijoittajan kannalta. Työn tuloksena pyritään löytämään hyötyjä ja haittoja varainhoitopalveluista suoriin osakkeisi...

  19. Johdannaiset sijoitusinstrumenttina

    OpenAIRE

    Ylinen, Markus

    2015-01-01

    Opinnäytetyön teoriaosuudessa käsiteltiin sijoittamisen eri muotoja: osake-, rahasto- ja korkosijoitukset, johdannaiset, joukkovelkakirjalainat, kiinteistöt, raaka-aineet ja valuutat. Sijoitusstrategioista kerrottiin yleisesti käytössä olevia strategioita, eli osinko-, arvo-, cost averaging- ja value averaging -strategiat sekä hajauttaminen. Sijoittajan käyttäytyminen käytiin läpi pääpiirteittäin. Johdannaisiin keskityttiin muita sijoitusmuotoja enemmän opinnäytetyön aiheen vuoksi. Johda...

  20. Final Report for Geometric Observers and Particle Filtering for Controlled Active Vision

    Science.gov (United States)

    2016-12-15

    rather than discrete objects. This has a simplifying effect on the formalism, which becomes grid independent. On the other hand models based on...ft(xt, ut) where ut is i.i.d. random noise with known pdf. At discrete times, observations Yt ∈ Rp become available. These measurements are related to...Tannenbaum, “Minimizing flows for the Monge–Kantorovich problem,” SIAM J. Math . Analysis 35 (2003) pp. 61-97. [10] S. Angenent, G. Sapiro, and A

  1. Korpikuusen kannon alla : Hahmosuunnittelun anatomia

    OpenAIRE

    Toivola, Laura

    2012-01-01

    Teksti on tutkimus hahmosuunnittelun metodeista ja siitä, mistä muodostuu ja kuinka luodaan ”hyvä” hahmo. Käytännön osiossa muunnetaan sarjakuvastripeissä käytetty hahmo tekijän alter egosta itsenäiseksi 3D-animaatiohahmoksi. Hahmon suunnittelu on jaettu kahteen osaan; hahmon taustan ja henkilöhistorian suunnitteluun sekä hahmon visuaalisen ulkomuodon ja habituksen luomiseen. Tekstissä käsitellään erilaisia näkökulmia, joita voi käyttää hyväkseen hahmoa luodessa ja pohditaan viitekirjal...

  2. Asiakkuudenhallinta : Asiakkuudenhoitomallien kehittäminen organisaation asiakaslähtöisyyden lisäämiseksi

    OpenAIRE

    Niemi, Lauri

    2010-01-01

    Tämän tutkimuksellisen kehittämishankkeen tarkoituksena oli perehtyä asiakkuudenhallintaan ja kehittää asiakkuudenhoitomalleja, jotka lisäävät organisaation asiakaslähtöisyyttä. Toimeksiantajana ja taustaorganisaationa kehittämishankkeessa oli Elisa Oyj. Työ suoritettiin tutkimuksellisena kehittämishankkeena. Työn tutkimusongelmana oli kartoittaa asiakkuudenhoitomallien hyödyllisyyttä ja sitä kuinka aktiivisessa käytössä ne ovat olleet asiakasrajapinnassa sekä tunnistaa niistä selkeitä kehity...

  3. Nintendo Wii-pelikonsolin käyttö ikääntyneiden tasapainon tukemisessa

    OpenAIRE

    Pere, Olli; Suihkonen, Juho; Kärkkäinen, Taneli

    2017-01-01

    Opinnäytetyömme tavoitteena oli lisätä tietoa Nintendo Wii-pelikonsolin käytöstä ikääntyneiden tasapainoharjoittelussa. Opinnäytetyössämme teimme kirjallisuuskatsauksen kokoamalla aiemmin tutkittua tietoa aiheesta. Selvittääksemme ikääntyneiden käyttökokemuksia tasapainoharjoittelusta Nintendo Wiipelikonsolilla, teimme palvelutalo Karpalokodilla aiheesta tapaustutkimuksen. Tapaustutkimukseen osallistui kolme 80-89-vuotiasta henkilöä. Aineiston tapaustutkimukseen keräsimme haastattelulla. ...

  4. Yksisivuisten web-sovellusten kehittäminen Angular 2 -sovelluskehyksellä

    OpenAIRE

    Kujala, Miika

    2016-01-01

    Yksisivuiset web-sovellukset ovat yleistyneet viime vuosina. Niiden kehityksessä hyödynnetään usein JavaScript-sovelluskehystä. Angular 2 on Google:n kehittämä JavaScript-sovelluskehys. Tämän tutkielman tavoitteena on tarkastella Angular 2 -sovelluskehystä ja sen soveltuvuutta yksisivuisten web-sovellusten ke- hityksessä. Tutkielmassa käydään läpi Angular 2 -sovelluskehyksen ominaisuuksia sekä Angular 2 -sovelluskehyksen käytössä ilmeneviä etuja ja haittoja.

  5. MEDRIAN VEL’PHONE-POIKIMASENSORIN TARVE SUOMESSA

    OpenAIRE

    Hulkko, Karoliina

    2015-01-01

    Tämä opinnäytetyö tehtiin FABAn toimeksiannosta esiselvityksenä ranskalaisen Medria Technologies SAS -yhtiön poikimasensorin tarpeesta suomalaisilla nautakarjatiloilla. Opinnäytetyössä oli yhteistyössä myös Finnlacto Oy, joka ryhtyi maahantuojaksi opinnäyteprosessin aikana. Teoreettinen viitekehys sisältää tietoa Medrian poikimasensorista, tietojärjestelmästä, ohjelmiston käytöstä, poikimasensorin asennuksesta ja käyttöönotosta ja kannattavuudesta. Opinnäytetyössä selvitettiin poikimasens...

  6. Big data -teknologian perusteet ja mahdollisuudet

    OpenAIRE

    Juurinen, Susanna

    2013-01-01

    Työn tarkoituksena oli tutkia tiedonhallintaa ja big data -ratkaisujen käytännön toteutusta, mahdollisuuksia, haasteita ja hyötyjä. Työssä kuvataan tiedon määrän kehitystä, keräysprosesseja ja -menetelmiä sekä pohditaan tiedonhallinnan vaatimuksia ja tietoturvallisuutta. Työn tarkoitus oli selvittää tiedonhallinnan ja analytiikan uusimman trendin, big datan, vaikutusmahdollisuuksia organisaatioiden toimintaan. Tiedon analytiikkaa voidaan valjastaa liiketoiminnan tai muiden toimialueiden t...

  7. TOIMINNANOHJAUSJÄRJESTELMÄN VAIHTO HAANPAAN EAST-LIIKETOIMINTAYKSIKÖN NÄKÖKULMASTA

    OpenAIRE

    Aarnikoivu, Lasse; Rantanen, Johanna

    2012-01-01

    Työn tarkoituksena oli selvittää ja pohtia kansainvälisen logistiikka-alan yrityksen toiminnanohjausjärjestelmän vaihdon syitä, hyötyjä, haittoja, käytännön toteutusta ja siihen liittyviä haasteita. Työ toteutettiin nestemäiseen logistiikkaan erikoistuneen Haanpaan East-liiketoimintayksikölle. Työn teoreettinen tarkastelu perustuu toiminnanohjausjärjestelmien teoriaan. Toiminnanohjausjärjestelmä eli ERP on integroitu, toiminnanohjauksessa käytetty tietojärjestelmä, jonka avulla yrityksen ...

  8. Uusi sukupolvi X asiakkaana

    OpenAIRE

    Mannila, Katja

    2012-01-01

    Tämän opinnäytetyön tavoitteena on luoda uudelle yritykselle lähtökohdat asiakasstrategian tekemiseen. Käytännössä yritykselle valitaan markkinoille sopiva tapa segmentoida sekä potentiaalinen kohderyhmä, jota lähdetään syvällisemmin tutkimaan. Teoriaosissa käsitellään kaksi eri kokonaisuutta. Ensimmäisessä osiossa tutustutaan erilaisiin tapoihin segmentoida ja segmentoinnin merkitykseen liiketoiminnalle. Toisessa osassa otetaan kohteeksi itse kuluttaja ja pohditaan kulutuskäyttäytymisen s...

  9. Kehitysehdotusten tuottaminen palvelupolun parantamiseksi - Case Expert ASA Oy

    OpenAIRE

    Berg, Esa

    2011-01-01

    Kodintekniikka-alan kiristyvä kilpailutilanne ja maailmantalouden epävakaat ajat vaativat alalla toimivilta yrityksiltä keinoja löytää kilpailuetuja verrattuna muihin alan toimijoihin. Tämä tilanne johtaa siihen, että yritysten tulee entistä enemmän kiinnittää aitoa kiinnostusta asiakkaiden tarpeisiin ja toiveisiin, jotta yritys voisi palvella heitä paremmin. Tämän opinnäytetyön tavoitteena on ollut asiakkaan palvelupolun kehittämiseen tähtäävien kehitysideoiden tuottaminen Service ...

  10. Opiskelijanuorten mielipiteitä verenluovutuksesta, verenluovutusta edistäviä ja estäviä tekijöitä Mikkelin ammattikorkeakoulun opiskelijoiden kokemana

    OpenAIRE

    Pöyry, Jenni

    2013-01-01

    Opinnäytetyö tehtiin Suomen Punaisen Ristin Veripalvelulle. Opinnäytetyön tarkoituksena oli selvittää Mikkelin ammattikorkeakoulussa eri koulutusohjelmissa opiskelevien nuorten mielipiteitä verenluovu-tuksesta. Työn tavoitteena oli löytää tekijöitä, joihin huomiota kiinnittämällä Veripalvelun olisi mahdol-lista rekrytoida uusia nuoria verenluovuttajia. Verenluovutus on Suomessa vapaaehtoista ja tällä hetkellä verentarve ja tarjonta ovat tasapainossa. Kui-tenkin ikääntyvä väestö, ihmisten ...

  11. Facebook-yhteisöpalvelun hyödyntäminen yrityksen markkinointiviestinnässä

    OpenAIRE

    Pajamäki, Ida

    2014-01-01

    Tämän opinnäytetyön tavoitteena oli selvittää, miksi yritysten olisi kannattavaa olla Facebook-yhteisöpalvelussa ja millaisia keinoja niillä on käytössään Facebook-palvelussa markkinoidessaan. Opinnäytetyössä rakennettiin työn toimeksiantajalle, Mainostoimisto Gurulle, oma Facebook-sivu. Guru on Turun ammattikorkeakoulun sisäinen mainostoimisto, jossa suunnitellaan kaikenlaista markkinointiviestintää opiskelijavoimin. Teoriaosassa käsiteltiin lyhyesti sosiaalista mediaa ja Facebook-palvel...

  12. Elektroninen kompassi

    OpenAIRE

    Moisio, Petri

    2014-01-01

    Tämän opinnäytetyön aiheena oli elektronisen kompassin suunnittelu ja toteutus sulautettuun järjestelmään. Työ tehtiin Trelab Oy:lle, joka suunnittelee ja valmistaa seuraavan sukupolven langattomia mittalaitteita. Kompassi oli suunniteltava siten, että se toimisi osana Trelabin Oloni-järjestelmää ja täyttäisi yrityksen vaatimukset langattoman mittalaitteen ohjelmiston suhteen. Koska varsinainen mittalaite sensoreineen oli jo olemassa, elektronisen kompassin toteuttaminen oli käytännössä ohjel...

  13. FC Kliini RY:n Kesäpäivien suunnittelu ja järjestäminen

    OpenAIRE

    Narmala, Kalle

    2012-01-01

    Opinnäytetyön aiheena oli suunnitella ja järjestää FC Kliini ry:n Kesäpäivät. Tapahtuma suunniteltiin yhdistyksen puheenjohtaja Antti Niemisen toimeksiannon mukaan. Kesäpäivien suunnittelu alkoi maaliskuussa 2012, jolloin sen ajankohdaksi päätettiin 17.-19.8.2012. Tapahtuma järjestettiin loppukesästä, jotta kaikki yhdistyksen jäsenet voisivat ottaa osaa tapahtumaan. Opinnäytetyö suoritettiin toiminnallisena, jossa yhdistyy käytäntö sekä teoria. FC Kliini ry on jo kauan suunnitellut virkist...

  14. Time-Reversal Based Range Extension Technique for Ultra-Wideband (UWB) Sensors and Applications in Tactical Communications and Networking

    Science.gov (United States)

    2008-10-16

    signal from the signal generator is also used to synchronize DSO to record the data of the received signal. The tapped -delay-line model of CIR will...between each filter tap . The output y(t) — h(t) *x(t) is then uniformly sampled with sampling period Ts. 1 ’s follows the relation Ta/Th — q, where q... eft ) ProbtagPake ^ p(l> ’HO PriHretuHg Figure 5.5: An equivalent block diagram of channel estimation The success of recovery relies on the

  15. Tietoturvatyökalujen tuominen osaksi testausprosessia

    OpenAIRE

    Saastamoinen, Vesse

    2016-01-01

    Opinnäytetyö tehtiin Codemate-nimiselle suomalaiselle ohjelmistoyritykselle, joka tarvitsi hyvää vertailua nykyisistä tietoturvatestaukseen suunnitelluista työkaluista. Vertailun tavoitteena oli löytää ja valita sopivat työkalut, joita voidaan hyödyntää Codematen testausprosessissa. Vertailua oli tarkoituksena tehdä lähinnä web-sovelluksiin suunnattuihin työkaluihin, mutta lisäksi mukaan otettiin myös muutamia verkko- ja palvelinskannereita ja Content Management System –skannereita. Vert...

  16. Linux sulautetuissa järjestelmissä.

    OpenAIRE

    AUTIO, HENRI

    2003-01-01

    Sulautettuja järjestelmiä löytää nykyään kaiken tyyppisistä laitteista, joihin törmäämme jokapäiväisessä elämässämme. Ne on tarkoitettu kustannustehokkaaksi ratkaisuksi tiettyyn ongelmaan ja niiden laitteisto on rakennettu nimenomaan tiettyä tarkoitusta varten ja vastaavasti ohjelmistopuolella sovellusohjelmat on suunniteltu hyödyntämään mahdollisimman tehokkaasti kyseisen laitteiston tarjoamia ominaisuuksia. Suurimmaksi ongelmaksi, jota vastaan sulautettujen järjestelmien suunnittelijat...

  17. Verkkokaupan arkkitehtuuri ja toteutus : Case: Mango Hotel

    OpenAIRE

    Ketolainen, Jari

    2010-01-01

    Opinnäytetyön toimeksiantajana toimi tamperelainen hotellialan yritys Mango Hotel. Yrityksellä oli ollut käytössä valmis verkkokaupparatkaisu vaatteiden, tavaroiden ja asusteiden myyntiin, mutta sovellus osoittautui vaikeakäyttöiseksi, huonosti Mango Hotellin tarpeisiin mukautuvaksi ja sitä oli ylläpitäjän hankala päivittää. Opinnäytetyön tarkoituksena oli suunnitella ja toteuttaa aivan uusi verkkokauppasovellus Mango Hotellin käyttöön käyttämättä tai muokkaamatta mitään valmista verkkoka...

  18. Kanta-asiakasohjelman kehittäminen : case Crocs Stores Oy

    OpenAIRE

    Manninen, Mirka

    2014-01-01

    Kanta-asiakkuuden tavoitteena on molemminpuolinen arvon tuottaminen asiakkaan ja yrityksen välillä. Tämän tutkimuksen tavoitteena on selvittää, millainen kanta-asiakasohjelma olisi toimeksiantajayrityksen kannalta toimivin. Tutkimus on tapaus- eli case -tutkimus, jonka toimeksiantaja on Crocs Stores Oy. Toimeksiantajalla on tällä hetkellä käytössään kanta-asiakasohjelma, joka ei palvele yrityksen tarpeita. Paremman kanta-asiakasohjelman kehittämisen lisäksi tavoitteina on selvittää asiakkaide...

  19. Heisenberg Uncertainty Relation in Quantum Liouville Equation

    Directory of Open Access Journals (Sweden)

    Davide Valenti

    2009-01-01

    Fourier transform of the density matrix ρ(z,y,t = ψ∗(z,tψ(y,t. We find again that the variances of x and v obtained by using ρ(z, y,t are respectively equal to the variances of X^ and P^ calculated in ψ(x,t. Finally we introduce the matrix ∥Ann′(t∥ and we show that a generic square-integrable function g(x,v,t can be written as Fourier transform of a density matrix, provided that the matrix ∥Ann′(t∥ is diagonalizable.

  20. Verkkokauppojen kilpailija-analyysi

    OpenAIRE

    Nissinen, Antti

    2014-01-01

    Tämä opinnäytetyö on tehty liiketalouden koulutusohjelmassa. Opinnäytetyön tarkoituksena oli selvittää verkkokaupan nykytilaa, analysoida verkkokauppojen ansaintalogiikkaa ja erilaisia liiketoimintamalleja sekä suorittaa kilpailija-analyysi selvitykseen valittujen neljän verkkokaupan osalta. Kyseessä on toiminnallinen opinnäytetyö, jossa käytettäviä tutkimusmenetelmiä ovat havainnointi ja kirjoituspöytätutkimus. Selvityksessä käydään ensin läpi aiheen teoreettista viitekehystä verkkokaupa...

  1. Työnopastuksen kehittäminen Varuskuntaravintola Kotkassa

    OpenAIRE

    Hälikkä, Mari-Anna

    2016-01-01

    Tämän opinnäytetyön tavoitteena oli kehittää työnopastusta Varuskuntaravintola Kotkassa. Leijona Catering Oy:llä on olemassa oma perehdyttämisrunko ja materiaali uuden työntekijän yleiseen perehdyttämiseen ja koko organisaation toimintaan, mutta Varuskuntaravintola Kotkan kirjallinen materiaali toimipaikkakohtaiseen työnopastukseen oli puutteellinen ja osittain vanhentunut. Tässä työssä laadittiin toimeksiantajalle, Varuskuntaravintola Kotkalle, työnopastuksen käytäntöä tukeva työnopastusmate...

  2. 24 Pesulan seurantaohjelmisto

    OpenAIRE

    Lumme, Tristan

    2017-01-01

    Insinöörityö tehtiin 24 Pesula Oy:n projektista, joka suoritettiin Helsingissä. Projektin tarkoituksena oli luoda sovellus listaamaan yrityksen toimipisteiden koneet ja niiden käyttökerrat automatisoidusti tietokantaan. 24 Pesula Oy on vuonna 1999 perustettu yritys ja Suomen ainoa itsepalvelupesulaketju. Aikaisemmin koneiden käytönseuranta hoidettiin siten, että käyttödata haettiin paikan päältä lukemalla yksittäisten koneiden lokitiedot. Yrityksen koneissa käytettiin myös Atmelin modifio...

  3. Mikrokiteisen selluloosan käyttö keittomakkaran valmistuksessa

    OpenAIRE

    Vainio, Mika

    2016-01-01

    Tutkielman kirjallisuusosiossa käsiteltiin keittomakkaran rasvankorvaajia. Siinä kuvattiin mikrokiteisen selluloosan valmistusta, ominaisuuksia sekä käyttökohteita. Myös muita tällä hetkellä käytössä olevia keittomakkaran rasvankorvaajia käsiteltiin, joita ovat hydrokolloidit ja kasveista saatavat proteiinit. Kirjallisuusosiossa selvitettiin myös keittomakkaran laadun määrittämiseen käytettyjä menetelmiä. Kokeellisen osion tavoitteena oli selvittää kahden eri mikrokiteisen selluloosalaadu...

  4. Facebook ja tietoturva

    OpenAIRE

    Konttila, Jukka

    2011-01-01

    Insinöörityössä käsiteltiin sosiaalisia medioita, joista valittiin tarkempaan tutkimukseen yksi suosituimmista, Facebook. Tavoitteena oli tutustua Facebookin perusteisiin ja tutkia mahdollisia tietoturva- sekä muita ongelmia esimerkkitapausten kautta. Esimerkkien kautta esille tuotuihin ongelmiin oli tavoitteena löytää tai selvittää ratkaisu. Työssä selvitettiin sekä käyttäjän omaan toimintaan liittyviä riskitekijöitä että sellaisia ongelmia, joihin käyttäjä ei voi vaikuttaa Facebookin tur...

  5. Kerää Disney Klassikot -kampanja : Verkkokauppa hypermarketin haastajana

    OpenAIRE

    Sarajisto, Mari-Susanna

    2015-01-01

    Tämän opinnäytetyön tarkoituksena oli tutkia Disney Klassikot –keräilykampanjaa 2015, keskittyen Suomen ensimmäiseen kvartaaliin Q1. Työn toimeksiantaja toimi The Walt Disney Company Nordic Suomen toimisto. Opinnäytetyön tavoitteena oli tuottaa toimeksiantajalle tietoa kampanjatoteutuksista ja Disney-brändin vaalimisesta valituissa jakeluteissä. Ensimmäistä kertaa Disney kampanjan kohdalla jakelutiet pääsivät vaikuttamaan kampanjatoteu-tukseen. Tutkimuksen tarkoituksena oli löytää uutta tutki...

  6. Virtuaalitodellisuuden hyödyntäminen tapahtumissa

    OpenAIRE

    Emenike, Johannes

    2017-01-01

    Opinnäytetyöni on konstruktiivinen kehittämishanke, jonka tavoitteena on tutkia ja kehittää virtuaalitodellisuuden käyttöä erilaisissa tapahtumissa niin, että käytöstä saadaan tapahtuman järjestäjälle tai osallistuvalle yritykselle taloudellista hyötyä. Toisin sanoen tavoite on tuottaa toimintamalleja ja tunnistaa elementtejä, joiden avulla virtuaalitodellisuuden käyttöä tapahtumissa voidaan tehostaa järjestäjän tai osallistuvan yrityksen näkökulmasta. Työn tilaaja on suomalainen virtuaalitod...

  7. Lohkoketjuteknologian hyödyntäminen toimitusketjun hallinnassa

    OpenAIRE

    Risteli, Tuomas

    2017-01-01

    Insinöörityön tavoitteena oli tutkia lohkoketjuteknologiaa ja sen hyödyntämistä toimitusketjunhallinnassa. Tarkoituksena oli perehtyä kyseiseen aiheeseen ja löytää yhteys lohkoketjuteknologian ominaisuuksien ja toimitusketjunhallinnan ongelmien välillä. Perehtymisen jälkeen selvisi, että lohkoketjun hyödyntäminen parantaa läpinäkyvyyttä toimitusketjuissa ja siten lisää myös luottamusta osapuolten välille. Lohkoketjuteknologia on uudenlainen tapa tallentaa ja siirtää dataa, joka eliminoi t...

  8. Speculations on niches occupied by fungi in the sea with relation to bacteria

    Digital Repository Service at National Institute of Oceanography (India)

    Raghukumar, S.

    Yt.1JnJlTl-~.{l..::,'1-r'<.:nhdait,l()lJC::5 ~:§~~~qJ:onoon:=Br«:scttff~i~lt~9~~i)j-=-.T-~-=~~"-.------------------------------------------------------------------- --;;~~,Fell J Wino Master I M'1980 TheaSsOciafioii-aiid-potel1tfanoli--"of(ungi"u(~ngfoV:e-'de... of thraustochytrids and their subsequent growth within the cell lumen. Miller and Jones (1983) have observed thraustochytrids within the kelp, Fucus serratus L. Inspite of numerous reports, detailed studies on the role of thraustochytrids in the decomposition...

  9. Sarjakuvan uudet muodot : Motion Comic ja Motion Novel

    OpenAIRE

    Lassila, Ilkka

    2011-01-01

    Sarjakuva on kehittynyt sen ensimmäisestä julkaisusta 1800-luvun lopusta huimasti vuoteen 2011. Tutkielmassa haluan tuoda esille, miten sarjakuva on viimeisen kahdenkymmenen vuoden aikana muuttanut muotoaan printatusta taiteesta digitaaliseen muotoon sekä miten se on löytänyt viimevuosien aikana myös uuden muodon, Motion Comicin, joka on eräänlainen elävä sarjakuva. Pohdin myös tämän uuden tekniikan tulevaisuuden näkymiä sekä ongelmia joita tämä uusi tekniikka joutuu kohtaamaan. Vaikka s...

  10. Mobiilisovelluksen toteutus web-tekniikoilla PhoneGap-kehykselle

    OpenAIRE

    Heikka, Kai

    2012-01-01

    Opinnäytetyön tavoitteena oli tutkia tablet-laitteiden sopivuutta kartoittaessa rannikoiden tilaa öljyvahinkojen sattuessa, jotta tilanteesta saadaan mahdollisimman ajantasainen ja oikea tieto tilanteen johtamiseen. Ensisijaisesti tutkimuksen kohteena oleva tablet-laite oli iPad 2, mutta tutkimuksen aikana todettiin myös muidenkin tablet-laitteiden käytön olevan mahdollista käyttämällä esimerkiksi web-tekniikoihin perustuvaa PhoneGap-kehystä. PhoneGap-kehys oli sopiva opinnäytetyön tarpe...

  11. Koira-avusteinen terapia lasten psyykkisten häiriöiden hoidossa

    OpenAIRE

    Tuovinen, Susanna

    2014-01-01

    Tuovinen, Susanna. Koira-avusteinen terapia lasten psyykkisten häiriöiden hoidossa. Kevät 2014. 61 sivua, 1 liite. Diakonia-ammattikorkeakoulu, Hoitotyön koulutusohjelma, Sairaanhoitaja (AMK). Koira-avusteinen psykoterapia on maailmalla tunnettu hoitomuoto psyykkisten häiriöiden hoidossa. Suomessa se ei kuitenkaan ole vielä saavuttanut samanlaista suosiota. Tämä opinnäytetyö kertoo koira-avusteisesta terapiasta ja sen käytöstä yhtenä lasten psyykkisten häiriöiden hoitomuotona. O...

  12. Aineenkoetuskoneen kehittäminen tutkimus- ja opetuskäyttöön

    OpenAIRE

    Lassila, Mika

    2016-01-01

    Tässä opinnäytetyössä tutustuttiin Centria-ammattikorkeakoulun konelaboratoriossa käytössä olevaan aineenkoetuskoneeseen ja sen käyttöön. Työssä käytiin lyhyesti läpi eri tyyliset aineenkoetuskoneet ja perehdyttiin tarkasti vetokokeeseen. Vetokoe on olennainen osa materiaalitekniikkaa ja sen avulla saadaan hyvin paljon tietoa eri materiaaleista ja kappaleista. Työssä käytiin läpi vetokokeen eri arvojen määrittäminen ja tutustuttiin vetokokeessa käytettäviin koesauvoihin. Aineenkoetuskonee...

  13. Internet-kulttuuri nykytaiteessa

    OpenAIRE

    Höyssä, Timo

    2016-01-01

    Internet-kulttuuri nykytaiteessa Tutkimuksessa tarkastellaan internet-taiteen historiaa ja nykyisiä esityskäytäntöjä sekä sitä miten globaali internet-kulttuuri on muokannut nykytaidetta sekä galleriassa että webissä. Tutkimuksessa kysytään miten internetin kehitys on vaikuttanut internet-taiteeseen sekä post-internet-taiteen syntyyn? Mikä on internetin paikka nykytaiteessa sekä populaarikulttuurissa? Internet culture in contemporary art A study on the history of Internet art and it’...

  14. 1800-LUVUN LOPUN SEINÄPUHELIMEN RESTAUROINTI

    OpenAIRE

    Ranta, Heidi

    2011-01-01

    Ensimmäinen patentti puhelimelle myönnettiin vuonna 1876 Alexander Graham Bellin ansiosta. Siitä lähtien puhelimen kehitys on ollut todella nopeaa. Puhelinta alettiin heti kehittää toimivammaksi ja käytännöllisemmäksi. Ei aikaakaan kun puhelin levisi sen kotimaasta, Amerikasta, mantereen yli Eurooppaan. Suomeen uutinen kiri jo samana vuonna, kun puhelin keksittiin ja vuonna 1877 myös Suomessa käytiin ensimmäinen puhelinkeskustelu. Suomi on ollut yksi maailman kärkimaista puhelintoimen alalla....

  15. Hoivayrittäjyys — yrityksen perustaminen ja neuvontapalvelut

    OpenAIRE

    Långstedt, Kyllikki

    2013-01-01

    Opinnäytetyön aiheenvalintaan vaikuttivat kiinnostukseni perustaa hoiva-alan yritys sekä osaltaan Laurean hallinnoiman yrityshautomon asiakaskyselyn tulokset. Tämän laadullisen opinnäytetyön tarkoituksena oli kuvata hoivayrittäjyyttä ja sitä, miten aloittava yrittäjä voi hyödyntää olemassa olevia yritysneuvontapalveluja. Tutkimuksen osaongelmina oli selvittää, mitä tukipalveluja toiminimellä aloittava hoiva-alan yrittämiseen tarvitsee, mistä yrittäjä löytää tietoa yrityksen perustamiseen ja m...

  16. Anniskelun palvelukäsikirja Kaukametsän tilausravintoloille

    OpenAIRE

    Tervo, Jukka-Pekka

    2007-01-01

    Kaukametsän ravintolat on Kajaanin Mamselliin kuuluva ravintolayksikkö, joka toimii pääsääntöisesti tilausravintolana. Kajaanin Mamsellin laatiman Laatukäsikirjan mukaan jokaisen Mamsellin omistaman ravintolan on suunniteltava toimipisteelleen palvelukäsikirja, jonka mukaan toimipisteessä toimitaan. Tässä opinnäytetyössä tarkoituksena oli kehittää ja tarkentaa Kaukametsän ravintolan palvelukäsikirjan alkoholijuomia koskevaa kohtaa paremmin käytännön työtä palvelevaksi. Erityise...

  17. Multivalued stochastic delay differential equations and related ...

    African Journals Online (AJOL)

    We study the existence and uniqueness of a solution for the multivalued stochastic differential equation with delay (the multivalued term is of subdifferential type):. dX(t) + aφ (X(t))dt ∍ b(t,X(t), Y(t), Z(t)) dt. ⎨ +σ (t, X (t), Y (t), Z (t)) dW (t), t ∈ (s, T). X(t) = ξ (t - s), t ∈ [s - δ, s]. Specify that in this case the coefficients at time t ...

  18. Modelling of Multi Input Transfer Function for Rainfall Forecasting in Batu City

    OpenAIRE

    Priska Arindya Purnama

    2017-01-01

    The aim of this research is to model and forecast the rainfall in Batu City using multi input transfer function model based on air temperature, humidity, wind speed and cloud. Transfer function model is a multivariate time series model which consists of an output series (Yt) sequence expected to be effected by an input series (Xt) and other inputs in a group called a noise series (Nt). Multi input transfer function model obtained is (b1,s1,r1) (b2,s2,r2) (b3,s3,r3) (b4,s4,r4)(pn,qn) = (0,0,0)...

  19. Hyvinvointipalveluiden tuotteistaminen : palveluinnovaatioiden kehittämismallin toteuttaminen

    OpenAIRE

    Heikkinen, Sami; Freundlich, Heidi; Heininen-Reimi, Taina; Savolainen, Heidi; Saarela, Ulla; Ruuhinen, Miia

    2016-01-01

    Hyvinvointialan kehittämisalusta ja palveluinnovaatiot -hanke toteutettiin Lahden ammattikorkeakoulun sosiaali- ja terveysalalla 1.4.2015–31.3.2016. Euroopan aluekehitysrahaston tukemassa hankkeessa vahvistettiin päijäthämäläisen hyvinvointitoimialan yhteistyötä ja kasvuedellytyksiä sekä edistettiin pitkäjänteisen kehittämistyön jatkoa. Hankkeen tavoitteena oli muodostaa alueelle hyvinvointialan kehittämisalusta ja löytää palveluinnovaatioita, joita kaupallistettaisiin yhdessä palveluntarjoaj...

  20. Mayariggauksen Mekanismit : mihin Maya-rigin perustoiminnot pohjautuvat

    OpenAIRE

    Reimi, Roope

    2015-01-01

    Tämä on tutkielma Mayan yleisimpien riggaustyökalujen ja mekanismien toiminnasta ja yleinen katsaus Mayan pohjarakenteeseen. Maya on Autodeskin yleiskäytännöllinen 3D-ohjelmisto, joka on saanut teollisuuden aloilla maineen luotettavana, mutta haastavana animaatioalustana. Tässä tutkielmassa aion selvittää muutamia konsepteja, jotka saattavat hämmentää Mayassa ja avata sen logiikkaa toimintojensa takana. Aion myös pureutua syvemmin muutamien Mayan perus riggaustyökalujen toimintaan ja millaine...

  1. Kuuntele ja osallistu - Sosiaalinen media myynnin ja markkinoinnin tukena

    OpenAIRE

    Lönnblad, Hanna

    2010-01-01

    Sosiaalinen media on tullut jäädäkseen. Viimeisen kymmenen vuoden aikana IRC-Gallerian, Habbo Hotelin ja Facebookin kaltaiset palvelut ovat omineet itselleen kasvavan osan nykyihmisen ajankäytöstä niin töissä, kouluissa kuin vapaa-ajalla. Sosiaalisen median palveluita pidetään teinien leikkipaikkoina, mutta tosiasiassa uusi media tarjoaa rajattomasti potentiaalia myös yritystoiminnan kehittämiseen ja kasvattamiseen kaiken-kokoisille yrityksille. Virtuaalista maailmaa ei tule väheksyä. Opi...

  2. Muhoksen kunnan viheralueiden hoitoluokitus

    OpenAIRE

    Lämsä, Jaana

    2013-01-01

    Tämän opinnäytetyön tavoitteena oli kartoittaa Muhoksen kunnan taajama-alueella sijaitsevat yleiset viheralueet ja laatia niille viheralueiden hoitoluokitus. Viheralueiden hoito on tärkeää aluei-den viihtyisyyden, turvallisuuden ja käytön takaamiseksi. Hoidosta syntyy paljon kustannuksia, joten viheralueiden hoidon suunnittelu ja kehittäminen auttavat pitämään kustannuksia kurissa. Työn tuloksena kartoitetuista viheralueista syntyi hoitoluokituskartta. Työn tilaaja oli Muhoksen kunnan tekn...

  3. Yrityksen internetsivuston palvelun laadun kehittäminen

    OpenAIRE

    Kova, Johanna

    2012-01-01

    Tänä päivänä internetin merkitys yrityksille on kasvanut valtavasti. Nykyään yhä useampi kuluttaja saa ensivaikutelman yrityksestä sen internetisivujen kautta. Näin ollen yritysten onkin tärkeää panostaa siihen, että kuluttaja löytää kaiken mahdollisen tarvittavan tiedon helposti yrityksen kotisivujen kautta. Opinnäytetyön tavoitteena oli selvittää kiinteistönvälitysalalla toimivan yrityksen internetsivuston palvelun laatua asunnon ostaja-asiakkaiden näkökulmasta ja saada tätä kautta kehittäm...

  4. Valmistalokauppa : Toimintatapa ja omavalvonnan kehitystarpeet Muurametalot Oy:ssä

    OpenAIRE

    Kantola, Jussi

    2012-01-01

    Valmistalokauppa on kehittynyt paljon viimeisten vuosien aikana. Taloja valmistavia yrityksiä on perustettu runsaasti ja valmistalojen kysyntä on kasvanut. Työn tarkoituksena oli päivittää Muurametalot Oy:n omavalvontajärjestelmä vastaamaan paremmin tämän päivän tarpeita. Tavoitteena oli muokata omavalvonnassa käytettävät tarkastuspöytäkirjat nykypäivän asetusten tasolle. Ideaalitilanne olisi, että jokainen työntekijä osallistuu omavalvonnan käyttöön. Järjestelmän periaatteena on tarjota ...

  5. Hatefulle ytringer. Delrapport 3: Grenseoppgangen mellom ytringsfrihet og strafferettslig vern mot hatefulle ytringer

    OpenAIRE

    Wessel-Aas, Jon; Fladmoe, Audun; Nadim, Marjan

    2016-01-01

    De siste årene har hatefulle ytringer på internett fått økt oppmerksomhet i den offentlige debatten. Denne rapporten inneholder en juridisk utredning som har som formål å redegjøre for det strafferettslige vernet mot hatefulle ytringer, basert på gjeldende rett. Gjennomgangen synliggjør dessuten hvilke grupper som er gitt slikt vern. Et forbud mot hatefulle ytringer er et inngrep i ytringsfriheten. Spørsmålet om hvor grensen mellom ytringsfriheten og hva man skal slippe å tåle av hatefulle yt...

  6. Työpajaviikot 2005 - 2006 : Kirkkomännikön koulu

    OpenAIRE

    Kalmari, Sanna

    2006-01-01

    Liikunta on hermoston ohjaamaa lihasten toimintaa. Se on tahdonalaista ja toteutamme sitä tiettyjen tavoitteiden saavuttamiseksi. Lasten tavoitteet ovat erilaisia kuin aikuisten ja liittyvät usein uusien taitojen oppimiseen tai peleissä pärjäämiseen. Sopivan harrastuksen löytäminen voi viedä vuosia. Tutkimusten mukaan lasten terveyden kehittyminen on kääntynyt laskuun ja täysin liikkumattomien, passiivisten lasten joukko kasvaa nopeasti. Nykyään vain joka kolmas lapsi liikkuu tarpeeksi. Olin ...

  7. Palkkahallinnon toimintatapojen tehostaminen päätöksenteon ilmiöitä hyödyntäen

    OpenAIRE

    Kosonen, Virpi

    2017-01-01

    Opinnäytetyön tavoitteena on löytää keinoja palkkahallinnon toimintatapojen tehostamiseen. Palkkahallinto joutuu työskentelemään jatkuvasti tiukkojen aikataulujen puitteissa. Työntekijöiden palkat on saatava ajallaan ja oikein työntekijöiden tileille. Heti, kun palkat on saatu pankkiin, on ne myös ajettava kirjanpitoon tietyn aikataulun mukaan ja tehtävä viranomaisille tarvittavat tilitykset, kuten ennakonpidätys-, sotu-, jäsenmaksu- ja ulosottotilitykset. Koska kaikilla toimenpiteillä on oma...

  8. Comparison of active SIFT-based 3D object recognition algorithms

    CSIR Research Space (South Africa)

    Keaikitse, M

    2013-09-01

    Full Text Available by the author of [8]. The following is the procedure used for obtaining that dataset. The training and testing datasets were captured using a Prosilica GE1900C camera. Everyday objects such as cereal and spice boxes were used. In compiling the training dataset....88 1 Yes Spice Bottle - - No Spray Can - - No Spray Can2 1.39 1 Yes images satisfies the condition: (|xi − xj | ≤ xT = 12) ∧ (|yi − yj | ≤ yT = 4), In our case, however, the camera is fixed and the object is placed on a rotating turntable. As a result...

  9. What makes a beautiful website? : factors influencing perceived website aesthetics

    OpenAIRE

    Noponen, Sampo

    2017-01-01

    Verkkosivujen estetiikka on merkittävä osa sivustojen käyttäjäkokemusta. Kauniiksi mielletty sivusto vaikuttaa positiivisesti verkkosivun käytöstä johtuneeseen kokonaisvaltaiseen kokemukseen. Estetiikkaa on paljon tutkittu ihmisen ja tietokoneen välisessä vuorovaikutuksessa, sekä hieman myös tietojärjestelmätieteen saralla. Tästä huolimatta ei ole olemassa yleisesti hyväksyttyjä periaatteita, miten suunnitella kauniita verkkosivustoja. Täten tässä tutkimuksessa selvitettiin mitkä tekijät vaik...

  10. RSA-salausmenetelmä

    OpenAIRE

    Sipola, T. (Tapani)

    2017-01-01

    Tiivistelmä Tutkielmassa esitellään lyhyesti salakirjoituksen perusperiaatteita. Tämän jälkeen perehdytään RSA-salauksen periaatteeseen, jonka toimivuus todistetaan. Lisäksi kerrotaan RSA-salauksen käytöstä digitaalisessa allekirjoituksessa. Lopuksi perustellaan RSA-salauksen turvallisuutta tutkimalla mahdollisia heikkouksia ja miten niitä voi välttää. RSA-salaus hyödyntää nopeaa potenssiinkorotusalgoritmia, jota sovelletaa...

  11. Mainosvideot Popot Sneaker Storelle

    OpenAIRE

    Perttilä, Miika

    2012-01-01

    Toiminnallisen opinnäytetyön tavoitteena oli tehdä Popot Sneaker Storea hyödyttäviä käytännön markkinoinnin toimenpiteitä tulevaisuuden markkinoinnin kanavassa. Popot Snea-ker Store on retrourheilukenkiä myyvä pieni yritys Helsingin Punavuoressa, joka on menestynyt hyvin aktiivisen markkinoinnin avulla. Tarkoitus oli jatkaa Popot Sneaker Storen aktiivista linjaa markkinoinnissa online-videomarkkinoinnin keinoin. Online-videomarkkinointi valikoitui toimintatavaksi sen vuoksi, että se on mu...

  12. Green Factor -työkalun kehittäminen vanhoille, täydennysrakennettaville asuinalueille : - Case Kaukovainio

    OpenAIRE

    Pehkonen, Leena

    2015-01-01

    Tämä opinnäytetyö on tehty Ympäristöministeriön rahoittaman Tulevaisuuden Kaukovainio -hankkeen KAKETSU (Kaukovainion kestävä tulevaisuus) -osahankkeelle. KAKETSU -hankkeen tavoitteena on kehittää asukaslähtöistä suunnittelua, ekologisten suunnitteluratkaisujen sekä viheraluesuunnittelua palvelevien mallien löytämistä. Opinnäytetyössä tutkittiin Green Factor -laskentamenetelmän käyttökelpoisuutta Kaukovainion asuinalueella, laskentamenetelmän yksittäistä elementtiä tai asiaa korostavan ...

  13. Yritysideasta yritykseksi

    OpenAIRE

    Kolmonen, Kimmo

    2013-01-01

    Tämä opinnäytetyö on uudenlainen portfolio-opinnäytetyö, missä opiskelija kerää opintojaksoilla, harjoittelun sekä opiskelijavaihdon yhteydessä tehtyjä tuotoksia eli projekti- tai muita oppimistehtäviä yhteen ja laatii niiden pohjalta kokoavan raportin, jonka liitteeksi tulevat tuotokset. Tämä opinnäytetyö käsittelee liiketoiminnan käynnistämisen prosessia käytännön esimerkin kautta. Opinnäytetyössä seurattava yritys on Personal Digiguide. Personal Digiguide -yrityksen yritysideana on tar...

  14. Web-sovelluskehityksen tekniikat

    OpenAIRE

    Kettunen, Werner

    2015-01-01

    Web-sovelluskehitykseen käytettäviä tekniikoita, työkaluja ja ohjelmakirjastoja on olemassa useita erilaisia ja niiden lähestymistapa web-sovelluskehitykseen poikkeaa jonkin verran toisistaan. Opinnäytetyössä selvitetään teoriassa ja käytännön esimerkkiprojektin avulla yleisimmin web-sovelluskehityksessä käytettyjä tekniikoita ja kirjastoja. Työssä esimerkkinä luodussa web-sovelluksessa käytettiin Laravel-ohjelmakehystä ja alkuosassa käsiteltyjä työkaluja ja kirjastoja, kuten Bootstrap ja ...

  15. Peitattujen teräslevyjen korroosiosuojauksen kehittäminen

    OpenAIRE

    Pulli, Mikko

    2012-01-01

    Tämän opinnäytetyön toimeksiantaja on Ruukki Metals Oy. Peitattujen teräslevyjen korroosiosuojauksen kehitystarpeet tekivät opinnäytetyön tekemisen aiheelliseksi. Työn tavoite oli löytää korroosiota aiheuttavat tekijät teräslevyjen varastoinnin ja kuljetuksen aikana sekä valita tai kehittää tarvittavat parannukset korroosiosuojaukseen ja pakkaamiseen. Käytettävä tietoperusta saatiin Ruukki Metalsin tuotannon ja tutkimuskeskuksen henkilöstöltä, OAMK:n Raahen kampuksen ja Ruukki Metalsin Raahen...

  16. Kompostoidut kierrätysmateriaalit nurmikon perustamisessa

    OpenAIRE

    Aattela, Evita

    2013-01-01

    Opinnäytetyön aihe liittyy EU:n Life + -ohjelman hankkeeseen LCA in Landscaping eli Elinkaarianalyysin soveltaminen kestävään, kierrätysmateriaaleja hyödyntävään viherrakentamiseen. Hankkeen tavoitteena on elinkaarianalyysin käytön kehittämisen lisäksi selvittää uusien kierrätysmateriaalien käyttöä nurmikon perustamisessa ja hoidossa sekä esitellä uudenlaisia kierrätyspohjaisia materiaaleja ammattimaiseen viherrakentamiseen. Työn toimeksiantaja oli Maa- ja elintarviketalouden tutkimuskeskus (...

  17. Virtual violin in the digital domain : physical modeling and model-based sound synthesis of violin and its interactive application in virtual environment

    OpenAIRE

    Holm, Jan-Markus

    2004-01-01

    Viulun mallintaminen on tunnustettu maailmanlaajuisesti erittäin haasteelliseksi ongelmaksi. Väitöskirjan syntymistä ja tutkimuksessa esitettyjen uusien tekniikoiden kehittämistä ovatkin ohjanneet pitkälle käytännön syyt. On ollut tarve pyrkiä luomaan aiempaa luotettavampia ja todenmukaisempia fysikaalisia malleja, mm. äänisynteesiä varten syntetisaattoreihin ja esimerkiksi mobiililaitteisiin, Jan-Markus Holm kertoo viulun fysikaalista mallintamista käsittelevän väitöstyönsä taustoista....

  18. Ravintola konseptia etsimässä : Eksynyt Willi Hirvi

    OpenAIRE

    Mäntynen, Kaisu

    2014-01-01

    Opinnäytetyön tarkoituksena oli selvittää, millaisia palveluita Hotelli Jämsä Oy:n ravintolan Willi Hirven tulisi tarjota saadakseen toimintansa kannattavaksi. Ravintolan konsepti hakee suuntaansa, ja yritys halusi toiminnan suunnittelun avuksi tietoa palveluiden käyttäjiltä, sekä heiltä jotka eivät niitä käytä. Tutkimuksen kohteena olivat työnsä puolesta hotellissa majoittuvat asiakkaat ja paikalliset asukkaat, joita haluttaisiin palvella paremmin. Tutkimus oli otteeltaan kvalitatiivinen....

  19. Integration of non-Gaussian fields

    DEFF Research Database (Denmark)

    Ditlevsen, Ove Dalager; Mohr, Gunnar; Hoffmeyer, Pernille

    1996-01-01

    The limitations of the validity of the central limit theorem argument as applied to definite integrals of non-Gaussian random fields are empirically explored by way of examples. The purpose is to investigate in specific cases whether the asymptotic convergence to the Gaussian distribution is fast....... and Randrup-Thomsen, S. Reliability of silo ring under lognormal stochastic pressure using stochastic interpolation. Proc. IUTAM Symp., Probabilistic Structural Mechanics: Advances in Structural Reliability Methods, San Antonio, TX, USA, June 1993 (eds.: P. D. Spanos & Y.-T. Wu) pp. 134-162. Springer, Berlin...

  20. Työntekijärekisterin luominen ja käyttöönotto

    OpenAIRE

    Kurkola, Matias

    2010-01-01

    Logistiikan turvallisuudesta huolehtiminen on tärkeä osa kuljetuksiin erikoistuneiden yritysten toimintaa. Yleisesti käytössä olevien turvallisuustyökalujen, kuten esimerkiksi kulunvalvonnan lisäksi toiminnan laatu vaatii tarkkaa henkilö- ja tavarakontrollia. Tämän opinnäytetyön tavoitteena oli luoda TNT Suomi Oy:n Turun toimipisteeseen helppokäyttöinen työntekijärekisteri, joka vähentäisi esimiesten työmäärää vapauttamalla resursseja henkilöstöhallinnosta varsinaiseen esimiestyöhön. Yrity...

  1. Näkyvyyttä ja uusia markkinointikeinoja ranskalaiselle La Cantine-ravintolalle

    OpenAIRE

    Holopainen, Niina; Jännäri, Noora; Tuokko, Jarrad

    2013-01-01

    Tämän opinnäytetyön tarkoituksena oli tehdä markkinointisuunnitelma La Cantine-ravintolalle, joka sijaitsee Munkkiniemessä. Markkinointisuunnitelman tavoitteena oli havainnollistaa yrityksen nykytilannetta markkinoinnin näkökulmasta sekä tutkia yritykselle sopivia markkinointiviestinnän keinoja. Opinnäytetyö koostuu käytännönläheisestä ja teoreettisesta osiosta. La Cantine ravintola on perustettu vasta vuoden 2013 tammikuussa ja ravintolalla ei ole vielä toimivaa markkinointisuunnitelmaa...

  2. Kunnan strateginen johtaminen - tutkimus Seinänaapurikuntien strategiaprosessien ominaispiirteistä ja kunnanjohtajista strategisina johtajina

    OpenAIRE

    Rannisto, Pasi-Heikki

    2005-01-01

    Tutkimusmenetelmät ja tutkimustehtävä Tutkimuksen tehtävänä on selvittää kunnan strategiaprosessi ja strateginen johtaminen kunnanjohtajan kannalta sekä kunnanjohtajan rooli strategian käytäntöön viemisessä. Tutkimuksen kohdekuntina ovat Etelä-Pohjanmaalle sijoittuvan Seinänaapurit -seutukunnan seitsemän kuntaa. Tutkimuksessa tarkastellaan ja arvioidaan kohdekuntien strategiaprosesseja ja kunnanjohtajien toimintaa strategioiden maastouttajina. Lähdeaineistona ovat kansainvälinen strat...

  3. Kuvaus 3D-tulostamisesta hammastekniikassa

    OpenAIRE

    Munne, Mauri; Mustonen, Tuomas; Vähäjylkkä, Jaakko

    2013-01-01

    3D-tulostaminen kehittyy nopeasti ja yleistyy koko ajan. Tulostimien tarkkuuksien kehittyessä 3D-tulostus on ottamassa myös jalansijaa hammastekniikan alalta. Tämän opinnäytetyön tarkoituksena on kuvata 3D-tulostamisen tilaa hammastekniikassa. 3D-tulostaminen on Suomessa vielä melko harvinaista, joten opinnäytetyön tavoitteena on koota yhteen kaikki mahdollinen tieto liittyen 3D-tulostamiseen hammastekniikassa. Tavoitteena on myös 3D-tulostimen testaaminen käytännössä aina suun skannaami...

  4. Konepajatyön laadun vaikutus teräsrakenteen kuumasinkitykseen

    OpenAIRE

    Ahola, Kimmo

    2008-01-01

    Tämän opinnäytetyön aiheena oli Konepajatyön vaikutus teräsrakenteen kuumasinkitykseen. Lujien teräksien käytöllä saavutetaan säästöjä materiaalikustannuksissa ja valmistuksessa. Lopputuotteiden kapasiteettia käyttötarkoituksessa saadaan joissain tapauksissa nostettua. Uusimman sukupolven lujia teräksiä käyttämällä on mahdollista muotoilla yhä lujempia ja kevyempiä rakenteita. Muovattavien ja hitsattavien rakenneterästen myötölujuusluokka on saatu nostettua jo suuruusluokkaan 1000MPa. K...

  5. Military Review. Volume 57, Number 5, May 1977

    Science.gov (United States)

    1977-05-01

    of the Uuited States for F16rnl Yt·nr 1977, 20 .Jnnuury J97G, pP 5·6. 0 Donald H. Rumsfeld, Ann11ul Dc/l’JI8l’ D().JJt!Th11().1!t Rcvort Fiscal Year...3,938 4,711 5,220 Portugal Escudos 12,538 14,699 16,046 16,736 25,108 19,898 18,500 Turkey Liras 6,237 8,487 9,961 12,192 15,831 United Kingdom

  6. Talouspalvelukeskuksen asiakastyytyväisyystutkimus - Kouvolan kaupunki

    OpenAIRE

    Ranne, Jonna

    2011-01-01

    Tutkimuksen tarkoituksena oli selvittää Kouvolan kaupungin Talouspalvelukeskuksen asiakastyytyväisyyden odotusarvot ja tämänhetkinen tyytyväisyyden taso sekä löytää kehityskohteita, joilla tyytyväisyyttä voitaisiin tulevaisuudessa parantaa. Talouspalvelukeskuksen asiakasorganisaatioissa työskenteleville yhteyshenkilöille lähetettiin sähköpostilla linkki tyytyväisyyskyselyyn, johon saatiin yhteensä 273 vastausta. Kokonaistyytyväisyydeksi kouluarvosana-asteikolla mitattuna saatiin 7,8, mikä...

  7. Sosiaalisen median negatiiviset vaikutukset käyttäjälle

    OpenAIRE

    Vidgren, Lilli

    2018-01-01

    Tutkielma on kirjallisuuskatsauksena toteutettu kandidaatintutkielma, jonka tutkimusaihe ja -otsikko on sosiaalisen median negatiiviset vaikutukset käyttä- jälle. Negatiivisia vaikutuksia tutkittiin vapaa-ajan käytön näkökulmasta. Sosiaalinen media on tullut nopeasti tärkeäksi ja välttämättömäksi osaksi ihmisten jokapäiväistä elämää, ja sen jatkuva läsnäolo vaikuttaa sen käyttäjiin negatiivisella tavalla. Negatiivisten vaikutusten tutkimisella ihmiset tulisivat enemmän tieto...

  8. Pinterest affiliate-markkinoijan työkaluna

    OpenAIRE

    Ratilainen, Arto

    2016-01-01

    Opinnäytetyön tarkoituksena oli kartoittaa affiliate-markkinoijien Pinterestin käyttöä ja siitä saatuja tuloksia. Opinnäytetyö toteutettiin All About Dumbbellsille, joka harjoittaa affiliate-markkinointia. Tutkimuksessa haettiin vastauksia siihen, miten affiliate-markkinoijat käyttävät Pinterestiä, miten hyödylliseksi he kokevat sen ja miksi Pinterestin ulkopuolelle jääneet affiliate-markkinoijat eivät käytä sitä. Opinnäytetyön keskeisimmät teoriaosuudet olivat affiliate-markkinointi ja P...

  9. Environment-assisted cracking of cast WE43-T6 magnesium

    International Nuclear Information System (INIS)

    Marrow, T.J.; Bin Ahmad, A.; Khan, I.N.; Sim, S.M.A.; Torkamani, S.

    2004-01-01

    Environment-assisted cracking of WE43 cast magnesium (4.2 wt.% Yt, 2.3 wt.% Nd, 0.7% Zr, 0.8% HRE) in the T6 peak-aged condition was induced in ambient air in notched specimens. The mechanism of fracture was studied using electron backscatter diffraction, serial sectioning and in situ observations of crack propagation. Cracks initiated at the intergranular brittle intermetallic, and propagated by transgranular cleavage. These observations imply that a microstructural model for the static fatigue limit in cast magnesium alloys may be developed which includes the effects of notch-like defects such as porosity

  10. Mustialan maanviljelysopiston ja sen lähiympäristön vanhojen omenapuiden kulttuurinen ja geneettinen monimuotoisuus

    OpenAIRE

    Ahinko, Heli

    2016-01-01

    Luonnonvarakeskuksen (Luke) Nurkkapuuhanke käynnistettiin tammikuussa 2012 keräämään ja täydentämään tarhaomenan paikallislajikkeisiin liittyvää tietoa. Opinnäytetyö on osa Nurkkapuuhanketta ja sen toimeksiantajana toimii Luonnonvarakeskus. Opinnäytetyön tavoitteena oli löytää ja tunnistaa Tammelan kunnassa sijaitsevan Mustialan entisen Maanviljelysopiston, nykyisen Hämeen ammattikorkeakoulun (HAMK) Mustialan yksikön- sekä sen lähialueella kasvavat vanhat omenapuut. Omenapuiden tunteminen mah...

  11. Tulevaisuuden rekrytointimenetelmät

    OpenAIRE

    Tuomi, Janna; Lehtonen, Linda

    2014-01-01

    Rekrytointiala muuttuu vauhdilla ja näin ollen uusia keinoja saavuttaa potentiaaliset työnhakijat tulee koko ajan lisää. Internetin sekä sosiaalisen median käytön lisääntyessä uusille rekrytointikanaville aukeaa koko ajan uusia mahdollisuuksia. Uudet ja vanhat kanavat tasapainottelevat keskenään, tavoitteenaan saada irti se hyöty, mitä uudet mahdollisuudet tuovat mukanaan Opinnäytetyössä tutkittiin erilaisia rekrytointikeinoja ja pyrittiin saamaan kokonaisvaltainen kuva siitä mitä rek...

  12. Markkinointisuunnitelma Case: Ringetteseura Blue Rings

    OpenAIRE

    Seppälä, Minna

    2012-01-01

    Tämän opinnäytetyön tarkoituksena on markkinointisuunnitelman laatiminen ringetteseura Blue Ringsin edustusjoukkueelle. Lähtökohtana on pidetty suunnitelman toteutuskelpoisuutta käytännössä sekä suunnitelman reaalisuutta. Opinnäytetyö on toteutettu projektityönä, jossa on käytetty benchmarkkauksen lisäksi sekä kvalitatiivisia että empiirisiä tutkimusmenetelmiä. Opinnäytetyö koostuu kahdesta osiosta; teoreettinen viitekehys sekä empiirinen osio. Teoriana opinnäytetyössä on käytetty markkinoinn...

  13. Korttitilityspalveluiden kartoitus : Case: Hotelli Haikon Kartano

    OpenAIRE

    Kokko, Saara

    2015-01-01

    Tämä opinnäytetyö toteutettiin toimeksiantona Hotelli Haikon Kartanolle. Opinnäytetyön tarkoituksena oli toteuttaa yritykselle kehittämishanke, jonka tavoitteena oli kartoittaa nykypäivän tarjonnasta yritykselle toimivin ja edullisin korttitilityspalvelu sekä löytää ratkaisuja korttitilitysprosessin automatisoimiseksi. Sysäyksen opinnäytetyöhön antoi työni Hotelli Haikon Kartanon taloushallinnon osastolla myyntireskontran hoitajan tehtävissä. Opinnäytetyö on projektiluontoinen ja tutkielm...

  14. Omaa ääntä etsimässä : syntetisaattorin käyttö Orbit-yhtyeessä

    OpenAIRE

    Myrskog, Mikael

    2014-01-01

    Musiikkikappaleessa on mielestäni oleellisinta sen sisäinen, esteettinen maailma ja se tunne, joka tästä välittyy. Tässä kokonaisuudessa yksi tärkeimmistä tekijöistä on mielestäni kappaleen eri instrumenttien luoma yhteinen saundimaailma. Opinnäytetyössäni tutkin ja kuvailen, miten käytän syntetisaattoreita saundien luomiseen fuusiojazzyhtyeessä Orbit. Mielestäni on tärkeää olla tietoinen siitä musiikin perinteestä, minkä jatkumon osana itse on. Näin esittelen ja analysoin kappaleita,...

  15. Investigation of Novel Molecular Targets for Pleckstrin Homology (PH) Domains Found in Oncogenes Implicated in Breast Cancer

    Science.gov (United States)

    2007-03-01

    protein’s PI3K-dependent roles as a positive regulator of IL- 2 gene induction in T cells (Deckert et al, 1998), NK cell-mediated cytotoxicity...82. Fournier, MV, Guimaraes da Costa, F, Paschoal, ME, Ronco, LV, Carvalho, MG, and Pardee, AB. (1999) Identification of a gene encoding a human...Ipl and Tih1. J Biol Chem. 277(51), 49935-44. Scanlan, MJ, Gout , I, Gordon, CM, Williamson, B, Stockert, E, Gure, AO, Jager, D, Chen, YT, Mackay, A

  16. Identification of Novel Molecular Targets for Pleckstrin Homology (PH) Domains Found in Oncogenes Implicated in Breast Cancer

    Science.gov (United States)

    2008-03-01

    roles as a positive regulator of IL- 2 gene induction in T cells (Deckert et al, 1998), NK cell-mediated cytotoxicity (Jevremovic et al, 2001), and FcRI...Identification of a gene encoding a human oxysterol-binding protein-homologue: a potential general molecular marker for blood dissemination of solid...Biol. 6(5), 384-385. Scanlan, MJ, Gout , I, Gordon, CM, Williamson, B, Stockert, E, Gure, AO, Jager, D, Chen, YT, Mackay, A, O’Hare, MJ, and Old LJ

  17. Characterization of Non-Linearized Spacecraft Relative Motion using Nonlinear Normal Modes

    Science.gov (United States)

    2016-04-20

    the HCW equation (Eq. (2) expressed in terms of relative orbit elements (ROEs) [17], x(t) = −ae 2 cos(β) + xd y(t) = ae sin(β) + yd z(t) = zm cos(ψ...30) where ae, xd , zm are constant and yd(t) = yd0− 32nxdt, β(t) = β0 +nt and ψ(t) = ψ0 +nt are time dependent. It is clear that (ae, zm, xd , yd0, β0...quantities correspond to the ambiguous orbit. It is noted that if the non- drifting condition xd = 0 is satisfied, Eqs. (37-40) will vanish. In the

  18. Jännityselokuvan dramaturgia

    OpenAIRE

    Kaukiainen, Emma

    2011-01-01

    Opinnäytetyö käsittelee elokuvan dramaturgiaa. Työ koostuu elokuvatutkimuksesta ja liitteenä olevasta omasta elokuvakäsikirjoituksesta. Tutkimus keskittyy rikos- ja jännitys-elokuvien genreen, erityisesti trillereihin. Tarkastelen genrelle tyypillisiä juonikuvioita, aiheita, rakenteita ja tapoja luoda jännitystä. Työn tarkoituksena on pohtia, miten genrekonventioita voi käyttää hyväkseen oman käsikirjoituksen tekemisessä. Käytän lähdeaineistona genren elokuvia sekä käsikirjoitusta ja elokuvaa...

  19. Prosessijätevesien puhdistaminen flotaation avulla

    OpenAIRE

    Autio, Antti

    2010-01-01

    Flotaatio on yleisesti käytössä oleva jätevesien puhdistusmenetelmä, jossa käsiteltävään jäteveteen puhalletaan ilmakuplia, jolloin jätevedessä olevat kiintoaineet törmäilevät ilmakupliin ja tarttuvat toisiinsa. Ilmakuplat nostavat partikkelit pintaan, mistä ne poistetaan ylitteenä, ja kirkastettu vesi jatkaa alitteena eteenpäin. Flotaatiota voidaan tehostaa erilaisilla lisäaineilla, jolloin saavutetaan parempia tuloksia aineiden tai niiden yhdistelmien mukaan. Työn toimeksiantajana toimi OMG...

  20. Lihan kahden jalostusasteen laadullinen ja kustannuksellinen vertailu Käpylän palvelukeskuksen ruokapalvelussa

    OpenAIRE

    Ikonen, Mika

    2006-01-01

    Tämä opinnäytetyö vertailee lihan jalostusasteiden, raaka ja kypsä, kustannuksia ja laadun ja työmenetelmien eroavaisuuksia. Tutkimuksen kohteena on seitsemän vastaavaa lihatuotetta kummastakin jalostusasteesta. Tarkoituksena on selvittää jalostusasteiden käytännöllisyys ruokapalvelussa. Teoriaosassa selvitetään ruokatuotantoprosessin kulkua ja työmenetelmiä lihaa käytettäessä ruokapalvelussa. Teoriakehyksessä selvitetään myös kustannuksien muodostuminen kypsennettäessä. Lihaan vaikuttavat la...

  1. LoRa IoT -radion soveltuvuus käytettyjen työkoneiden tiedonsiirtoon

    OpenAIRE

    Hasu, Lassi

    2017-01-01

    Opinnäytetyön tarkoituksena oli tutkia LoRa-radiotekniikan soveltuvuutta lastinkäsittelylaitteiden tuottaman datan tiedonsiirtoon. LoRa on teollisen internetin sovelluksia varten kehitetty pitkän kantaman radiotekniikka. Tavoitteena oli löytää käyttötapauksia, joihin LoRa-tekniikka soveltuu etsittäessä kustannustehokasta radiotekniikkaa erityisesti käytettyihin lastinkäsittelylaitteisiin. Työn toimeksiantaja oli Cargotec Finland Oy:n Kalmar-liiketoimintayksikkö. Työn tutkimusmenetelmänä käyte...

  2. Sertifikaatit ravintolassa : Luomu, UTZ, MSC, ASC

    OpenAIRE

    Hakamäki, Henna

    2017-01-01

    Tämän opinnäytetyön tarkoituksena on selvittää tietävätkö ihmiset, mitä sertifikaatit tarkoittavat, olisivatko asiakkaat valmiita maksamaan sertifioiduista raaka-aineista tehdystä ruoasta enemmän ja markkinoivatko ravintolat käytössä olevia sertifikaatteja riittävästi saadakseen siitä hyödyn. Tulosten perusteella pyrittiin selvittämään kannattaako yritysten panostaa sertifikaattien markkinointiin. Teoriaosassa käsitellään neljää opinnäytetyöhön valikoitua sertifikaattia: luomu, UTZ, MSC ...

  3. Tutkimus raumalaisten naisten sisustustuotteiden ostokäyttäytymisestä

    OpenAIRE

    Vartio, Jenni

    2011-01-01

    Opinnäytteen aiheena oli raumalaisten naisten sisustustuotteiden ostokäyt-täytyminen. Tutkimuksen tavoitteena oli saada selville, mitä raumalaiset naiset ostavat ja etsivät raumalaisista sisustusalan liikkeistä ja kuinka paljon he käyttävät verkkokauppoja sisustustuotteiden ostamiseen. Samalla kartoitettiin, onko Raumalla tarvetta uusille sisustusliikkeille. Myös perheen osallistumista ostopäätökseen kysyttiin. Tällä hetkellä on muodissa ekologisuus ja eettisyys kaikessa kuluttamisessa ja sik...

  4. Asiakkaan turvallisuuskokemus majoitusliikkeessä : Case Hotel Rantasipi Pohjanhovi

    OpenAIRE

    Kilpeläinen, Iida-Maria

    2014-01-01

    Opinnäytetyön tarkoituksena oli selvittää, miten asiakkaiden turvallisuus toteutuu turvallisuuden arvoketjun osiossa majoitusliike. Tavoitteena oli kartoittaa, millaisia ovat hotellin tekemät panostukset turvallisuuden saavuttamiseksi ja miten nämä panostukset vaikuttavat asiakkaan kokemukseen turvallisuudesta. Lisäksi pyrin löytämään yleisimpiä tekijöitä, jotka vaikuttavat asiakkaan turvallisuuskokemuksen syntymiseen. Opinnäytetyön toimeksiantajana toimi Lapin matkailun turvallisuusjärje...

  5. The eSourcing Capability Model for Service Providers: Knowledge Manage-ment across the Sourcing Life-cycle

    OpenAIRE

    Laaksonen, Pekka

    2011-01-01

    Laaksonen, Pekka The eSourcing Capability Model for Service Providers: Knowledge Manage-ment across the Sourcing Life-cycle Jyväskylä: Jyväskylän yliopisto, 2011, 42 s. Tietojärjestelmätiede, kandidaatintutkielma Ohjaaja(t): Käkölä, Timo Tässä kandidaatintutkielmassa selvitettiin sitä, miten the eSourcing Capability Model for Service Providers-mallin käytännöt (practices) ovat liittyneet tietä-myksenhallinnan neljään prosessiin: tiedon luominen, varastointi/noutaminen, jakamine...

  6. Manipulaation merkit : tulkinta toisen maailmansodan propagandajulisteista semioottisen kuva-analyysin keinoin

    OpenAIRE

    Salohalla, Lassi

    2014-01-01

    Tämä opinnäytetyön tavoitteena on tarkastella toisen maailmansodan aikaisten propagandajulisteiden viestintää ja tutkia julisteiden välittämien viestien merkitysten muodostumista. Pyrkimyksenä on löytää propagandajulisteiden kuvituksista ja teksteistä viestinnällisiä piilomerkityksiä ja pohtia viestien lähettäjien päämääriä. Toisen maailmansodan aikaisilla propagandajulisteilla tässä työssä tarkoitetaan vuosien 1939 ja 1945 välillä sotamenestyksen tai kansantalouden edistämistarkoituksiin...

  7. Entsymaattisen Abbott Architect c8000 HbA1c -menetelmän validointi

    OpenAIRE

    Karjalainen, Laura

    2013-01-01

    Opinnäytetyö suoritettiin THL:n Tautiriskiyksikön analyyttisen biokemian laboratoriossa (TLAB). Työssä validoitiin uusi entsymaattinen Abbott Architect c8000 HbA1c -menetelmä, jota käytetään diabetekseen liittyvissä tutkimuksissa. Validoinnilla haluttiin varmistaa uuden mittaustekniikaltaan erilaisen menetelmän toimivuus. Menetelmävertailussa komparatiivisena menetelmänä oli laboratoriossa rutiinikäytössä ollut Abbottin immunoturbidimetrinen HbA1c-menetelmä. Uusi entsymaattinen menetelmä peru...

  8. Algebran ja geometrian yhdyskohtia lukio-opetuksessa ja kuution tilavuuden kahdentaminen

    OpenAIRE

    Tuohilampi, Antti

    2012-01-01

    Työ kertoo kuinka voimme kehittää lukio-opetuksessa algebran ja geometrian yhdyskohtia. Tämä on tarkoitettu lukion pitkän matematiikan analyyttisen geometrian kurssin yhteyteen, tai lisä materiaalina tämän jälkeen esimerkiksi matematiikka kerhoon. Kerron työssäni ensiksi geometrian aksioomista ja aksiomaattisesta todistamisesta. Seuraavaksi tutkin janojen suhteita, verrantoja ja kolmion sivujen suhteita. Jatkan tästä kuution tilavuuden tuplaamiseen. Tarkoituksena on löytää tapa esittää nämä a...

  9. Harrasta terveellisesti ja turvallisesti itsepuolustuslajeja

    OpenAIRE

    Bäckström, Daniela; Arras, Pia

    2012-01-01

    TIIVISTELMÄ Arras, Pia & Bäckström, Daniela. Harrasta terveellisesti ja turvallisesti itsepuolustuslajeja. Helsinki, syksy 2012, 45 s., 2 liitettä. Diakonia-ammattikorkeakoulu, Diak Etelä Helsinki. Hoitotyön koulutusohjelma, sairaanhoitaja (AMK). Opinnäytetyö käynnistettiin Helsingin itsepuolustuskoulun kanssa. Yhteisen hankkeen taustalla ovat samat mielenkiinnon kohteet ja havaittu tarve ensiaputaitojen kehittämiseen. Työelämälähtöisen opinnäytetyön tavoitteena oli tuottaa käytännölli...

  10. Cross-correlation of long-range correlated series

    International Nuclear Information System (INIS)

    Arianos, Sergio; Carbone, Anna

    2009-01-01

    A method for estimating the cross-correlation C xy (τ) of long-range correlated series x(t) and y(t), at varying lags τ and scales n, is proposed. For fractional Brownian motions with Hurst exponents H 1 and H 2 , the asymptotic expression for C xy (τ) depends only on the lag τ (wide-sense stationarity) and scales as a power of n with exponent H 1 +H 2 for τ→0. The method is illustrated on: (i) financial series, to show the leverage effect; (ii) genomic sequences, to estimate the correlations between structural parameters along the chromosomes

  11. Ostotoiminnan laadunvarmistus ja toiminnanohjauksen kehittäminen Mantsinen Group Ltd Oy:ssä

    OpenAIRE

    Hiltunen, Jarmo

    2012-01-01

    Opinnäytetyön aiheena oli ostotoiminnan laadunvarmistuksen ja toiminnanohjauksen kehittäminen Mantsinen Group Ltd Oy:ssä. Työssä on perehdytty erityisesti niihin ostotoiminnan laadun kehittämisen haasteisiin mitkä liittyvät alihankintaostamisen osa-alueeseen. Opinnäytetyön päätavoitteena oli luoda työkaluja hankinnan laadun jatkuvan parantamisen avuksi. Lisäksi tavoitteena oli perehtyä hankintojen mittaamisen teoriaan. Opinnäytetyön tutkimusmenetelmänä on käytetty käytännön tietoa ostam...

  12. Ravintola Xn markkinointisuunnitelma : Nykytilan kartoitus ja kehitysideoita

    OpenAIRE

    Koivunen, Saara

    2015-01-01

    Tämän työn tarkoitus oli kartoittaa koulu Yn opetusravintola Ravintola Xn markkinoinnin nykytilanne ja etsiä siihen uusia näkökulmia kehitysehdotusten avulla. Työn tavoitteena oli luoda ravintolalle sen toiminta-ajan ensimmäinen käytännön markkinointisuunnitelma, jota ravintolan johto voi käyttää työkalunaan. Suunnitelmassa keskityttiin ulkoiseen markkinointiin ja painotettiin valittuja kilpailukeinoja, jotka pohjautuvat 5P-malliin. Työ toteutettiin tutkimuksellisena kehittämistyönä lähes...

  13. Viestintä ja sen vaikutus palveluun opiskelijaravintolassa

    OpenAIRE

    Ilvonen, Satu

    2015-01-01

    Sain ajatuksen opinnäytetyöhön huomatessani puutteita useiden opiskelijaravintoloiden tiedottamisessa. Tavoitteena oli löytää keinoja parantaa palvelun laatua vaikuttamalla asiakkaiden valintoihin ja käyttäytymiseen toimivalla viestinnällä. Työn teoriaosuus kertoo viestinnästä ja tiedottamisesta. Viestinnän merkitys on suuri ja sen puuttuminen kokonaan tai osittain voi aiheuttaa suurtakin vahinkoa. Palveluyrityksessä sisäinen viestintä on elinehto ja siihen tulisi panostaa jo tuottavuusnä...

  14. Manufacturing leisure - Innovations in happiness, well-being and fun

    OpenAIRE

    Pantzar, Mika; Shove, Elizabeth

    2005-01-01

    Kulutus ja vapaa-ajan talous ovat nousseet useissa länsimaissa elinkeinopoliittisen keskustelun huomion kohteeksi viime vuosina. Talouden kasvu on nähty yhä enemmän tapahtuvan ns. elämystalouden ja viihdeteollisuuden virittämänä. Manufacturing leisure - Innovations in happiness, well-being and fun lähestyy vapaa-ajan klusteria kuluttajien vapaa-ajan käytäntöjen näkökulmasta. Saksalaiset, englantilaiset ja suomalaiset tutkijat pyrkivät vastaamaan muun muassa seuraaviin kysymyksiin: · Minkälais...

  15. Structures to Resist the Effects of Accidental Explosions

    Science.gov (United States)

    1969-06-01

    a VL tan Oily an12 L tan 120Lytn tn2 2L ta (ta L120\\12 L tannfv+G tan tan Ltan-~n&ý 12 YtAn12*+(H-y)tafl12o.tn-8 t~Fl..i. I H - tae+(- fta ~v-tn y/L7" 2...ONE SIDE FRE I d) FOUR SIDES SUPPORTED Fgw -. ipcLIci., fmd iea d deine. l cing. 1: 77 9~#4 󈧄 HORIZ. / HORI. LVERTuw l I [ VERT. IR EDA OE SE F VER

  16. Tietoturvallisuusauditointi ISO 27000-viitekehyksessä

    OpenAIRE

    Luoma, Ilmari

    2015-01-01

    Tiedon olemassaolo eri olomuodoissa muodostaa vaikeasti hallittavan uhkakentän, jonka käsittelyyn kansainvälisesti hyväksytty ISO 27000 -standardi on hyvä väline. Työn tarkoitus on perehtyä ISO/IEC 27000 -standardisarjaan, soveltaa standardin vaatimuksia laatimalla tietoturvallisuuden auditointiaineisto ja -menetelmä, sekä toteuttaa tietoturvallisuusauditointi käytännössä. Työssä esitellään tietoturvallisuuden kytkeytyminen yritysturvallisuuteen, tietoturvallisuuden osa-alueittainen ...

  17. Median vaikutukset 0-12 -vuotiaiden lasten terveyteen ja hyvinvointiin : Kirjallisuuskatsaus

    OpenAIRE

    Paalimäki, Niina

    2015-01-01

    Digitaalinen media, kuten tietokone ja televisio, ovat nykyisin merkittävä osa lapsen arkipäivää iästä riippumatta. Lähes jokaisessa länsimaalaisessa perheessä on televisio ja lisäksi lapset altistuvat usein muullekin medialle, kuten videopeleille ja internetille, niin kotona kuin kodin ulkopuolella. Myös lehdet ja kirjat ovat edelleen osa lapsen mediaympäristöä. Mediankäytön lisääntymisen myötä media on entistä useammin noussut puheenaiheeksi eri konteksteissa ja viime aikoina etenkin lasten...

  18. Social Phobia among Finnish Adolescents: Assessment, Epidemiology, Comorbidity, and Correlates

    OpenAIRE

    Ranta, Klaus

    2008-01-01

    Sosiaalisten tilanteiden pelko (STP) on ahdistuneisuushäiriö, jonka keskeisenä oireena on voimakas pelko joutua kielteisen arvioinnin kohteeksi sosiaalisessa tai esiintymistilanteessa. Häiriö johtaa kärsimykseen näissä tilanteissa ja usein sosiaalisten tilanteiden välttämiseen. Aiempi tutkimus viittaa siihen, että STP kliinisenä häiriönä kehittyy valtaosin nuoruusiän aikana, on kulultaan pitkäaikainen ja edeltää masennustilojen, myöhempien ahdistuneisuushäiriöiden ja päihteiden käytön puhkeam...

  19. Luomulihan käyttö ammattikeittiöissä

    OpenAIRE

    Lehtinen, Markus

    2012-01-01

    Eettisien ja ekologisien arvojen huomioiminen elintarvikkeissa sekä niiden valmistuksessa ovat kasvaneet nykypäivänä kulutuksen myötä. Kuluttajat haluavat yhä enemmän tietää käyttämiensä elintarvikkeiden alkuperästä ja tuotantotavoista. Tutkimuksen tarkoituksena oli selvittää Portaat Luomuun -ohjelmassa olevien keittiöiden luomulihan käyttöä, halukkuutta luomulihan käytön lisäämiseen sekä asiakkaiden mahdollisia vaatimuksia. Lisäksi haluttiin selvittää, mitä luomulihatuotteita ammattikeit...

  20. Tietoisuustaitoihin perustuvat menetelmät toimintaterapiassa : kirjallisuuskatsaus

    OpenAIRE

    Norring, Jaana

    2013-01-01

    Tämän opinnäytetyön tarkoituksena oli helpottaa tietoisuustaitoihin perehtyneen suomalaisen toimintaterapeutin mahdollisuutta ottaa tietoisuustaidot terapiakäyttöön. Opinnäytetyö selvittää, miten tietoisuustaitoja on käytetty toimintaterapian asiakastyössä. Siinä esitetään tietoa siitä, mitä tietoisuustaitoihin perustuvia menetelmiä on tutkittu toimintaterapiassa ja minkä asiakasryhmien parissa tutkimusta on tehty sekä arvioidaan tutkimusten näytön tasoa. Opinnäytetyö toteutettiin integro...

  1. Tieto- ja viestintätekniikan opetuskäyttö opettajaksi opiskelevien harjoittelutilanteissa ja siihen vaikuttaneet tekijät

    OpenAIRE

    Fagerlund, Janne

    2015-01-01

    Tässä tutkimuksessa selvitettiin luokanopettajaopiskelijoiden kokemuksia tieto- ja viestintätekniikan (TVT) opetuskäytössä opettajankoulutuksen mahdollistamissa harjoittelutilanteissa sekä käyttöön vaikuttaneita tekijöitä. TVT:n opetuskäyttö on eräs kasvatuksen ja koulutuksen ajankohtaisimmista ja tutkituimmista osa-alueista, sillä sen hyötyjä opetuksessa ja oppimisessa voidaan perustella monista pedagogisista näkökulmista. TVT:n opetuskäyttö on sekä kansainvälisten että valtakunnallisten tut...

  2. Tuotannon layoutin suunnittelu Flinkenberg OY:lle

    OpenAIRE

    Puotiniemi, Olli

    2013-01-01

    Opinnäytetyön aiheena on layoutsuunnittelu Flinkenberg Oy:lle. Yrityksen on tarkoitus tulevaisuudessa hankkia uusi työstökone nykyisiin toimitiloihin. Siitä seurasi tarve saada uusi layoutsuunnitelma tuotantohallista vanhan tilalle. Myös vanha layout kaipasi päivitystä. Opinnäytetyössä on pyritty soveltamaan jo olemassa olevaa teoriaa ja käytäntöä layoutsuunnittelussa. Teoriaa oli tarjolla paljon, ja olikin tärkeää osata perehtyä vain olennaiseen. Siihen tässäkin tutkimuksessa on pyritty....

  3. ZERAFF - tekstiileiden myyntikaluste

    OpenAIRE

    Palomäki, Hanne

    2013-01-01

    Opinnäytteen tehtävänä oli luoda kannettava ja pieneen tilaan mahtuva myyntikaluste tekstiilituotteille. Opinnäytteen toimeksiantajana oli Tekstiiliverstas, joka valmistaa kudonta-tekniikalla huiveja ja peitteitä. Tekstiiliverstas myy tuotteitaan pääasiassa erilaisissa myyn-titapahtumissa, mutta sillä ei ole käytössään tapahtumiin soveltuvaa kalustetta. Tarve tekstiilituotteet huomioon ottavalle kalusteelle oli ilmeinen. Täydellinen tuote Tekstii-liverstaan käyttöön on kevyt, kannettava ja...

  4. Akseligeneraattorin hybridikäyttö

    OpenAIRE

    Haukka, Jari

    2014-01-01

    Opinnäytetyön tavoitteena oli tuottaa selkeä informaatiopaketti koskien akseli-generaattorin hybridikäyttöä. Informaatiopaketin tarkoituksena oli tuoda ilmi akseligeneraattorin hybridikäytön toimintaa ja mahdollisuuksia lähtemällä liikkeelle vertailun mahdollistavista erilaisista olemassa olevista propulsiotyypeistä. Vertailukohteista opinnäytetyö eteni järjestelmän tärkeimpiin yksittäisiin komponentteihin ja niiden toimintaan, päätyen lopulta itse akseligeneraattorin hybridikäyttöön kokonais...

  5. Markkinointisuunnitelma Carean Helmi -kahvilalle

    OpenAIRE

    Pöyhönen, Terhi

    2013-01-01

    Tämän opinnäytetyön tarkoituksena oli tuottaa Helmi Cafelle markkinointisuunnitelma, jota se voi hyödyntää markkinoinnissaan. Tavoitteena oli tuoda esiin seikkoja, joiden avulla Helmi Cafe saa kasvatettua tunnettuuttaan ja tuotua toimintaideologiaansa ihmisten tietoisuuteen. Työn tavoitteena oli myös kehittää kahvilalle keinoja markkinoida palvelujaan tehokkaammin. Työ toteutettiin kirjoituspöytätyyppisenä tutkimuksena, jossa tutustuttiin markkinoinnin teorioihin ja sovellettiin niitä Hel...

  6. S1-luokan elementtiväestönsuojan käyttö asuinkerrostalossa

    OpenAIRE

    Uski, Reijo

    2012-01-01

    Opinnäytetyössä on laadittu ajanmukainen ja tiivis ohje elementtirakenteisen väestönsuojan käytöstä uudisrakentamisessa. Työssä selvitetään kahden erilaisen elementtiväestönsuojan tyypin rakenneperiaatteita sekä käyttöä talonrakentamisessa. Samalla vertaillaan elementtirakenteisen ja perinteisen massiivirakenteisen paikallavaletun väestönsuojan hyviä ja huonoja ominaisuuksia erityisesti työmaan näkökulmasta. Opinnäytetyössä käsitellään lyhyesti väestönsuojan elementtitekniikan ongelmakohtia....

  7. Virtuaalisen yhteisöllisyyden vaikutus fyysiseen aktiivisuuteen : tyypin 2 diabeetikoilla

    OpenAIRE

    Ruuska, Juha-Pekka; Wirtanen, Jenni-Henrietta

    2012-01-01

    Ihmisten fyysinen aktiivisuus on huomattavasti vähentynyt viime vuosikymmenten aikana. Tämän sekä nykyisten ravitsemustottumusten seurauksena tyypin 2 diabeteksesta on tullut hyvinvointimaissa kasvava terveydenhuollon haaste ja taloudellisesti kuormittava ongelma. Liikunnalla on todettu olevan suotuisia vaikutuksia tyypin 2 diabeteksen ehkäisyssä ja hoidossa. Tästä syystä on tärkeää löytää keinoja joilla voidaan vaikuttaa ihmisten liikuntatottumuksiin. Tämän opinnäytetyön tarkoituksena oli...

  8. ”Rakastava ja fiksu ihminen ja se keittää aina hyvät kahvit” : Yhteisöllinen valokuvaprojekti kehitysvammaisten ohjatun asumisen kodissa

    OpenAIRE

    Saarinen, Kirsi

    2013-01-01

    Opinnäytetyön tavoitteena oli toteuttaa kehitysvammaisten aikuisten ohjatun asumisen yksikössä Puistokodissa sen yhteisöllisyyttä ja viihtyisyyttä tukeva valokuvaprojekti. Projektin aikana kerätyn tutkimusaineiston avulla haluttiin lisäksi tuottaa tietoa valokuvatyöskentelyn toimivuudesta ja siihen liittyvistä hyvistä käytännöistä Puistokodin asukkaiden hyvinvoinnin tukemiseksi mahdollisesti myös tulevaisuudessa. Asukkaat osallistuivat valokuvaprojektin aikana kuuteen ryhmätapaamise...

  9. Nokkoskuidun tunnistusmenetelmät

    OpenAIRE

    Suomela, Jenni

    2015-01-01

    Nokkosta (Urtica dioica) on käytetty tekstiilikuituna muiden runkokuitujen ohella. Sen kulttuurihistoriallinen merkitys on osittain hämärän peitossa, koska tutkimusta on tehty sen osalta vähäisesti. Merkittävimpänä syynä tähän on se, että nokkoskuitu on mikroskooppisilta ominaisuuksiltaan hyvin samankaltainen muiden runkokuitujen kanssa, joten sen tunnistus on saattanut olla puutteellista. Tämän tutkielman tarkoitus on ollut löytää nokkoselle ominaiset tunnuspiirteet ja menetelmät joilla n...

  10. Encountering Difference. The experience of highly skilled Nordic citizens in India

    OpenAIRE

    Foulkes Savinetti, Nicol

    2015-01-01

    Erilaisuutta kohtaamassa Korkeastikoulutettujen pohjoismaiden kansalaisten kokemuksia Intiassa Väitöskirjatyössä tarkastellaan Intiassa tilapäisesti työskenteleviä suomalaisia ja tanskalaisia korkeasti koulutettuja henkilöitä ja selvitetään kuinka muuttaminen Mumbain, Delhin ja Bangaloren haasteellisiin miljoonakaupunkeihin vaikuttaa heidän kansalaisuuteensa, suhteessa niin julkiseen valtaan, työmarkkinoihin, ja laajemmin yhteisöihin ja fyysiseen ympäristöön. Käytän Rainer Bauböckin ka...

  11. Vanhempien kasvatustyylit nuorten kokemina – Yhteydet koettuun elämäntyytyväisyyteen, yksinäisyyteen ja itsetuntoon

    OpenAIRE

    Savolainen, Juska

    2017-01-01

    Nykyyhteiskunnan modernisoituminen ja valinnan mahdollisuuksien kasvaminen ovat edes-auttaneet vanhempien yksilöllisten kasvatusratkaisujen tekemistä. Tämän hetken vanhem-muutta kuvailevat valinnanmahdollisuudet, mutta myös yhä kasvavat haasteet pätevästä kasvattamisesta. Toisaalta tutkijat myös raportoivat yhä enemmän nuorten kasvavia hyvinvoinnin riskejä, kuten yksinäisyyttä ja pahaa oloa. Tämä tutkimus pyrkii löytämään yhteyksiä vanhempien käyttämien eri kasvatustyylien ja nuorten kokemien...

  12. Kuntien itsehallinnollinen asema kaavoituksessa

    OpenAIRE

    Prusi, Tuija

    2013-01-01

    Kuntien oikeutta ja velvollisuutta vastata maankäytön suunnittelustaan kutsutaan ”kaavoitusmonopoliksi”. Nykyisin käytetään myös käsitettä ”suunnittelumonopoli”, jota rajoittavat ensinnäkin rakennuslainsäädännön aineelliset, harkintaa rajoittavat säännökset, toiseksi valtakunnalliset alueidenkäyttötavoitteet ja kolmanneksi maakunnallisten suunnitelmien ohjausvaikutus. Maankäyttö- ja rakennuslaissa (MRL) on asetettu kuntatason kaavojen laatimiselle menettely- ja sisältövaatimukset, joita on as...

  13. Makuuhuonekalusteiden suunnittelu Kiteen Huonekalutehtaalle

    OpenAIRE

    Toivanen, Riitta-Liisa

    2011-01-01

    Opinnäytetyöni aiheena oli makuuhuonekalusteiden suunnittelu Kiteen Huonekalutehtaalle. Toimeksiannon lähtökohtana oli yrityksen tarve kehittää uusia makuuhuonekalusteita markkinoitaviksi jälleenmyyjille. Suunnittelun pääkohteena oli sänky, jonka jälkeen tuotesarjaan lisättiin yöpöytä tai lipasto. Työ alkoi tiedonhaulla, jolla kartoitettiin toimeksiantajan tuotevalikoimaa, tuotantoa ja mahdollisia asiakaskuntia. Aihetta lähestyttiin myös tutustumalla tämän hetken trendeihin, kuluttajien ...

  14. Die Fantasie Tarot : konsepti Tarot-korttipakalle

    OpenAIRE

    Hanninen, Kai

    2014-01-01

    Tässä opinnäytetyössä käsittelen Tarot-korttipakkaa, sen historiaa ja symboliikkaa. Tarkoituksenani on luoda konsepti kaupallisesti julkaistavalle korttipakalle joka on yhtenevä korteista jo julkaistujen tulkintojen kanssa. Käytän työssäni sekä perinteisiä että nykyaikaisia kuvitustekniikoita. Asiasanat: kuvitus, symboliikka, Tarot, hah- mosuunnittelu, konseptisuunnittelu In this graduation project I’m covering the history, symbolicism and use of Tarot-Decks. The purpose of the project ...

  15. Digitaalinen markkinointi pk-yrityksessä inbound-markkinoinnin keinoin CASE: Customer Intelligence Finland Oy

    OpenAIRE

    Lassila, Anna-Sofia

    2016-01-01

    Tämän opinnäytetyön tarkoituksena oli tutkia kuinka digitaalista markkinointia kannattaa tehdä inbound-markkinoinnin keinoin. Tutkimuksen ensisijaisena tavoitteena oli löytää tehokkaimmat keinot inbound-markkinoinnin toteuttamiseen. Toisena tavoitteena oli antaa tuloksiin pohjautuen suosituksia digitaalisen markkinoinnin jatkotoimenpiteistä inbound-metodia hyödyntäen. Tämän opinnäytetyön toimeksiantajana toimi Customer Intelligence Finland Oy (CIFI). Tämän opinnäytetyön tutkimusmenetelmän...

  16. Nuorten sosiaalisen median käyttö tiedonhankinnassa

    OpenAIRE

    Simolin, Annina

    2017-01-01

    Opinnäytetyön toimeksiantajana on Hämeen ammattikorkeakoulun strateginen viestintä, joka vastaa muun muassa opiskelijahankinnasta. HAMKilla on tällä hetkellä käytössään useita sosiaalisen median kanavia, ja työllä haluttiin selvittää mistä kanavista ja mitä tietoa nuoret erityisesti hakevat jatko-opintoja suunnitellessaan. Lisäksi haluttiin selvittää miten nuoret haluavat itse olla yhteydessä oppilaitoksiin hakuaikana. Teoriaosiossa on käsitelty nuorten mediakäyttäytymistä sekä useita sosiaal...

  17. Allasterapia osana neurologista kuntoutusta

    OpenAIRE

    Laaksonen, Aino; Lahti, Janina; Saastamoinen, Maarit; Salmi, Sirja

    2009-01-01

    Opinnäytetyön tarkoituksena oli koota teoriatietoa allasterapiasta ja erityisesti sen soveltuvuudesta neurologisille kuntoutujille. Opinnäytetyö toteutettiin vuoden 2009 aikana. Opinnäytetyön aineisto koottiin kirjallisuuskatsauksen ja avoimen teemahaastattelun avulla. Kirjallisuutta ja tutki-mustietoa neurologisesta allasterapiasta on vähän, ja se irrallista, joten teemahaastatteluista laaditulla vapaamuotoi-sella yhteenvedolla opinnäytetyöhön saatiin mukaan myös käytännönkokemuksia. Opinnäy...

  18. Partneriverkoston johtaminen osana hankinnan johtamista

    OpenAIRE

    Hyrynen, Katja

    2010-01-01

    Tämän opinnäytteen tarkoitus oli luoda kohdeyritykselle teorian kautta johdettu ajatusmalli ja työkaluja, joiden avulla partneriverkosto saadaan liitettyä sujuvasti osaksi hankintatoimen johtamista ja osaksi hankinnan ja koko yrityksen prosessia. Tavoitteena oli, että partneriverkoston johtamisen avulla pystytään mahdollisimman tehokkaasti löytämään omaa organisaatiota hyödyttävät tekijät, sekä taloudellista kehitystä että osaamispääoman kasvattamista tukevat. Partneriverkoston johtamis...

  19. 3D- Visualisointipalveluiden toimintaedellytysten selvittäminen Jyväskylän seudulla

    OpenAIRE

    Lahtinen, Johanna

    2013-01-01

    Opinnäytetyössä tutkittiin, millaisilla markkinoilla toimeksiantaja, Visualisointipalvelu Divion toimii kilpailun näkökulmasta ja miten nämä asiat vaikuttavat yrityksen tulevaisuuden suunnitelmiin. Tutkimuksen tavoitteena oli selvittää, mitä alalla toimivat kilpailijat ajattelevat itsestään ja omista ja kilpailijoidensa toiminta mahdollisuuksista nyt ja tulevaisuudessa. Aihe oli toimeksiantajalle tarpellinen, sillä yrityksellä ei ollut käytössään aiempaa kilpailijatietoutta, jonka avulla se v...

  20. Mekaniikkasuunittelijoiden metakognitiivisen tietoisuuden kehittäminen

    OpenAIRE

    Kyttänen, Pasi-Pekka

    2007-01-01

    Tutkimuksen tarkoituksena oli tarkastella mekaniikkasuunnittelijoiden metakognitiivista tietoisuutta ja kehittää sitä tukevia käytäntöjä ja välineitä. Tarve tutkimuksen tekemiseen tuli havaituista ongelmista, jotka liittyivät suunnittelijoiden osaamiseen, oppimiseen, itsensä kehittämiseen sekä suunnittelutehtävän hallintaan. Mekaniikkasuunnittelijan työ on itsenäistä ja vastuullista, suuren ja kompleksisen tiedon kognitiivista käsittelyä. Suunnittelumaailma on hektinen ja jo...

  1. Käden pakotettu käyttö : vaikuttava aivohalvauspotilaan kuntoutusmenetelmä

    OpenAIRE

    Hänninen, Kati; Näsi, Minna

    2007-01-01

    Opinnäytetyön tarkoituksena oli käsitellä käden pakotettua käyttöä aivohalvauspotilaan kuntoutusmenetelmänä ja tuoda esille sen vaikuttavuutta halvaantuneen yläraajan toimintakyvyn edistämisen kannalta. Tavoitteena oli kirjallisuuskatsauksen ja tapausesimerkin avulla luoda kattava kokonaisuus käden pakotetun käytön kuntoutuksesta. Lähdeaineistona käytettiin uusimpia aiheeseen liittyviä tutkimuksia, monipuolista kirjallisuutta sekä tapausesimerkin henkilökohtaisia tiedonantoja. Opinnäytetyössä...

  2. Treatment-Induced Autophagy Associated with Tumor Dormancy and Relapse

    Science.gov (United States)

    2017-07-01

    Monogr. 10021, 57e71. http://dx.doi.org/10.1093/jncimonographs/lgh014. McWhinney, S.R., Goldberg , R.M., McLeod, H.L., 2009. Platinum neurotoxicity... variations on a common theme of self-eating? Nat Rev Mol Cell Biol 13: 7 – 12 Cohen-Kaplan V, Livneh I, Avni N, Fabre B, Ziv T, Kwon YT, Ciechanover A (2016...Hippo kinases STK3/STK4 is essential for autophagy. Mol Cell 57: 55 – 68 Wing SS, Chiang HL, Goldberg AL, Dice JF (1991) Proteins containing peptide

  3. Paloauton ohjaus ohjelmoitavalla logiikalla

    OpenAIRE

    Mäkilä, Tero

    2010-01-01

    Paloautoja valmistetaan tarpeista riippuen pienistä pakettiautokokoluokan autoista isoihin säiliöautoihin. Toimilaitteiden lisääntyminen ja monimutkaistuminen ovat tuoneet mukanaan myös ohjaustarpeiden kasvamiseen. Tämän opinnäytetyön tarkoituksena oli suunnitella kosketusnäytöllä varustettu logiikkaohjaus kevytpaloauton järjestelmien ohjaukseen. Työn tuloksena saatiin logiikkaohjelma, joka ohjaan paloauton toimintoja, sekä käyttöpaneelin ohjelma, joka välittää käyttäjälle informaatio...

  4. Film noir -elokuvien vaikutus 1950- ja 1960-lukujen suomalaiseen rikoselokuvaan

    OpenAIRE

    Seppänen, Nina

    2010-01-01

    Opinnäytetyössä tutkittiin, onko yhdysvaltalainen elokuvasuuntaus film noir vaikuttanut suomalaiseen 1950- ja 1960-lukujen rikoselokuvaan. Film noir –elokuvat ovat synkkäsävyisiä rikosdraamoja, joiden henkilögalleriaan kuuluu kovapintaisia yksityisetsiviä, vietteleviä femme fataleja ja murhanhimoisia rikollisia. Tutkimuksen tavoitteena on verrata kahta elokuvasuuntausta keskenään ja pyrkiä löytämään niiden erot ja yhtäläisyydet sekä syyt näille. Tutkimus suoritettiin kvalitatiivisin menet...

  5. Vedonlyöntiä virtuaalipyssyillä – anteeksi mitä? : Pelaajien näkemyksiä ja kokemuksia skinivedonlyönnistä

    OpenAIRE

    Valkama, Suvi

    2016-01-01

    Rahapelaaminen ja digipelaaminen elää nykyään jo eräänlaisessa symbioosissa. Verkkorahapelaaminen ammentaa vaikutteita molemmilta sektoreilta. Mahdollisten pelihaittojen ja -ongelmien ehkäisemisen vuoksi on tärkeää, että kasvattajat ja vanhemmat, sosiaalialan ammattilaiset ja muut toimijat tällä saralla saavat ajantasaista tietoa uusista ilmiöistä koskien raha- ja digipelaamista. Tämän opinnäytetyön tavoitteena oli tuottaa uutta tietoa virtuaalisilla esineillä käytävästä vedonlyönnistä. T...

  6. Ei haukku haavaa tee : koiran vaikutus lapsen toimintaan ja toiminnallisuuden kehitykseen

    OpenAIRE

    Ansamaa, Katariina; Kaitila, Emmi

    2014-01-01

    Eläinten vaikutuksesta ihmisen terveyteen ja hyvinvointiin on olemassa paljon tutkimuksia. Myös eläinavusteisesta terapiasta on tutkimuksia, mutta koira-avusteisen terapian tutkimustieto on vielä vähäistä. Toimintaterapiassa koiran avulla voidaan pyrkiä löytämään ja mahdollistamaan asiakkaalle arjen merkityksellisiä toimintoja. Tämän opinnäytetyön tarkoituksena oli kerätä tietoa lasten koira-avusteisesta toimintaterapiasta. Teoreettinen viitekehys muodostuu eläin- ja koira-avusteisen terapian...

  7. Prosessipuhdistusmenetelmät laivoilla

    OpenAIRE

    Karvali, Ville

    2017-01-01

    Prosessipuhdistusta käytetään laajasti teollisuuden tarpeisiin, mutta laivoilla sen käyt-tö rajoittuu laivan rakentamisen ja telakoinnin yhteyteen. Suuri tekijä tähän on tiedon puute erilaisista puhdistusmahdollisuuksista. Työssä selvitetään erilaisten työtapojen käyttömahdollisuuksia laivalla myös satamassa ja merellä ollessa. Tiedon lisääntyessä erilaisten puhdistusmahdollisuuksien käyttö helpottuu. Lähdemateriaalina prosessipuhdistusmenetelmille on käytetty toimeksiantajalta tullut-ta ...

  8. Siivouksen laadunhallinta asuinkiinteistöissä

    OpenAIRE

    Huhmarkangas, Riikka

    2013-01-01

    Työssäni kehitettiin siivouksen laadunhallintaa VTS-kotien asuinkiinteistöissä. Pääpaino oli VTS Kiinteistöpalvelu Oy:n käytössä olevan laadunarviointiohjelman kehittämisessä. Työssäni kartoitettiin, mitä ja miten pitää kehittää asuinkiinteistösiivouksen laadunhallintaa myös tulevaisuudessa. Lähtökohtana oli se, että siivouksen taso tulee saada samalle linjalle kaikkien palveluntuottajien kanssa riippumatta siitä, kuka palvelua tuottaa. Jokaisessa VTS-kodissa tulisi siivouksen lopputulos ...

  9. DirectX 11 -grafiikkamoottori ja BRDF-mallit

    OpenAIRE

    Niemi, Teemu

    2017-01-01

    Opinnäytetyön tavoitteena oli luoda grafiikkamoottori, jolla voidaan esitellä yleisempiä tietokonegrafiikassa käytettyjä BRDF-malleja. Työssä luotu grafiikkamoottori suunniteltiin niin, että sillä on helppo valita eri BRDF-malleja tarkastelua varten kevyen käyttöliittymän avulla. Toisena päätavoitteena työssä oli tutustua BRDF-mallien taustalla olevaan matematiikkaan sekä BRDF-mallien toteuttamiseen näytönohjaimessa suoritettavilla varjostinohjelmilla. Työn teoriaosassa kerrotaan BRDF-mall...

  10. Tehoa pienyrityksen markkinointiin Facebookista. Case: Vaateliike Leija

    OpenAIRE

    Ruismäki, Anna

    2016-01-01

    Opinnäytetyön tavoitteena oli selvittää Facebook-markkinoinnin keinoja. Työssä on laadittu yksityiskohtaiset ohjeet markkinoinnin aloittamiselle sekä siinä huomioonotettaville tekijöille. Työn toimeksiantajana toimi Suomessa toimiva vaatetusalan yritys. Työ oli toimeksiantajayritykselle tarvelähtöinen, sillä yrityksellä ei ollut ennalta kokemusta tai tietotaitoa Facebook-markkinoinnista. Työn tavoitteena oli myös löytää perusteita sille, että Facebook on toimeksiantajan ja tämän kohderyhmän k...

  11. Kattilantestauslaboratorion huolto- ja kunnossapitosuunnitelma

    OpenAIRE

    Muurikainen, Matias

    2017-01-01

    Jyväskylän ammattikorkeakoululla on kattilantestauslaboratorio Biotalousinstituutissa Saarijärvellä. Biotalousinstituutilla ei ollut viralliselle kattilantestauslaitteistolle huolto- ja kunnossapitosuunnitelmaa. Opinnäytetyön tarkoituksena oli luoda helppokäyttöinen ja helposti muokattava Excel-tiedosto, mistä henkilökunta voi löytää kunkin laitteen yksityiskohtaiset ohjeet. Kattilantestauslaboratoriossa on suuri määrä laitteita, jotka eivät liity välittömästi kattilantestaustoimintaan. Tä...

  12. Markkinointiviestinnän kehityssuunnitelma tilausravintolan syys- ja talvikaudelle : Case: Yritys X

    OpenAIRE

    Riikonen, Esa

    2013-01-01

    Tämän opinnäytetyön aiheena oli markkinointiviestinnän kehityssuunnitelma tilausravintolalle. Toimeksiantajayritys on alle kymmenhenkinen, vuonna 2006 perustettu elämysravintola Lappeenrannan Linnoituksessa. Ravintola on varsin suosittu kesäsesongin aikana, jolloin se pitää ovensa auki asiakkailleen päivit-täin aamusta iltaan. Syys- ja talvikaudella 1.9–30.4 ravintola on ainoastaan tila-uskäytössä. Syys- ja talvikaudella ravintolassa pyritään järjestämään paljon eri-laisia tapahtumia, ja ravi...

  13. Combining Radiotherapy and Immunotherapy to Target Survivin in Prostate Cancer

    Science.gov (United States)

    2009-01-01

    EL4 ). All mice apart from the 20Gy-irradiated...4x 4G y 5G y 10 G y 20 G y control EL4 EG7.OVA IF N γ sp ot s/ 1 x1 05 s pl en oc yt es OVA-specific immune responses IFNγ -ELISPOT 0 0.1 0.2 0.3...300 350 ELISPOT 1-4-09 control EL4 EG7.OVA OVA peptide IF Nγ s po ts / 1x 10 5 sp le no cy te s no treatment 4x4Gy MIS416

  14. Vaccination of High-Risk Breast Cancer Patients with Carbohydrate Mimicking Peptides

    Science.gov (United States)

    2008-05-01

    we tested sera from immunized C57Bl6 mice against several carbohydrate expressing cells such as EL4 cells and MDA-231 for their ability to mediate... EL4 231 0 5 10 15 20 Na•ve anti-P10S Serum % o f c yt ot ox ic ity Figure 1. P10s anti-sera does not mediate CDC against antigen tumor cell ...lines. MDA-231 and EL4 cells were incubated with 1:50 P10s anti-sera and 1:4 rabbit serum for 4 hours. The number of viable cells was determined and the

  15. Psykofyysiset menetelmät kroonisen kivun hoidossa : Työelämävalmiuksia tukevan ryhmätoiminnan suunnittelu kroonisista kivuista kärsiville pitkäaikaistyöttömille

    OpenAIRE

    Jämsä, Silja

    2016-01-01

    Opinnäytetyön tarkoituksena oli kuvata psykofyysisen harjoittelun mahdollisuuksia kroonisesta kivusta kärsivien asiakkaiden kuntoutuksessa sekä suunnitella ryhmätoiminnan käytännön toteutus pitkäaikaistyöttömille pitkittyneistä kiputiloista kärsiville kuntoutujille. Työn tavoitteiksi asetettiin 1) perehtyminen teoreettiselta näkökannalta psykofyysiseen fysioterapiaan ja krooniseen kipuun sekä tutustuminen psykofyysiseen viitekehykseen kuuluviin lähestymistapoihin, menetelmiin ja harjoitteisii...

  16. Verkkomainonta

    OpenAIRE

    Taipalus, Lauri

    2011-01-01

    Työn tarkoituksena oli selvittää yritysten asenteita verkkomainontaa kohtaan, sekä verkkomainonnan käyttöä yrityksissä. Ensimmäisenä tavoitteena oli perehtyä verkkomainonnan eri muotoihin. Toisena tavoitteena oli toteuttaa tutkimus yritysten verkkomainonnan käytöstä. Teoreettisessa viitekehyksessä perehdyttiin siihen, mitä verkkomainonta pitää sisällään, ja mikä on verkkomainonnan osuus koko mainoskakusta. Tarkemmin teoriassa tutustuttiin erilaisiin tapoihin mainostaa verkossa. Käsitellyt...

  17. Recenzija. Monografija apie filosofijos ir literatūros giminystę

    Directory of Open Access Journals (Sweden)

    Tomas Kačerauskas

    2011-04-01

    Full Text Available Prieš keletą metų neoficialiame pokalbyje J. Baranova prasitarė, kad nėra didesnio malonumo už rašymą. Tiesą sakant, buvau sužavėtas ir priblokštas ne tik dėl šios ištaros asimetrijos R. Barthes’o minčiai apie skaitymo malonumą (net erotinį. Visai kitaip apie rašymą atsiliepia A. Šliogeris (kurio filosofi jos apmąstymui J. Baranova pelnytai skiria daug dėmesio: jis mieliau nerašytų nei rašytų. Tokiais atvejais prisimenu M. Bulgakovą, kuris „tempiąs save už plaukų prie rašomojo stalo“. Rašymas daug kam siejasi su disciplina, prievarta savęs atžvilgiu, geriausiu atveju – kasdieniu įpročiu.

  18. Influence of grade on the reliability of corroding pipelines

    International Nuclear Information System (INIS)

    Maes, M.A.; Dann, M.; Salama, M.M.

    2008-01-01

    This paper focuses on a comparative analysis of the reliability associated with the evolution of corrosion between normal and high-strength pipe material. The use of high strength steel grades such as X100 and X120 for high pressure gas pipeline in the arctic is currently being considered. To achieve this objective, a time-dependent reliability analysis using variable Y/T ratios in a multiaxial finite strain analysis of thin-walled pipeline is performed. This analysis allows for the consideration of longitudinal grooves and the presence of companion axial tension and bending loads. Limit states models are developed based on suitable strain hardening models for the ultimate behavior of corroded medium and high strength pipeline material. In an application, the evolution of corrosion is modeled in pipelines of different grades that have been subjected to an internal corrosion inspection after a specified time which allows for a Bayesian updating of long-term corrosion estimates and, hence, the derivation of annual probabilities of failure as a function of time. The effect of grade and Y/T is clearly demonstrated

  19. Dynamic PET scanning and compartmental model analysis to determine cellular level radiotracer distribution in vivo

    International Nuclear Information System (INIS)

    Smith, G.T.; Hubner, K.F.; Goodman, M.M.; Stubbs, J.B.

    1992-01-01

    Positron emission tomography (PET) has been used to measure tissue radiotracer concentration in vivo. Radiochemical distribution can be determined with compartmental model analysis. A two compartment model describes the kinetics of N-13 ammonia ( 13 NH 3 ) in the myocardium. The model consists of a vascular space, Q 1 and a space for 13 NH 3 bound within the tissue, Q 2 . Differential equations for the model can be written: X(t) = AX(t) + BU( t), Y(t)= CX(t)+ DU(t) (1) where X(t) is a column vector [Q 1 (t); Q 2 (t)], U(t) is the arterial input activity measured from the left ventricular blood pool, and Y(t) is the measured tissue activity using PET. Matrices A, B, C, and D are dependent on physiological parameters describing the kinetics of 13 NH 3 in the myocardium. Estimated parameter matrices in Equation 1 have been validated in dog experiments by measuring myocardial perfusion with dynamic PET scanning and intravenous injection of 13 NH 3 . Tracer concentrations for each compartment can be calculated by direct integration of Equation 1. If the cellular level distribution of each compartment is known, the concentration of tracer within the intracellular and extracellular space can be determined. Applications of this type of modeling include parameter estimation for measurement of physiological processes, organ level dosimetry, and determination of cellular radiotracer distribution

  20. Measurement of the charge asymmetry in highly boosted top-quark pair production in s=8 TeV pp collision data collected by the ATLAS experiment

    Directory of Open Access Journals (Sweden)

    G. Aad

    2016-05-01

    Full Text Available In the pp→tt¯ process the angular distributions of top and anti-top quarks are expected to present a subtle difference, which could be enhanced by processes not included in the Standard Model. This Letter presents a measurement of the charge asymmetry in events where the top-quark pair is produced with a large invariant mass. The analysis is performed on 20.3 fb−1 of pp collision data at s=8TeV collected by the ATLAS experiment at the LHC, using reconstruction techniques specifically designed for the decay topology of highly boosted top quarks. The charge asymmetry in a fiducial region with large invariant mass of the top-quark pair (mtt¯>0.75 TeV and an absolute rapidity difference of the top and anti-top quark candidates within −2<|yt|−|yt¯|<2 is measured to be 4.2±3.2%, in agreement with the Standard Model prediction at next-to-leading order. A differential measurement in three tt¯ mass bins is also presented.

  1. Linear minimax estimation for random vectors with parametric uncertainty

    KAUST Repository

    Bitar, E

    2010-06-01

    In this paper, we take a minimax approach to the problem of computing a worst-case linear mean squared error (MSE) estimate of X given Y , where X and Y are jointly distributed random vectors with parametric uncertainty in their distribution. We consider two uncertainty models, PA and PB. Model PA represents X and Y as jointly Gaussian whose covariance matrix Λ belongs to the convex hull of a set of m known covariance matrices. Model PB characterizes X and Y as jointly distributed according to a Gaussian mixture model with m known zero-mean components, but unknown component weights. We show: (a) the linear minimax estimator computed under model PA is identical to that computed under model PB when the vertices of the uncertain covariance set in PA are the same as the component covariances in model PB, and (b) the problem of computing the linear minimax estimator under either model reduces to a semidefinite program (SDP). We also consider the dynamic situation where x(t) and y(t) evolve according to a discrete-time LTI state space model driven by white noise, the statistics of which is modeled by PA and PB as before. We derive a recursive linear minimax filter for x(t) given y(t).

  2. A model stomach system to investigate disintegration kinetics of solid foods during gastric digestion.

    Science.gov (United States)

    Kong, F; Singh, R P

    2008-06-01

    Knowledge of the disintegration kinetics of food particulates in the human stomach is essential for assessing the bioaccessibility of nutrients in solid foods and understanding stomach emptying. The objective of this study was to develop a model stomach system and to investigate the kinetics of food disintegration. Our system consisted mainly of a turntable and a jacketed glass chamber containing simulated gastric juice in which plastic beads were added to simulate food particulates as well as provide a suitable mechanical destructive force on food samples. The mechanical force on the samples was simultaneously measured using the load cell of a TA-XT2 texture analyzer. Cylindrical carrots and ham samples were used as representative foods. The system is capable of simulating the in vivo stomach in terms of providing a wide range of continuous and periodic forces comparable to those measured in vivo. The modified power exponential function of the form y(t)= 1 - (1 -e(-kt))(beta), where y(t) is the mass retention ratio at time t, provided a reasonable description for the disintegration performance of tested foods. The mass retention curve can be either a sigmoidal decay with an initial delay or an exponential decay, which are decided largely by the hardness of the foods during digestion and the extent of physical force acting on the foods. A good match was observed between the kinetics of food disintegration and in vivo stomach emptying.

  3. Measurement of the top-Yukawa coupling and the search for ttH production

    CERN Document Server

    Vasquez, Jared; The ATLAS collaboration

    2015-01-01

    To test whether the observed Higgs boson follows the predictions of the SM, careful study and measurement of its properties are necessary. Due to the top quark's large mass, a measurement of the top-Yukawa coupling (Y_t) is paramount to an understanding of EWSB and could provide a viable probe for new physics. While most production processes provide only an indirect measurement of Y_t via loop effects, the ttH and tH production allow for a direct tree-level measurement of the coupling strength (which could differ due to new physics contamination). The ttH process is probed through various Higgs decay channels with several advantages. The H->bb channel allows for a coupling measurement of both 3rd generation quarks while profiting from the largest Higgs branching ratio. The h->γγ channel has a much smaller branching ratio but benefits from a fine diphoton mass resolution. The process is also probed in the multilepton channel, which is targeted at the off-shell Higgs coupling of H->WW* and H->ZZ* as well as t...

  4. pyXSIM: Synthetic X-ray observations generator

    Science.gov (United States)

    ZuHone, John A.; Hallman, Eric. J.

    2016-08-01

    pyXSIM simulates X-ray observations from astrophysical sources. X-rays probe the high-energy universe, from hot galaxy clusters to compact objects such as neutron stars and black holes and many interesting sources in between. pyXSIM generates synthetic X-ray observations of these sources from a wide variety of models, whether from grid-based simulation codes such as FLASH (ascl:1010.082), Enzo (ascl:1010.072), and Athena (ascl:1010.014), to particle-based codes such as Gadget (ascl:0003.001) and AREPO, and even from datasets that have been created “by hand”, such as from NumPy arrays. pyXSIM can also manipulate the synthetic observations it produces in various ways and export the simulated X-ray events to other software packages to simulate the end products of specific X-ray observatories. pyXSIM is an implementation of the PHOX (ascl:1112.004) algorithm and was initially the photon_simulator analysis module in yt (ascl:1011.022); it is dependent on yt.

  5. Genetic differentiation of Octopus minor (Mollusca, Cephalopoda) off the northern coast of China as revealed by amplified fragment length polymorphisms.

    Science.gov (United States)

    Yang, J M; Sun, G H; Zheng, X D; Ren, L H; Wang, W J; Li, G R; Sun, B C

    2015-12-02

    Octopus minor (Sasaki, 1920) is an economically important cephalopod that is found in the northern coastal waters of China. In this study, we investigated genetic differentiation in fishery populations using amplified fragment length polymorphisms (AFLPs). A total of 150 individuals were collected from five locations: Dalian (DL), Yan-tai (YT), Qingdao (QD), Lianyungang (LY), and Zhoushan (ZS), and 243 reproducible bands were amplified using five AFLP primer combinations. The percentage of polymorphic bands ranged from 53.33 to 76.08%. Nei's genetic identity ranged from 0.9139 to 0.9713, and the genetic distance ranged from 0.0291 to 0.0900. A phylogenetic tree was constructed using the unweighted pair group method with arithmetic mean, based on the genetic distance. The DL and YT populations originated from one clade, while the QD, LY, and ZS populations originated from another. The results indicate that the O. minor stock consisted of two genetic populations with an overall significantly analogous FST value (0.1088, P octopus fisheries, so that this marine resource can be conserved for its long-term utilization.

  6. Full-range stress–strain behaviour of contemporary pipeline steels: Part I. Model description

    International Nuclear Information System (INIS)

    Hertelé, Stijn; De Waele, Wim; Denys, Rudi; Verstraete, Matthias

    2012-01-01

    The stress–strain relationship of contemporary pipeline steels is often approximated by the relatively simple Ramberg–Osgood equation. However, these steels often show a more complex post-yield behaviour, which can result in significant errors. To address this limitation for cases where an accurate full-range description is needed, the authors developed a new ‘UGent’ stress–strain model which has two independent strain-hardening exponents. This paper compares the UGent model with the Ramberg–Osgood model for a wide range of experimental data, by means of least-squares curve fitting. A significant improvement is observed for contemporary pipeline steels with a yield-to-tensile ratio above 0.80. These steels typically exhibit two distinct stages of strain hardening. In contrast to the Ramberg–Osgood model, both stages are successfully described by the UGent model. A companion paper (Part II) discusses how to find appropriate model parameter values for the UGent model. - Highlights: ► Contemporary pipeline steels often show two strain-hardening stages. ► This phenomenon is progressively apparent as Y/T exceeds 0.80. ► Both stages cannot be simultaneously described by the Ramberg–Osgood model. ► A new “UGent” model provides significantly better descriptions. ► The improvement becomes more pronounced as Y/T increases.

  7. Yoga for heart failure: A review and future research

    Directory of Open Access Journals (Sweden)

    Paula R Pullen

    2018-01-01

    Full Text Available Background: Complementary and alternative medicine is a rapidly growing area of biomedical inquiry. Yoga has emerged in the forefront of holistic medical care due to its long history of linking physical, mental, and spiritual well-being. Research in yoga therapy (YT has associated improved cardiovascular and quality of life (QoL outcomes for the special needs of heart failure (HF patients. Aim: The aim of this study is to review yoga intervention studies on HF patients, discuss proposed mechanisms, and examine yoga's effect on physiological systems that have potential benefits for HF patients. Second, to recommend future research directions to find the most effective delivery methods of yoga to medically stable HF patients. Methods: The authors conducted a systematic review of the medical literature for RCTs involving HF patients as participants in yoga interventions and for studies utilizing mechanistic theories of stretch and new technologies. We examined physical intensity, mechanistic theories, and the use of the latest technologies. Conclusions: Based on the review, there is a need to further explore yoga mechanisms and research options for the delivery of YT. Software apps as exergames developed for use at home and community activity centers may minimize health disparities and increase QoL for HF patients.

  8. Yukon River King Salmon - Ichthyophonus Pilot Study

    Science.gov (United States)

    Kocan, R.M.; Hershberger, P.K.

    2001-01-01

    When king salmon enter the Yukon River on their spawning migration in mid June, over 25% of the population are infected with Ichthyophonus. The percent of infected fish remains relatively constant until the fish pass river mile 1,319 at Dawson, Y.T., then it drops to 13% when they reach river mile 1,745 at Whitehorse, Y.T. When the sexes are examined separately, slightly more females are infected than males (29% vs 22%). The percent of fish exhibiting clinical signs (diseased) is 2-3% when they enter the river, but increases to over 20% at river mile 715 near Tanana, AK. Disease prevalence within the population remains constant at >20% until fish pass Dawson, then the percent of diseased fish drops to <9% at Whitehorse. When the sexes are examined separately, male disease prevalence is highest at Tanana (22.6%) then gradually drops to just 12.9% at Whitehorse. Females however, continue to show an increase in disease prevalence peaking at river mile 1,081 near Circle, AK, at 36.4%, then dropping to just 5.3% at Whitehorse. Data on infection and disease collected from kings at Nenana on the Tanana River more closely resembles that seen at Whitehorse than the lower and middle Yukon River.

  9. Derivation and analysis of the Feynman-alpha formula for deterministically pulsed sources

    International Nuclear Information System (INIS)

    Wright, J.; Pazsit, I.

    2004-03-01

    The purpose or this report is to give a detailed description of the calculation of the Feynman-alpha formula with deterministically pulsed sources. In contrast to previous calculations, Laplace transform and complex function methods are used to arrive at a compact solution in form of a Fourier series-like expansion. The advantage of this method is that it is capable to treat various pulse shapes. In particular, in addition to square- and Dirac delta pulses, a more realistic Gauss-shaped pulse is also considered here. The final solution of the modified variance-to-mean, that is the Feynman Y(t) function, can be quantitatively evaluated fast and with little computational effort. The analytical solutions obtained are then analysed quantitatively. The behaviour of the number or neutrons in the system is investigated in detail, together with the transient that follows the switching on of the source. An analysis of the behaviour of the Feynman Y(t) function was made with respect to the pulse width and repetition frequency. Lastly, the possibility of using me formulae for the extraction of the parameter alpha from a simulated measurement is also investigated

  10. Diversidad de arañas (Araneae, Araneomorphae en la selva de montaña: un caso de estudio en las Yungas Argentinas

    Directory of Open Access Journals (Sweden)

    Rubio, Gonzalo D.

    2015-12-01

    Full Text Available The spider diversity from yungas vegetation in northwestern Argentina is studied, integrating two levels: local (α diversity, community structures and a projection at regional level of diversity (β diversity. Twenty six sites in Salta Province were sampled, representing different ambient/altitudinal strata of yungas sensu stricto (SP= pedemontane rainforest, SM= montane rainforest and BM= montane forest, yungas sensu lato (Cc-s= yungas central and southern sectors connectivity areas, YT= transitional yungas, and Chaco Serrano sites (ChS as contrast. The sampling was carried out seasonally for one year taking 10 samples of vegetation with G-Vac method. A total of 6412 spiders, 188 species and 34 families were obtained (only yungas. Theridiidae, Anyphaenidae and Linyphiidae were dominant. The highest richness was observed in Araneidae, Salticidae and Theridiidae. >em>Chibchea salta (Pholcidae, Dubiaranea msp111 (Linyphiidae and Mysmena msp110 (Mysmenidae were dominant species. Relevant differences in species composition and abundance highlighted two groups of environment (Cc-s+SP+YT+ChS vs. (SM+BM. Dictynidae, Oxyopidae and Philodromidae are associated with lower altitudinal floors (Cc-s, YT, ChS. The greatest species richness and diversity were recorded in SP and YT. The highest similarity was recorded in SM and BM; the major differences were observed in Cc-s and ChS compared with the other ambient, except with SP. Complementarity and similarity indices and coefficients revealed high β diversity in the region. Thus, it is suggested that besides reinforcing protection in transitional levels Yungas (the most disturbed and diverse habitats for spiders, conservation management in the area should be directed towards promoting natural spatial heterogeneity of Yungas, giving special emphasis to habitat mosaics that constitute each different stratum.Se estudia la diversidad de arañas de vegetación de las yungas del noroeste argentino, integrando dos

  11. Fitness Level and Not Aging per se, Determines the Oxygen Uptake Kinetics Response

    Directory of Open Access Journals (Sweden)

    Mitchell A. George

    2018-03-01

    Full Text Available Although aging has been associated to slower V˙O2 kinetics, some evidence indicates that fitness status and not aging per se might modulate this response. The main goal of this study was to examine the V˙O2, deoxygenated hemoglobin+myoglobin (deoxy-[Hb+Mb] kinetics, and the NIRS-derived vascular reperfusion responses in older compared to young men of different training levels (i.e., inactive, recreationally active, and endurance trained. Ten young inactive [YI; 26 ± 5 yrs.; peak V˙O2 (V˙O2peak, 2.96 ± 0.55 L·min−1], 10 young recreationally active (YR; 26 ± 6 yrs.; 3.92 ± 0.33 L·min−1, 10 young endurance trained (YT; 30 ± 4 yrs.; 4.42 ± 0.32 L·min−1, 7 older inactive (OI; 69 ± 4 yrs.; 2.50 ± 0.31 L·min−1, 10 older recreationally active (OR; 69 ± 5 yrs.; 2.71 ± 0.42 L·min−1, and 10 older endurance trained (OT; 66 ± 3 yrs.; 3.20 ± 0.35 L·min−1 men completed transitions of moderate intensity cycling exercise (MODS to determine V˙O2 and deoxy-[Hb+Mb] kinetics, and the deoxy-[Hb+Mb]/V˙O2 ratio. The time constant of V˙O2 (τV˙O2 was greater in YI (38.8 ± 10.4 s and OI (44.1 ± 10.8 s compared with YR (26.8 ± 7.5 s and OR (26.6 ± 6.5 s, as well as compared to YT (14.8 ± 3.4 s, and OT (17.7 ± 2.7 s (p < 0.05. τV˙O2 was greater in YR and OR compared with YT and OT (p < 0.05. The deoxy-[Hb+Mb]/V˙O2 ratio was greater in YI (1.23 ± 0.05 and OI (1.29 ± 0.08 compared with YR (1.11 ± 0.03 and OR (1.13 ± 0.06, as well as compared to YT (1.01 ± 0.03, and OT (1.06 ± 0.03 (p < 0.05. Similarly, the deoxy-[Hb+Mb]/ V˙O2 ratio was greater in YR and OR compared with YT and OT (p < 0.05. There was a main effect of training (p = 0.033, whereby inactive (p = 0.018 and recreationally active men (p = 0.031 had significantly poorer vascular reperfusion than endurance trained men regardless of age. This study demonstrated not only that age-related slowing of V˙O2 kinetics can be eliminated in endurance trained individuals

  12. Theoretical analysis of non-Gaussian heterogeneity effects on subsurface flow and transport

    Science.gov (United States)

    Riva, Monica; Guadagnini, Alberto; Neuman, Shlomo P.

    2017-04-01

    Much of the stochastic groundwater literature is devoted to the analysis of flow and transport in Gaussian or multi-Gaussian log hydraulic conductivity (or transmissivity) fields, Y(x)=ln\\func K(x) (x being a position vector), characterized by one or (less frequently) a multiplicity of spatial correlation scales. Yet Y and many other variables and their (spatial or temporal) increments, ΔY, are known to be generally non-Gaussian. One common manifestation of non-Gaussianity is that whereas frequency distributions of Y often exhibit mild peaks and light tails, those of increments ΔY are generally symmetric with peaks that grow sharper, and tails that become heavier, as separation scale or lag between pairs of Y values decreases. A statistical model that captures these disparate, scale-dependent distributions of Y and ΔY in a unified and consistent manner has been recently proposed by us. This new "generalized sub-Gaussian (GSG)" model has the form Y(x)=U(x)G(x) where G(x) is (generally, but not necessarily) a multiscale Gaussian random field and U(x) is a nonnegative subordinator independent of G. The purpose of this paper is to explore analytically, in an elementary manner, lead-order effects that non-Gaussian heterogeneity described by the GSG model have on the stochastic description of flow and transport. Recognizing that perturbation expansion of hydraulic conductivity K=eY diverges when Y is sub-Gaussian, we render the expansion convergent by truncating Y's domain of definition. We then demonstrate theoretically and illustrate by way of numerical examples that, as the domain of truncation expands, (a) the variance of truncated Y (denoted by Yt) approaches that of Y and (b) the pdf (and thereby moments) of Yt increments approach those of Y increments and, as a consequence, the variogram of Yt approaches that of Y. This in turn guarantees that perturbing Kt=etY to second order in σYt (the standard deviation of Yt) yields results which approach those we obtain

  13. Mitochondrial control region I and microsatellite analyses of endangered Philippine hornbill species (Aves; Bucerotidae detect gene flow between island populations and genetic diversity loss

    Directory of Open Access Journals (Sweden)

    Sammler Svenja

    2012-10-01

    Full Text Available Abstract Background The Visayan Tarictic Hornbill (Penelopides panini and the Walden’s Hornbill (Aceros waldeni are two threatened hornbill species endemic to the western islands of the Visayas that constitute - between Luzon and Mindanao - the central island group of the Philippine archipelago. In order to evaluate their genetic diversity and to support efforts towards their conservation, we analyzed genetic variation in ~ 600 base pairs (bp of the mitochondrial control region I and at 12–19 nuclear microsatellite loci. The sampling covered extant populations, still occurring only on two islands (P. panini: Panay and Negros, A. waldeni: only Panay, and it was augmented with museum specimens of extinct populations from neighboring islands. For comparison, their less endangered (= more abundant sister taxa, the Luzon Tarictic Hornbill (P. manillae from the Luzon and Polillo Islands and the Writhed Hornbill (A. leucocephalus from Mindanao Island, were also included in the study. We reconstructed the population history of the two Penelopides species and assessed the genetic population structure of the remaining wild populations in all four species. Results Mitochondrial and nuclear data concordantly show a clear genetic separation according to the island of origin in both Penelopides species, but also unravel sporadic over-water movements between islands. We found evidence that deforestation in the last century influenced these migratory events. Both classes of markers and the comparison to museum specimens reveal a genetic diversity loss in both Visayan hornbill species, P. panini and A. waldeni, as compared to their more abundant relatives. This might have been caused by local extinction of genetically differentiated populations together with the dramatic decline in the abundance of the extant populations. Conclusions We demonstrated a loss in genetic diversity of P. panini and A. waldeni as compared to their sister taxa P. manillae and A

  14. Macroscopical and microscopical studies of the common bile duct in reindeer (Rangifer tarandus tarandus L

    Directory of Open Access Journals (Sweden)

    Timo Rahko

    1990-08-01

    Full Text Available The histological structure and secretory function of the common bile duct (ductus hepaticus communis has not been previously described in reindeer. Macroscopical studies were thus performed in 25 reindeer to reveal the morphology and topography of the ductus hepaticus communis and adjoining organs. Histologic structure of the common bile duct was investigated in 20 animals. Our studies showed that the ductus hepaticus communis and pancreaticus join about 2 cm before the duodenal opening to form the common duct. The common bile duct is an elastic tube about 3 to 5 cm long and 2 to 3 mm thick partly surrounded by fat and pancreatic tissues. The wall of the duct, being about 1 mm thick by light microscopy, consisted of folded mucosa surrounded by connective tissue fibres and a serosal layer. Distally, also muscular bands were seen. In some areas separate leucocytes and even lymphatic nodules were present. Surprisingly pancreatic acini occurred in certain areas of the wall, even in close contact to subepithelial tissues. Mucosal epithelium consisted of surface and glandular epithelial cells with mucous secretion. Numerous intraepithelial globule leucocytes were identifiable within the lamina epithelialis.Tutkimus yhteisen sappikäytävän rakenteesta porolla.Abstract in Finnish / Yhteenveto: Yhteisen sappikäytävän (ductus hepaticus communis histologista rakennetta ja eritystoimintaa ei ole aikaisemmin kuvattu porolla. Makroskooppisia tutkimuksia suoritettiin 25 porolla yhteisen sappikäytävän rakenteen ja topografian selvittämiseksi. Seinämän histologinen rakenne selvitettiin 20 porolla. Tutkimukset osoittivat, että porolla ductus hepaticus communis ja ductus pancreaticus yhtyvät noin 2 cm ennen ohutsuolta muodostaakseen yhteisen tiehyeen. Ductus hepaticus communis on noin 3-5 cm pitkä ja 2-3 mm:n läpimittainen käytävä. Se on elastinen ja osit-tain rasva- ja haimakudoksen ympäröimä. Seinämä on mikroskooppisesti noin 1 mm paksu

  15. Electron microscopical studies of the common bile duct in reindeer

    Directory of Open Access Journals (Sweden)

    Timo Rahko

    1990-08-01

    Full Text Available In a previous publication the authors have described some ultrastructural characteristics of granulated cells in the common bile duct of the reindeer. On the basis of the same material, electron microscopic observations on other tissue elements of bile duct wall are now reported. The surface and glandular epithelium were composed of tall columnar epithelial cells with villous structures on the luminal surfaces. The parietal cytoplasmic membranes of epithelial cells were equipped with intercellular desmosomes while intraepithelial globule leucocytes did not form any junctional complex with other cells. Apical cytoplasmic areas of superficial epithelial cells showed electron-dense small bodies possibly consisting of mucinous substances. The goblet and deep glandular cells, on the other hand, contained numerous large mucin granules with less electron-dense matrices. It appears that their secretions are more abundant than those in superficial epithelial cells which obviously are absorptive as their main function. The nuclei and other cytoplasmic organelles showed profiles similar to those in epithelial cells generally. The lumen of the bile ducts was usually empty or contained fine-granular or amorphous material. An unusual feature was the presence of parts of globule leucocytes or even almost whole cells occurring freely in ductal secretions.Elektronimikroskooppinen tutkimus yhteisen sappikäytävän rakenteesta porolla.Abstract in Finnish / Yhteenveto: Aikaisemmassa julkaisussa tekijät kuvasivat poron yhteisen sappikäytävän (ductus hepaticus communis seinämän jyväsellisten solujen hienorakennetta. Tässä artikkelissa selostetaan saman aineiston perusteella (6 tervettä teurasporoa elektronimikroskooppisia havaintoja sappikäytäväseinämän muista kudosrakenteista. Sappikäytäväseinämän pinta- ja rauhasepiteeli koostuu korkeista epiteelisoluista. Pinnallisia epiteelisoluja kattavat säännölliset mikrovillukset, ja niillä on vain v

  16. Assessing the sources of the fishing down marine food web process in the Argentinean-Uruguayan Common Fishing Zone

    Directory of Open Access Journals (Sweden)

    Andrés J. Jaureguizar

    2008-03-01

    Full Text Available The temporal trend in the mean trophic level (mTL, fisheries-in-balance index (FIB, trophic categories landing (TrC and landing profile (LP of the exploited marine community (82 species in the Argentinean-Uruguayan Common Fishing Zone (AUCFZ were examined from 1989 to 2003. The total landings (Yt (rs=-0.561; P< 0.05 and the Yt of carnivores and top predators has declined, while the Yt of herbivores, detritivores and omnivores has increased. Consequently, the mTL significantly decreased (rs =-0.88; P< 0.01 at a rate of 0.41 from 1991 (mTL =3.81 to 2003 (mTL =3.4, and the FIB index has declined in the last 6 years. The LP temporal pattern showed four periods with significant differences in their species composition and Primary Production Required, which shows a strong decline in the traditional fishery resources (i.e. Merluccius hubbsi, Micropogonias furnieri, and increases in crustacean (Chaceon notilis, molluscs (Zygochlamys patagonica and some fishes (Macrodon ancylodon, Macruronus magallanicus, Rajidae. The mTL trend reflects the changes in the AUCFZ landing structure. This was characterized by large, slow-growing and late-maturing species during the early 1990s, while during recent years, early 2000s, it was mainly characterized by medium-sized fishes, crustaceans and molluscs. The examination of the mTL, FBI, TrC trajectories and LP temporal pattern suggests that new fishery resources are developing or that the fishing effort has been redistributed from overexploited resources to lightly exploited resources. In addition, the examination of discriminator and common species, and the fact that traditional resources are being over-fished support the hypothesis that the mTL trend has been influenced more by the impacts of new fishing technologies than the changes in market-driven exploitation and environmental fluctuation. These results provide evidence of the fishing down process along AUCFZ.

  17. Validation of reference genes for quantitative RT-PCR studies of gene expression in perennial ryegrass (Lolium perenne L.

    Directory of Open Access Journals (Sweden)

    Thrush Anthony

    2010-01-01

    Full Text Available Abstract Background Perennial ryegrass (Lolium perenne L. is an important pasture and turf crop. Biotechniques such as gene expression studies are being employed to improve traits in this temperate grass. Quantitative reverse transcription-polymerase chain reaction (qRT-PCR is among the best methods available for determining changes in gene expression. Before analysis of target gene expression, it is essential to select an appropriate normalisation strategy to control for non-specific variation between samples. Reference genes that have stable expression at different biological and physiological states can be effectively used for normalisation; however, their expression stability must be validated before use. Results Existing Serial Analysis of Gene Expression data were queried to identify six moderately expressed genes that had relatively stable gene expression throughout the year. These six candidate reference genes (eukaryotic elongation factor 1 alpha, eEF1A; TAT-binding protein homolog 1, TBP-1; eukaryotic translation initiation factor 4 alpha, eIF4A; YT521-B-like protein family protein, YT521-B; histone 3, H3; ubiquitin-conjugating enzyme, E2 were validated for qRT-PCR normalisation in 442 diverse perennial ryegrass (Lolium perenne L. samples sourced from field- and laboratory-grown plants under a wide range of experimental conditions. Eukaryotic EF1A is encoded by members of a multigene family exhibiting differential expression and necessitated the expression analysis of different eEF1A encoding genes; a highly expressed eEF1A (h, a moderately, but stably expressed eEF1A (s, and combined expression of multigene eEF1A (m. NormFinder identified eEF1A (s and YT521-B as the best combination of two genes for normalisation of gene expression data in perennial ryegrass following different defoliation management in the field. Conclusions This study is unique in the magnitude of samples tested with the inclusion of numerous field-grown samples

  18. Structural studies of conformational changes of proteins upon phosphorylation: Structures of activated CheY, CheY-N16-FliM complex, and AAA + ATPase domain of NtrC1 in both inactive and active states

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Seok-Yong [Univ. of California, Berkeley, CA (United States)

    2003-04-10

    Protein phosphorylation is a general mechanism for signal transduction as well as regulation of cellular function. Unlike phosphorylation in eukaryotic systems that uses Ser/Thr for the sites of modification, two-component signal transduction systems, which are prevalent in bacteria, archea, and lower eukaryotes, use an aspartate as the site of phosphorylation. Two-component systems comprise a histidine kinase and a receiver domain. The conformational change of the receiver domain upon phosphorylation leads to signal transfer to the downstream target, a process that had not been understood well at the molecular level. The transient nature of the phospho-Asp bond had made structural studies difficult. The discovery of an excellent analogue for acylphosphate, BeF3-, enabled structural study of activated receiver domains. The structure of activated Chemotaxis protein Y (CheY) was determined both by NMR spectroscopy and X-ray crystallography. These structures revealed the molecular basis of the conformational change that is coupled to phosphorylation. Phosphorylation of the conserved Asp residue in the active site allows hydrogen bonding of the T87 Oγ to phospho-aspartate, which in turn leads to the rotation of Y106 into the ''in'' position (termed Y-T coupling). The structure of activated CheY complexed with the 16 N-terminal residues of FliM (N16-FliM), its target, was also determined by X-ray crystallography and confirmed the proposed mechanism of activation (Y-T coupling). First, N16-FliM binds to the region on CheY that undergoes a significant conformational change. Second, the ''in'' position of Y106 presents a better binding surface for FliM because the sidechain of Y106 in the inactive form of CheY (''out'' position) sterically interferes with binding of N16-FliM. In addition to confirmation of Y-T coupling, the structure of the activated CheY-N16-FliM complex suggested that the

  19. Evaluation of Pb–17Li compatibility of ODS Fe-12Cr-5Al alloys

    Energy Technology Data Exchange (ETDEWEB)

    Unocic, Kinga A., E-mail: unocicka@ornl.gov; Hoelzer, David T.

    2016-10-15

    The Dual Coolant Lead Lithium (DCLL: eutectic Pb–17Li and He) blanket concept requires improved Pb–17Li compatibility with ferritic steels in order to demonstrate acceptable performance in fusion reactors. As an initial step, static Pb-17at.%Li (Pb-17Li) capsule experiments were conducted on new oxide dispersion strengthened (ODS) FeCrAl alloys ((1) Y{sub 2}O{sub 3} (125Y), (2) Y{sub 2}O{sub 3} + ZrO{sub 2} (125YZ), (3) Y{sub 2}O{sub 3} + HfO{sub 2} (125YH), and (4) Y{sub 2}O{sub 3} + TiO{sub 2} (125YT)) produced at ORNL via mechanical alloying (MA). Tests were conducted in static Pb–17Li for 1000 h at 700 °C. Alloys showed promising compatibility with Pb–17Li with small mass change after testing for 125YZ, 125YH and 125YT, while the 125Y alloy experienced the highest mass loss associated with some oxide spallation and subsequent alloy dissolution. X-ray diffraction methods identified the surface reaction product as LiAlO{sub 2} on all four alloys. A small decrease (∼1 at.%) in Al content beneath the oxide scale was observed in all four ODS alloys, which extended 60 μm beneath the oxide/metal interface. This indicates improvements in alloy dissolution by decreasing the amount of Al loss from the alloy. Scales formed on 125YZ, 125YH and 125YT were examined via scanning transmission electron microscopy (S/TEM) and revealed incorporation of Zr-, Hf-, and Ti-rich precipitates within the LiAlO{sub 2} product, respectively. This indicates an inward scale growth mechanism. Future work in flowing Pb–17Li is needed to further evaluate the effectiveness of this strategy in a test blanket module. - Highlights: • Investigation of Pb-17Li compatibility of new ODS Fe-12Cr5Al. • Promising small mass change after static Pb-17Li exposure. • LiAlO{sub 2} formed on the surface during Pb-17Li exposure. • Oxide precipitates incorporated within the LiAlO{sub 2} product. • An inward scale growth mechanism was identified.

  20. Molecular systematics and undescribed diversity of Madagascan scolecophidian snakes (Squamata: Serpentes).

    Science.gov (United States)

    Nagy, Zoltán T; Marion, Angela B; Glaw, Frank; Miralles, Aurélien; Nopper, Joachim; Vences, Miguel; Hedges, S Blair

    2015-11-10

    We provide an updated molecular phylogenetic analysis of global diversity of typhlopid and xenotyphlopid blindsnakes, adding a set of Madagascan samples and sequences of an additional mitochondrial gene to an existing supermatrix of nuclear and mitochondrial gene segments. Our data suggest monophyly of Madagascan typhlopids, exclusive of introduced Indotyphlops braminus. The Madagascar-endemic typhlopid clade includes two species previously assigned to the genus Lemuriatyphlops (in the subfamily Asiatyphlopinae), which were not each others closest relatives. This contradicts a previous study that described Lemuriatyphlops based on a sequence of the cytochrome oxidase subunit 1 gene from a single species and found this species not forming a clade with the other Malagasy species included. Based on our novel phylogenetic assessment we include all species in this endemic typhlopid clade in the genus Madatyphlops and in the subfamily Madatyphlopinae and consider Lemuriatyphlops as junior synonym. Within Madatyphlops, we identify several candidate species. For some of these (those in the M. arenarius complex), our preliminary data suggest sympatric occurrence and morphological differentiation, thus the existence of undescribed species. We also comment on the genus-level classification of several non-Madagascan typhlopids. We suggest that African species included in Madatyphlops (Afrotyphlops calabresii, A. cuneirostris, A. platyrhynchus, and Rhinotyphlops leucocephalus) should not be included in this genus. We furthermore argue that recent claims of Sundatyphlops, Antillotyphlops, and Cubatyphlops being "undiagnosable" or "not monophyletic" were based on errors in tree reconstruction and failure to notice diagnostic characters, and thus regard these three genera as valid.

  1. Birth intervention and non-maternal infant-handling during parturition in a nonhuman primate.

    Science.gov (United States)

    Pan, Wenshi; Gu, Tieliu; Pan, Yue; Feng, Chunguang; Long, Yu; Zhao, Yi; Meng, Hao; Liang, Zuhong; Yao, Meng

    2014-10-01

    Direct intervention in infant delivery by non-parturient individuals is a rare phenomenon in nonhuman primates. In contrast, birth assistance by other individuals, or the practice of midwifery, is universal among human societies and generally believed to be a behavior unique to our species. It has been proposed that the enlarged head of the human fetus and the relatively narrow birth canal constrained by bipedalism has made human parturition more difficult than in nonhuman primates, and these anatomic challenges have led to the rotation of the fetus in the birth canal and an occiput anterior (i.e., backward-facing) orientation of emergence. These characteristics have hindered the mother's ability to self-assist the delivery of the infant, therefore necessitating assistance by other individuals or midwives for successful birth. Here we report the first high-definition video recordings of birth intervention behavior in a wild nonhuman primate, the white-headed langur (Trachypithecus leucocephalus). We observed that while a primiparous female gave birth to an infant in an occiput posterior (i.e., forward-facing) orientation, a multiparous female intervened in the delivery by manually pulling the infant out of the birth canal and cared for it in the following hours. Our finding shows extensive social interactions throughout parturition, and presents an unequivocal case of non-maternal intervention with infant birth in a nonhuman primate.

  2. WLAN-antenni ajoneuvokäyttöön

    OpenAIRE

    Mustonen, Sami

    2006-01-01

    Insinöörityössä tutkittiin, mikä WLAN-antenni soveltuisi parhaiten käytettäväksi Sunit Oy:n valmistamissa ajoneuvotietokoneissa. WLAN-antennin täytyy olla tehokas ja helposti asennettava ajoneuvokäyttöön. Työssä tutkittiin myös, kuinka merkittävässä asemassa ovat suurtaajuuskäytössä käytettävät RF-liittimet ja kaapelit. Insinöörityön tutkimus perustuu suurimmalta osaltaanantenniteoriaan, sähkömagnetismiin ja mikroaaltomittaustekniikkaan. WLAN-antennimittaukset on tehty Kajaanin ammattikork...

  3. Brändi näkyy musiikkivideossa : Esimerkkitapaus Michael Jackson

    OpenAIRE

    Kontinen, Noora

    2016-01-01

    Tutkin opinnäytetyössäni brändin ja musiikkivideon suhdetta toisiinsa. Työssä käsitellään lyhyesti myös tähteyttä. Esittelen ensin vähän historiaa ja peruskäsitteitä, minkä jälkeen käytän Michael Jacksonin Billie Jean -musiikkivideota esimerkkinä tutkiessani Michael Jacksonin brändiä. Teoksessa käytetään lähdeaineistoa sekä omaa analyysia. Keskityn tarkastelemaan musiikkivideoita, ja niihin liittyviä sisältöjä yleisesti, ei niinkään teknisesti. Toivon, että työstäni on apua jollekin,...

  4. ”En tykkää junnata paikallaan" : Palveluneuvojat laadun kehittäjinä Kelassa

    OpenAIRE

    Kyllönen, Anne

    2016-01-01

    Opinnäytetyöni tavoitteena oli selvittää millaiset asiat tukevat palveluneuvojan työn laadun kehittämistä Kansaneläkelaitoksessa (Kela). Kelassa toimistojen asiakaspalvelussa työskentelevät palveluneuvojat ovat erikoistuneet asiakaspalvelutyöhön ja heillä on käytössä palvelumalli. Tutkimuksessa selvitetään palveluneuvojien näkemyksiä palvelumallista, millaisia vaikutusmahdollisuuksia heillä on työnsä kehittämiseen sekä mitkä seikat tukevat ja innostavat heidän kehittymistään. Opinnäytetyön te...

  5. Kuntouttavan korvaushoitoyksikön arviointimenetelmien kartoitus

    OpenAIRE

    Heinistö, Terhi; Vento, Tia

    2015-01-01

    Opinnäytetyön aiheena on asiakkaiden toimintakykyä mittaavien arviointimenetelmien kartoitus Helsingin Diakonissalaitoksen päihde- ja mielenterveystyön yksikön kuntouttavan korvaushoidon toimipisteessä. Pääpaino työssä on kartoittaa vastuuhoitajien käytössä olevia menetelmiä sekä toimintakyvyn osa-alueiden tarkemman arvioinnin tarvetta yksikössä. Lisäksi työssä etsitään uusia moniammatillisesti käytettäviä arviointimenetelmiä. Opinnäytetyön tuloksia voivat hyödyntää kuntouttavan korvaushoidon...

  6. Mansikkaviljelmän perustaminen Lapväärttiin

    OpenAIRE

    Klåvus, Hanna

    2013-01-01

    Tavoitteena on ollut suunnitella ja perustaa mansikkaviljelmä Lapväärttiin ja työllistyä samalla. Tämä opinnäytetyö on tehty toiminnallisena opinnäytetyönä ja se sisältää teoreettista taustaa työlle ja toteutuksen, sekä pohdinnan työn onnistumisesta, mikä on apuna mansikan viljelyä suunnittelevalle. Kahden hehtaarin mansikkaviljelmälle löytyi hyvä paikka talouskeskuksen vierestä. Sijainti on hyvä niin käytännön töiden kuin asiakkaidenkin kannalta. Talouskeskus sijaitsee Lapväärtissä hyvie...

  7. Determination of daily intake of elements from Philippine total diet samples using inductively coupled plasma-atomic emission spectrometry

    International Nuclear Information System (INIS)

    Leon, G.C. de; Shiraishi, K.; Kawamura, H.; Igaraishi, Y.; Palattao, M.V.; Azanon, E.M.

    1990-10-01

    Total diet samples were analyzed for major elements (Na, K, Ca, Mg, P) and some minor trace elements (Fe, Zn, Mn, Al, Sr, Cu, Ba, Yt) using inductively coupled plasma-atomic emission spectrometry (ICP-AES). Samples analyzed were classified into sex and age groups. Results for some elements (Na, K, Mg, Zn, Cu, Mn) were compared with values from Bataan dietary survey calculated using the Philippine composition table. Exceot for Na, analytical results were similar to calculated values. Analytical results for Ca and Fe were also compared with the values from Food and Nutrition Research Institute. In general, values obtained in the study were lower than the FNRI values. Comparison of the analytical and calculated results with the Japanese and ICRP data showed that Philippine values were lower than foreign values. (Auth.). 22 refs., 9 tabs

  8. Myyntisaatavien hallinta taloushallinnon palvelukeskuksessa

    OpenAIRE

    Paloheinä, Emilia

    2013-01-01

    Keväällä 2013 yleinen taloustilanne on ollut taantumassa ja maksuhäiriöt yleistyneet. Myös perintälakiin on tehty muutoksia. Tämä opinnäytetyö on tapaustutkimus, jonka tarkoituksena on ollut tutkia toimeksiantajan myyntisaatavien hallintaa vaikeutuneessa taloustilanteessa. Opinnäytetyön tarkoitus on tuottaa päätöksenteon tueksi raportti, joka auttaa toimeksiantajaa kehittämään yrityksen käytännön perintätyöhön liittyviä toimia. Yleisemmällä tasolla työssä selvitetään myyntisaatavien merkit...

  9. Tanssijan roolityö : Minä toisena

    OpenAIRE

    Penttilä, Elena

    2012-01-01

    Tanssi ja teatteri, sekä näyttämöllisyyden mahdollisuudet ja haasteet, kiehtovat minua. Taiteellisen opinnäytetyöni innoittajana on toiminut tahtoni löytää työskentelymuoto, jossa tanssija kykenisi hyödyntämään näyttelijäntyön perusteita tuodakseen keholliseen ilmaisuunsa moniulotteisuutta ja syvyyttä. Opinnäytetyöni produktiotyöskentelyssä roolityön lähtökohtana toimivat eri aistikanavia pitkin tarjotut impulssit, näyttämötilan käsittäminen paikkana sekä teokselle luotu tarinamuotoinen t...

  10. Siirtyminen IPv6-protokollaan yrityksen verkkolaitteistossa

    OpenAIRE

    Lindén, Kalle

    2012-01-01

    Tämän opinnäytetyön tarkoituksena on selvittää, mitä muutoksia Päijät-Hämeen koulutuskonsernin (PHKK) tietoverkon runkolaitteissa tarvitsee tehdä, jotta voidaan ottaa IPv6-protokolla käyttöön. Siirtyminen IPv6-protokollaan tulee olemaan välttämätön toimenpide, koska IPv4-protokollasta loppuvat uudet yksilölliset osoitteet. IPv4- ja IPv6-protokollien suurimmat erot ovat osoitekentän koon kasvaminen 32 bitistä 128 bittiin. Aluksi IPv4-osoitteistuksessa oli käytössä luokallinen osoitejärjest...

  11. Hyperbolicity of projective hypersurfaces

    CERN Document Server

    Diverio, Simone

    2016-01-01

    This book presents recent advances on Kobayashi hyperbolicity in complex geometry, especially in connection with projective hypersurfaces. This is a very active field, not least because of the fascinating relations with complex algebraic and arithmetic geometry. Foundational works of Serge Lang and Paul A. Vojta, among others, resulted in precise conjectures regarding the interplay of these research fields (e.g. existence of Zariski dense entire curves should correspond to the (potential) density of rational points). Perhaps one of the conjectures which generated most activity in Kobayashi hyperbolicity theory is the one formed by Kobayashi himself in 1970 which predicts that a very general projective hypersurface of degree large enough does not contain any (non-constant) entire curves. Since the seminal work of Green and Griffiths in 1979, later refined by J.-P. Demailly, J. Noguchi, Y.-T. Siu and others, it became clear that a possible general strategy to attack this problem was to look at particular algebr...

  12. Hengitän ja tunnen kehoni : Luova liike psykofyysisessä fysioterapiassa

    OpenAIRE

    Mäntynen, Mari

    2015-01-01

    Tämän kehittämistehtävän tarkoituksena oli tarkastella luovaa liikettä osana psykofyysistä fysioterapiaprosessia. Luovaa liikettä käsiteltiin tanssi- ja liiketerapian näkökulmasta sekä havainnointi- että terapiamenetelmänä. Psykofyysisen fysioterapian näkemystä kuvattiin ruumiinkuvakäsitteen avulla. Käytännön kokemuksia tuotiin esille sekä yksilöterapiassa että kehotietoisuusryhmässä. Tässä työssä asiakkaiden kokemukset nousivat esille terapeutin arvioimana. Kehittämistehtävä toteutettiin aik...

  13. Avoimen lähdekoodin HA-tietokannat

    OpenAIRE

    Vartio, Sami

    2014-01-01

    Insinöörityössä perehdyttiin avoimen lähdekoodin periaatteisiin ja lisenssimalleihin sekä huomioitiin liiketaloudelliset lähtökohdat. Tavoitteena oli tutustua järjestelmän saatavuuteen sekä klusteroinnin periaatteisiin. Järjestelmän saatavuus (HA) on tietojärjestelmien suunnittelussa käytettävä käytäntö, joka pyrkii siihen että järjestelmä on aina käyttäjän käytettävissä. Aluksi käsiteltiin perustietoja sekä teoriaa. Tutkimuksen edetessä paneuduttiin laajemmin yleisimpiin avoimen lähdeko...

  14. Demovaiheen metallibändin tunnetuksi tekeminen markkinointiviestinnän keinoin

    OpenAIRE

    Pulkkinen, Joonas

    2016-01-01

    Opinnäytetyön tarkoituksena oli tutkia metallibändin brändäystä ja markkinointiviestintää, ja etsiä tätä kautta keinoja lisätä demovaiheessa olevan bändin tunnettuutta markkinointiviestinnän keinoja käyttäen. Demovaiheen bändeillä usein muodostuu ongelmaksi tunnettuudensa lisääminen, johon tämä opinnäytetyö pyrki löytämään ratkaisuja. Teoreettisessa käsiteperustassa käsiteltiin musiikin markkinointia, bändin brändäystä sekä markkinointiviestintää. Demovaiheen bändeillä usein budjetti on var...

  15. Syöpäpotilaiden toiveet hoitoympäristöstä päiväsairaalassa

    OpenAIRE

    Mäki, Saara; Ojalainen, Kati

    2015-01-01

    Tämän opinnäytetyön tarkoituksena oli selvittää syöpäpotilaiden toiveita päiväsairaalan fyysisestä hoitoympäristöstä. Tavoitteena oli saada selville ideaali päiväsairaalatila, jossa potilaat kokevat olonsa mahdollisimman turvalliseksi ja miellyttäväksi. Tämän opinnäytetyön tuloksia voidaan hyödyntää suunnitellessa uuden syöpäsairaalan päiväosastojen hoitotiloja. Opinnäytetyö on toteutettu yhteistyössä Helsingin ja Uudenmaan sairaanhoitopiirin HYKS :in Syöpäkeskuksen kanssa. Tämän opinnäyt...

  16. Työpaikkakiusaamisen synnyn syyt ravintola-alalla

    OpenAIRE

    Öström, Riikka

    2011-01-01

    Tutkimuksen taustalla on henkilökohtainen kokemus työpaikkakiusatuksi joutu-misesta ravintola-alalla. Tutkimusongelmana oli selvittää ne syyt, jotka johtavat ravintola-alalla työpaikkakiusaamiseen sekä selvittää, pätevätkö samat kiusaami-seen johtavat syyt niin ravintola-alalla kuin yleisestikin työelämässä. Tutkimuksen tarkoituksena on antaa valmiuksia työelämään sekä löytää lisää tietoa työpaikkakiusaamisesta ja kuinka sitä pystyttäisiin välttelemään. Teoriaosuudelle antaa pohjan määritelmä...

  17. At the Intersection of Theatre and Social Work in Orissa, India: Natya Chetana and Its Theatre

    OpenAIRE

    Ranta-Tyrkkö, Satu

    2010-01-01

    Tutkimus on etnografia Intiassa Orissan osavaltiossa toimivasta Natya Chetana (Tietoisuuden Teatteri) -teatteriryhmästä, ja ryhmän työstä sosiaalityönä. Natya Chetanan kautta avautuvista näkökulmista käsin tutkimus osallistuu myös sosiaalityön kansainvälisiä ja globaaleja kysymyksiä, tehtäviä ja painotuksia koskevaan keskusteluun. Alunperin tutkimus virisi havainnosta, että yhtäällä itsestään selvästi sosiaalityöksi miellettyjä käytäntöjä ja lähestymistapoja ei välttämättä tunnisteta tai edes...

  18. Kuorma-auton tiedonsiirtoväylät ja HMS 990:n käyttö

    OpenAIRE

    Paajanen, Petri

    2015-01-01

    Tämän insinöörityön tavoitteena on selvittää Mercedes-Benz Actros -kuorma-auton tiedonsiirtoväylien toiminnan teoriaa sekä tarkastella merkkikorjaamojen käytössä olevaan HMS 990 -diagnostiikkatyökalua. Työn tilaajana on Veho Group Oy Ab. Varsinaisen insinöörityön liitteenä syntyi koulutusmateriaalia väylävikojen diagnosointiin Veho Oy:n käyttöön. Väylätekniikkaa on ollut ajoneuvoissa jo vuosia. Tiedonsiirtoväylien avulla saadaan mm. yksinkertaistettua ajoneuvojen sähköjärjestelmää ja kor...

  19. Huoltoneuvojan perehdytysprosessi

    OpenAIRE

    Kaukonen, Jaani

    2017-01-01

    Tässä työssä tutkittiin VV-Autotalot oy:n huoltoneuvojan perehdyttämisprosessia. Työssä käsitellään perehdyttämisen sisältöä sekä Nordean käytössä olevaa perehdytysprosessia uusille palveluneuvojille. Tavoitteena oli tehdä ohjeistus, jonka avulla luodaan selkeä perehdytysprosessi. Suomen laki vaatii, että uusi työntekijä on perehdytettävä ja hänen on saatava opastus työhönsä. Perehdyttämisellä pyritään vähentämään työtapaturmia, virheitä sekä auttamaan uusi työntekijä mahdollisimman nope...

  20. Jäsen 360° -datan vaikutukset Ylöjärven seurakunnan työn kehittämisprosessissa

    OpenAIRE

    Korppoo-Seppänen, Riikka

    2017-01-01

    Tämän opinnäytetyön tarkoituksena oli selvittää, onko Ylöjärven seurakunnan työn kehittämisprosessissa hyödynnetty Jäsen 360° -dataa ja miten se on vaikuttanut työn tekemiseen ja koko seurakunnan toiminnan suunnitteluun ja ohjaukseen. Tarkoituksena oli myös selvittää minkälaisissa tilanteissa ja miten kehittämisprosessi on muuttanut henkilöstön toimintatapoja sekä onko Jäsen 360° -datan avulla muutettu toiminnan suuntaamista. Tutkimuksen avulla selvitettiin Jäsen 360° -datan käytön rajoitteit...