Directory of Open Access Journals (Sweden)
Eneida García López
2010-06-01
Full Text Available Se realizó una investigación descriptiva transversal, con el objetivo de evaluar el nivel de conocimiento sobre implantes dentales de los estomatólogos generales básico e integrales de los municipios, Habana del Este, Centro Habana y Habana Vieja. El Ministerio de Salud Pública tiene especial interés en la implementación y generalización de las técnicas de implantología dental a nivel de los municipios por lo que esta temática se convierte en tema de necesario dominio para los estomatólogos, pues necesitan orientar, tratar y remitir a sus pacientes. Para medir los conocimientos fue aplicada una encuesta que constaba de diez preguntas, y se utilizó los criterios de conocen y desconocen, para evaluar las respuestas según su calidad. El nivel de conocimientos se clasificó en adecuado cuando la encuesta tuvo un 70 % o más de respuestas con el criterio de conocen. El nivel de conocimientos fue no adecuado para los grupos de estudios y para los municipios.A cross-sectional and descriptive research was carried out to assess the knowledge level on dental implants of Basic and Integral General Stomatologists from Habana del Este, Centro Habana and Habana Vieja municipalities and due to its spreading in the different media and the interest of our Public Health Ministry in application of this technique at municipality level it becomes necessary domain of stomatologists because of they need to guide, to treat and to refer the patients. To knowledge measurement we applied a survey including ten questions using to know and not to know criteria to assess the answers according to its quality. The knowledge level was classified as suitable when there was a 70 % or more of answers with the criterion of to know, but this knowledge level was not suitable for study groups and for the municipalities.
Directory of Open Access Journals (Sweden)
Marlén Palet
2007-01-01
Full Text Available Con la declaratoria del Centro Histórico como Monumento Nacional en 1978, el inicio de los Planes de Restauración en 1981, y un año después, la inclusión en la lista del Patrimonio Mundial, se inició una etapa en que, no ajenos a una tendencia internacional, se veía el patrimonio cultural y lo relativo a su salvaguarda, bajo un prisma de mecenazgo, es decir, la necesidad de recuperar los valores heredados en su dimensión sociocultural Ya más adelante fuimos incorporando la temática económica en la salvaguarda patrimonial, donde el territorio adquiere la dimensión de activo económico capaz de auto-sustentar su propia recuperación (Leal, 2004. Las palabras del Historiador de La Habana, en la conferencia dictada en el Forum Universal de las Culturas en Barcelona 2004, sintetizan en pocas líneas lo mucho que en apenas 25 años se ha realizado en materia de rehabilitación del casco histórico de la capital cubana. Indudablemente, una sabia conducción y una voluntad política de los Gobiernos, tanto Local como Nacional, han comenzado a dar resultados favorables en la comunidad. El objetivo del presente trabajo es brindar un análisis del impacto de la rehabilitación de La Habana Vieja en el desenvolvimiento de la población y en la valoración y protagonismo que va activándose en la propia localidad para llevar a cabo la estrategia de desarrollo trazada. Numerosos son los programas que se llevan a cabo con éxito de forma participativa en simultáneo con la obra restauradora. Desde el rescate de monumentos y viejas tradiciones, hasta la atención especializada de los grupos poblacionales más vulnerables. El espacio urbano va cambiando, adquiriendo nuevas funciones u otras perdidas en etapas precedentes; la reconstrucción que se experimenta lleva implícito nuevos procesos territoriales que van remodelando el sistema ambiental local.
[Costs estimation of tuberculosis cases detection. La Habana Vieja Municipality, Cuba. 2002].
Peralta Pérez, Mariana; Gálvez González, Ana M; González Ochoa, Edilberto
2007-01-01
The Cuban Tuberculosis Control Program has been able to significantly reduce the tuberculosis cases incidence in all its forms. La Habana Vieja municipality has maintained the highest incidence in Havana City province during 5 years and one of the highest in the country. To estimate the cost of Tuberculosis cases detection in Habana Vieja municipality, in the year 2002. A descriptive retrospective study to estimate the costs with social perspective was carried out. The costs of cases detection and their departures in health facilities were considered. For patients with cough/expectoration > or =14 days (RS+14) the pocket expense and monetary losses for labour absences were considered. Costs were expressed in equivalent Cuban pesos to American dollars (1 CUC = 1 USD). Information from official records in health institutions and from interviews to workers and RS+14 was obtained. Social cost of tuberculosis cases detection for an RS+14 was in average 24,11 CUC, and institutional cost was 12,55; for clinical investigation 0.37; for sputum smear microscopy 2,25; for culture 7,05; for thorax X-ray 1,67; for notification 3,07; and for registering 0,36. The biggest costs were observed in sputum smear microscopies and cultures performance; salaries and reagents were the issues contributing more in that cost. The results obtained in this study could be extrapolated to other municipalities in the country with social and economic conditions similar to La Habana Vieja.
Directory of Open Access Journals (Sweden)
Eneida García López
2010-06-01
Full Text Available Se realizó una investigación descriptiva transversal, con el objetivo de evaluar el nivel de conocimiento sobre implantes dentales de los estomatólogos generales básico e integrales de los municipios, Habana del Este, Centro Habana y Habana Vieja. El Ministerio de Salud Pública tiene especial interés en la implementación y generalización de las técnicas de implantología dental a nivel de los municipios por lo que esta temática se convierte en tema de necesario dominio para los estomatólogos, pues necesitan orientar, tratar y remitir a sus pacientes. Para medir los conocimientos fue aplicada una encuesta que constaba de diez preguntas, y se utilizó los criterios de conocen y desconocen, para evaluar las respuestas según su calidad. El nivel de conocimientos se clasificó en adecuado cuando la encuesta tuvo un 70 % o más de respuestas con el criterio de conocen. El nivel de conocimientos fue no adecuado para los grupos de estudios y para los municipios.
Directory of Open Access Journals (Sweden)
Juan Manuel Cano Sanchiz
2016-11-01
Full Text Available Arqueologia de Gênero nas cidades de Pelotas - RS - Brasil e Habana Vieja - Habana - Cuba / século XIX es la publicación de la Tesis Doctoral homónima de Karla Ma Fredel, defendida en el Instituto de Filosofia e Ciências Humanas de la Universidade Estadual de Campinas (UNICAMP, en octubre de 2012. La tesis se desarrolló bajo la orientación del profesor Dr. Pedro Paulo A. Funari (Laboratório de Arqueologia Pública, NEPAM/UNICAMP y la co-orientación de los profesores Dra. Lourdes Domínguez (Oficina del Historiador de La Habana; Academia de la Historia de Cuba y Dr. Lúcio Menezes Ferreira (Laboratório Multidisciplinar de Pesquisa Arqueológica, UFPel. Todos ellos han contribuido a esta nueva obra con sendos prólogo (Domínguez, prefacio (Funari y presentación (Ferreira.
Moreno Mora, Roberto
2012-01-01
Objetivo: Determinar la evolución de los pacientes con retardo en el neurodesarrollo y de niños asintomáticos con factores de riesgo, atendidos en el programa comunitario de atención temprana, del municipio Habana Vieja. Métodos: Se realizó una investigación prospectiva de evaluación entre 1998 y 2008. El total de casos en estudio fue de 372 evaluados mediante examen neurológico clásico y por escalas estandarizadas. Se organizó la investigación en tres partes: descripción del universo, result...
La vivienda en La Habana Vieja. Desarrollo histórico, problemática actual y programas en curso
Directory of Open Access Journals (Sweden)
Menéndez García, Madeline
2004-12-01
Full Text Available The domestic architecture of Old Havana, a key aspect of its urban image, presents a variety of problems fundamentally associated with typological characteristics of the traditional house with courtyard and its development over more than four centuries of history. In spite of housing problems in the city as a whole and the fact that the oldest central areas are overcrowded and in a state of deterioration, Old Havana retains high heritage values, provided principally by its architecture, its urban ambience and its vitality. The comprehensiveness of the restoration program in the Historic Center which has been made possible by a new administration model, has led to the incorporation of diverse programs focusing on housing. These form part of an attempt to meet the challenge of preserving the residential nature of the area while at the same time providing decent and comfortable housing.La arquitectura doméstica de la Habana Vieja, protagonista principal de su imagen urbana, presenta un variado repertorio asociado, de manera fundamental, a las características tipológicas de la tradicional casa patio, en su tránsito por más de cuatro siglos de historia. A pesar de los problemas habitacionales que acumula la Ciudad en su conjunto y que en las más antiguas áreas centrales se traducen en sobreocupación y deterioro, La Habana Vieja conserva los altos valores patrimoniales que le han sido reconocidos, proporcionados principalmente por su arquitectura, sus ambientes urbanos y su vitalidad. El carácter integral que persigue el programa de rehabilitación del Centro Histórico y que logra materializarse gracias a su novedoso modelo de gestión, ha posibilitado la incorporación de diversos programas de atención a la vivienda. Con ellos se intenta enfrentar el reto que implica conservar el carácter residencial del conjunto recuperando, al mismo tiempo, la vivienda digna y confortable aspirada.
La imagen de los destinos turísticos cubanos. Un acercamiento desde La Habana Vieja
Directory of Open Access Journals (Sweden)
Dra. Maité Echarri Chávez
2012-11-01
Full Text Available El estudio y análisis de la imagen de los destinos turísticos, a partir de las expectativas del cliente y desde la perspectiva de las entidades comercializadoras de los mismos, constituye todo un reto teniendo en cuenta que la decisión de viajar está también condicionada por un cúmulo de información que puede no ser correspondida con la realidad que se constata en el lugar de destino y los medios de comunicación. El informe que se presenta es resultado de investigaciones cuyo objetivo es conocer y analizar esas expectativas para el caso cubano, así como el análisis de la imagen inducida desde la perspectiva de las entidades comercializadoras, tomando como referente La Habana Vieja, principal destino de ciudad de Cuba. Los resultados obtenidos permitieron reconocer los íconos culturales que identifican a la ciudad y el papel que los mismos juegan en los diferentes soportes comunicacionales, proporcionándoles a las entidades gestoras de la actividad turística el punto de vista adecuado para la futura toma de decisiones en el ámbito de la imagen.
AGS experiments - 1994, 1995, 1996
Energy Technology Data Exchange (ETDEWEB)
Depken, J.C.
1997-01-01
This report contains the following information on the Brookhaven AGS Accelerator complex: FY 1996 AGS schedule as run; FY 1997 AGS schedule (working copy); AGS beams 1997; AGS experimental area FY 1994 physics program; AGS experimental area FY 1995 physics program; AGS experimental area FY 1996 physics program; AGS experimental area FY 1997 physics program (in progress); a listing of experiments by number; two-phage summaries of each experiment begin here, also ordered by number; listing of publications of AGS experiments begins here; and listing of AGS experimenters begins here.
AGS experiments - 1994, 1995, 1996
International Nuclear Information System (INIS)
Depken, J.C.
1997-01-01
This report contains the following information on the Brookhaven AGS Accelerator complex: FY 1996 AGS schedule as run; FY 1997 AGS schedule (working copy); AGS beams 1997; AGS experimental area FY 1994 physics program; AGS experimental area FY 1995 physics program; AGS experimental area FY 1996 physics program; AGS experimental area FY 1997 physics program (in progress); a listing of experiments by number; two-phage summaries of each experiment begin here, also ordered by number; listing of publications of AGS experiments begins here; and listing of AGS experimenters begins here
Turismo y desarrollo sostenible: el caso del centro histórico de la Habana - Cuba
Directory of Open Access Journals (Sweden)
Eduardo Salinas Chávez
2005-01-01
Full Text Available La adaptación a los nuevos tiempos ha hecho necesario una ampliación de la visión sobre los Centros Históricos a nivel mundial, entendiéndose estos no sólo en su valor histórico, cultural y social sino también en su dimensión económica, ya que se trata de lograr un desarrollo integral autofinanciado que haga recuperable y productiva la inversión de restauración y conservación de los mismos. Históricamente La Habana Vieja se caracterizó por disponer de una importante red hotelera que junto a restaurantes, bares, cafeterías, comercios y otros servicios se distinguían en el ámbito internacional. El sector terciario constituye, por tanto, una de las fuentes principales para la diversificación de la base económica del Centro Histórico de La Habana tradicionalmente vinculado al carácter del mismo a través de su tipología y funciones. En esta investigación se abordan de forma holística las relaciones que se establecen entre los cambios generados por el sector turístico en su dimensión económica y la repercusión espacial que implican dichos cambios para el Centro Histórico de La Habana, para lo cual se han aplicado diversos indicadores como el Índice de Centralidad Turística (Biagini, 1986 y la Tasa de Frecuentación Turística (Defert,1967 y se trabaja en la determinación de la Capacidad de Acogida Turística de las diferentes zonas del mismo
Environmental radioactivity surveillance programme 1994-1996
International Nuclear Information System (INIS)
Pollard, D.; Smith, V.; Howett, D.; Hayden, E.; Fegan, M.; O'Colmain, M.; Cunningham, J.D.
1997-12-01
This report presents the results of the terrestrial monitoring programme implemented by the Radiological Protection Institute of Ireland during the period 1994 to 1996. This monitoring programme includes the routine sampling and testing for radioactivity of samples of air, rainwater, drinking water and milk. Atmospheric concentrations of krypton-85 continued to rise over the period. No abnormal readings were observed for gamma dose rate, radioactivity in airborne particulates or radioactivity in rainwater. Significant variation in the concentrations of natural radioactivity was observed between drinking water supplies.The levels of anthropogenic radioactivity recorded during this reporting period in air, rainwater, drinking water and milk continue to be insignificant from a radiological safety point of view
Hábitos o comportamientos inadecuados y malos resultados académicos en estudiantes de secundaria
Aguilar Valdés, Juan; Cumbá Abreu, Caridad; Cortés Alfaro, Alba; Collado, Ana María; García Roche, René G; Pérez Sosa, Dania
2010-01-01
Determinados hábitos y comportamientos son más frecuentes en educandos con malos resultados académicos, por ser sus causas o consecuencias. El objetivo del actual trabajo fue identificar la relación entre los hábitos o comportamientos de vida inadecuados, con los malos resultados académicos de los alumnos de una secundaria básica del municipio Habana Vieja. Se realizó un estudio de tipo transversal, en los 1 129 alumnos de una Escuela Secundaria Básica del Municipio Habana Vieja en Ciudad de ...
Renewable Energy Development on Tribal Lamds of Viejas
Energy Technology Data Exchange (ETDEWEB)
Terrence Meyer (Black & Veatch); Mike Elenbaas (Black & Veatch)
2005-09-30
The purpose of this study is to investigate the feasibility of Renewable Energy Development on the lands of the Viejas Band of the Kumeyaay Indian Nation. In addition, the study will investigate the feasibility of forming a renewable energy based tribal utility. Viejas contracted with Black & Veatch and Fredericks, Pelcyger & Hester, LLC to assist in the development of a feasibility study to ascertain the economics and operational factors of forming an electric and water utility. This report is the result of the investigation conducted by Black & Veatch, with input from Viejas Tribal Government.
Directory of Open Access Journals (Sweden)
Roberto Moreno Mora
2008-09-01
Full Text Available OBJETIVO: evaluar un programa dirigido a los niños con retardo del neurodesarrollo. MÉTODOS: estudio retrospectivo analítico de casos y controles, de la consulta de neurodesarrollo de La Habana Vieja. El universo y muestra estuvo constituido por 170 pacientes con retardo del neurodesarrollo entre los años 2000 y 2006. Se seleccionó aleatoriamente un grupo estudio constituido por 52 niños bajo peso con retraso del desarrollo sicomotor, y un grupo control formado por 118 niños normopesos con retraso del desarrollo sicomotor. Fueron evaluados por un equipo interdisciplinario, y se les realizó seguimiento trimestral, aplicándoles estimulación integral, fisiátrica, sicomotora, logopédica y en el hogar. Se aplicaron programas de estimulación como Isidoro Candell, Bobath y Vojta. RESULTADOS: el grupo estudio presentó el menor por ciento de nivel escolar medio superior (42,31 % y el mayor por ciento de lactancia materna no exclusiva (20,08 %. Además, presentó hipertonía (10,91 %, trastornos de conducta (10,91 % y epilepsia-Down (3,64 %. La evaluación motora presentó en el grupo estudio en la categoría normal, un ascenso a un 59 %. El grupo estudio presentó el mayor por ciento de evolución agravada (12 % y el grupo control presentó un mayor por ciento de evolución favorable (39 %. CONCLUSIONES: la esfera motora presentó una respuesta más positiva que la esfera mental, y la evolución agravada se relacionó con los niños bajo peso con retardo del desarrollo sicomotor, aunque en general la evolución de los niños estimulados en nuestro programa presentó tendencia a la evolución favorable y superada.OBJECTIVE: to evaluate a program directed to children with neurodevelopment retardation. METHODS: a retrospective analytical case-control study was conducted at the neurodevelopment department of Old Havana. The universe and the sample were composed of 170 patients with neurodevelopment retardation from 2000 to 2006. A study group
Directory of Open Access Journals (Sweden)
María Regla Bolaños Gutiérrez
2009-09-01
Full Text Available OBJETIVO: caracterizar la ocurrencia de los diagnósticos tardíos en personas con VIH y posibles fallas de la prevención en la atención primaria. MÉTODOS: se realizó un estudio descriptivo de corte transversal, de los 422 casos ocurridos en la Ciudad de La Habana, en el período comprendido entre 1986-2007. La información se obtuvo de la base de datos nacional de casos VIH/SIDA del Ministerio de Salud Pública. RESULTADOS: los casos de inicio clínico se incrementaron a partir de 1997, con un máximo en 2007, y los municipios con un mayor porcentaje de afectados son La Lisa, Plaza y Habana Vieja. Hubo un predominio del sexo masculino (91 % con orientación sexual de hombres que tienen sexo con hombres (85,3 %; el grupo de edad más afectado fue de 40-44 años (20,4 %, y el 53,3 % son diagnosticados por la pesquisa de ingresos. Las entidades más frecuentes son, el desgaste por VIH (34,4 %, adenopatías generalizadas con CD4 bajos (21,7 %, y neumonía por Pneomucystis jiroveci (16,0 %. En los últimos 10 años hubo un incremento de las defunciones y un 38,4 % fallecen el mismo año de su diagnóstico. CONCLUSIONES: existen dificultades en el trabajo de prevención del VIH/SIDA, en la Atención Primaria de Salud.OBJECTIVE: to characterize the occurrence of late diagnoses in HIV-persons, and the possible failures in primary care. METHODS: a cross-sectional and descriptive study was made of the 422 cases occurred in Havana City from 1986 to 2007. Information is from the national data-base of HIV/AIDS cases of Public Health Ministry. RESULTS: cases of clinical beginning were increased from 1997, with a peak in 2007, and the municipalities with greater percentage of diseased include La Lisa, Plaza, and Habana Vieja. There was a predominance of male sex (91 % with sexual intercourse from man to man (85,3 %; the more affected age group was that aged 40-44 (20,4 %, and the 53,3 % was that more diagnosed through admission inquiry. More frequent
Rodriguez Chavez, E
1996-01-01
"The article argues that the rafters crisis of 1994 and the resulting migration agreements between the United States and Cuba in 1994 and 1995 were a radical turn in policies and migration flows between the two countries. The article also describes the general evolution of Cuban migration flows towards the U.S. from the 1984 bilateral agreement up to 1996. As a context, it describes the structural elements of recent Cuban emigration and the place Cubans occupy in the general immigration from Latin America and the Caribbean." (EXCERPT)
Romero-Placeres, Manuel; Más-Bermejo, Pedro; Lacasaña-Navarro, Marina; Rojo-Solís, Martha María Téllez; Aguilar-Valdés, Juan; Romieu, Isabelle
2004-01-01
OBJETIVO: Identificar la relación que guardan las consultas de urgencias por enfermedades respiratorias agudas, crisis agudas de asma bronquial e infecciones respiratorias agudas, con los cambios diarios en los niveles de contaminación atmosférica, en menores de 14 años de edad que fueron atendidos en dos centros hospitalarios de la ciudad de La Habana. MATERIAL Y MÉTODOS: Se realizó un estudio ecológico de series de tiempo durante el periodo comprendido entre el 1 de octubre de 1996 y el 11 ...
Inguinal hernia repair in the Amsterdam region 1994-1996.
Schoots, I G; van Dijkman, B; Butzelaar, R M; van Geldere, D; Simons, M P
2001-03-01
In the Netherlands, approximately 30,000 inguinal hernia repairs are performed yearly. At least 15% are for recurrence. New procedures are being introduced creating discussion on which technique is the best. Currently it is not possible to choose on evidence alone because of the long follow-up that is needed. In 1996 an inventory was taken of all inguinal hernia repairs that were performed in the Amsterdam region (9 hospitals). These results were compared with the results from a similar study performed in 1994. Major changes in treatment strategy were noted. The Bassini repair was replaced by Shouldice and Lichtenstein techniques. There was a significant increase in the use of prostheses for both primary and recurrent inguinal hernias. There was no significant decrease in the percentage of operations performed for recurrent hernia from 19.5% to 16.8%. However, there was a significant decrease in operations performed for early recurrences (5.1%-3.4%) (p = 0.05). These results suggest that the Shouldice and Lichtenstein repairs may be superior to the Bassini repair in terms of early hernia recurrence.
Interactions between care-giving and paid work hours among European midlife women, 1994 to 1996
Spieß, Christa Katharina; Schneider, A. Ulrike
2003-01-01
This paper uses data from the European Community Household Panel surveys of 1994 and 1996 to study the association between changes in care-giving and changes in weekly work hours. Our sample comprises women aged 45-59 years who participated in the labour force in at least one of the two years studied. Controlling for country variation, we find significant relationships between starting or increasing informal care-giving and changes in weekly work hours. No such association is found however am...
Barde-Cabusson, S.; Finizola, A.; Torres, P.; Víctor Villasante-Marcos, V.; Abella, R.; Aragó, S.; Berthod, C.; Ibarra, P.; Geyer Traver, A.
2013-12-01
Determining the link between shallow structure and volcanism is a topic of interest in Volcanology. We carried out a geophysical study devoted to the characterization of the major structural limits influencing volcanic hydrothermal activity and underground meteoric circulations in La Palma (Canary Islands). Since 1 Ma volcanic activity concentrates at the southern half of the island, on the Cumbre Vieja volcanic rift-zone. During the 1949 eruption a N-S fault system, facing west, developed in the summit area of Cumbre Vieja. This was interpreted as the surface expression of an incipient deformation zone on the western flank. The distribution of the recent activity and faulting indicate that a discontinuity may be present beneath the western flank of Cumbre Vieja, along which a future collapse may occur. Our study, which combines the application of self-potential and soil temperature measurements, provides new information to characterize and locate the limits guiding upward or downward fluid circulation and possibly associated to future failures and potential landslides on the Cumbre Vieja rift-zone. We found a clear asymmetry of the self-potential signal between the eastern and the western flanks of Cumbre Vieja. Strong infiltration of meteoric water seems to affect most of the summit axis while we observe poor variation in the self-potential values on the western flank. This could be explained by a constant thickness of the vadose zone on this flank, i.e., the presence of an impermeable layer at constant depth. This layer could correspond to the landslide interface associated to the previous Cumbre Nueva edifice destruction, on which Cumbre Vieja is currently growing. This constant self-potential pattern is interrupted by at least one other main infiltration zone, near Tajuya volcano, at 1200 m a.s.l. on the western flank, where field observation allowed identifying a small horst-graben system. However it is not clear if this fault system results from local
AGS experiments: 1992, 1993, 1994. Revision December 1994
International Nuclear Information System (INIS)
Depken, J.C.
1995-03-01
This document contains listings and two page summaries for experiments run at the GAS for 1992--1994. Listings are also given for publications and experimenters. A working copy of the 1995--1996 experiment schedule is also included
Energy Technology Data Exchange (ETDEWEB)
Baubron, J C [BRGM, 45 - Orleans (France); Allard, P [CEA Centre d` Etudes Nucleaires de Saclay, 91 - Gif-sur-Yvette (France). Direction des Sciences de la Matiere; Fernandez, E [Obviscori, Heridia (Costa Rica); Hammouya, G [Observatoire de la Soufriere, IPG-P, le Houelmont, 97 - Gourgeyre (France); Soto, G J [ICE, San Jose (Costa Rica)
1997-12-31
The surveillance of the temporal evolution of radon and helium concentrations in the carbon dioxide of crater fumaroles and gaseous emanations is performed since 1992 on the Irazu, Arenal, Poas and Rincon de la Vieja volcanoes in Costa-Rica. The {sup 3}He/{sup 4}He ratio is used as an indicator of the deep origin of the volcanic gas while radon is an indicator of the CO{sub 2} flux. Radon measurements performed on the Irazu show a continuous decay of radon concentration in the intra-crater fumaroles with an important increase of the gaseous flux since 1992. On the contrary, the external fumaroles on the NW flank were characterized by an important increase in radon concentration in 1994 with a stable flux. The radon surveillance performed in soils around the volcano has shown an intense increase of the diffuse gaseous flows probably linked to the micro-seismic activity of the volcano. Similar observations are reported for the Rincon de la Vieja volcano and correlated with its eruptive history and its phreatic and phreato-magmatic activity. Short paper. (J.S.).
Energy Technology Data Exchange (ETDEWEB)
Baubron, J.C. [BRGM, 45 - Orleans (France); Allard, P. [CEA Centre d`Etudes Nucleaires de Saclay, 91 - Gif-sur-Yvette (France). Direction des Sciences de la Matiere; Fernandez, E. [Obviscori, Heridia (Costa Rica); Hammouya, G. [Observatoire de la Soufriere, IPG-P, le Houelmont, 97 - Gourgeyre (France); Soto, G.J. [ICE, San Jose (Costa Rica)
1996-12-31
The surveillance of the temporal evolution of radon and helium concentrations in the carbon dioxide of crater fumaroles and gaseous emanations is performed since 1992 on the Irazu, Arenal, Poas and Rincon de la Vieja volcanoes in Costa-Rica. The {sup 3}He/{sup 4}He ratio is used as an indicator of the deep origin of the volcanic gas while radon is an indicator of the CO{sub 2} flux. Radon measurements performed on the Irazu show a continuous decay of radon concentration in the intra-crater fumaroles with an important increase of the gaseous flux since 1992. On the contrary, the external fumaroles on the NW flank were characterized by an important increase in radon concentration in 1994 with a stable flux. The radon surveillance performed in soils around the volcano has shown an intense increase of the diffuse gaseous flows probably linked to the micro-seismic activity of the volcano. Similar observations are reported for the Rincon de la Vieja volcano and correlated with its eruptive history and its phreatic and phreato-magmatic activity. Short paper. (J.S.).
National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0157610 includes chemical, meteorological, physical and time series data collected from TIME_SERIES_BATS_1994_1996 in the North Atlantic Ocean from...
Desarrollo humano, eutopía y viejas palabras
Directory of Open Access Journals (Sweden)
Chaime Marcuello Servós
2005-01-01
Full Text Available El propósito de este artículo es presentar un marco conceptual a la noción de desarrollo humano como parte importante de una vieja pregunta en ocasiones olvidada, censurada y desde hace un tiempo recuperada por las ciencias sociales; esto es, la pregunta por la buena sociedad. Esta cuestión es algo más que un llamado ético o axiológico. Sus repercusiones son hondas y tienen un contenido social, político, económico y jurídico inevitable. El reto es recuperar una pregunta que va más allá del positivismo tecnocientífico que ha hecho de los datos cuantitativos, del economicismo, de los números y de la falta de crítica una nueva forma de alienación. En este aparente viaje a ninguna parte, no basta con reconocerse como copartícipes del destino de Sísifo, tentados por el carpe diem de Baco o hipnotizados por la vocación de Prometeo y Vulcano. El desarrollo humano ha sido un nuevo paradigma y un cambio de referentes, pero también tiene mucho de re-descubrimiento de viejas palabras.
Torikai, J.D.
1996-01-01
This report describes the status of ground-water resources at U.S. Navy Support Facility, Diego Garcia. Data presented are from January 1994 through September 1996, with a focus on data from July through September 1996 (third quarter of 1996). A complete database of ground-water withdrawals and chloride-concentration records since 1985 is maintained by the U.S. Geological Survey. Total rainfall for the period July through September 1996 was 8.94 inches, which is 60 percent less than the mean rainfall of 22.23 inches for the period July through September. July and August are part of the annual dry season, while September is the start of the annual wet season. Ground-water withdrawal during July through September 1996 averaged 1,038,300 gallons per day. Withdrawal for the same 3 months in 1995 averaged 888,500 gallons per day. Ground-water withdrawals have steadily increased since about April 1995. At the end of September 1996, the chloride concentration of water from the elevated tanks at Cantonment and Air Operations were 68 and 150 milligrams per liter, respectively. The chloride concentration from all five production areas increased throughout the third quarter of 1996, and started the upward trend in about April 1995. Chloride concentration of ground water in monitoring wells at Cantonment and Air Operations also increased throughout the third quarter of 1996, with the largest increases from water in the deepest monitoring wells. Chloride concentrations have not been at this level since the dry season of 1994. A fuel-pipeline leak at Air Operations in May 1991 decreased total islandwide withdrawals by 15 percent. This lost pumping capacity is being offset by increased pumpage at Cantonment. Six wells do not contribute to the water supply because they are being used to hydraulically divert fuel migration away from water-supply wells by a program of ground-water withdrawal and injection.
International Nuclear Information System (INIS)
Baubron, J.C.; Allard, P.; Hammouya, G.; Soto, G.J.
1996-01-01
The surveillance of the temporal evolution of radon and helium concentrations in the carbon dioxide of crater fumaroles and gaseous emanations is performed since 1992 on the Irazu, Arenal, Poas and Rincon de la Vieja volcanoes in Costa-Rica. The 3 He/ 4 He ratio is used as an indicator of the deep origin of the volcanic gas while radon is an indicator of the CO 2 flux. Radon measurements performed on the Irazu show a continuous decay of radon concentration in the intra-crater fumaroles with an important increase of the gaseous flux since 1992. On the contrary, the external fumaroles on the NW flank were characterized by an important increase in radon concentration in 1994 with a stable flux. The radon surveillance performed in soils around the volcano has shown an intense increase of the diffuse gaseous flows probably linked to the micro-seismic activity of the volcano. Similar observations are reported for the Rincon de la Vieja volcano and correlated with its eruptive history and its phreatic and phreato-magmatic activity. Short paper. (J.S.)
Directory of Open Access Journals (Sweden)
Borroto Gutiérrez Susana
2000-01-01
Full Text Available Fundamento: La provincia Ciudad de la Habana, capital de Cuba y con la mayor densidad poblacional, aporta alrededor del 27% de los casos nuevos de tuberculosis. El presente artículo propone describir la distribución y tendencia de las tasas de incidencia de tuberculosis (1986-1998 por municipios y edades en la provincia Ciudad de la Habana. Método: Se calcularon las tasas y el porcentaje de variación total de las tasas, así como el promedio anual de variación en dos etapas y entre ellas (1986-93 y 1994-98. Las tendencias se calcularon mediante regresión lineal simple. Resultados: De 1986 a 1993 la tasa de incidencia provincial ascendió un 6%. De 1994 a 1998 decreció en 7.3%. Los 3 municipios con mayor densidad poblacional mostraron mayor incremento en las tasas. De los 15 municipios sólo en el de La Lisa disminuyeron las tasas durante todo el período. Las tasas por edades fueron similares en todos los municipios, más altas en sujetos ³65 años. El 0.6% de los casos notificados correspondían a personas menores de 15 años. Las tasas de tuberculosis infantil fueron muy bajas en el período estudiado. Conclusiones: Las diferencias en los municipios requieren de acciones diferenciadas para lograr mayor impacto y repercusión en el país. El descenso de las tasas observado en los últimos 3 años denota el control de la epidemia y la recuperación del programa nacional de control de la tuberculosis.
Directory of Open Access Journals (Sweden)
José Armando Chávez Hernández
2012-08-01
Full Text Available En el lugar exacto donde se fundó la Villa de San Cristóbal de La Habana, se levanta un monumento que semeja un pequeño templo de la Grecia antigua: El Templete. Esta importante edificación de la ciudad ha estado sufriendo de lesiones estructurales poco comunes para un inmueble de estas características: pequeña, de una estructura robusta, materiales adecuados, buena ejecución, y por tanto de una excelente estabilidad estructural. Varias intervenciones no han podido evitar que vuelvan a aparecer estas lesiones estructurales, por lo que se hizo necesario un estudio de mayor complejidad y utilizando técnicas más avanzadas, que permitieran llegar a conocer las verdaderas causas de los daños. En este trabajo se expone el procedimiento que se ha seguido para llegar a un diagnóstico sobre bases científicas, que es el soporte para realizar el proyecto de intervención y recuperación del inmueble.Exactly in the same place where the Villa of San Cristóbal of Havana was founded, a monument that look like a small temple from Ancient Greece rises: The Templete. This important building of the city has been suffering unusual structural lesions for a construction with those characteristics: small, robust construction, suitable materials, proper execution, and therefore an excellent structural stability. Several interventions have failed to prevent reappearance of structural lesions, that is why it became necessary a more complex study and the use of more advanced techniques, which allow to get to know the true causes of the damage. This paper outlines the procedure to be followed to arrive at a diagnosis on a scientific basis, which is the main support for the proposed intervention and recovery project of the property.
Burns, F.; Cole, M.; Vaccaro, W.; Alonso Cótchico, M.; Melián, G.; Asensio-Ramos, M.; Padron, E.; Hernandez Perez, P. A.; Perez, N. M.
2017-12-01
Volcanic activity at La Palma (Canary Islands) in the last 123 ka has taken place exclusively at the southern part of the island, where Cumbre Vieja volcano, which is characterized by a main north-south rift zone 20 km long and up to 1950 m in elevation and covering an area of 220 km2 with vents located also at the northwest and northeast. Cumbre Vieja is the most active basaltic volcano in the Canaries with 7 historical eruptions being San Juan (1949) and Teneguía (1971) the most recent ones. Since no visible degassing (fumaroles, etc.) at Cumbre Vieja occurs, our geochemical program for the volcanic surveillance of Cumbre Vieja is mainly focused on diffuse degassing monitoring. Diffuse CO2 emission surveys are yearly performed in summer to minimize the influence of meteorological variations. About 570 sampling sites were selected for each survey to obtain a homogeneous distribution after taking into consideration the local geology, structure, and accessibility. Measurements of soil CO2 efflux were performed in situ by means of a portable non-dispersive infrared sensor following the accumulation chamber method. The soil CO2 efflux values of the 2017 survey ranged from non-detectable to 47.7 g m-2 d-1. Statistical-graphical analysis of the data show two different geocheleemical populations; background (B) and peak (P) represented by 98.2% and 1.8% of the total data, respectively. The geometric means of the B and P populations are 2.9 and 36.5 g m-2 d-1, respectively. Most of the area showed B values while the P values were mainly observed both flanks of the main N-S volcanic rift. To estimate the diffuse CO2 emission in metric tons per day released from Cumbre Vieja (220 km2) for the 2017 survey, we ran about 100 sGs simulations. The estimated 2017 diffuse CO2 output released to atmosphere by Cumbre Vieja was at 801 ± 27 t d-1, value relatively higher than the background average of CO2 emission estimated on 374 t d-1 and within the background range of 132 t d-1
Directory of Open Access Journals (Sweden)
Ricardo Fuentealba
2000-02-01
Full Text Available Se describen los principales resultados del Tercer Estudio Nacional de Consumo de Drogas realizado en Chile por el Consejo Nacional para el Control de Estupefacientes (CONACE entre el 1 de septiembre de 1998 y el 15 de enero de 1999, que utilizó el mismo diseño metodológico de los estudios primero y segundo, realizados en 1994 y 1996, y que amplió la muestra a 31 665 individuos que representaban a una población de 6 940 727 personas de 12 a 64 años de edad, de ambos sexos y de cinco niveles socioeconómicos, residentes en zonas urbanas de 62 comunas de las 13 regiones del país. Además, se comparan los resultados proporcionados por los tres estudios. El estudio de 1998 muestra que 17,5% de los chilenos han consumido alguna vez en la vida alguna de las tres drogas ilícitas de mayor uso en el país: marihuana (16,8%, pasta base (2,3% y clorhidrato de cocaína (4,0%. La prevalencia del consumo de cualquiera de las tres drogas durante el último año fue de 5,3% y durante el último mes de 2,2%, predominando una vez más el consumo de marihuana. Con respecto a las drogas lícitas, 28,4% de los chilenos han consumido alguna vez en su vida ansiolíticos, 84,4% alcohol y 71,9% tabaco. La mayor parte de las personas que alguna vez consumieron drogas ilegales dejaron de hacerlo: 71,6, 64,1 y 66,8% en el caso de la marihuana, de la pasta base de cocaína y del clorhidrato de cocaína, respectivamente. Para las drogas legales, estos porcentajes fueron menores: 55,5% para los ansiolíticos, 16,0% para el alcohol y 34,5% para el tabaco. El consumo de drogas lícitas e ilícitas fue varias veces mayor en los hombres que en las mujeres, excepto el de ansiolíticos, que fue tres veces mayor en el sexo femenino que en el masculino. El consumo fue más frecuente entre los 19 y 25 años de edad. El consumo de drogas ilícitas fue más frecuente en los niveles socioeconómicos más altos y el de drogas lícitas en los más bajos. El percentil 50 de la edad
Energy Technology Data Exchange (ETDEWEB)
Pasto, A.E.; Russell, B.J.
1997-10-01
The High Temperature Materials Laboratory (HTML) has completed its ninth year of operation as a designated US Department of Energy User Facility at the Oak Ridge National Laboratory. This document profiles the historical growth of the HTML User and Fellowship Programs since their inception in 1987. Growth of the HTML programs has been demonstrated by the number of institutions executing user agreements, and by the number of days of instrument use (user days) since the HTML began operation. A total of 276 nonproprietary agreements (135 industry, 135 university, and 6 other federal agency) and 56 proprietary agreements are now in effect. This represents an increase of 70 nonproprietary user agreements since the last reporting period (for FY 1994). A state-by-state summary of these nonproprietary user agreements is given in Appendix A, and an alphabetical listing is provided in Appendix B. Forty-four states are represented by these users. During FY 1995 and 1996, the HTML User Program evaluated 145 nonproprietary proposals (62 from industry, 82 from universities, and 1 from other government facilities) and several proprietary proposals. The HTML User Advisory Committee approved about 95% of those proposals, frequently after the prospective user revised the proposal based on comments from the committee. This annual report discusses activities in the individual user centers, as well as plans for the future. It also gives statistics about users, proposals, and publications as well as summaries of the nonproprietary research projects active during 1995 and 1996.
Fluharty, Marilyn J.
1992-01-01
Commercial Passenger Fishing Vessel (CPFV) logs were analyzed to determine the degree of sea lion interactions in the CPFV fishery. From 1994 to 1996, sea lions depredated over 152,000 fish representing more than 40 different species. Although the depredation total seems high, it is still less than 10% of the fish caught by anglers. In southern California, sea lions primarily depredated California barracuda and mackerels, while in central and northern California, they depredated salmonids. De...
Plant cell wall architecture. Final report, 1 June 1994--30 October 1996
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-12-31
The authors have successfully finished the DOE-supported project entitled ``Plant cell wall architecture.`` During the funding period (June 1, 1994--October 30, 1996), they have published 6 research papers and 2 review articles. A brief description of these accomplishments is outlined as follows: (1) Improved and extended tissue printing techniques to reveal different surface and wall architectures, and to localized proteins and RNA. (2) Identification of an auxin- and cytokinin-regulated gene from Zinnia which is mainly expressed in cambium. (3) It was found that caffeoyl CoA 3-O-methyltransferase is involved in an alternative methylation pathway of lignin biosynthesis. (4) It was found that two different O-methyltransferases involved in lignification are differentially regulated in different lignifying tissues during development. They propose a scheme of monolignol biosynthesis combining both methylation pathways. (5) Identification of cysteine and serine proteases which are preferentially expressed during xylogenesis. This is the first report to identify an autolysis-associated cDNA in plants. (6) Characterization of two ribonuclease genes which are induced during xylogenesis and by wounding. (7) Isolation of cinnamic acid 4-hydroxylase gene and analysis of its expression patterns during lignification.
Report of Activity, 1994 - 1996; Rapport d`activite, 1994 - 1996
Energy Technology Data Exchange (ETDEWEB)
Gutbrod, H H [Laboratoire de Physique Subatomique et des Technologies Associees - SUBATECH, Centre National de la Recherche Scientifique, 44 - Nantes (France)
1997-10-01
SUBATECH (Laboratory of Subatomic Physics and Associated Technologies) has been created in 1994 by three founding fathers, the Ecole des Mines de Nantes, the University of Nantes and the Institute IN2P3/CNRS. The challenging new idea was to house under one roof groups working in fundamental research as well as those working in applied research. During the first year the experimental activities focused on nuclear collisions at lower energies, e.g. reactions mechanism studies with the detector INDRA at GANIL. The laboratory specialized in the analysis of two particle correlations which allows to study the dynamics and the geometry aspects of the reaction mechanism. In the area of subatomic Physics our teams study the collisions of heavy ions at different energies to investigate the multifragmentation of nuclei or to search for the quark gluon plasma. In the area of associated TECHnologies the accent is on the problems related to nuclear waste, from the `treatment of nuclear waste with new method (GEDEON)` or its interaction with bacteria to the research of the chemistry of Tc, Ac-225 and Bi-213 and the program of alpha-immunotherapy on micro-tumors. In the field of fundamental science, in parallel to the work on simulations for the new projects, the Subatech scientists could start work on prototypes for the experiments ALICE at the LHC at CERN (scheduled for the year 2005) and STAR at RHIC at Brookhaven (scheduled for 1999). The experimental groups work closely together with the theory groups of Subatech. The author of the VENUS model works in Subatech. This internationally known model is amongst the most important code capable to describe many of the SPS data. Another theory group works on the analysis of multiparticle correlations in the WA98 data with the wavelet theory. Finally, a third group is currently studying the multifragmentation in the final state at GANIL
Dynamics of diffuse carbon dioxide emissions from Cumbre Vieja volcano, La Palma, Canary Islands
Padrón, Eleazar; Pérez, Nemesio M.; Rodríguez, Fátima; Melián, Gladys; Hernández, Pedro A.; Sumino, Hirochika; Padilla, Germán; Barrancos, José; Dionis, Samara; Notsu, Kenji; Calvo, David
2015-04-01
We report herein the results of 13 soil CO2 efflux surveys at Cumbre Vieja volcano, La Palma Island, the most active basaltic volcano in the Canary Islands. The CO2 efflux measurements were undertaken using the accumulation chamber method between 2001 and 2013 to constrain the total CO2 output from the studied area and to evaluate occasional CO2 efflux surveys as a volcanic surveillance tool for Cumbre Vieja. Soil CO2 efflux values ranged from non-detectable up to 2442 g m-2 days-1, with the highest values observed in the south, where the last volcanic eruption took place (Teneguía, 1971). Isotopic analyses of soil gas carbon dioxide suggest an organic origin as the main contribution to the CO2 efflux, with a very small magmatic gas component observed at the southern part of the volcano. Total biogenic and magmatic combined CO2 emission rates showed a high temporal variability, ranging between 320 and 1544 t days-1 and averaging 1147 t days-1 over the 220-km2 region. Two significant increases in the CO2 emission observed in 2011 and 2013 were likely caused by an enhanced magmatic endogenous contribution revealed by significant changes in the 3He/4He ratio in a CO2-rich cold spring. The relatively stable emission rate presented in this work defines the background CO2 emission range for Cumbre Vieja during a volcanic quiescence period.
Stability analysis of Western flank of Cumbre Vieja volcano (La Palma) using numerical modelling
Bru, Guadalupe; Gonzalez, Pablo J.; Fernandez-Merodo, Jose A.; Fernandez, Jose
2016-04-01
La Palma volcanic island is one of the youngest of the Canary archipelago, being a composite volcano formed by three overlapping volcanic centers. There are clear onshore and offshore evidences of past giant landslides that have occurred during its evolution. Currently, the active Cumbre Vieja volcano is in an early development state (Carracedo et al., 2001). The study of flank instability processes aim to assess, among other hazards, catastrophic collapse and potential tsunami generation. Early studies of the potential instability of Cumbre Vieja volcano western flank have focused on the use of sparse geodetic networks (Moss et al. 1999), surface geological mapping techniques (Day et al. 1999) and offshore bathymetry (Urgeles et al. 1999). Recently, a dense GNSS network and satellite radar interferometry results indicate ground motion consistent with deep-seated creeping processes (Prieto et al. 2009, Gonzalez et al. 2010). In this work, we present a geomechanical advanced numerical model that captures the ongoing deformation processes at Cumbre Vieja. We choose the Finite Elements Method (FEM) which is based in continuum mechanics and is the most used for geotechnical applications. FEM has the ability of using arbitrary geometry, heterogeneities, irregular boundaries and different constitutive models representative of the geotechnical units involved. Our main contribution is the introduction of an inverse approach to constrain the geomechanical parameters using satellite radar interferometry displacements. This is the first application of such approach on a large volcano flank study. We suggest that the use of surface displacements and inverse methods to rigorously constrain the geomechanical model parameter space is a powerful tool to understand volcano flank instability. A particular important result of the studied case is the estimation of displaced rock volume, which is a parameter of critical importance for simulations of Cumbre Vieja tsunamigenic hazard
A propos des indiens Makú -compte-rendu de mission dans le Vaupés colombien (1994-1996-
Directory of Open Access Journals (Sweden)
1998-01-01
Full Text Available Après deux années denquête ethnographique parmi les Indiens Makú du Vaupés colombien, et dans le but de mettre fin aux nombreuses confusions dont ceux-ci sont lobjet depuis le boom médiatique déclenché par lapparition, en 1988, de leurs voisins Nukak du Guaviare, il savérait nécessaire dactualiser quelques données élémentaires concernant ces peuples encore méconnus des basses-terres dAmérique du Sud. A PROPÓSITO DE LOS INDIOS MAKÚ -INFORME DE INVESTIGACIÓN EN EL VAUPÉS COLOMBIANO (1994-1996. Después de dos años de investigación etnográfica entre los Indios Makú del Vaupés colombiano, y con el propósito de acabar con las numerosas confusiones de las cuales éstos son objeto desde el boom de los medios ocasionado por la aparición, en 1988, de sus vecinos Nukak del Guaviare, se hacía necesario actualizar la información que se tiene sobre estos pueblos aún desconocidos de las tierras bajas de la América del Sur. ABOUT MAKU INDIANS -FIELDWORK REPORT IN THE COLOMBIAN VAUPES (1994-1996. This article summarizes two years of ethnographic fieldwork among Makú Indians of the Colombian Vaupés, in order to put end to the confusion that resulted from the media boom triggered by the appearance of Nukak in Guaviare in 1998. This situation justifies making available data on yet unknown peoples in the South American lowlands.
UNIDIR and its activities. 1996
International Nuclear Information System (INIS)
1996-04-01
The United Nations Institute for Disarmament Research (UNIDIR) was established by the General Assembly for the purpose of undertaking independent research on disarmament and related problems, particularly international security issues. This paper covers the description of UNIDIR mandate, organization and finance, fellowship program, research program for 1996 and beyond, projects to be conducted in 1996, activities done in 1994/1995, list of the major conferences held, list of publications, UNIDIR voluntary contributors, and the statute of this organization
International Nuclear Information System (INIS)
1997-04-01
The Uranium Industry Annual 1996 (UIA 1996) provides current statistical data on the US uranium industry's activities relating to uranium raw materials and uranium marketing. The UIA 1996 is prepared for use by the Congress, Federal and State agencies, the uranium and nuclear electric utility industries, and the public. Data on uranium raw materials activities for 1987 through 1996 including exploration activities and expenditures, EIA-estimated reserves, mine production of uranium, production of uranium concentrate, and industry employment are presented in Chapter 1. Data on uranium marketing activities for 1994 through 2006, including purchases of uranium and enrichment services, enrichment feed deliveries, uranium fuel assemblies, filled and unfilled market requirements, uranium imports and exports, and uranium inventories are shown in Chapter 2. A feature article, The Role of Thorium in Nuclear Energy, is included. 24 figs., 56 tabs
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-04-01
The Uranium Industry Annual 1996 (UIA 1996) provides current statistical data on the US uranium industry`s activities relating to uranium raw materials and uranium marketing. The UIA 1996 is prepared for use by the Congress, Federal and State agencies, the uranium and nuclear electric utility industries, and the public. Data on uranium raw materials activities for 1987 through 1996 including exploration activities and expenditures, EIA-estimated reserves, mine production of uranium, production of uranium concentrate, and industry employment are presented in Chapter 1. Data on uranium marketing activities for 1994 through 2006, including purchases of uranium and enrichment services, enrichment feed deliveries, uranium fuel assemblies, filled and unfilled market requirements, uranium imports and exports, and uranium inventories are shown in Chapter 2. A feature article, The Role of Thorium in Nuclear Energy, is included. 24 figs., 56 tabs.
Plant remains of archaeological site Casa Vieja, Callango (Ica
Directory of Open Access Journals (Sweden)
José Roque
2013-06-01
Full Text Available A paleoethnobotanical study was carried out at the Middle Horizon archaeological site of Casa Vieja, located in Callango within the Lower Ica Valley. A total of 23 species were identified, all determined to be of the Magnoliopyta Division, 78 % (or 18 species were Magnoliopsid and 22% (or 15 species Liliopsid. The Fabaceae are the best represented family with 6 species. Most of the analyzed samples correspond to seeds of Gossypium barbadense “cotton”. Seventy percent of the species were probably used as food; 48% for artifact-making and construction and 52% for medicinal and curative purposes.
Factores psicosociales que influyen en el abandono de la lactancia materna
Raisa Durán Menéndez; Déborah Villegas Cruz; Zeida Sobrado Rosales; Manuel Almanza Mas
1999-01-01
Se realizó un estudio prospectivo sobre el abandono de la lactancia materna en 144 madres en la Consulta de Seguimiento del Servicio de Neonatología del Hospital General Docente "Enrique Cabrera", de Ciudad de La Habana, durante el período comprendido de junio de 1994 a diciembre de 1996. Se valoraron los niveles de escolaridad de los padres, ocupación, apoyo familiar y nivel de ansiedad de la madre, entre otros. El 59,1 % de los neonatos lactó hasta los primeros 4 meses de vida. El objetivo ...
Diffuse He degassing from Cumbre Vieja volcano, La Palma, Canary Islands
Asensio-Ramos, María; De Jongh, Marli E.; Lamfers, Kristen R.; Alonso, Mar; Amonte, Cecilia; Padrón, Eleazar; Hernández, Pedro A.; Pérez, Nemesio M.
2017-04-01
Helium is considered as an ideal geochemical tracer due to its geochemical properties: chemical inertness, physical stability and practical insolubility in water under normal conditions. These characteristics, together with its high mobility on the crust, make the presence of helium anomalies on the surface environment of a volcanic system to be related to deep fluid migration controlled by volcano-tectonic features, also providing valuable information about the location and characteristics of the gas source and the fracturing of the crust. The recent results reported by Padrón et al. (2013) clearly show importance of helium emission studies for the prediction of major volcanic events and the importance of continuous monitoring of this gas in active volcanic regions. La Palma Island (708.32 km2) is located at the northwestern end of the Canarian Archipelago. Subaerial volcanic activity on this island started ˜2.0 My ago and has taken place exclusively at the southern part in the last 123 ka. Cumbre Vieja volcano, the most active basaltic volcano of the Canary Islands, was built in this zone, including a main north-south rift area 20 km long and up to 1,950 m in elevation, with vents located also at the northwest and northeast. Padrón et al., (2012) showed that helium is mainly emitted along both N-S and N-W rift of Cumbre Vieja, being, therefore, zones of enhanced permeability for deep gas migration and preferential routes for degassing. This work represents a continuation of the results obtained by Padrón et al. (2012) until the year 2016. Each study covered the 220 km2 of Cumbre Vieja with an average of 570 homogenously distributed sampling points. At each sampling site, soil gas samples were collected at 40 cm depth by withdrawing the gas aliquots into 60 cc hypodermic syringes. He content in the soil gases was analyzed by means of quadrupole mass spectrometry (QMS). Atmospheric gas was used periodically to calibrate the instrument. To estimate the helium
Identifying ideology: media representations of the Irving Oil Refinery strike, 1994-1996
Energy Technology Data Exchange (ETDEWEB)
Steuter, E.C.
1998-07-01
Media coverage of a strike at the Irving Oil Refinery in Saint John, New Brunswick which began in 1994 and lasted until 1996 is used as a background for the examination of ideology, used here in the more inclusive sense, one in which the term suggests a frame of mind without the coherence and easily recognized label usually associated with political ideology. Central issues such as monopoly ownership of the New Brunswick media by the Irving Group of Companies (also owners of the refinery) , the ideological presentation of strikes in general, and the representation of changing labour relations in a post-industrial, globally-oriented society are analyzed to show how these issues influenced media coverage. Four New Brunswick dailies as well as selected English-language dailies from other parts of Canada have been scrutinized in an effort to determine their ideological stand. It was found that restrictive ideologies such as liberalism or conservatism are on the decline; instead, more inclusive ideologies like defeatism and individualism were prominently featured especially by the St. John Telegraph-Journal in New Brunswick and other papers outside the province. The most striking finding was that if the media coverage of the Irving Refinery strike is representative of public opinion, the current organization of the provincial political economy is accepted as 'natural' by a majority of New Brunswickers.
AGS experiments: 1993 - 1994 - 1995
Energy Technology Data Exchange (ETDEWEB)
Depken, J.C.
1996-04-01
This report contains: FY 1995 AGS Schedule as Run; FY 1996-97 AGE Schedule (working copy); AGS Beams 1995; AGS Experimental Area FY 1993 Physics Program; AGS Experimental Area FY 1994 Physics Program; AGS Experimental Area FY 1995 Physics Program; AGS Experimental Area FY 1996 Physics Program (In progress); A listing of experiments by number; Two-page summaries of each experiment begin here, also ordered by number; Listing of publications of AGS experiments begins here; and Listing of AGS experimenters begins here. This is the twelfth edition.
AGS experiments: 1993 - 1994 - 1995
International Nuclear Information System (INIS)
Depken, J.C.
1996-04-01
This report contains: FY 1995 AGS Schedule as Run; FY 1996-97 AGE Schedule (working copy); AGS Beams 1995; AGS Experimental Area FY 1993 Physics Program; AGS Experimental Area FY 1994 Physics Program; AGS Experimental Area FY 1995 Physics Program; AGS Experimental Area FY 1996 Physics Program (In progress); A listing of experiments by number; Two-page summaries of each experiment begin here, also ordered by number; Listing of publications of AGS experiments begins here; and Listing of AGS experimenters begins here. This is the twelfth edition
Composition patterns of waterbirds from La Vieja River, Geographic Valley of Cauca River, Colombia
International Nuclear Information System (INIS)
Ramirez Urrea, Laura Milena; Arbelaez Cortes, Enrique; Marin Gomez, Oscar Humberto; Duque Montoya, Diego
2014-01-01
We compiled and analyzed data gathered from observations during the period 2001-2013 in three sectors along La Vieja River, located in the Cauca River Valley, Colombia. We describe spatial and temporal aspects of such dataset, focusing in indentify patterns of species' composition and abundance. We recorded 28 waterbird species in 33 transects, being 22 species observed in more than 50 % of these transects. The species richness among transects did not shows significant differences. However, two cluster analyses, considering both presence/absence and abundance data, showed that there is spatial structure in the species composition along the river. In contrast, although observations were conducted during more than ten years there is no evidence of temporal changes in species composition. Still, some species showed increase or decrease trends in their frequency. We present a new record for one species (Chloroceryle aenea) for the region. Despite that the landscape surrounding La Vieja River has faced a high anthropogenic impact; the river still presents a significant diversity of waterbirds, which could add value to the conservation plans in the zone.
Migraciones y efectos socio-ambientales. La Habana de los 90
Directory of Open Access Journals (Sweden)
René A. González Rego
2007-01-01
Full Text Available el presente artículo hace referencia al efecto social de las migraciones internas en Habana de la década de los noventa del pasado siglo. Ttiene en cuenta la estructura por sexos y edades, racial y laboral, según el lugar de procedencia de los inmigrantes, analizando la posible influencia de estos parámetros en el entorno ciudadano, ya sea por la introducción de hábitos, costumbres o formas de comportamiento ajenos a la ciudad, o bien por las características de la vivienda; elementos todos ellos que contribuyen a diferenciar el ambiente social de la urbe desde el punto de vista espacial. Eestos elementos, en las condiciones de crisis económica actual, contribuyen a su vez a que se agraven los problemas sociales, de empleo y de servicios básicos en la ciudad. el análisis de esta problemática se basa en la Eencuesta Nnacional de Iinternas de 1.995, así como en diferentes resultados de investigación vinculados a esta temática, obtenidos por el Centro de Estudios Demográficos de la Universidad de La Habana y por el propio autor.
Torikai, J.D.
1996-01-01
This report describes the status of ground-water resources at U.S. Navy Support Facility, Diego Garcia. Data presented are from January 1994 through March 1996, with a focus on data from January through March 1996 (first quarter of 1996). A complete database of ground-water withdrawals and chloride-concentration records since 1985 is maintained by the U.S. Geological Survey. Cumulative rainfall for January through March 1996 was about 30 inches, which is 9 percent less than the mean cumulative rainfall of about 33 inches for January through March. The period January through February is the end of the annual wet season, while March marks the start of the annual dry season. Ground-water withdrawal during January through March 1996 averaged 970,300 gallons per day. Withdrawal for the same 3 months in 1995 averaged 894,600 gallons per day. With- drawal patterns during the first quarter of 1996 did not change significantly since 1991, with the Cantonment and Air Operations areas supplying about 99 percent of total islandwide pumpage. At the end of March 1996, the chloride concentration of water from the elevated tanks at Cantonment and Air Operations were 47 and 80 milligrams per liter, respectively. The chloride data from all five production areas showed no significant upward or downward trends throughout the first quarter of 1996. Potable levels of chloride concentrations have been maintained by adjusting individual pumping rates, and also because of the absence of long-term droughts. Chloride concentration of ground water in monitoring wells at Cantonment and Air Operations also showed no significant trends throughout the first quarter of 1996. Chloride concentrations have been about the same since the last quarter of 1995. A fuel-pipeline leak at Air Operations in May 1991 decreased total islandwide withdrawals by 15 percent. This lost pumping capacity is being offset by increased pumpage at Cantonment. Six wells do not contribute to the water supply because they
Torikai, J.D.
1996-01-01
This report describes the status of ground-water resources at U.S. Navy Support Facility, Diego Garcia. Data presented are from January 1994 through June 1996, with a focus on data from April through June 1996 (second quarter of 1996). A complete database of ground-water withdrawals and chloride-concentration records since 1985 is maintained by the U.S. Geological Survey. Cumulative rainfall for April through June 1996 was 22.64 inches, which is 12 percent more than the mean cumulative rainfall of 20.21 inches for April through June. The period April through June is part of the annual dry season. Ground-water withdrawal during April through June 1996 averaged 1,048,000 gallons per day. Withdrawal for the same 3 months in 1995 averaged 833,700 gallons per day. Withdrawal patterns during the second quarter of 1996 did not change significantly since 1991, with the Cantonment and Air Operations areas supplying about 99 percent of total islandwide pumpage. At the end of June 1996, the chloride concentration of water from the elevated tanks at Cantonment and Air Operations were 52 and 80 milligrams per liter, respectively. The chloride data from all five production areas showed no significant upward or downward trends throughout the second quarter of 1996. Potable levels of chloride concentrations have been maintained by adjusting individual pumping rates, and also because of the absence of long-term droughts. Chloride concentration of ground water in monitoring wells at Cantonment and Air Operations also showed no significant trends throughout the second quarter of 1996. Chloride concentrations have been about the same since the last quarter of 1995. A fuel-pipeline leak at Air Operations in May 1991 decreased total islandwide withdrawals by 15 percent. This lost pumping capacity is being offset by increased pumpage at Cantonment. Six wells do not contribute to the water supply because they are being used to hydraulically divert fuel migration away from water
Estudio del empleo de los pronombres clíticos en un corpus oral de La Habana (Cuba
Directory of Open Access Journals (Sweden)
Milagros Aleza
2013-04-01
Full Text Available Esta investigación tiene por objeto un estudio del uso de los pronombres átonos (clíticos en un corpus oral de La Habana (Cuba: El habla culta de la generación joven de La Habana. Materiales para su estudio (tomo 2 de la obra El habla culta de la generación joven de San Juan, La Habana y Santo Domingo. Materiales para su estudio, publicada en 2001. Dado que Cuba es uno de los países considerados distinguidores de caso, resulta especialmente interesante conocer qué verbos y qué estructuras pronominalizan en ambos casos o se inclinan por el uso del dativo en lugar del acusativo, con el fin de analizar las posibles opciones y determinar qué estructuras o tipos de verbo determinan y condicionan la elección del pronombre. Para ello, abordaremos el uso de los clíticos de tercera persona en verbos o construcciones transitivas y de caso reinterpretado, así como otros fenómenos interesantes como la inmovilización del pronombre le y la duplicación del complemento mediante clítico.
International Nuclear Information System (INIS)
Pena, J. J.; Rossell, M. A.; Calvo, J. L.; Vega, J. M.
2003-01-01
The Ibero-American Group of Scientific Societies of Radiological Protection (GRIAPRA) was constituted on 30-September-1996 as the end of a process that the SEPR began in its V National Congress (Santiago de Compostela, 1994). In this work are presented some of the results of the experience accumulated by the SEPR (GRIAPRA) in training and professional update of latin-american radiologists,medical physicists and technician during these last six years:Cuba (La Habana 1998), Peru (Lima 1999), Mexico (Guadalajara 2000), Brazil (Recife, 2001), Peru (Lima 2002) and Cuba (La Habana 2003). They are shown the professional profiles of the american colleagues that in number superior to 300 persons have been accepted in these training courses imparted by members very qualified of the SEPR and SEFM, the theoric-practical structure of these courses, the design of their programming, documentation, the sources of financing, the general analysis of the wisdoms and mistakes and the proposal to continue with this cooperation in the future. (Author)
Energy Technology Data Exchange (ETDEWEB)
Pena, J. J.; Rossell, M. A.; Calvo, J. L.; Vega, J. M.
2003-07-01
The Ibero-American Group of Scientific Societies of Radiological Protection (GRIAPRA) was constituted on 30-September-1996 as the end of a process that the SEPR began in its V National Congress (Santiago de Compostela, 1994). In this work are presented some of the results of the experience accumulated by the SEPR (GRIAPRA) in training and professional update of latin-american radiologists,medical physicists and technician during these last six years:Cuba (La Habana 1998), Peru (Lima 1999), Mexico (Guadalajara 2000), Brazil (Recife, 2001), Peru (Lima 2002) and Cuba (La Habana 2003). They are shown the professional profiles of the american colleagues that in number superior to 300 persons have been accepted in these training courses imparted by members very qualified of the SEPR and SEFM, the theoric-practical structure of these courses, the design of their programming, documentation, the sources of financing, the general analysis of the wisdoms and mistakes and the proposal to continue with this cooperation in the future. (Author)
Energy Technology Data Exchange (ETDEWEB)
Gutierrez Negrin, Luis C. A. [Gerencia de Proyectos Geotermoelectricos de la Comision Federal de Electricidad, Morelia (Mexico)
1997-01-01
During 1996, 56.2 million tons of steam were produced, at an average annual rate of 6,416 tons per hour (t/h), to supply enough steam to operate of 26 geothermal-electric plants in three geothermal fields, which represent an installed capacity of 743 MW. To accomplish that production, 177 geothermal wells were operated at an average annual production of 36 t/h of steam. Electricity generation was 5,737 gigawatts-hour, which represent 3.8% of the whole electrical energy generated in Mexico in 1996. Production of steam and generation of electricity were increased in 1996, comparing with 1994 and 1995. However, unitary costs were practically the same between 1995 and 1996. The Comision Federal de Electricidad (Federal Commission for Electricity, or CFE) has programmed several geothermal- electric projects to increase the installed capacity in the fields under exploitation in new fields. Also, the CFE has some non electrical projects to reach an integral use of geothermics in Mexico. [Espanol] A fin de suministrar el vapor necesario para la generacion de 26 plantas geotermoelectricas instaladas en tres campos geotermicos, con una capacidad total de 743 megawatts (MW) durante 1996 se produjeron 56.2 millones de toneladas de vapor, a una tasa media anual de 6,416 toneladas por hora (t/h). Ello implico la operacion de 177 pozos productores, con una produccion de la energia electrica generada en Mexico en 1996. Tanto la produccion de vapor como la generacion de electricidad en 1996 se incrementaron con respecto a los anos precedentes de 1994 y 1995, pese a que los costos unitarios se mantuvieron practicamente constantes entre 1995 y 1996. La Comision Federal de Electricidad (CFE) tiene en programa varios proyectos geotermoelectricos para incrementar la capacidad instalada en los campos en explotacion y para iniciar el aprovechamiento en campos nuevos, asi como proyectos no electricos para conseguir un aprovechamiento integral de la geotermia en Mexico.
Human genome program report. Part 2, 1996 research abstracts
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-11-01
This report contains Part 2 of a two-part report to reflect research and progress in the US Department of Energy Human Genome Program from 1994 through 1996, with specified updates made just before publication. Part 2 consists of 1996 research abstracts. Attention is focused on the following: sequencing; mapping; informatics; ethical, legal, and social issues; infrastructure; and small business innovation research.
Russia's Chechen Wars 1994-2000: Lessons from Urban Combat
National Research Council Canada - National Science Library
Oliker, Olga
2001-01-01
This report provides an analysis of Russian combat in Chechnya beginning with the first modern Chechen war of 1994-1996 and comparing and contrasting it with the ongoing conflict that began in 1999...
Directory of Open Access Journals (Sweden)
F. Ballester
2002-12-01
Full Text Available Objetivo: Estimar la asociación a corto plazo entre los valores de contaminación atmosférica por partículas en suspensión y diferentes indicadores de morbilidad y mortalidad en la ciudad de Valencia. Métodos: Estudio ecológico de series temporales en el que se relacionan las variaciones diarias en los valores de contaminación atmosférica por humos negros e indicadores de mortalidad, ingresos hospitalarios y visitas a urgencias en la ciudad de Valencia, durante el período 1994-1996. La magnitud de la asociación se estimó mediante regresión autorregresiva de Poisson utilizando modelos aditivos generalizados. Se examinó la forma de la relación, el efecto retardado de la contaminación y la posible modificación de efecto por otros contaminantes o períodos del año. Resultados: Existe una asociación significativa entre los valores de partículas en suspensión y varios indicadores analizados en Valencia. La forma de dicha relación es lineal. Un incremento de 10 μg/m³ en los valores diarios de humos negros se asoció con un incremento del 1,8% (intervalo de confianza [IC] del 95%, 0,9-2,7% en el número de defunciones del día siguiente. El mismo incremento en la contaminación se asoció con un aumento del 1,5% (0,1-2,8% en las defunciones por causa circulatoria, en un 1,3% (0,0-2,6% en los ingresos por causas circulatorias y en un 5,4 (0,6-10,4% en el número de visitas a urgencias por asma. Esta asociación no está confundida por los valores de otros contaminantes. No se encontró asociación de los humos negros con la mortalidad por enfermedades respiratorias, los ingresos hospitalarios por enfermedades cerebrovasculares ni las visitas a urgencias por enfermedad pulmonar obstructiva crónica (EPOC. Conclusiones: Este estudio proporciona evidencia de que los valores de partículas en suspensión en Valencia se asocian con las urgencias por asma, los ingresos por enfermedades circulatorias y las defunciones diarias. La asociaci
Liegler, A.; Bakkar Hindeleh, H.; Deering, C. D.; Fentress, S. E.
2015-12-01
Volcanic gas emissions are a key component for monitoring volcanic activity, magmatic input of volatiles to the atmosphere and the assessment of geothermal potential in volcanic regions. Diffuse soil degassing has been shown to represent a major part of volcanic gas emissions. However, this type of gas emission has not yet been quantified in the Guanacaste province of Costa Rica; a region of the country with several large, active or dormant volcanoes. We conducted the first study of diffuse CO2 degassing at Rincón de la Vieja and Miravalles volcanoes, both located in Guanacaste. Diffuse degassing was measured using the accumulation chamber method to quantify CO2 flux in regions where hydrothermal surface features indicate anomalous activity. The total diffuse carbon dioxide flux estimated at Miravalles in two areas, together roughly 2 km2 in size, was 135 t/day and in several areas at Rincón de la Vieja a minimum of 4 t/day. Comparatively low flux values and a very local concentration (few m2) of CO2 flux were observed at the active Rincón de la Vieja volcano, compared to the dormant Miravalles volcano, where significant soil flux was found over extended areas, not only around vents. Our assessment of the origin of these differences leads to two possibilities depending on if the surface features on the two volcanoes are fed by a common hydrothermal system or two separate ones. In the former case, the different intensity of diffuse CO2 flux could indicate a different degassing behavior and stronger concentration of gas emissions at the active vent areas at Rincon de la Vieja. In the latter case, where the hydrothermal systems are not linked, the amount of CO2 degassed through the flanks of the volcanoes could indicate that different physical and chemical conditions are governing the degassing of the two systems.
Directory of Open Access Journals (Sweden)
Miguel Ángel Sánchez Celada
2012-02-01
Full Text Available Este artículo determina una tipología de riesgos para el municipio de Centro Habana, ubicado en la parte norte central de la provincia La Habana, la misma puede ser una herramienta para los decisores y planificadores, al permitir identificar zonas prioritarias de intervención. Se definen los peligros que afectan a este territorio, vinculándolos con la vulnerabilidad estructural de su patrimonio construido, estableciendo que los peligros principales son las inundaciones marinas en el litoral norte, las inundaciones pluviales al sur y el peligro de derrumbe de los inmuebles en todo el espacio estudiado.
Digital Documentation and Archiving Low Cost: la Habana Vieja in Cuba
Morganti, C.; Bartolomei, C.
2017-11-01
This article deepens the subject of photo-modelling applied to architecture, on a medium and large scale and it shows all the possibilities to apply the last technologies of augmented reality and virtual reality to the historical and architectural contest of Havana City in Cuba. The context was quite unsuitable to our project because of different and complex reasons. The need to minimize the size of the tools, their weight and cost. Minimize the time of survey and photographic shot on site. To face the difficulties given by the continuing presence of a chaotic influx of people disturbing the work. Not least the difficulty of having a limited number of daily hours available to carry out photographic shots that requires special lighting conditions. This article describes the necessary steps to obtain a 3D dimensional textured model from reality through a photographic set.
Incidencia de tuberculosis en el municipio Marianao: Ciudad de la Habana, Cuba (1990-2000
Directory of Open Access Journals (Sweden)
D'fana Valdés Jorgelina
2003-01-01
Full Text Available Fundamento: Para la eliminación de la tuberculosis es necesario vigilar su incidencia a nivel local, por ser éste el de acceso de los enfermos a los servicios de salud. El objetivo de este trabajo es describir la distribución y la tendencia de las tasas de incidencia, por áreas de salud y por grupos de edades, de la tuberculosis en el municipio Marianao, de Ciudad de la Habana, durante los periodos 1990-1994 y 1995-2000. Métodos: La serie temporal de las tasas de incidencia de 1990-1994 y 1995-2000 se analizó mediante una técnica de alisamiento exponencial con dos parámetros. Se estimó el porcentaje total y promedio anual de variación. Se hizo la estratificación de las áreas de salud. Resultados: En 1990-1994 la tasa aumentó de 11,1 a 25,8 por 105 habitantes, (33% incremento anual, siendo más notable en las áreas de los Policlínicos Finlay y Portuondo (incremento anual promedio de 112,7% y 36,2% respectivamente. Tomando en cuenta que en 1995 se realizó un refuerzo del programa de control, de 1995 al 2000 las tasas descendieron en 47,6% en el municipio; las áreas de Finlay y Portuondo disminuyeron sus tasas en 79,9% y 39,7% respectivamente, mientras que en el área del Policlínico González Coro se incrementó un 58,3% y el 27 de noviembre no mostró variación importante. El grupo de 60 años de edad y más fue en el que predominó el aumento, con un 49,8% del total y sólo hubo un caso en menores de 15 años en el periodo. Durante el mismo, sólo se diagnosticaron seis casos de tuberculosis/ Virus de le inmunodeficiencia humana. El área 27 de noviembre resultó la única ubicada en el nivel insatisfactorio, según la estratificación realizada. Conclusiones: La tendencia de la tuberculosis en el municipio Marianao durante el periodo estudiado fue inicialmente ascendente y luego descendente. La enfermedad predominó en las personas adultas mayores.
Morphometry of Vieja species (Cichlidae) in rivers of Usumacinta's basin, Chiapas, Mexico
Soria-Barreto, Miriam; Rodiles-Hernández, Rocío; González-Díaz, Alfonso A.
2011-01-01
Se evaluaron y compararon diversas características morfológicas de 6 especies de Vieja Fernández-Yépez, 1969 del río Usumacinta. Se emplearon 20 organismos adultos por especie y 33 medidas corporales que fueron estandarizadas y examinadas con un análisis discriminante. Además se comparó la forma del cuerpo entre las especies, mediante el análisis de morfometría geométrica a partir de imágenes digitalizadas. El análisis con la morfometría tradicional y geométrica permitió diferenciar los seis ...
Kempter, K.A.; Rowe, G.L.
2000-01-01
The Active Crater at Rincon de la Vieja volcano, Costa Rica, reaches an elevation of 1750 m and contains a warm, hyper-acidic crater lake that probably formed soon after the eruption of the Rio Blanco tephra deposit approximately 3500 years before present. The Active Crater is buttressed by volcanic ridges and older craters on all sides except the north, which dips steeply toward the Caribbean coastal plains. Acidic, above-ambient-temperature streams are found along the Active Crater's north flank at elevations between 800 and 1000 m. A geochemical survey of thermal and non-thermal waters at Rincon de la Vieja was done in 1989 to determine whether hyper-acidic fluids are leaking from the Active Crater through the north flank, affecting the composition of north-flank streams. Results of the water-chemistry survey reveal that three distinct thermal waters are found on the flanks of Rincon de la Vieja volcano: acid chloride-sulfate (ACS), acid sulfate (AS), and neutral chloride (NC) waters. The most extreme ACS water was collected from the crater lake that fills the Active Crater. Chemical analyses of the lake water reveal a hyper-acidic (pH ~ 0) chloride-sulfate brine with elevated concentrations of calcium, magnesium, aluminum, iron, manganese, copper, zinc, fluorine, and boron. The composition of the brine reflects the combined effects of magmatic degassing from a shallow magma body beneath the Active Crater, dissolution of andesitic volcanic rock, and evaporative concentration of dissolved constituents at above-ambient temperatures. Similar cation and anion enrichments are found in the above-ambient-temperature streams draining the north flank of the Active Crater. The pH of north-flank thermal waters range from 3.6 to 4.1 and chloride:sulfate ratios (1.2-1.4) that are a factor of two greater than that of the lake brine (0.60). The waters have an ACS composition that is quite different from the AS and NC thermal waters that occur along the southern flank of Rincon
INCIDENCIA DE TUBERCULOSIS EN EL MUNICIPIO MARIANAO. CIUDAD DE LA HABANA, CUBA (19902000
Directory of Open Access Journals (Sweden)
Jorgelina D\\u0092fana
2003-01-01
Full Text Available Fundamento: Para la eliminación de la tuberculosis es necesario vigilar su incidencia a nivel local, por ser éste el de acceso de los enfermos a los servicios de salud. El objetivo de este trabajo es describir la distribución y la tendencia de las tasas de incidencia, por áreas de salud y por grupos de edades, de la tuberculosis en el municipio Marianao, de Ciudad de la Habana, durante los periodos 1990-1994 y 1995-2000. Métodos: La serie temporal de las tasas de incidencia de 1990- 1994 y 1995-2000 se analizó mediante una técnica de alisamiento exponencial con dos parámetros. Se estimó el porcentaje total y promedio anual de variación. Se hizo la estratificación de las áreas de salud. Resultados: En 1990-1994 la tasa aumentó de 11,1 a 25,8 por 105 habitantes, (33% incremento anual, siendo más notable en las áreas de los Policlínicos Finlay y Portuondo (incremento anual promedio de 112,7% y 36,2% respectivamente. Tomando en cuenta que en 1995 se realizó un refuerzo del programa de control, de 1995 al 2000 las tasas descendieron en 47,6% en el municipio; las áreas de Finlay y Portuondo disminuyeron sus tasas en 79,9% y 39,7% respectivamente, mientras que en el área del Policlínico González Coro se incrementó un 58,3% y el 27 de noviembre no mostró variación importante. El grupo de 60 años de edad y más fue en el que predominó el aumento, con un 49,8% del total y sólo hubo un caso en menores de 15 años en el periodo. Durante el mismo, sólo se diagnosticaron seis casos de tuberculosis/ Virus de le inmunodeficiencia humana. El área 27 de noviembre resultó la única ubicada en el nivel insatisfactorio, según la estratificación realizada. Conclusiones: La tendencia de la tuberculosis en el municipio Marianao durante el periodo estudiado fue inicialmente ascendente y luego descendente. La enfermedad predominó en las personas adultas mayores.
Ciudad, imagen y memoria. El Río Almendares y la ciudad de La Habana
Directory of Open Access Journals (Sweden)
María Victoria Zardoya Loureda
2008-05-01
El presente trabajo, es resultado de una investigación realizada a partir de un análisis de la significación del río Almendares en la evolución urbana de La Habana con el objetivo de destacar los principales valores de sus zonas patrimoniales colindantes, paso previo indispensable para poder establecer una estrategia con vistas a preservarlos.
Advanced techniques in building pathology diagnosis:: "El Templete" of Old Habana
Chávez Hernández, José Armando; Broche Lorenzo, Jorge Luis; Recarey Morfa, Carlos A; Sánchez García, Fernando; Maestre Mesa, Miguel Angel; Pérez Martínez, Noel
2012-01-01
En el lugar exacto donde se fundó la Villa de San Cristóbal de La Habana, se levanta un monumento que semeja un pequeño templo de la Grecia antigua: El Templete. Esta importante edificación de la ciudad ha estado sufriendo de lesiones estructurales poco comunes para un inmueble de estas características: pequeña, de una estructura robusta, materiales adecuados, buena ejecución, y por tanto de una excelente estabilidad estructural. Varias intervenciones no han podido evitar que vuelvan a aparec...
Savannah River Site 1996 epidemiologic surveillance report
International Nuclear Information System (INIS)
2000-01-01
This report provides a summary of epidemiologic surveillance data collected from Savannah River Site from January 1, 1996 through December 31, 1996. The data were collected by a coordinator at Savannah River Site and submitted to the Epidemiologic Surveillance Data Center located at Oak Ridge Institute for Science and Education, where quality control procedures and preliminary data analyses were carried out. The analyses were interpreted and the final report prepared by the DOE Office of Epidemiologic Studies. The information in this report provides highlights of the data analyses conducted on the 1996 data collected from Savannah River Site. The main sections of the report include: work force characteristics; absences due to injury or illness lasting 5 or more consecutive workdays; workplace illnesses, injuries, and deaths that were reportable to the Occupational Safety and Health Administration (''OSHA-recordable'' events); and disabilities and deaths among current workers. The 1996 report includes a new section on time trends that provides comparative information on the health of the work force from 1994 through 1996
Who is leading the change?. U.S. dietary quality comparison between 1965 and 1996.
Popkin, Barry M; Zizza, Claire; Siega-Riz, Anna Maria
2003-07-01
Many studies have examined rapidly changing trends in U.S. dietary intake, but not as they correspond to other health inequalities among black and white Americans. The purpose of this study was to explore 30-year trends in diet quality and to examine whether income or education is the key socioeconomic factor linked with these shifts. The 1965 Nationwide Food Consumption Survey and the 1994-1996 Continuing Survey of Food Intake by Individuals were used and included, respectively, 6476 and 9241 respondents who were aged > or =18 years. The Revised Diet Quality Index (DQI-R), an instrument that provides a summary assessment of a diet's overall healthfulness, was also used. Between 1965 and 1996, improvements were found in both the overall DQI-R and its components across all education levels, with the exception of calcium intake. Conversely, improvements linked with income effects were inconsistent and less clear. In 1965, the effect of college attendance resulted in a 1.8 point higher DQI-R, higher calcium intake, and increased servings of fruits and vegetables. In 1994-1996, there were consistently improved diets for the overall DQI-R and its components, particularly among college attendees. Diet quality has improved across both race and socioeconomic status groupings between 1965 and 1994-1996; however, education provides a much clearer differentiation. Education efforts must be emphasized to eliminate disadvantages in diet quality.
Report of Activity, 1994 - 1996
International Nuclear Information System (INIS)
Gutbrod, H.H.
1997-10-01
SUBATECH (Laboratory of Subatomic Physics and Associated Technologies) has been created in 1994 by three founding fathers, the Ecole des Mines de Nantes, the University of Nantes and the Institute IN2P3/CNRS. The challenging new idea was to house under one roof groups working in fundamental research as well as those working in applied research. During the first year the experimental activities focused on nuclear collisions at lower energies, e.g. reactions mechanism studies with the detector INDRA at GANIL. The laboratory specialized in the analysis of two particle correlations which allows to study the dynamics and the geometry aspects of the reaction mechanism. In the area of subatomic Physics our teams study the collisions of heavy ions at different energies to investigate the multifragmentation of nuclei or to search for the quark gluon plasma. In the area of associated TECHnologies the accent is on the problems related to nuclear waste, from the 'treatment of nuclear waste with new method (GEDEON)' or its interaction with bacteria to the research of the chemistry of Tc, Ac-225 and Bi-213 and the program of alpha-immunotherapy on micro-tumors. In the field of fundamental science, in parallel to the work on simulations for the new projects, the Subatech scientists could start work on prototypes for the experiments ALICE at the LHC at CERN (scheduled for the year 2005) and STAR at RHIC at Brookhaven (scheduled for 1999). The experimental groups work closely together with the theory groups of Subatech. The author of the VENUS model works in Subatech. This internationally known model is amongst the most important code capable to describe many of the SPS data. Another theory group works on the analysis of multiparticle correlations in the WA98 data with the wavelet theory. Finally, a third group is currently studying the multifragmentation in the final state at GANIL
Directory of Open Access Journals (Sweden)
Tania Mayvel Espinosa Reyes
2012-04-01
Full Text Available Introducción: los costos económicos y psicosociales asociados con los resultados falsos positivos de la pesquisa neonatal de hiperplasia adrenal congénita son altos. Objetivos: identificar los factores perinatales que intervienen en la elevación y en el tiempo de normalización de los valores de 17 hidroxiprogesterona (17OHP, en pacientes no afectados por hiperplasia adrenal congénita. Métodos: se realizó un estudio descriptivo longitudinal retrospectivo en 1 114 pacientes procedentes de Ciudad de La Habana y La Habana, con resultados falsos positivos en la pesquisa, desde enero/2007 hasta junio/2010. Se identificaron las diferencias en la frecuencia de los factores perinatales reconocidos en este grupo con una muestra de población general, y otra integrada por enfermos de hiperplasia adrenal congénita. Resultados: de los pacientes falsos positivos, el 50,7 % pertenecía al sexo masculino y 49,3 % al femenino. El 54,7 % nació por cesárea, y el 82 % no presentó sufrimiento fetal agudo, aquellos con menor edad gestacional y peso al nacer más bajo presentaron niveles medios de 17OHP más elevados. El 68,1 % normalizó la 17OHP al cumplir un mes de vida, independientemente del tipo de parto y de la presencia de sufrimiento fetal agudo; pero la edad gestacional y el peso al nacer tuvieron correlación inversa con la persistencia de su elevación. Predominó el parto eutócico en los neonatos enfermos y normales, y la cesárea en los falsos positivos. La media de la edad gestacional y del peso al nacer fue significativamente menor en los casos en el primer grupo, comparada con la de los grupos restantes. Conclusiones: la prematuridad y el bajo peso al nacer tuvieron una influencia significativa sobre la elevación y la persistencia de los valores de 17OHP, no así el tipo de parto y el sufrimiento fetal agudo.Introduction: the psychosocial and economic costs associated with the false-positive results of the neonatal screening of
Viejas y nuevas formas de hacer política: el Buen gobierno comunitario
Mandujano Estrada, Miguel
2016-01-01
En el marco de las viejas y nuevas formas de acción política, este trabajo presenta el Buen gobierno comunitario, una experiencia de intensificación democrática llevada a cabo por el pueblo indígena de Cherán, en México. En el centro del argumento, la propuesta presenta el caso como una imagen del sufrimiento y crítica a la idea de Estado nación en la que el Buen gobierno se alza como una forma decolonial más allá de la línea abismal moderna
1996 Savannah River Site annual epidemiologic surveillance report
Energy Technology Data Exchange (ETDEWEB)
None
2000-03-01
This report provides a summary of epidemiologic surveillance data collected from Savannah River Site from January 1, 1996 through December 31, 1996. The data were collected by a coordinator at Savannah River Site and submitted to the Epidemiologic Surveillance Data Center located at Oak Ridge Institute for Science and Education, where quality control procedures and preliminary data analyses were carried out. The analyses were interpreted and the final report prepared by the DOE Office of Epidemiologic Studies. The information in this report provides highlights of the data analyses conducted on the 1996 data collected from Savannah River Site. The main sections of the report include: work force characteristics; absences due to injury or illness lasting 5 or more consecutive workdays; workplace illnesses, injuries, and deaths that were reportable to the Occupational Safety and Health Administration (''OSHA-recordable'' events); and disabilities and deaths among current workers. The 1996 report includes a new section on time trends that provides comparative information on the health of the work force from 1994 through 1996.
Directory of Open Access Journals (Sweden)
Manuel Núñez Lafitte
2008-12-01
Full Text Available Sea water intrusion is the process by which the sea water in an aquifer displaces the sweet water as consequence of a sensitive reduction of the hydraulic head, either for natural actions or for anthropic activity Sea water intrusion takes place in the coastal aquifers mainly independently to the predominant lithology. In this work the scenario analysis is approached by studying the effects that sea water intrusion in dry years would produce to the supply of underground water to the City of Havana and Havana Province, when there would be high exploitation of the aquifers without maintenance of recharge works such as in South Dike.There would be a cartography of the scenario in danger to show the presage of the penetration expressed in the longitude of the marine intrusion wedge, taking as contour conditions the variable that may be unfavorable for their temporal variation, such as precipitation and depression. The thickness of the sheet of sweet water is considered constant.La intrusión marina es el proceso por el cual el agua de mar desplaza en un acuífero el agua dulce como consecuencia de una reducción sensible de la carga hidráulica, ya sea por acciones naturales o por actividad antrópica.La intrusión marina tiene lugar principalmente en los acuíferos costeros independientemente a la litología predominante.En este trabajo se aborda el análisis del escenario que en el abasto de agua subterránea a la Ciudad de La Habana y Provincia Habana produciría la intrusión marina durante la ocurrencias de años secos, simultaneados, con altas explotaciones del acuífero y el no mantenimiento de obras de recarga como es el caso del Dique Sur.Se cartografía el escenario de peligro que muestra el pronóstico de la penetración expresada en longitud de la cuña de intrusión marina tomando como condiciones de contorno las variables que pueden ser desfavorables por su variación temporal, tales como la precipitación, explotación y abatimiento
Hess, N.A.; Ribic, C.A.; Vining, I.
1999-01-01
Composition and abundance of benthic marine debris were investigated during three bottom trawl surveys in inlet and offshore locations surrounding Kodiak Island, Alaska, 1994-1996. Debris items were primarily plastic and metal regardless of trawl location. Plastic bait jars, fishing line, and crab pots were the most common fishery-related debris items and were encountered in large amounts in inlets (20-25 items km-2), but were less abundant outside of inlets (4.5-11 items km-2). Overall density of debris was also significantly greater in inlets than outside of inlets. Plastic debris densities in inlets ranged 22-31.5 items km-2, 7.8-18.8 items km-2 outside of inlets. Trawls in inlets contained almost as much metal debris as plastic debris. Density of metal debris ranged from 21.2 to 23.7 items km-2 in inlets, a maximum of 2.7 items km-2 outside of inlets. Inlets around the town of Kodiak had the highest densities of fishery-related and total benthic debris. Differences in benthic debris density between inlets and outside of inlets and differences by area may be due to differences in fishing activity and water circulation patterns. At the current reduced levels of fishing activity, however, yearly monitoring of benthic debris appears unnecessary. Copyright (C) 1999.
National energy balance - 1977-1996 - Chile
International Nuclear Information System (INIS)
1997-01-01
The present document summarizes the historic document related to energy production, transformation and consumption in the country between 1977 and 1996. The manner the figures are presented allows their usage for diverse analyses. Certain modifications have been added to this introduction according to the suggestions received due to the publication of the 1975-1994 statement. This work will be periodically updated, including possible new energy sources as well as new consumption sectors. (author)
National energy balance - 1977-1996 - Chile
International Nuclear Information System (INIS)
1997-01-01
The present document summarizes the historic document related to energy production, transformation and consumption in the country between 1977 and 1996. The manner the figures are presented allows their usage for diverse analyses. Certain modifications have been added to this introduction according to the suggestions received due to the publication of the 1975-1994 statement. This work will be periodically updated, including possible new energy sources as well as new consumption sectors
Occupational radiation doses in Portugal from 1994 to 1998
International Nuclear Information System (INIS)
Alves, J.G.; Martins, M.B.; Amaral, E.M.
2000-01-01
This work reports on the occupational radiation doses for external radiation received in 1994-1998 by the radiation workers monitored by the Radiological Protection and Nuclear Safety Department (DPRSN) in Portugal. Individual monitoring for external radiation is carried out in Portugal by DPRSN since the 60s, and the workers are monitored on a monthly or quarterly bases. In 1995 DPRSN monitored approximately 8000 people and was the only laboratory carrying out this sort of activity in Portugal. In 1998 the number of monitored people increased to nearly 8500 from 860 facilities, which leads us to state that the results shown in this work are well representative of the universe of radiation workers in Portugal. Until 1996, the dose measurement procedure was based only on film dosimetry and the results reported for the 1994-1995 period were obtained with this methodology. Since 1996, thermoluminescent dosimetry (TLD) was gradually introduced and since then an effort has been made to transfer the monitored workers from film to TLD. In 1998, both film and TLD dosimetry systems were running simultaneously, with average numbers of 4500 workers monitored with film dosimetry, while 4000 were monitored with TLD. The data presented from 1996 to 1998 were obtained with both methodologies. This work reports the annual mean effective doses received from external radiation, for the monitored and exposed workers in the different fields of activity, namely, industry, research laboratories, health and mining. The distribution of the annual effective dose by dose intervals is also reported. The collective annual dose by field of activity is estimated and the contribution to the total annual collective dose is determined. The collective dose estimates for the period 1994 to 1998 demonstrated that the health sector is the most representative exposed group in Portugal. (author)
Directory of Open Access Journals (Sweden)
Iliana Valdés-Hernández
2018-04-01
Full Text Available La tuberculosis es uno de los mayores problemas que enfrenta la salud mundial en la actualidad. La única vacuna disponible contra esta enfermedad es la BCG, esta protege solo contra la tuberculosis grave de la infancia, lo cual plantea un reto en la búsqueda de nuevos candidatos vacunales. Teniendo en cuenta el antecedente protector de Mycobacterium ´habana´ contra la tuberculosis experimental, nos propusimos aportar elementos que avalen el empleo de M. ´habana´ TMC 5135 como candidato vacunal contra la tuberculosis, mediante estudios de infección en cultivos celulares de macrófagos murinos. Se caracterizó el proceso de fagocitosis de esta micobacteria por cultivos primarios de macrófagos peritoneales murinos y por la línea celular RAW 264.7, para lo cual se determinó el porcentaje de fagocitosis y el número fagocítico. El presente trabajo demostró que el proceso de fagocitosis de M. ´habana´ TMC 5135 está influenciado por la fuente celular empleada como célula hospedadora, así como por la carga bacteriana infectante y el tiempo de exposición a la misma. La presente investigación contribuye a la caracterización de la infección por esta micobacteria en sus principales células blanco de la inmunidad innata y traza el camino de futuras investigaciones para evaluar la activación de mecanismos efectores de la inmunidad innata frente a este candidato.
El 98 en La Habana: sociedad y vida cotidiana
Directory of Open Access Journals (Sweden)
Barcia Zequeira, María del Carmen
1998-04-01
Full Text Available The author discusses the situation in Havana in the 1890's, specifically the city's everyday life before after the blockade by the U. S. fleet. She emphasizes the living conditions of anonymous men and women, the main actors in that complex time and place divided by class and ethnicity as well as gender.
En este artículo se aborda la situación de La Habana a finales de los años noventa y específicamente la vida cotidiana antes y durante el bloqueo establecido por la flota de los Estados Unidos. Se hace hincapié en la vida de los hombres y mujeres anónimos que fueron los principales actores de aquella compleja etapa y en este contexto se destacan los elementos clasistas, étnicos y de género.
Analysis of the existent proposals for the environmental ordering of the Ciudad de la Habana, Cuba
International Nuclear Information System (INIS)
Santos A, Camilo Ernesto
2005-01-01
Five existing proposals regarding the environmental ordering of the Ciudad de la Habana Cuban province were examined: the framework and the general plan for territorial ordering and urbanism developed by the institute of Physical Planning (IPF, for its Spanish acronym); the project carried out by the united nations; the strategic plan for the city's economic and social development created by the group for the integral development of the city; and the environmental sustainability proposal for Havana city of the CAESAR project (for its Spanish acronym), designed by a grouping of universities from Germany, Cuba, Spain and Mexico. The objective was to analyze, through a comparative methodology, the strategic, relevant and urgent aspects, which are part of the environmental ordering of the Ciudad de La Habana province, thus allowing for determining interactions with regard to the environmental situations that the province is faced with and that curtail the development process of the city. This work intends to establish that there are technical, scientific and academic proposals with regard to the environmental ordering of Havana city that need to be harmonized towards a better planning thereof
Aspectos relevantes del uso de Mycobacterium´habana´ como candidato vacunal contra la tuberculosis
Directory of Open Access Journals (Sweden)
Iliana Valdés
2011-12-01
Full Text Available La eficacia protectora de la actual vacuna (BCG contra la tuberculosis, para contrarrestar las formas pulmonares de esta enfermedad y su reactivación, resulta variable o poco eficiente, lo cual impone la búsqueda urgente de nuevas alternativas profilácticas contra esta enfermedad. Basados en las ventajas inmunogénicas que ofrece el uso de vacunas vivas, se han encaminado diferentes estrategias de este tipo empleando mutantes auxotróficos de Mycobacterium tuberculosis , BCG recombinante o micobacterias no tuberculosas. Existen evidencias experimentales acerca de la protección conferida tras la vacunación con cepas vivas, inactivadas o fracciones proteicas de Mycobacterium'habana' TMC-5135 contra la infección por Mycobacterium tuberculosis. Esta respuesta protectora parece ir aparejada de escasos signos de virulencia en los modelos animales ensayados, lo cual coloca a M.´habana´ dentro de los posibles candidatos vacunales contra la tuberculosis al ajustarse a la condición que impone una vacuna clásica de reproducir la infección y los eventos inmunes que le suceden lo más fielmente posible a como ocurren de manera natural, sin causar extensos daños en el receptor.
International Nuclear Information System (INIS)
Butz, T.R.; Payne, A.G.; Grimes, J.G.; Helgerson, R.N.; Bard, C.S.
1979-01-01
Results of the Sierra Vieja survey area of the detailed geochemical survey for Trans-Pecos, Texas are reported. Field and laboratory data are presented for 29 groundwater and 240 stream sediment samples. Statistical and areal distributions of uranium and possible uranium-related variables are given. A generalized geologic map of the survey area is provided, and pertinent geologic factors which may be of significance in evaluating the potential for uranium mineralization are briefly discussed. Highest concentrations of uranium in groundwater predominantly occur in areas marginal to the Rio Grande. These wells and spring produce from Quaternary alluvium or the Vieja Group. High specific conductance is also associated with most of the wells located marginal to the Rio Grande. The specific conductance of wells in other areas with greater than or equal to 11.5 ppB uranium are notably lower. Higher than background concentrations of molybdenum, arsenic, and vanadium are observed with wells containing greater than or equal to 11.5 ppB uranium. Total alkalinity and pH display a variable distribution throughout the survey area. Stream sediment from several areas contain greater than or equal to 2.57 soluble uranium. In areas where these concentrations account for greater than or equal to 83% of the uranium present in the sediment, above background concentrations of sodium, aluminum, barium, potassium, zirconium, cerium, and strontium are detected. The degree to which these elements are associated with favorably high uranium concentrations is related to the relative amounts of volcaniclastic and calcareous sedimentary material incorporated in the sample
Hoy hace: la erupción del Rincón de la Vieja el 8 de mayo de 1991
Directory of Open Access Journals (Sweden)
Soto Bonilla, Gerardo
2005-08-01
Full Text Available Uno de los eventos volcánicos importantes del siglo XX en Costa Rica fue el ocurrido el 8 de mayo del año 1991 en el Volcán Rincón de la Vieja. A continuación, se muestra la información recopilada en la serie Hoy hace. concerniente a la emergencia suscitada en esa ocasión. Se incluye una relación de las principales observaciones reportadas con respecto al Volcán desde el año 1765 hasta el año 1998. El documento explica el mecanismo de la erupción principal y enlista las actividades posteriores que se dieron One of the important volcanic events of the 20th Century in Costa Rica was the one of May 8, 1991 at the Rincón de la Vieja Volcano. Following, it shows the information collected in the series Today in History (Hoy hace related to the emergency generated at that moment. It includes a relation to the main observations reported in regards to the Volcano from the year 1765 to the year 1998. The document explains the mechanism of the main eruption and lists the posterior activities
Atención temprana comunitaria en niños con retardo en el neurodesarrollo
Directory of Open Access Journals (Sweden)
Roberto Moreno Mora
Full Text Available Objetivo: determinar la evolución de los pacientes con retardo en el neurodesarrollo, atendidos en el Programa Comunitario de Atención Temprana, del municipio Habana Vieja. Métodos: se realizó una investigación prospectiva de evaluación del Programa Comunitario de Atención Temprana en la Habana Vieja entre 1998 y 2008. El universo fue de 170 pacientes con retardo del neurodesarrollo, remitidos por su médico de familia, y evaluados por un equipo interdisciplinario mediante examen clínico y por escalas estandarizadas. Posterior a cada evaluación se aplicó un programa de estimulación individual ejecutada por rehabilitadores y defectólogos de cada policlínico y en el hogar. Se utilizó como estadígrafo el resumen frecuencial, porcentajes y el test de chi cuadrado. Resultados: al inicio los pacientes obtuvieron fundamentalmente evaluación de deficiente, tanto en la área mental (55,29 % como en la área motora (57,64 %. En la evaluación final, se comprobó el ascenso significativo de los porcentajes en la evaluación normal (mental: X²= 58,50; p= 0,00001; motor: X²= 73,06; p= 0,00001. Los pacientes afectados asociados a afecciones perinatales tuvieron una evolución satisfactoria asociados a las categorías superadas (24,75 % y favorables (43,78 %. Resultó significativo (X²= 18,90; p= 0,00001 que los pacientes con antecedente de sepsis neonatal evolucionaron desfavorablemente. La tercera parte de los pacientes con bajo peso al nacer evolucionó de manera estática y agravada (19,23/16,00 %. Conclusiones: los resultados del programa comunitario de atención temprana demuestran que se alcanzó mejoría en el neurodesarrollo en la mayoría de los pacientes.
Intento suicida y funcionamiento familiar
Directory of Open Access Journals (Sweden)
Wilfredo Guibert Reyes
2001-10-01
Full Text Available Se realizó un estudio analítico retrospectivo de corte transversal del tipo caso control con el objetivo de caracterizar el funcionamiento familiar diferencial de los individuos que realizaron intentos suicida en un área de salud de la Habana Vieja, durante los meses de enero a mayo de 2000. La muestra estuvo conformada por 62 individuos y sus respectivas familias, 31 del grupo estudio e igual cantidad de controles. Se les aplicó la entrevista familiar semiestructurada circular, la prueba de funcionamiento familiar FF-SIL y se observaron sus interacciones familiares. Se encontró que el funcionamiento familiar (FF en los individuos que realizaron intento suicida es predominantemente disfuncional, que las características diferenciales del funcionamiento familiar en las suicidas fueron la poca adaptabilidad (67,7 %, la baja cohesión (70,9 %, y la desarmonía (87,1 % y que en las familias de los suicidas predominaron significativamente todos los factores familiares de riesgo esenciales que predisponen al suicidioA case-control crosswise retrospective and analytical study was made from January to May, 2000 to characterize the family performance in individual who attempted to commit suicide in a health area located in Habana Vieja municipality. The sample was composed by 62 subjects and their respective families, 31 of them belonged to the study group and the rest to the control group. The circular semi-structured family interview and the family performance test were applied whereas family interactions were observed. It was found that family performance in individuals with attempted suicides was predominantly dysfunctional; the differential characteristics of family performance in suicidal persons were low adaptability(67.7%, low cohesion (70.9% and lack of harmony (87.1% and that all the essential family risk factors that are conductive to suicide were significantly present in the families of the suicides
Directory of Open Access Journals (Sweden)
Rolando José Garrido García
2003-02-01
Full Text Available Con el propósito de identificar las dificultades gerenciales que presenta el proceso de atención de enfermería (PAE en el procedimiento de Ingreso en el Hogar en el área de salud "Ángel Arturo Aballí", del municipio Habana Vieja, se realizó un estudio en el mes de marzo del año 2001, de tipo descriptivo cualitativo, utilizando como universo el total del personal de enfermería que trabaja en los consultorios del área. Los resultados fundamentales plantean dificultades con recursos, como la escasez de material de cura, la falta de medicamentos e instrumental, así como dificultades con el tiempo disponible para la ejecución del PAE, por la interferencia con otras tareas asignadas de forma urgente y no planificadas. Finalmente se precisó que el personal de enfermería del área conoce los lineamientos que utilizan los médicos para decidir el ingreso domiciliario.With the objective of identifying the general difficulties found in the process of nursing care(PNC provided in the home care service "Angel Arturo Aballí" located in Habana Vieja municipality, a descriptive and qualitative study was conducted on March, 2001 in which the universe of study was the nursing staff working in the various physician´s medical offices in the area. The fundamental results achieved were: shortage of material resources such as cure material, lack of medicines and medical implements, as well as difficulties in devoting time to the performance of PNC since nurses have to carry out other assigned tasks that are often urgent and unplanned. Finally, the paper states that the nursing staff of the area has knowledge about the guidelines followed by physicians to decide upon the home care option.
La glosa de 1541 a los refranes que dizen las viejas tras el fuego
Directory of Open Access Journals (Sweden)
Hugo O. Bizzarri
2001-11-01
Full Text Available The Marqués de Santillana's Refranes que dizen las viejas tras el fuego had a widely Spreads diffusion during the XVIth century. The printing made in 1541 by Francisco Fernández de Córdoba not only points out a particular way of reception -that of the illustrated collection with short moral glosses- but also was one of the fundamental sources to Juan de Mal Lara's Philosophia vulgar (Sevilla, 1568. A transcription of the1541 printing preserved in only one copy which mproves Sbarbi's edition (1874 is presented in this article. This is, thus, an attempt to bring materials to the study of the Hispanic Refranero's early printed stage.
Directory of Open Access Journals (Sweden)
L. Felipe Sexto
2002-09-01
Full Text Available El trabajo aborda los aspectos más significativos que se derivan de las mediciones de ruido efectuadas en áreas de laCentral Termoeléctrica Habana, en enero del 2000, realizando una caracterización del paisaje sonoro inherente a la sala demáquinas dónde se encuentran en explotación tres grupos de turbogeneradores de 100 MW cada uno. También se ofrecenlos resultados en otras zonas importantes de la planta. Se exponen las emisiones características de algunos equipos bajocondiciones de campo directo y reverberante. Además, se valoran algunos riesgos que afectan al personal expuesto y semencionan acciones necesarias para contrarrestar los efectos de la contaminación sonora. Entre los parámetros empleadospara la evaluación del ruido se hallan el nivel sonoro con ponderación AF, el nivel sonoro continuo equivalente, los valoresmáximo y mínimo, el análisis de frecuencias, el tiempo de exposición y el índice NR (noise rating curves. También, setratan criterios y recomendaciones dadas por ISO, EPA y NIOSH.Palabras claves: Ruido, contaminación, salud, turbogenerador, medición de ruido.___________________________________________________________________AbstractThe work approaches the most significant aspects that are derived from the conducted noise measurements in areas of theThermoelectrial Power station Habana, and a characterization of the inherent sonorous landscape in the engine room wherethree groups of turbogenerators of 100 MW each are in operation. Also the results in other important zones of the plant areoffered. The transmissions characteristic of some equipment under conditions of direct and reverberante field are exposed.In addition, some risks that affect the exposed personnel and actions necessary to resist the effects of the sonorouscontamination are mentioned. Between the parameters used for the noise evaluation are the sonorous level withponderación AF, the equivalent continuous sonorous level, the maximum and
Directory of Open Access Journals (Sweden)
Ricardo Fuentealba
2000-02-01
Full Text Available Se describen los principales resultados del Tercer Estudio Nacional de Consumo de Drogas realizado en Chile por el Consejo Nacional para el Control de Estupefacientes (CONACE entre el 1 de septiembre de 1998 y el 15 de enero de 1999, que utilizó el mismo diseño metodológico de los estudios primero y segundo, realizados en 1994 y 1996, y que amplió la muestra a 31 665 individuos que representaban a una población de 6 940 727 personas de 12 a 64 años de edad, de ambos sexos y de cinco niveles socioeconómicos, residentes en zonas urbanas de 62 comunas de las 13 regiones del país. Además, se comparan los resultados proporcionados por los tres estudios. El estudio de 1998 muestra que 17,5% de los chilenos han consumido alguna vez en la vida alguna de las tres drogas ilícitas de mayor uso en el país: marihuana (16,8%, pasta base (2,3% y clorhidrato de cocaína (4,0%. La prevalencia del consumo de cualquiera de las tres drogas durante el último año fue de 5,3% y durante el último mes de 2,2%, predominando una vez más el consumo de marihuana. Con respecto a las drogas lícitas, 28,4% de los chilenos han consumido alguna vez en su vida ansiolíticos, 84,4% alcohol y 71,9% tabaco. La mayor parte de las personas que alguna vez consumieron drogas ilegales dejaron de hacerlo: 71,6, 64,1 y 66,8% en el caso de la marihuana, de la pasta base de cocaína y del clorhidrato de cocaína, respectivamente. Para las drogas legales, estos porcentajes fueron menores: 55,5% para los ansiolíticos, 16,0% para el alcohol y 34,5% para el tabaco. El consumo de drogas lícitas e ilícitas fue varias veces mayor en los hombres que en las mujeres, excepto el de ansiolíticos, que fue tres veces mayor en el sexo femenino que en el masculino. El consumo fue más frecuente entre los 19 y 25 años de edad. El consumo de drogas ilícitas fue más frecuente en los niveles socioeconómicos más altos y el de drogas lícitas en los más bajos. El percentil 50 de la edad
Energy Technology Data Exchange (ETDEWEB)
Hakulin, H. [ed.
1996-12-31
The main objective of SULA 2 programme are (1) reduction of specific energy consumption, (2) reduction of harmful emissions and impact on the environment, (3) promoting technology export. Participants in the programme are the steel and base metal producers; Fundia wire, Imatra Steel Oy Ab, Outokumpu Oy and Rautaruukki Oy, as well as universities with laboratories for research on metal producing processes and their control such as Helsinki University of Technology, University of Oulu, Aabo Akademi and Tampere University of Technology. The programme consists of 32 research projects, of which 14 are applied technology. The total funding for 1995-1996 is 52,5 mill. FIM. Information on the research results is exchanged at the SULA-seminars arranged in 1994, 1996 and at the beginning of 1999. In connection with the seminars a yearbook will be published. The yearbook contains the reports of all the programme projects
Energy Technology Data Exchange (ETDEWEB)
Hakulin, H [ed.
1997-12-31
The main objective of SULA 2 programme are (1) reduction of specific energy consumption, (2) reduction of harmful emissions and impact on the environment, (3) promoting technology export. Participants in the programme are the steel and base metal producers; Fundia wire, Imatra Steel Oy Ab, Outokumpu Oy and Rautaruukki Oy, as well as universities with laboratories for research on metal producing processes and their control such as Helsinki University of Technology, University of Oulu, Aabo Akademi and Tampere University of Technology. The programme consists of 32 research projects, of which 14 are applied technology. The total funding for 1995-1996 is 52,5 mill. FIM. Information on the research results is exchanged at the SULA-seminars arranged in 1994, 1996 and at the beginning of 1999. In connection with the seminars a yearbook will be published. The yearbook contains the reports of all the programme projects
Directory of Open Access Journals (Sweden)
Pilar Marchante Castellanos
2007-12-01
Full Text Available El plan de estudios de 1863 se mantuvo vigente en la Real Universidad de La Habana prácticamente de forma inalterable hasta 1871, año en el que el gobierno colonial español emitió un decreto mediante el cual impuso una serie de cambios, fundamentalmente, como represalia a la creciente tendencia independentista en la isla y al estallido de la primera guerra contra la dominación española en 1868. Se exponen las principales modificaciones al plan de 1863 entre las que se encontraron la supresión de los estudios de Doctorado y la prohibición de conferir ese grado, en las facultades de Derecho, Farmacia y Medicina de la Real Universidad de La Habana. Se describen los aspectos esenciales que caracterizaron los estudios de Farmacia en la Universidad en esa segunda etapa de aplicación del plan de estudios de 1863 y se relacionan las principales disposiciones que fueron emitidas durante esta, con inclusión del decreto mediante el cual se restablecieron a partir del curso académico 1879-1880 los estudios de Doctorado en las facultades en que se había suprimido y la capacidad de conferir los títulos correspondientes a la Universidad. Una nueva reforma de la enseñanza aprobada en 1880 determinó el fin de la vigencia del plan de 1863 en el alto centro docenteThe curriculum of 1863 was maintained practically unalterable in the Real Universidad de La Habana until 1871, when the Spanish colonial government issued a decree by which a series of changes were established, mainly as a reprisal to the increasing independentist trend in the island and the outbreak of the first war against the Spanish domination in 1868. The chief modifications to the plan of 1863, such as the suppression of the Doctorate studies and the prohibition of conferring this degree in the Law, Pharmacy and Medicine faculties of the Real Universidad de La Habana, were exposed. The essential aspects that characterize the Pharmacy studies at the University in this second stage of
International Nuclear Information System (INIS)
Faninger, G.
1997-03-01
The government (state and federal) energy RD and D budget in Austria was 137.6 Mio ATS in 1990, 245.0 Mio ATS in 1991, 210.7 Mio ATS in 1992, 286.9 Mio ATS in 1993, 324.6 Mio ATS in 1994, 332.1 Mio, ATS in 1995 and 334.3 Mio ATS in 1996. The expenditures of the Austrian private industry for energy RD and D are estimated to be about 89 Mio ATS for the year 1990, about 122 Mio ATS for the year 1991, about 98 Mio ATS for the year 1992, about 124 Mio AS for 1993, about 170 Mio ATS for 1994, about 128 Mio ATS for 1995 and about 116 Mio ATS for 1996. The energy RD and D budget of the Austrian Electricity Companies was 133.3 Mio ATS for 1991, 181.1 Mio ATS for 1992, 192.4 Mio, ATS for 1993, 126.6 Mio ATS for 1994, 191.0 Mio ATS for 1995 and 207.3 Mio ATS for 1996. (author)
The New England travel market: generational travel patterns, 1979 to 1996
Rod Warnick
2002-01-01
Generations of travelers who select New England as a primary destination are examined over time from the years of 1979 through 1996 and the analysis serves to update an earlier review of generational travel patterns of the region (Warnick, 1994). Changes in travel patterns are noted by overall adjusted annual change rates by demographic and geographic regions of...
State energy price and expenditure report 1994
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-06-01
The State Energy Price and Expenditure Report (SEPER) presents energy price and expenditure estimates individually for the 50 States and the District of Columbia and in aggregate for the United States. The price and expenditure estimates developed in the State Energy Price and Expenditure Data System (SEPEDS) are provided by energy source and economic sector and are published for the years 1970 through 1994. Consumption estimates used to calculate expenditures and the documentation for those estimates are taken from the State Energy Data Report 1994, Consumption Estimates (SEDR), published in October 1996. Expenditures are calculated by multiplying the price estimates by the consumption estimates, which are adjusted to remove process fuel; intermediate petroleum products; and other consumption that has no direct fuel costs, i.e., hydroelectric, geothermal, wind, solar, and photovoltaic energy sources. Documentation is included describing the development of price estimates, data sources, and calculation methods. 316 tabs.
State energy price and expenditure report 1994
International Nuclear Information System (INIS)
1997-06-01
The State Energy Price and Expenditure Report (SEPER) presents energy price and expenditure estimates individually for the 50 States and the District of Columbia and in aggregate for the United States. The price and expenditure estimates developed in the State Energy Price and Expenditure Data System (SEPEDS) are provided by energy source and economic sector and are published for the years 1970 through 1994. Consumption estimates used to calculate expenditures and the documentation for those estimates are taken from the State Energy Data Report 1994, Consumption Estimates (SEDR), published in October 1996. Expenditures are calculated by multiplying the price estimates by the consumption estimates, which are adjusted to remove process fuel; intermediate petroleum products; and other consumption that has no direct fuel costs, i.e., hydroelectric, geothermal, wind, solar, and photovoltaic energy sources. Documentation is included describing the development of price estimates, data sources, and calculation methods. 316 tabs
Directory of Open Access Journals (Sweden)
Raynier Coro González
2012-09-01
Full Text Available Introducción: la adolescencia constituye una edad de riesgo para la tuberculosis. Objetivo: caracterizar la tuberculosis en adolescentes de entre 15 y 18 años en La Habana, en el período 2001-2010. Métodos: se realizó un estudio observacional, descriptivo y transversal, en el universo de adolescentes de 15 a 18 años afectados de tuberculosis, de la provincia La Habana, desde el 1º de enero de 2001 hasta el 31 de diciembre de 2010. De las encuestas epidemiológicas se revisaron: variables demográficas, categoría epidemiológica, topografía de la lesión, estudios realizados y resultados del tratamiento. Resultados: se reportó una incidencia de 32 casos, con 8 casos en 2001 y 6 en 2010, y tasas de 8,6 y 4,9 × 100 mil habitantes de 15-18 años respectivamente. Predominó el sexo masculino y la edad de 18 años, sin relación con el color de la piel. Los municipios más afectados fueron 10 de Octubre, Habana Vieja y Centro Habana. Predominaron los estudiantes (17-53,1 %, de ellos 5 en escuelas internas; 9 eran desocupados (28,1 %, incluyendo 1 recluso. En la mayoría (20 casos, 62 % no se encontró el contacto infectante. Predominó la forma pulmonar (27-84,4 %, con 44,4 % de baciloscopias positivas. No se reportó coinfección con el virus de la inmunodeficiencia humana. Todos recibieron el tratamiento estrictamente supervisado y curaron, con excepción de un fallecido en la segunda semana de tratamiento. Conclusiones: es necesario profundizar en los factores que inciden en la tuberculosis en este grupo de edad, así como garantizar un mayor aislamiento microbiológico y búsqueda exhaustiva de la fuente de infección.Introduction: adolescence is a risky age for tuberculosis. Objective: to characterize tuberculosis in 15-16 years old adolescents in Havana from 2001-2010. Methods: a cross-sectional, observational and descriptive study was conducted in a universe of 15-18 years-old adolescents with tuberculosis from Havana in the period
Statistical yearbook 1994. Data available as of 31 March 1996. 41 ed.
International Nuclear Information System (INIS)
1996-01-01
This is the forty-first issue of the United Nations Statistical Yearbook, prepared by the Statistics Division, Department for Economic and Social Information and Policy Analysis of the United Nations Secretariat, since 1948. The present issue contains series covering, in general, 1984-1993 or 1985-1994, using statistics available to the Statistics Division up to 31 December 1995. The Yearbook is based on data compiled by the Statistics Division from over 40 different international and national sources
Energy Technology Data Exchange (ETDEWEB)
Vesterlin, V [Metsaetalouden kehittaemiskeskus Tapio, Helsinki (Finland)
1997-12-31
The objective of the project was to reduce the harvesting and procurement costs of energy wood, and clarification of the procurable volumes of energy wood by using the forestry-planning systems for private forests. A model will be developed for planning the energy wood procurement, and the regional energy wood reserves will be investigated for different utilization targets and purposes. The project has started in the beginning of 1993 and it will last to the end of 1996. Basic information needed was collected from the pilot areas in cooperation with the PUUHA project stated in Mikkeli. The targets have been determined from the pilot areas using an position-data program, used as calculation program, in the form of maps and forest stand charts. The numerical road data of the area has been carried over from the database of the National Board of Survey. The volumes of energy wood reserves of the test area have been calculated and composed on different levels of biomass utilization from variable procurement targets by taking the calculatory short-distance transportation and the harvesting costs of the first thinnings in to account and separately from the utilization targets of the felling residues utilization targets. At present cost and stumpage price level only a small proportion of first thinning targets seem to be profitable in utilization of energy wood. Even these targets usually require forest amelioration support
Energy Technology Data Exchange (ETDEWEB)
Vesterlin, V. [Metsaetalouden kehittaemiskeskus Tapio, Helsinki (Finland)
1996-12-31
The objective of the project was to reduce the harvesting and procurement costs of energy wood, and clarification of the procurable volumes of energy wood by using the forestry-planning systems for private forests. A model will be developed for planning the energy wood procurement, and the regional energy wood reserves will be investigated for different utilization targets and purposes. The project has started in the beginning of 1993 and it will last to the end of 1996. Basic information needed was collected from the pilot areas in cooperation with the PUUHA project stated in Mikkeli. The targets have been determined from the pilot areas using an position-data program, used as calculation program, in the form of maps and forest stand charts. The numerical road data of the area has been carried over from the database of the National Board of Survey. The volumes of energy wood reserves of the test area have been calculated and composed on different levels of biomass utilization from variable procurement targets by taking the calculatory short-distance transportation and the harvesting costs of the first thinnings in to account and separately from the utilization targets of the felling residues utilization targets. At present cost and stumpage price level only a small proportion of first thinning targets seem to be profitable in utilization of energy wood. Even these targets usually require forest amelioration support
Dendrobium «Bohemia Habana». Nuevo cultivar de orquídea epifita obtenido en Cuba
Suárez Guerra, Lorenzo
2013-01-01
Los Dendrobium, forman parte del género de las orquídeas más cultivadas de todo el mundo. Se le comercializa como flor de corte, material in vitro y planta de pote o maceta. Varios cultivares de Dendrobium son vendidos de este modo y se ubican en el cuarto lugar en ventas entre los productos de floricultura, después de las Palmáceas, Dracaena y Anthurium de corte. En este trabajo se presentan las principales características de un nuevo cultivar de Dendrobium. «Bohemia Habana», es el resultado...
Lower Grande Ronde smolt trap monitoring. Annual report 1996
International Nuclear Information System (INIS)
Setter, A.; Carmichael, R.W.
1998-01-01
The authors sampled downstream migrating salmonids at Boggan's Oasis in the Grande Ronde River with a screw trap during 1995 and a scoop trap during 1996. Sampling began in March and terminated early in June. Wild spring chinook and wild/hatchery steelhead were collected and marked to assess migration patterns and timing. Fish were marked with tags in order to obtain downstream migration data with minimal fish handling. Observations were recorded when a fish swam through an interrogation monitor at hydroelectric facilities downstream. The second year for monitoring smolts leaving the Grande Ronde River was completed in 1995. The authors continued to pursue moving to a permanent location downstream for 1997 because of the limitations for trapping smolts at Boggan's Oasis. This involved reconnaissance surveys of several potential sites near the mouth of the river from 1994--1996. During February of 1996, a water velocity and bottom topography assessment was completed. Results of the assessment were used for siting the anchoring tower structure upstream approximately 1.2 miles from the mouth of the Grande Ronde River
Ames Laboratory annual site environmental report, calendar year 1996
International Nuclear Information System (INIS)
1998-04-01
This report summarizes the environmental status of Ames Laboratory for calendar year 1996. It includes descriptions of the Laboratory site, its mission, the status of its compliance with applicable environmental regulations, its planning and activities to maintain compliance, and a comprehensive review of its environmental protection, surveillance and monitoring programs. Ames Laboratory is located on the campus of Iowa State University (ISU) and occupies twelve buildings owned by the Department of Energy (DOE). The Laboratory also leases space in ISU owned buildings. Laboratory activities involve less than ten percent of the total chemical use and approximately one percent of the radioisotope use on the ISU campus. In 1996, the Office of Assurance and Assessment merged with the Environment, Safety and Health Group forming the Environment, Safety, Health and Assurance (ESH and A) office. In 1996, the Laboratory accumulated and disposed of wastes under US Environmental Protection Agency (EPA) issued generator numbers. Ames Laboratory submitted a Proposed Site Treatment Plan to EPA in December 1995. This plan complied with the Federal Facilities Compliance Act (FFCA). It was approved by EPA in January 1996. The consent agreement/consent order was issued in February 1996. Pollution awareness, waste minimization and recycling programs, implemented in 1990 and updated in 1994, continued through 1996. Included in these efforts were a waste white paper and green computer paper recycling program. Ames Laboratory also continued to recycle salvageable metal and used oil, and it recovered freon for recycling. All of the chemical and nearly all of the radiological legacy wastes were properly disposed by the end of 1996. Additional radiological legacy waste will be properly disposed during 1997
Kendall, Rose (Compiler); Wolfe, Kathy (Compiler)
1997-01-01
Under the mandate contained in the FY 1976 NASA Authorization Act, the National Aeronautics and Space Administration (NASA) has developed and is implementing a comprehensive program of research, technology, and monitoring of the Earth's upper atmosphere, with emphasis on the stratosphere. This program aims at expanding our understanding to permit both the quantitative analysis of current perturbations as well as the assessment of possible future changes in this important region of our environment. It is carried out jointly by the Upper Atmosphere Research Program (UARP) and the Atmospheric Chemistry Modeling and Analysis Program (ACMAP), both managed within the Science Division in the Office of Mission to Planet Earth at NASA. Significant contributions to this effort are also provided by the Atmospheric Effects of Aviation Project (AEAP) of NASA's Office of Aeronautics. The long-term objectives of the present program are to perform research to: understand the physics, chemistry, and transport processes of the upper atmosphere and their effect on the distribution of chemical species in the stratosphere, such as ozone; understand the relationship of the trace constituent composition of the lower stratosphere and the lower troposphere to the radiative balance and temperature distribution of the Earth's atmosphere; and accurately assess possible perturbations of the upper atmosphere caused by human activities as well as by natural phenomena. In compliance with the Clean Air Act Amendments of 1990, Public Law 101-549, NASA has prepared a report on the state of our knowledge of the Earth's upper atmosphere, particularly the stratosphere, and on the progress of UARP and ACMAP. The report for the year 1996 is composed of two parts. Part 1 summarizes the objectives, status, and accomplishments of the research tasks supported under NASA UARP and ACMAP in a document entitled, Research Summary 1994-1996. Part 2 is entitled Present State of Knowledge of the Upper Atmosphere
The 1996 European Directive and radiation protection at CERN, or why 15 plus 4 is unequal to 19
International Nuclear Information System (INIS)
Hoefert, M.
1997-04-01
The recommendations of the 1996 EU Directive on radiation protection are compared with the practice at CERN as laid down in the 1996 Radiation Safety Manual which is largely based on the Swiss Radiation Protection Ordinance of 1994. The three topics discussed are individual dosimetry for persons exposed in the exercise of their profession, exemption values and clearance levels for radioactivity and committed effective dose coefficients, and reference levels for members of the public. (author)
Radiocesium in reindeer the slaughter-season 1996/97
International Nuclear Information System (INIS)
Aahman, B.
1997-10-01
During the slaughter season 1996/1997 (1 July 1996 to 30 June 1997), 731 reindeer in Sweden (1.2% of the total number of slaughtered reindeer) were condemned because of too high levels of radiocaesium (over 1 500 Bq 137 Cs per kg fresh meat). This was less than during the previous year, 1995/1996 (when 2% were condemned) and a large improvement compared to earlier years (before 1994). The main reason was that a large part of the slaughtered animals had been slaughtered early in the autumn - when radiocaesium levels are lower than in winter- (8952 reindeer) or that they had been fed uncontaminated feed during some period before slaughter (about 9 900 reindeer). The decreasing number of condemned reindeer is also an effect of generally declining radiocaesium levels in reindeer. The average decline in freely grazing reindeer corresponds to an effective ecological half-life at 3.4 years for the period 1986/87 to 1991/92 and a corresponding half-life 5.6 years for the following 5 years (until 1996/97). The predictions for 1996/97 and the official regulations for control of radiocaesium in reindeer meat were well in accordance with the measured levels of radiocaesium in the slaughtered reindeer. Totally about 22 000 reindeer carcasses were monitored for 137 Cs. The main part of the meat control was made by direct monitoring of gamma radiation from reindeer carcasses at the slaughter house. In this way, the number of muscle samples that were monitored for radiocaesium was kept at a low level (4 198 samples)
Viejas, nuevas y novísimas guerras: la conflictividad desafía la modernidad
Directory of Open Access Journals (Sweden)
José Manuel Pureza
2012-02-01
Full Text Available La comparación entre los sistemas políticos, objetivos de guerra, tipo de ejército, técnica militar y economía de guerra de las llamadas viejas guerras y de las nuevas guerras nos revela un continuum y una articulación de las causas de la violencia y de las guerras, que, a su vez, tienen manifestaciones cada vez más locales (a pesar de sus impactos globales. Y subraya también la necesidad de repensar categorías y adaptar conceptos. De hecho, los contextos de paz formal (y violenta en que emergían las viejas guerras interestatales se transformaron, después del final de la Guerra Fría, en escenarios de un nuevo tipo de conflictividad violenta, a los que se ha llamado «nuevas guerras». Sin embargo, los abordajes tradicionales sobre esas «viejas guerras» invisibilizaron las señales de emergencia de los nuevos tipos de conflictividad, ya que éstos no correspondían a ninguna definición tradicional de guerra. Las características de estas (nuevas manifestaciones de la violencia han ido desafiando las fronteras entre lo que se define como guerra y lo que se define como paz. Sin embargo, los conceptos o definiciones de conflicto y de guerra no son inmutables y estáticos, son conceptos dinámicos y deben tener capacidad de adaptación a las nuevas realidades. Nuestra propuesta es precisamente que hoy día, hay espacios de indefinición o «sin nombre», normalmente entendidos como contextos de paz formal, pero que pueden contener indicios del surgimiento de nuevísimos tipos de conflictividad, cuestionando y poniendo en duda las distinciones estanques y herméticas entre escenarios de paz formal, guerra y posguerra. Comparing the political systems, war objectives, type of army, military technique and war economics of the so-called new wars reveals a continuum and a connection of the causes for violence and wars which, in turn, present increasingly local signs (in spite of their global impact. It also stresses the need
Funciones agua rendimiento para 14 cultivos agrícolas en condiciones del sur de La Habana
González Robaina, Felicita; Herrera Puebla, Julián; López Seijas, Teresa; Cid Lazo, Greco
2013-01-01
El estudio de las funciones agua rendimiento y su uso dentro de la planificación del uso del agua es una vía importante para trazar estrategias de manejo que contribuyan al incremento en la producción agrícola. Utilizando los datos de consumo de agua, agua aplicada por riego, precipitaciones y los rendimientos obtenidos en más de 100 experimentos de campo realizados fundamentalmente en suelo Ferralítico Rojo de la zona sur de La Habana y con ayuda de herramientas de análisis de regresión en e...
State of Maine residential heating oil survey: 1995--1996 season summary
International Nuclear Information System (INIS)
Elder, B.
1996-05-01
In Maine the cash price is surveyed, as opposed to lthe retail or charge price, as it has been identified as the price most often paid by Maine consumers. As one can see from the chart in this report, the 1995-1996 cash prices for No. 2 heating oil can be characterized as having an upward trend and much more fluctuation than last years' relatively flat line. The 1995-96 heating season started at the closing price of the previous season and for the first few weeks prices were lower than most of the 1994-95 trendline. When the weather became cooler, however, prices were on a steady incline until well into the winter. Prices leveled off for most of the rest of the season with a dramatic surge on the last week of the survey. The average statewide cash price for No. 2 heating oil this year was .861 1 cents, approximately ten cents higher than the average for 1994-1995 which was .7661 cents per gallon. It has been the observation of the SPO that during most of the 1995-1996 season, Maine's prices showed a direct correspondence with New England rack or wholesale prices. It appeared that they never fluctuated more than 3-4 cents from each other
Task 11: Technology development integration. Semi-annual report, April 1, 1996--September 30, 1996
Energy Technology Data Exchange (ETDEWEB)
Musich, M.A.
1997-05-01
A review was conducted of three systems analysis (SA) studies performed by Lockheed Idaho Technologies Company (LITCO) on integrated thermal treatment systems (ITTSs) and integrated nonthermal treatment systems (INTSs) for the remediation of mixed low-level waste (MLLW) stored throughout the U.S. Department of Energy (DOE) weapons complex. The review was performed by an independent team led by the Energy & Environmental Research Center (EERC), including Science Applications International Corporation, the Waste Policy Institute (WPI), and Virginia Tech. The three studies reviewed were as follows: (1) Integrated Thermal Treatment System Study, Phase 1 - issued July 1994, (2) Integrated Thermal Treatment System Study, Phase 2 - issued February 1996, and (3) Integrated Nonthermal Treatment System Study - drafted March 1996. The three studies were commissioned by DOE to be SA studies of environmental management (EM) systems. The purpose of LITCO`s engineering evaluation of the MLLW treatment system alternatives was to help DOE in the prioritization of research, development, and demonstration activities for remediation technologies. The review of these three studies was structured to further aid DOE in its current and future decision-making processes. The methodology in the studies was compared to a sound systems engineering (SE) approach to help DOE determine which tasks still need to be accomplished to complete a thorough design/review.
Task 11: Technology development integration. Semi-annual report, April 1, 1996--September 30, 1996
International Nuclear Information System (INIS)
Musich, M.A.
1997-01-01
A review was conducted of three systems analysis (SA) studies performed by Lockheed Idaho Technologies Company (LITCO) on integrated thermal treatment systems (ITTSs) and integrated nonthermal treatment systems (INTSs) for the remediation of mixed low-level waste (MLLW) stored throughout the U.S. Department of Energy (DOE) weapons complex. The review was performed by an independent team led by the Energy ampersand Environmental Research Center (EERC), including Science Applications International Corporation, the Waste Policy Institute (WPI), and Virginia Tech. The three studies reviewed were as follows: (1) Integrated Thermal Treatment System Study, Phase 1 - issued July 1994, (2) Integrated Thermal Treatment System Study, Phase 2 - issued February 1996, and (3) Integrated Nonthermal Treatment System Study - drafted March 1996. The three studies were commissioned by DOE to be SA studies of environmental management (EM) systems. The purpose of LITCO's engineering evaluation of the MLLW treatment system alternatives was to help DOE in the prioritization of research, development, and demonstration activities for remediation technologies. The review of these three studies was structured to further aid DOE in its current and future decision-making processes. The methodology in the studies was compared to a sound systems engineering (SE) approach to help DOE determine which tasks still need to be accomplished to complete a thorough design/review
National Research Council Canada - National Science Library
1997-01-01
.... We also assessed internal controls and compliance with laws and regulations. As part of that objective, we evaluated how the Defense agencies presented the accrued leave account on the FYs 1994,1995, and 1996 Statements of Financial Position...
Directory of Open Access Journals (Sweden)
Manuel Romero-Placeres
2004-06-01
Full Text Available OBJETIVO: Identificar la relación que guardan las consultas de urgencias por enfermedades respiratorias agudas, crisis agudas de asma bronquial e infecciones respiratorias agudas, con los cambios diarios en los niveles de contaminación atmosférica, en menores de 14 años de edad que fueron atendidos en dos centros hospitalarios de la ciudad de La Habana. MATERIAL Y MÉTODOS: Se realizó un estudio ecológico de series de tiempo durante el periodo comprendido entre el 1 de octubre de 1996 y el 11 marzo de 1998. Se estudió la asociación entre la presencia de crisis agudas de asma bronquial, infecciones respiratorias agudas y enfermedades respiratorias agudas por un lado, y la exposición a niveles de partículas menores de 10 µg/m³ (PM10, humo y dióxido de azufre (SO2, por otro; asimismo, se construyeron modelos con la técnica de regresión binomial negativa, para estudiar periodos de latencia de 1 a 5 días y el efecto acumulado de siete días, previos a las consultas de urgencia. RESULTADOS: Los niveles de contaminación atmosférica, por lo general, resultaron bajos, ya que el promedio de 24 horas para PM10, humo y SO2 fue de 59.2 µg/m³ (DE=29.2, 27.7 µg/m³ (DE=21.2 y 21.1 µg/m³ (DE=20.1, respectivamente. Un incremento de 20 µg/m³ en el promedio diario de humo se relacionó con un incremento de 2.2% (IC 95% 0.9-3.6 en el número de consultas de urgencias por crisis agudas de asma bronquial. Un incremento de 20 µg/m³ en el promedio diario de humo y de SO2 se relacionó con un incremento en las infecciones respiratorias agudas de 2.4% (95% CI 1.2-3.6 y 5% (95% CI 1.3-5.3, respectivamente, con un retraso de cinco días. Además, se presentó un efecto acumulado en todos los contaminantes estudiados. CONCLUSIONES: Los resultados sugieren que los niveles de contaminantes atmosféricos en la ciudad de La Habana afectan la salud respiratoria de los niños, por lo que se requiere de la aplicación de medidas de control, en particular
Lam, K S; Wang, T J; Wang, T; Tang, J; Kajii, Y; Liu, C M; Shim, S G
2004-01-01
Surface ozone (O3) was measured at Oki Island (Japan), Cheju Island (South Korea), Lanyu Island (Taiwan Province, China), Cape D'Aguilar (Hong Kong SAR) and Lin'an, Longfenshan, Waliguan (China mainland) during January 1994--December 1996 as a component of IGAC/APARE (International Global Atmospheric Chemistry/East Asia-North Pacific Regional Experiment). This paper gave a joint discussion on the observational results at these stations over the study region. Investigations showed that the average of surface O3 mixing ratios at the seven sites are 47.9+/-15.8, 48.1+/-17.9, 30.2+/-16.4, 31.6+/-17.5, 36.3+/-17.5, 34.8+/-11.5 and 48.2+/-9.5 ppbv, respectively. Significant diurnal variations of surface O3 have been observed at Oki, Cheju, D'Aguilar, Lin'an and Longfenshan. Their annual averaged diurnal differences range from 8 to 23 ppbv and differ in each season. Surface O3 at Lanyu and Waliguan do not show strong diurnal variability. Seasonal cycles of surface O3 showed difference at the temperate and the subtropical remote sites. Oki has a summer minimum-spring maximum, while Lanyu has a summer minimum-autumn maximum. The suburban sites at D'Aguilar and Lin'an report high-level O3 in autumn and low level O3 in summer. Surface O3 remains-high in autumn and low in winter at the rural site Longfenshan. For the global background station Waliguan, surface O3 exhibits a broad spring-summer maximum and autumn-winter minimum. The backward air trajectories to these sites have shown different pathways of long-range transport of air pollution from East Asia Continent to North Pacific Ocean. Surface O3 was found to be strongly and positively correlated with CO at Oki and Lanyu, especially in spring and autumn, reflecting the substantial photochemical buildup of O3 on a regional scale. It is believed that the regional sources of pollution in East Asia have enhanced the average surface O3 concentrations in the background atmosphere of North Pacific.
The 1996 High Schools That Work Assessment: Good News, Bad News and Hope. Research Brief.
Bottoms, Gene
Implementation of the High Schools That Work (HSTW) key practices improved achievement for career-bound students in these four ways: (1) HSTW sites showed significant improvement in average reading and math scores; (2) the percentage of career- bound students meeting HSTW performance goals in 1994 and 1996 increased from 33% to 43% in reading and…
Yanine Suárez, Habib Fernando
2010-01-01
Se evaluó el efecto del uso del suelo, sobre la densidad y diversidad de bacterias degradadoras de hidrocarburos (HC). Se seleccionaron los usos: bosque, pastizal y cafetal en la cuenca del río La Vieja (Valle del Cauca y Quindío), y bosque, cebollar y plantación forestal en la cuenca del río Otún (Risaralda) y se realizaron dos eventos de muestreo. La densidad se evaluó mediante la técnica de NMP en medio Bushnell-Hass, suplementado con diesel y usando XTT como indicador de actividad. Las ba...
El bastón de la vieja. "La niña de las rastas, el niño de las crestas"
Peris Girona, Juan Luis
2014-01-01
Treball Final de Grau en Comunicació Audiovisual. Codi:CA0932. Curs acadèmic 2013-2014 The main objective in the realization of this video has been the learning process. This means having gained the training and knowledge of the know EL BASTÓN DE LA VIEJA. “La niña de las rastas, el niño de la cresta”. Armando Gallego Martínez Juan Luis Peris Girona how in a more professional way, improving in this process our production skills, conducting and organizing a team, and our p...
Idaho Habitat/Natural Production Monitoring Part I, 1994 Annual Report.
Energy Technology Data Exchange (ETDEWEB)
Hall-Griswold, Judy A.; Leitzinger, Eric J.; Petrosky, C.E. (Idaho Department of Fish and Game, Boise, ID
1995-11-01
A total of 333 stream sections were sampled in 1994 to monitor in chinook salmon and steelhead trout parr populations in Idaho. Percent carry capacity and density estimates were summarized by different classes of fish: wild A-run steelhead trout, wild B-run steelhead trout, natural A-run steelhead trout, natural B-run steelhead trout, wild spring and summer chinook salmon. These data were also summarized by cells and subbasins as defined in Idaho Department of Fish and Game`s 1992-1996 Anadromous Fish Management Plan.
Comportamiento de la tuberculosis en adolescentes de 15 a 18 años
Directory of Open Access Journals (Sweden)
Raynier Coro González
2012-09-01
Full Text Available Introducción: la adolescencia constituye una edad de riesgo para la tuberculosis. Objetivo: caracterizar la tuberculosis en adolescentes de entre 15 y 18 años en La Habana, en el período 2001-2010. Métodos: se realizó un estudio observacional, descriptivo y transversal, en el universo de adolescentes de 15 a 18 años afectados de tuberculosis, de la provincia La Habana, desde el 1º de enero de 2001 hasta el 31 de diciembre de 2010. De las encuestas epidemiológicas se revisaron: variables demográficas, categoría epidemiológica, topografía de la lesión, estudios realizados y resultados del tratamiento. Resultados: se reportó una incidencia de 32 casos, con 8 casos en 2001 y 6 en 2010, y tasas de 8,6 y 4,9 × 100 mil habitantes de 15-18 años respectivamente. Predominó el sexo masculino y la edad de 18 años, sin relación con el color de la piel. Los municipios más afectados fueron 10 de Octubre, Habana Vieja y Centro Habana. Predominaron los estudiantes (17-53,1 %, de ellos 5 en escuelas internas; 9 eran desocupados (28,1 %, incluyendo 1 recluso. En la mayoría (20 casos, 62 % no se encontró el contacto infectante. Predominó la forma pulmonar (27-84,4 %, con 44,4 % de baciloscopias positivas. No se reportó coinfección con el virus de la inmunodeficiencia humana. Todos recibieron el tratamiento estrictamente supervisado y curaron, con excepción de un fallecido en la segunda semana de tratamiento. Conclusiones: es necesario profundizar en los factores que inciden en la tuberculosis en este grupo de edad, así como garantizar un mayor aislamiento microbiológico y búsqueda exhaustiva de la fuente de infección.
Directory of Open Access Journals (Sweden)
Jorge Enrique Elías Caro
2009-01-01
Full Text Available En este trabajo se hará un análisis de las relaciones político-militares que se suscitaron durante el proceso independentista entre Santa Marta en el Caribe Neogranadino y la Habana en Cuba. Así mismo, se explicarán ciertas particularidades de las guerras navales, fluviales y terrestres que sostuvieron estas ciudades realistas con otras que defendían la causa emancipadora, durante el periodo comprendido entre 1810-1815.
Institutt for Energiteknikk - Annual Report 1994
International Nuclear Information System (INIS)
1995-01-01
Work at Institutt for energiteknikk (IFE) comprises both nuclear and non-nuclear activities. The main nuclear program is centered on the Halden Reactor Project. In 1958, the first Halden Reactor Project Agreement was signed by organisations representing 12 European countries. During 1994 France became a full member and associate membership was established with Russia. Accordingly, 16 countries were participating in the Project by the end of the year. The objectives have evolved from being simply a demonstration of the operation of a boiling heavy-water reactor to becoming a substantial research and development programme covering the domains of human-machine interaction, fuel behaviour, materials testing, water chemistry, and instrumentation. In 1994, significant progress was achieved in all of the areas addressed by the project, including the re-instrumentation of irradiated fuel rods, fission gas release, irradiation-assisted stress corrosion cracking, a conceptual design of advanced cockpit-type control rooms, analysis of human behaviour, and information processing and presentation. More than 35 years after its reactor's first critically, the Halden Project continues to provide the scientific community with a wealth of information for the safe and efficient production of nuclear power. The current Project Agreement covers the period from 1993 to 1996
Institutt for Energiteknikk - Annual Report 1994
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-12-01
Work at Institutt for energiteknikk (IFE) comprises both nuclear and non-nuclear activities. The main nuclear program is centered on the Halden Reactor Project. In 1958, the first Halden Reactor Project Agreement was signed by organisations representing 12 European countries. During 1994 France became a full member and associate membership was established with Russia. Accordingly, 16 countries were participating in the Project by the end of the year. The objectives have evolved from being simply a demonstration of the operation of a boiling heavy-water reactor to becoming a substantial research and development programme covering the domains of human-machine interaction, fuel behaviour, materials testing, water chemistry, and instrumentation. In 1994, significant progress was achieved in all of the areas addressed by the project, including the re-instrumentation of irradiated fuel rods, fission gas release, irradiation-assisted stress corrosion cracking, a conceptual design of advanced cockpit-type control rooms, analysis of human behaviour, and information processing and presentation. More than 35 years after its reactor`s first critically, the Halden Project continues to provide the scientific community with a wealth of information for the safe and efficient production of nuclear power. The current Project Agreement covers the period from 1993 to 1996.
Directory of Open Access Journals (Sweden)
Carlos Santiago Martín Fernández
2011-01-01
Full Text Available El presente artículo describe los nexos o relaciones existentes entre tres aspectos de gran actualidad: el desarrollo inmobiliario-turístico, la ordenación del territorio y las estrategias políticas. Para ello, estudiamos un caso emblemático en Canarias: el proceso de construcción del Resort Cerca Vieja en Fuencaliente, isla de La Palma.
Modelo hidrogeofísico de la cuenca sur de La Habana
Directory of Open Access Journals (Sweden)
González Espinosa Jacqueline
2000-08-01
Full Text Available A hidrogeophysical model of the South Basin of La Habana is presented as the result of multivaried statistical processing applied to well logging and transmisivity data from pumping test Through combining Euclidian Group Analysis, correlation analysis and Uvarov relationships it was possible to separate the structured components of the different variables and: to define the correlation between the geophysical parameters of the well and the filtration velocity of the groundwater, these coefficients are above 0.8; to establish the relation between Dar-Zarrouk parameters (from electrical well logging and transmisivity (from pumping tests. The former one was estimated from longitudinal conductance. Within less than 15% of error. It is shown that the applied processing is suscefult even in the study of karstic aquifers. Where heterogeneity and anisotropy are characteristics. Como resultado del procesamiento estadístico multivariado aplicado a los registros geofísicos de pozo y a los datos de transmisividad obtenidos de pruebas de bombeo, se presenta un modelo hidrogeofísico de la Cuenca Sur de La Habana que permite sintetizar la información hidrodinámica y geofísica existente. La aplicación combinada del análisis euclidiano de agrupación, del análisis de correlación y de las relaciones de Uvarov, permitió separar la componente estructurada de las variables estudiadas y definir la correlación entre parámetros geofísicos de pozo y la velocidad de filtración de las aguas subterr
Social attitudes towards atomic energy in Poland in the period of 1989-1996
International Nuclear Information System (INIS)
Latek, S.
1996-01-01
The public opinion on the atomic energy and its future development in Poland have been discussed on the base of four inquiring actions results carried out in Poland in 1989, 1991, 1994 and 1996. The general conclusion was that public acceptance for nuclear power generation in Poland was rather low however the attitudes towards the subject differed very much between groups of people with selected features being investigated e.g. age, sex, education. 4 figs, 2 tabs
María de Lourdes Marrero; María de los Angeles Aguilera; María Guadalupe Aldrete
2008-01-01
Objetivos. Evaluar el nivel el nivel de estrés psicosocial laboral según los modelos demanda-control de la tensión laboral y desbalance esfuerzo-recompensa; y determinar asociaciones entre el estrés psicosocial laboral y trastornos del embarazo. Materiales y métodos. Estudio de cohorte prospectivo con 78 trabajadoras embarazadas del sector de la salud, en un municipio de la ciudad de La Habana, Cuba, en el periodo 2005-2006. Las encuestadas respondieron una versión al español del Job Content ...
Perigo sísmico, exposição e vulnerabilidade das villas vieja e nueva de trancas, tucumán, argentina
García, Alicia Irene
2010-01-01
As Villas Vieja e Nueva de Trancas, situadas na bacia tectônica de Tapia-Trancas, estão localizadas sobre a zona epicentral do terremoto que destruiu a antiga vila em 1826. O objetivo é estudar o risco sísmico que apresentam as cidades como a soma do perigo sísmico natural e a vulnerabilidade da população frente à ocorrência potencial de outro sismo destrutivo. Recorreu-se à análise bibliográfico-documental de estadísticas demográfico-econômicas, às técnicas de relevamento geográfico e anális...
Laureates of the Palladin Prize of the National Academy of Sciences of Ukraine (1995-1996
Directory of Open Access Journals (Sweden)
R. P. Vynogradova
2014-04-01
Full Text Available A. I. Bykoriz (born in 1934, O.O. Filchenkov (born in 1960 were awarded the O. V. Palladin prize for the monograph “Transforming growth factors” (K. Naukova Dumka, 1994 in 1995. A. I. Dvoretskyi (born in 1937, Ie. Iu. Chebotarev were awarded in 1996 for the series of works “The study of mechanisms of ionizing radiation affecting ion homeostasis in cells of animal organisms”.
Reinders, M.F.; Geertzen, J.H.B.; Dijkstra, P.U.
2002-01-01
Objectives: The objective was to assess the reported use in recent publications of the diagnostic criteria for complex regional pain syndrome type I (CRPS 1) proposed by the International Association for the Study of Pain (IASP) in 1994. Methods: A literature search of MEDLINE (January 1996 to July
Directory of Open Access Journals (Sweden)
Miriam Soria-Barreto
2011-06-01
Full Text Available Se evaluaron y compararon diversas características morfológicas de 6 especies de Vieja Fernández-Yépez, 1969 del río Usumacinta. Se emplearon 20 organismos adultos por especie y 33 medidas corporales que fueron estandarizadas y examinadas con un análisis discriminante. Además se comparó la forma del cuerpo entre las especies, mediante el análisis de morfometría geométrica a partir de imágenes digitalizadas. El análisis con la morfometría tradicional y geométrica permitió diferenciar los seis taxones. Se encontraron 10 medidas discriminantes, que expresan diferencias significativas en la longitud de las aletas y la región cefálica, de las cuales la posición de la boca diferenció estadísticamente más taxones. Las relaciones de similitud con ambos análisis mostraron 2 grupos, siendo V. bifasciata (Steindachner, 1864 y V. synspila (Hubbs, 1935 las especies más parecidas. Las gradillas de deformación mostraron que la mayor variación está en la región cefálica, específicamente en la posición de la boca y los ojos. Las diferencias morfométricas encontradas pueden servir para la determinación taxonómica en trabajos futuros. La variación encontrada en la morfología cefálica y trófica puede ser un mecanismo que favorece la coexistencia de las especies y la diversidad del grupo en la región.We evaluated and compared morphological characteristics among the 6 species of Vieja Fernández-Yépez, 1969 from Usumacinta River. We analyzed 20 adults by specie, obtaining 33 measurements, which were standardized and analyzed with a discriminant analysis. We also performed a comparison of body shape among species, using the geometric morphometric analysis from digitalized images. Traditional and geometric morphometrics allowed distinguishing each taxa. We found 10 discriminants measures, related with the head region and length of fins, only mouth position was different among more taxa. In both analyses, similarity relationships
Directory of Open Access Journals (Sweden)
Raydel Martinez Sanchez
1994-10-01
Full Text Available Se realizó un estudio seroepidemiológico de Toxoplasma gondii en cuatro Municípios de la Provincia La Habana en el periodo comprendido entre el mes de Octubre de 1990 y Abril de 1991, utilizando una técnica de ultramicro ELISA de 10 µL. Se examinaron un total de 362 muestras de mujeres embarazadas y se obtuvo una prevalencia de infección de 71,0%. La infección toxoplásmica fue más frecuente en las embarazadas que residían en zona rural y convivian con gatos. Se estudió la relación entre la infección toxoplásmica y el antecedente de abortos espontáneos sin encontrar diferencias estadísticamente significativas.A seroepidemiological study of Toxoplasma gondii was carried out in four municipalities of Havana Province from October 1990 to April 1991 using a 10µL ultra micro-ELISA. We tested 362 serum samples, from pregnant women, and 71% of toxoplasmic infection was found. Toxoplasmic infection was more frequent in women living in rural zones having domestics contacts with cats. The relationship of toxoplasmic infection and spontaneous abortion antecedent in this group was analyzed but no statistically significant differences were found.
Amphibians and reptiles of C. E. Miller Ranch and the Sierra Vieja, Chihuahuan Desert, Texas, USA
Directory of Open Access Journals (Sweden)
Drew R. Davis
2018-02-01
Full Text Available We report the occurrence of 50 species of amphibians and reptiles recently collected on C. E. Miller Ranch and the Sierra Vieja in the Chihuahuan Desert of Texas, USA and describe their perceived distribution and abundance across various habitat associations of the region. Our recent surveys follow intense, historic sampling of amphibians and reptiles from this region in 1948. Of the 50 species detected in recent surveys, six were not collected in 1948 and an additional three species documented in 1948 have yet to be detected in a 14-year period of recent surveys. Combining data from both historic and recent surveys, a total of 53 species of amphibians and reptiles are known from the ranch (11 amphibians, 42 reptiles. Land stewardship and conservation practices have likely contributed to the persistence of the majority of these species through time. Additionally, we discuss the status of amphibians and reptiles not collected during recent surveys and comment on potential species that have not yet been detected.
Amphibians and reptiles of C. E. Miller Ranch and the Sierra Vieja, Chihuahuan Desert, Texas, USA.
Davis, Drew R; LaDuc, Travis J
2018-01-01
We report the occurrence of 50 species of amphibians and reptiles recently collected on C. E. Miller Ranch and the Sierra Vieja in the Chihuahuan Desert of Texas, USA and describe their perceived distribution and abundance across various habitat associations of the region. Our recent surveys follow intense, historic sampling of amphibians and reptiles from this region in 1948. Of the 50 species detected in recent surveys, six were not collected in 1948 and an additional three species documented in 1948 have yet to be detected in a 14-year period of recent surveys. Combining data from both historic and recent surveys, a total of 53 species of amphibians and reptiles are known from the ranch (11 amphibians, 42 reptiles). Land stewardship and conservation practices have likely contributed to the persistence of the majority of these species through time. Additionally, we discuss the status of amphibians and reptiles not collected during recent surveys and comment on potential species that have not yet been detected.
Directory of Open Access Journals (Sweden)
Angel Núñez Fidel
1997-01-01
Full Text Available Se realizó un estudio sobre la calidad del diagnóstico coproparasitológico en 77 laboratorios de la red de salud pública de la provincia Ciudad de La Habana, Cuba. El procedimiento se basó en la entrega a cada jefe de laboratorio de un modelo de encuesta, y una bolsa de nylon conteniendo 10 viales plásticos con distintos especímenes parasitarios, preservados en formaldehído al 7%. Recogidos los resultados en las primeras 72 horas después de su entrega, se realizó la evaluación mediante una escala de puntuación establecida. La mayoría de los laboratorios aprobaron (70%; sin embargo aún existen centros, sobre todo policlínicas, con calificaciones deficientes. Los municipios con resultados más desfavorables fueron, Lisa, Marianao y Habana del Este, alcanzándose mejores resultados en los hospitales que en las policlínicas. En el análisis de Protozooarios, el mejor diagnosticado fué Giardia lamblia, con solo un centro que erró al identificarlo. Las mayores dificultades se presentaron en Blastocystis hominis con 61% de fallas, Endolimax nana, con 24,6%, y Entamoeba histolytica, con 22%. Entre los helmintos, la mayor aprobación fué en Trichuris trichiura y los errores diagnósticos predominaron con Fasciola hepatica y Taenia sp., ambos con 66,2% de fallas. Dados los resultados obtenidos, hemos organizado una intervención educativa en la red de laboratorios de la provincia.
Contaminación atmosférica por partículas y salud en Valencia, 1994-1996
Directory of Open Access Journals (Sweden)
Ballester F.
2002-01-01
Full Text Available Objetivo: Estimar la asociación a corto plazo entre los valores de contaminación atmosférica por partículas en suspensión y diferentes indicadores de morbilidad y mortalidad en la ciudad de Valencia. Métodos: Estudio ecológico de series temporales en el que se relacionan las variaciones diarias en los valores de contaminación atmosférica por humos negros e indicadores de mortalidad, ingresos hospitalarios y visitas a urgencias en la ciudad de Valencia, durante el período 1994-1996. La magnitud de la asociación se estimó mediante regresión autorregresiva de Poisson utilizando modelos aditivos generalizados. Se examinó la forma de la relación, el efecto retardado de la contaminación y la posible modificación de efecto por otros contaminantes o períodos del año. Resultados: Existe una asociación significativa entre los valores de partículas en suspensión y varios indicadores analizados en Valencia. La forma de dicha relación es lineal. Un incremento de 10 μg/m³ en los valores diarios de humos negros se asoció con un incremento del 1,8% (intervalo de confianza [IC] del 95%, 0,9-2,7% en el número de defunciones del día siguiente. El mismo incremento en la contaminación se asoció con un aumento del 1,5% (0,1-2,8% en las defunciones por causa circulatoria, en un 1,3% (0,0-2,6% en los ingresos por causas circulatorias y en un 5,4 (0,6-10,4% en el número de visitas a urgencias por asma. Esta asociación no está confundida por los valores de otros contaminantes. No se encontró asociación de los humos negros con la mortalidad por enfermedades respiratorias, los ingresos hospitalarios por enfermedades cerebrovasculares ni las visitas a urgencias por enfermedad pulmonar obstructiva crónica (EPOC. Conclusiones: Este estudio proporciona evidencia de que los valores de partículas en suspensión en Valencia se asocian con las urgencias por asma, los ingresos por enfermedades circulatorias y las defunciones diarias. La asociaci
Clinical and imaging characteristics of the vascular dementia. Preliminary studies
International Nuclear Information System (INIS)
Gomez Viera, Nelson; Rivero Arias, Edmundo; Perez Nellar, Jesus; Begueria Santos, Ramon; Arias Sifontes, William; Raiteris Flores, Juan
1997-01-01
A descriptive prospective study was carried out in 41 patients presenting with vascular dementia from Habana Vieja municipality, Havana City, in order to know some of the clinical and imaging characteristics of this disease. The main risk factors observed were the history of cerebrovascular disease and arterial hypertension. Depression, sleeping disorders and focal and pseudo bulbar neurologic signs were the most frequent clinical findings. Folstein neuropsychological test evidenced an important disorder of attention, calculation, the evocation memory and orientation. According to this test, 29 % of the patients had a severe dementia and nearly 50 % showed a severe handicap. The most frequent imaging findings observed in the computerized axial tomography of the cranium were cerebral atrophy, and single or multiple infarctions. Multiple cerebral infarctions, the lacunar status, subcortical encephalopathy of Binswanger, and single infarction located in cerebral areas related to cognition were considered as possible psychopathological mechanisms associated with the disease
Directory of Open Access Journals (Sweden)
Pilar Marchante Castellanos
2009-04-01
Full Text Available Aunque el plan de estudios de 1880, último que aplicó la Corona española en Cuba, representó un notable progreso para la organización de la enseñanza en la Universidad de La Habana, no introdujo de inicio cambios en la formación del profesional farmacéutico. La verdadera transformación se produjo al aplicarse la reforma de 1887, la cual tuvo como principal objetivo rediseñar las carreras de Farmacia y Medicina en la Real Universidad de La Habana. En este trabajo se presenta el plan de estudios de 1880 y el que se aprobó como resultado de la reforma de 1887 para la Facultad de Farmacia. Se hace además referencia a los profesores que ocuparon las diferentes cátedras y a los auxiliares que debieron asumir las vacantes en cada curso. Todos los catedráticos resultaron afectados de una u otra forma por las sucesivas medidas administrativas adoptadas en la Universidad, en virtud de la crítica situación política que afectó a la isla durante la vigencia del plan de 1880, agudizada al extremo después del estallido, en 1895, de la última guerra librada contra España por la independencia de Cuba.
Radioactive waste discharges from UKAEA establishments during 1996 and associated monitoring results
International Nuclear Information System (INIS)
Morton, A.K.M.; Forbes, S.A.; Hughes, B.; Richardson, E.
1997-08-01
This annual report is published by the Safety Directorate of the United Kingdom Atomic Energy Authority (UKAEA) and provides information on radioactive discharges from its sites. The Culcheth site was closed and then redeveloped during the end of 1993 and the Springfields site became part of BNFL in October 1994. No operations involving the need to discharge radioactivity are undertaken at the Risley site. After discussions with the Authorising Departments at that time, the discharge authorisations were revoked on 1 July 1994. These sites are therefore no longer included in this report. UKAEA has published annual radioactive waste discharges and associated monitoring results since 1963. This report is intended to give a relatively short factual overview of UKAEA waste discharge and disposal, and its impact on the environment. Additional information may be found in annual discharge reports published by the individual UKAEA establishments and the UKAEA Report on Safety and the Environment 1996-97 due to be issued at the end of September 1997. (UK)
Quarterly coal report, April 1996--June 1996
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-11-01
This report provides information about U.S. coal production, distribution; exports, imports, prices, consumption, and stocks. Data on coke production is also provided. This report presents data for April 1996 thru June 1996.
Directory of Open Access Journals (Sweden)
Elena HERNÁNDEZ SANDOICA
2011-07-01
Full Text Available RESUMEN: La Universidad de La Habana fue creada en 1728 (la autorización de Inocencio XIII, obtenida en 1721, tardó dos años en llegar a La Habana, y luego todavía surgirían obstáculos. Nació bajo el patrocinio del convento de Santo Domingo (también conocido como «San Juan de Letrán». Hasta entonces, una fuerte pugna por hacerse con el privilegio de concesión de los grados académicos había enfrentado a dominicos y jesuítas, los cuales contaban con el apoyo del obispo Valdés. Este, disgustado, no acudió a la ceremonia fundacional, el día 5 de enero de 1728. Es una historia un tanto familiar —incluso para la, ya tardía, fecha de la implantación de la Universidad en Cuba—, que nos habla del forcejeo entre órdenes por conseguir el preceptivo breve papal. Una historia que se repite con frecuencia, de manera mecánica y casi siempre alborotada, en los procesos de traslación cultural que, de la mano de la Iglesia y la monarquía católicas, caracterizaron la fundación de las universidades en la América hispana, ya desde el siglo XVI
Directory of Open Access Journals (Sweden)
Elena HERNÁNDEZ SANDOICA
2010-04-01
Full Text Available RESUMEN: La Universidad de La Habana fue creada en 1728 (la autorización de Inocencio XIII, obtenida en 1721, tardó dos años en llegar a La Habana, y luego todavía surgirían obstáculos. Nació bajo el patrocinio del convento de Santo Domingo (también conocido como «San Juan de Letrán». Hasta entonces, una fuerte pugna por hacerse con el privilegio de concesión de los grados académicos había enfrentado a dominicos y jesuítas, los cuales contaban con el apoyo del obispo Valdés. Este, disgustado, no acudió a la ceremonia fundacional, el día 5 de enero de 1728. Es una historia un tanto familiar —incluso para la, ya tardía, fecha de la implantación de la Universidad en Cuba—, que nos habla del forcejeo entre órdenes por conseguir el preceptivo breve papal. Una historia que se repite con frecuencia, de manera mecánica y casi siempre alborotada, en los procesos de traslación cultural que, de la mano de la Iglesia y la monarquía católicas, caracterizaron la fundación de las universidades en la América hispana, ya desde el siglo XVI
Vega Jiménez, Junior
2015-01-01
Los orígenes de la medicina tradicional china en Cuba datan de la época colonial, cuyas técnicasfueronintroducidas a través de los inmigrantes chinos. Es muy frecuentelautilización, tanto en el argot popular como médico,delrefrán: "A ese no lo cura ni el médico chino".El origen de esta frase es real, y proviene del poco conocido JuanCham-Bom-Bian. La mayor parte de su estancia en Cuba ocurrió entre la sciudades de La Habana y Cárdenas; enesta última ocurrió su misteriosa muerte. El objetivo d...
EPA released the final report, Analysis of Fat Intake Based on USDA’s 1994-1996, 1998 Continuing Survey of Food Intakes by Individuals (CSFII, Final Report). For this report, the EPA conducted an analysis of fat consumption across the U.S. population based on data derived...
Steam generator cleaning campaigns at Bruce A: 1993-1996
International Nuclear Information System (INIS)
Puzzuoli, F.V.; Leinonen, P.J.; Lowe, G.A.
1997-01-01
Boiler chemical cleaning (BOCC) and high-pressure water lancing operations were performed during the Bruce A 1993 Unit 3, 1994 Unit 3, 1995 Unit 1 and 1996 Unit 3 outages to remove secondary side deposits. High-pressure water lancing focused on three boiler areas: tube support plates, to remove broached hole deposits, hot leg U-bend supports to dislodge deposits contributing to boiler tube stress corrosion cracking and tube sheets with the aim of removing accumulated sludge piles and post BOCC insoluble residues. The chemical cleaning processes applied were modified versions of the one developed by the Electric Power Research Institute/Steam Generator Owners Group. During these BOCC operations, corrosion for several key boiler materials was monitored and was well below the specified allowances
Radioactivity monitoring of the Irish marine environment 1996 and 1997
International Nuclear Information System (INIS)
Long, S.; Pollard, D.; Hayden, E.; Smith, V.; Fegan, M.; Ryan, T.P.; Dowdall, A.; Cunningham, J.D.
1998-07-01
This report presents the results of the marine radioactivity monitoring programme carried out be the Radiological Protection Institute of Ireland (RPII) during 1996 and 1997. The primary objective of the programme is to assess the exposure to the Irish population resulting from radioactive contamination of the Irish marine environment and to estimate the risks to health from this exposure. Discharges from the British Nuclear Fuels (BNFL) reprocessing plant at Sellafield continue to be the principal source of this contamination. Approximately 300 samples of fish, shellfish, seaweed, seawater and sediment were collected each year. The samples were analysed for a range of contaminating radionuclides at the Institute's radioanalytical laboratory. The results show that the radionuclide of greatest dosimetric significance continues to be caesium-137. Since 1994 the commissioning and operation of new facilities at Sellafield have resulted in an increase in the discharges of technetium-99 to the Irish Sea. This has been reflected in an increase in the activity concentration of this radionuclide at all east coast sampling sites during the reporting period. The main pathway contributing to the exposure of the Irish public is the consumption of seafood. The committed effective dose to heavy consumers of seafood due to artificial radionuclides in 1996 was 1.6 μSv and in 1997 was 1.4 μSv. in 1996 was 1.6 μSv and in 1997 was 1.4 μSv
200-ZP-1 phase 2 interim remedial measure quarterly report, August--October 1996
International Nuclear Information System (INIS)
Freeman-Pollard, J.R.; Jacques, I.D.; McMahon, W.J.; Singleton, K.M.; Strope, S.A.; Swanson, L.C.; Windmueller, C.R.
1996-11-01
A groundwater pump-and-treat system is being operated in the 200-ZP-1 Operable Unit under authority of the Hanford Federal Facility Agreement and Consent Order . The purpose of the pump-and-treat system is to accomplish the following: Minimize further migration of the high-concentration portion of the carbon tetrachloride plume and co-contaminants chloroform and trichlorethylene in the 200-ZP-1 Operable Unit Provide data for evaluation of final remedy selection. The 200-ZP-1 pump-and-treat operations were conducted as a pilot-scale treatability test and interim remedial measure treatment system between August 1994 and July 1996 to assess the effectiveness of liquid-phase granular activated carbon carbon tetrachloride removal. The pilot-scale treatability test's removal efficiently was determined to be 99.96% for carbon tetrachloride, chloroform, and trichloroethylene. This report summarizes and evaluates treatment, hydraulic, and hydrochemistry data collected for the 200-ZP-1 interim remedial measure from August through September 1996
Indicaciones del meprobamato en personas de 60 años de edad y más en Ciudad de La Habana, 2000-2001
Directory of Open Access Journals (Sweden)
Ana Julia García Milian
2003-12-01
Full Text Available Teniendo en cuenta las evidencias de un consumo elevado del meprobamato (10,4 % de los pacientes de la tercera edad lo consumen y es el 4,2 % del total de los medicamentos consumidos por ellos, además de un aumento en el consumo nacional del medicamento expresado en DDD (1996-3,4 a 1999-4,2/1 000 habitantes. Se decidió realizar un estudio de utilización de medicamentos indicación-prescripción que permitiera identificar los diagnósticos más frecuentes que motivaron la prescripción del medicamento y las especialidades que lo prescriben en Ciudad de La Habana en el período de septiembre de 2000 a enero de 2001. Se encuestó el 86,6 % de la muestra y se identificó la indicación del meprobamato en 11 afecciones; la hipertensión arterial constituyó la más frecuente y la Medicina General Integral la especialidad que más lo prescribe. Se recomienda la realización de una intervención sobre hipertensión arterial en Atención Primaria de Salud y educar a la población en el tratamiento de dicha enfermedad, así como los usos y riesgos del meprobamato.Taking into account the evidences of an elevated consumption of meprobamate (10.4 % of the patients at the third age take it, and it accounts for 4.2 % of the total of drugs consumed by them, and an increase in the national consumption of the drug expressed in DDD (from 1996-3.4 to 1999-4.2/1 000 inhabitants, it was decided to carry out a study on the use of indication-prescription drugs that allowed to identify the most frequent diagnoses leading to the prescription of drugs and the specialties of the physicians prescribing it in Havana City, from September, 2000, to January, 2001. 86.6 % of the sample were surveyed and the indication of meprobamate was found in 11 affections. Arterial hypertension was the most common affection and General Comprehensive Medicine was the specialty prescribing it the most. It was recommended to make an intervention on arterial hypertension in Primary Health
Directory of Open Access Journals (Sweden)
Beatriz Gutiérrez
2005-12-01
Full Text Available Existe una gran falta de información acerca de la infección por Helicobacter pylori en los países de la región del Caribe. Nuestros objetivos en este estudio fueron determinar la prevalencia, la resistencia a los antibióticos y los factores de virulencia de la bacteria. La medida de la prevalencia de la infección por H. pylori se determinó en un grupo de pacientes a los que se les practicó una endoscopia en tres centros hospitalarios de La Ciudad de La Habana, lo que nos permitió evaluar la resistencia a la claritromicina y la presencia de cagA + en las cepas obtenidas. De las endoscopias realizadas se obtuvieron 117 biopsias gástricas, procedentes de tres centros hospitalarios de La Ciudad de La Habana, Cuba: Instituto de Oncología, Instituto de Gastroenterología y el Hospital Calixto García. Las biopsias fueron mantenidas a –70 ºC para posterior cultivo en tres medios diferentes (dos selectivos y uno no selectivo y su posterior incubación por 7 días a 37 ºC en una atmósfera de microaerofilia. La presencia de H. pylori fue identificada por la presencia de diferentes enzimas (oxidasa, catalasa, ureasa. Se realizó la extracción del DNA y la PCR, donde se utilizó el primer H2761676 y se amplificó con 397 fragmentos del gen cagA. La susceptibilidad a la claritromicina fue medida por el método de difusión en gel. Diagnóstico endoscópico: (1 cáncer gástrico; (19 úlcera duodenal; (8 úlcera gástrica; (89 dispepsias no ulcerosas, incluyendo (62 gastritis; (9 hernia hiatal; (2 reflujo biliar; (1 pólipo gástrico; (15 panendoscopias normales. Del total de 117 biopsias realizadas, 83 fueron positivas a la infección por H.pylori (70,9% . De las 35 cepas a las que se les realizó presencia de cagA+ resultaron positivas 31 (88,5%. Solo el 3% de las cepas fueron resistentes a la claritromicina. La prevalencia de la infección por H. pylori en la población sintomática de La Ciudad de La Habana es la misma que la reportada en
1996: BMBF expenditures for energy resrearch. Draft of the departmental federal budget 30
International Nuclear Information System (INIS)
Anon.
1995-01-01
Departmental budget 30 of the 1996 draft federal budget covers the activities of the German Federal Ministry for Education, Science, Research, and Technology (BMBF). The Ministry is the result of an amalgamation, in 1994, of the former Ministry for Education and Science (BMBW) and the former Ministry for Research and Technology (BMFT). For this reason, the total budget as indicated in the figures for 1995 and 1996 cannot be compared directly. The 1996 departmental budget No. 30 comprises a total of DM 15.62 (1995: 15.53) billion. Nuclear technology and nuclear research have desappeared almost completely as budgetary items and can be found only under the headings of Safety Research (DM 81/78 million) and Decommissioning (DM 259/232 million). A similar development was observed in recent years also with the change in names of German national research centers. However, this does not mean that the BMBF has completely withdrawn from nuclear research. These activities are now covered under more general items, such as 'Renewable Energies, Economical Use of Energy, Conversion and Combustion Technologies', for which expenditures of DM 290 (285) million have been earmarked in 1996. The BMBF makes available approx. DM 303 (290) million for investments into research centers, and approx. DM 1.32 (1.31) billion DM to cover their operating costs. The nuclear research share in these funds decreases steadily. DM 467 (472) million have been earmarked for basic research. (orig.) [de
Environmental impact evaluation: law no. 16.466 of 1994 01 14 and regulations
International Nuclear Information System (INIS)
2007-01-01
No.16.466 law of January 9, 1994, known as the Law on Prevention and Environmental Impact Assessment EIA or just law is probably the law marked the beginning of a new generation of environmental standards in Uruguay, together with other like Hazardous Waste Act (Act 17 220 1999), the law of Natural Protected Areas System (Law 17 234 2000) and especially the General Law Protection Environment (Law no. 17 283 of November 28, 2000), but which also reaches to the Constitution of the Republic, with the inclusion of environment in the new wording of Article 47 of the 1996 reform.
Directory of Open Access Journals (Sweden)
Francisco Rodríguez Barrientos
2007-05-01
Full Text Available A partir del ámbito territorial de las cuencas hidrográficas y de las divisiones políticoadministrativas, es posible determinar microrregiones con homogeneidad física,histórica, económica, social y cultural, en las cuales se puedan diseñar y ejecutar planes de manejo consensuados y participativos, algo indispensable para una política sostenible. En el trabajo se presentan elementos teóricos que ayudan a delimitar, precisar y operacionalizar elconcepto de microrregión, y se ofrecen las razones por las que se considera que las microcuencas de los ríos Platanar, Peje y La Vieja dentro de la cuenca del río San Carlos constituyen una microrregión. También se hace una caracterización de la microrregión Platanar-La Vieja, así como una descripción y análisis de los principales problemas que en ella afrontan los recursos suelo, forestal e hídrico.
Age at Immigration and the Incomes of Older Immigrants, 1994–2010
Tienda, Marta
2015-01-01
Objectives. Seniors comprise a growing proportion of new U.S. immigrants. We investigate whether late-age immigrants are disadvantaged in older age relative to those arriving earlier in life, based on income, reliance on public benefits, and access to public medical insurance. We test whether the 1996 welfare reform law altered the relationships between age at immigration and these outcomes. Method. Immigrants aged 65 and older in the 1994–2010 Current Population Surveys were classified by age at immigration. Median and logistic regressions are used to estimate the association between age at immigration and several outcomes and to test whether these associations differ for arrivals before and after welfare reform. Results. Late-age immigration is strongly associated with lower personal income, lower rates of Medicare and Social Security receipt, and higher participation in Supplemental Security Income (SSI) and Medicaid. Arrival after 1996 is associated with lower rates of SSI, Medicaid, and Medicare receipt. The association between late-age immigration and income is stronger for post-1996 arrivals relative to earlier arrivals, whereas that between late-age immigration and Medicaid is weaker, suggesting that the penalty conferred by late-age immigration grew after reform. Discussion. Late-age immigrants face formidable economic disadvantages exacerbated by exclusion from public benefits, with implications for immigration, health care, and welfare policy. PMID:24942972
La Habana escultórica: de La Giraldilla a Lennon
Directory of Open Access Journals (Sweden)
Pereira, María de los Ángeles
2009-12-01
Full Text Available Public sculpture accompanied Havana’s architectural and urban development from its origin through its consolidation as a modern city towards the late 19th and first decades of the 20th Centuries. This substantially contributed to form the city’s profiles and to grant Havana those massive dimensions that characterize it as the Cuban capital. The development of commemorative monuments reflects both the repertoire of icons of the Cuban nation throughout its historical process, and the evolution of the aesthetic course towards a ormal and conceptual renewal that eventually granted this artistic expression a leading role within the Cuban culture.La escultura pública acompañó al desarrollo arquitectónico y urbanístico de La Habana desde su surgimiento hasta su cabal consolidación como ciudad moderna hacia finales del siglo XIX y primeras décadas del XX, contribuyendo de modo sustancial a la configuración de sus perfiles y a la monumentalidad que la caracteriza como capital de Cuba. El desarrollo del arte monumentario conmemorativo, además de reflejar el repertorio icónico de la nación cubana a lo largo de su proceso histórico, constituye un reflejo de la evolución de los derroteros estéticos en el tránsito hacia una renovación formal y conceptual que, finalmente, coloca a esta manifestación en un lugar protagonista entre de las diferentes expresiones de su cultura artística cubana.
Directory of Open Access Journals (Sweden)
Jenny Carolina Ramírez-Leal
2014-01-01
Full Text Available Este trabajo presenta el desarrollo de una herramienta Web georreferenciada a través de la API de Google Maps, para administrar los recursos hídricos superficiales de la cuenca del río La Vieja en Colombia. Esto con el fin de crear un sistema de integración de información de fácil acceso, que ofrezca a las personas datos reales y actuales acerca del estado de los recursos hídricos en la cuenca del río La Vieja, para futuras consultas e investigaciones. Esta aplicación Web se llevó a cabo a través de la metodología ágil SCRUM y la metodología Mpiua, que integradas permitieron un desarrollo evolutivo e incremental, donde se involucró al usuario activamente al momento de incorporar aspectos de usabilidad y accesibilidad. Así mismo, se hizo uso de la arquitectura MVC para obtener un producto más escalable con abstracción de datos, código entendible, intercomunicación entre componentes y control de los recursos del servidor. Finalmente, se obtuvo la implementación de la herramienta Web HidroQuindío, que permite administrar la información de las estaciones de monitoreo, fuentes hídricas, entes territoriales, fuentes de captación y estructuras de conducción de apoyo a la toma de decisiones alrededor de la cuenca.
International Nuclear Information System (INIS)
1997-04-01
NKS (Nordic Nuclear Safety Research) is a cooperative body in nuclear safety, radiation protection and emergency preparedness. Its purpose is to carry out cost-effective Nordic projects, thus producing research results, exercises, information, recommendations, manuals etc., to be used by decision makers and other concerned staff members at authorities and within the nuclear industry. This is the annual report for 1996, the third year of the fifth four-year NKS program (1994-1997). The report also contains plans for the rest of the program period, including budget proposals. The following major fields of research have been identified: reactor safety; radioactive waste; radioecology; emergency preparedness; and information issues. A total of nine projects are now under way within that framework. One project (RAK-1) is dedicated to reactor safety strategies: how to avoid serious accidents. A parallel project (RAK-2) deals with minimizing releases in case of an accident. When can an overheated reactor core still be water-cooled? What might be the consequences of the cooling? All Nordic countries have long-lived low and medium level radioactive waste that requires final disposal. One project (AFA-1) addresses that issue. Environmental impact of radioactive releases is studied in two radioecology projects. The project on marine radioecology, including sediment research (EKO-1), encompasses sampling, analysis and modeling. These are also key issues in the project on long ecological half-lives in semi-natural systems (EKO-2). The transfer of radioactive cesium and strontium in the chains soil - vegetation - sheep and mushroom - roe deer is studied, along with freshwater systems. Long-term doses to main is the ultimate output from the obtained models. Another aspect of environmental impact is emergency preparedness. A recently started project, EKO-5, addresses the issue of early planning for cleanup operations following a fallout. 'Early' in this context means within the
Mesa solución política al conflicto armado Oslo y la Habana 2: la imaginación pacificadora
Directory of Open Access Journals (Sweden)
Humberto Vélez R
2012-01-01
Full Text Available El presente texto realizado en razón del I Congreso regional de paz – Antioquia, se realiza una recopilación investigativa respecto de los temas tocados en la agenda de paz entre el gobierno y la guerrilla y sus posibles consecuencias, para ello se toman las diferentes publicaciones realizadas en el blog Atisbos, desarrollado por el autor y tomando como referencia el número 158, y la expectativa generada por los resultados del proceso Santos-Guerrillas, con el fin de darle un marco conceptual analítico adecuado al proceso de Oslo y de la Habana 2, y para lo cual se realiza en lenguaje crítico-político.
Age at immigration and the incomes of older immigrants, 1994-2010.
O'Neil, Kevin; Tienda, Marta
2015-03-01
Seniors comprise a growing proportion of new U.S. immigrants. We investigate whether late-age immigrants are disadvantaged in older age relative to those arriving earlier in life, based on income, reliance on public benefits, and access to public medical insurance. We test whether the 1996 welfare reform law altered the relationships between age at immigration and these outcomes. Immigrants aged 65 and older in the 1994-2010 Current Population Surveys were classified by age at immigration. Median and logistic regressions are used to estimate the association between age at immigration and several outcomes and to test whether these associations differ for arrivals before and after welfare reform. Late-age immigration is strongly associated with lower personal income, lower rates of Medicare and Social Security receipt, and higher participation in Supplemental Security Income (SSI) and Medicaid. Arrival after 1996 is associated with lower rates of SSI, Medicaid, and Medicare receipt. The association between late-age immigration and income is stronger for post-1996 arrivals relative to earlier arrivals, whereas that between late-age immigration and Medicaid is weaker, suggesting that the penalty conferred by late-age immigration grew after reform. Late-age immigrants face formidable economic disadvantages exacerbated by exclusion from public benefits, with implications for immigration, health care, and welfare policy. © The Author 2014. Published by Oxford University Press on behalf of The Gerontological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Physics division. Progress report for period ending September 30, 1996
Energy Technology Data Exchange (ETDEWEB)
Ball, S.J. [ed.
1997-04-01
This report covers the research and development activities of the Physics Division for the 1995 and 1996 fiscal years, beginning October 1, 1994, and ending September 30, 1996. The activities of the Division continue to be concentrated in the areas of experimental nuclear physics, experimental atomic physics, and theoretical nuclear and atomic physics. In addition, there are smaller programs in plasma diagnostics and data compilation and evaluation. During the period of this report, there has been considerable success in bringing the Holifield Radioactive Ion Beam Facility (HRIBF) into routine operation. The budgets of the nuclear physics portion of the Division have increased each year in nearly all areas, and several new members have been added to the Division research and development staff. On August 30, 1996, the HRIBF successfully accelerated its first radioactive ion beams, {sup 69}As and {sup 70}As. Prior to this, the heart of the facility, the RIB injector system, was completed, including installation of a remote handling system for the target/ion source assembly. Target and ion source development is likely to be the technical key to success of the HRIBF. We have expanded our efforts in those development areas. Of special note is the development of highly permeable composite targets which have now been shown to allow release of difficult-to-produce radioactive ions such as {sup 17,18}F. A summary of the HRIBF work is provided in Chapter 1, along with supporting activities of the Joint Institute for Heavy Ion Research.
Nuclear Science Division 1994 annual report
International Nuclear Information System (INIS)
Myers, W.D.
1995-06-01
This report describes the activities of the Nuclear Science Division for the period of January 1, 1994, to December 31, 1994. This was a time of significant accomplishment for all of the programs in the Division. Assembly of the solar neutrino detector at the Sudbury Neutrino Observatory is well under way. All of the components fabricated by LBL were shipped to Sudbury early in the year and our efforts are now divided between assisting the assembly of the detector and preparing software for data analysis once the detector is operational in 1996. Much of the activity at the 88-Inch Cyclotron centered on Gammasphere. The open-quotes early implementationclose quotes phase of the detector ended in September. This phase was extremely successful, involving over 60 experiments with nearly 200 users from 37 institutions worldwide. The mechanical structure was installed and the final electronic system is expected to operate in March 1995. The Division concurrently hosted a conference on physics for large γ-ray detector arrays at the Clark Kerr Campus at UC Berkeley in August. This was a very successful meeting, reflecting the enthusiasm for this field worldwide. Also at the Cyclotron, the progress toward weak interaction experiments using ultra-thin sources passed a major milestone with the trapping of radioactive 21 Na atoms. We are now engaged in a major upgrade of the experimental area and the outlook is very promising for these novel experiments. Another highlight of research at the Cyclotron was the confirmation of element 106. This development allowed the original LLNL/LBL discovery team to move forward with their proposal to name this element seaborgium
Nuclear Science Division 1994 annual report
Energy Technology Data Exchange (ETDEWEB)
Myers, W.D. [ed.
1995-06-01
This report describes the activities of the Nuclear Science Division for the period of January 1, 1994, to December 31, 1994. This was a time of significant accomplishment for all of the programs in the Division. Assembly of the solar neutrino detector at the Sudbury Neutrino Observatory is well under way. All of the components fabricated by LBL were shipped to Sudbury early in the year and our efforts are now divided between assisting the assembly of the detector and preparing software for data analysis once the detector is operational in 1996. Much of the activity at the 88-Inch Cyclotron centered on Gammasphere. The {open_quotes}early implementation{close_quotes} phase of the detector ended in September. This phase was extremely successful, involving over 60 experiments with nearly 200 users from 37 institutions worldwide. The mechanical structure was installed and the final electronic system is expected to operate in March 1995. The Division concurrently hosted a conference on physics for large {gamma}-ray detector arrays at the Clark Kerr Campus at UC Berkeley in August. This was a very successful meeting, reflecting the enthusiasm for this field worldwide. Also at the Cyclotron, the progress toward weak interaction experiments using ultra-thin sources passed a major milestone with the trapping of radioactive {sup 21}Na atoms. We are now engaged in a major upgrade of the experimental area and the outlook is very promising for these novel experiments. Another highlight of research at the Cyclotron was the confirmation of element 106. This development allowed the original LLNL/LBL discovery team to move forward with their proposal to name this element seaborgium.
Statistical analysis of accident data associated with sea transport (data from 1994-1997). Annex 1
International Nuclear Information System (INIS)
Schneider, T.; Tabarre, M.; Armingaud, F.
2001-01-01
This analysis is based on Lloyd's database concerning sea transport accidents for the 1994-1997 period and completes the previous analysis based on 1994 data. It gives an accurate description of the world fleet and the most severe ship accidents (total losses), as well as the frequencies of accident (in average on the 1994-1997 period the frequency of accident for cargo carrying ships is 2.57.10 -3 loss /ship.year). Furthermore, an analysis has been performed on the ship casualties recorded by the Marine Accident Investigation Branch (MAIB) for UK vessels for the 1990-1996 period, this database including all accidents for which a declaration has been made to authorities (for example, the average frequency of fires derived from this analysis is 1.36.10 -2 per ship.year, this occurrence corresponding to the occurrence of initiating events of fire). Concerning fire accidents aboard ships supposed to be representative of the radioactive material transporters, a specific analysis was achieved by the French Bureau Veritas, on a selection of the world casualties (total losses) for the 1978-1988 period. This analysis related to the origin of the fire points out that it originates mainly in the machinery room and quarters. In a few cases the fire duration recorded is more than one day. (author)
Directory of Open Access Journals (Sweden)
Eumelia Ondina Terrero
2010-03-01
Full Text Available Introducción: el sobrepeso y la obesidad, factores de riesgo aterosclerótico, se incrementan de manera creciente en todas las edades. Las trasgresiones de la lactancia materna han sido relacionadas frecuentemente con el exceso de peso. Objetivos: contribuir al esclarecimiento de la relación entre la duración de la lactancia materna y el exceso de peso (sobrepeso y obesidad en adolescentes. Métodos: estudio observacional de casos y controles en 344 adolescentes que estudian en la Secundaria Básica Urbana "Benito Juárez" del área de salud del policlínico "Antonio Guiteras Holmes" en La Habana Vieja, realizado entre enero de 2005 y enero de 2006. A todos los estudiantes se les realizaron mediciones antropométricas de peso corporal, talla y circunferencia de cintura. El grupo control se conformó con los estudiantes normopeso. La asociación estadística entre la duración de la lactancia materna y el exceso de peso corporal se determinó mediante el cálculo de odds ratio con un nivel de significación de pIntroduction: the excess weight and obesity are atherosclerosis risks increasing in all ages. Transgressions of breastfeeding have been related frequently to excess weight. Objectives: to contribute to clearing up of relation between the length of breastfeeding and the excessive body weight (excess weight and obesity in adolescents. Methods: this is an observational study of cases and controls conducted in 344 adolescents studying in "Benito Juárez" Urban Secondary School (UBS from health area of "Antonio Guiteras Holmes" Polyclinic in Habana Vieja (January, 2005 to January, 2006. In all students we made anthropometry measurements of body weight, height and waist circumference. Control group included students with normal weight. Statistical association between breastfeeding and corporal excess weight was determined by odds ratio calculus con a 95 % accuracy. Results: it was verified the 14 % of excess weight and the 4% of obesity. The
Ma. del C. Espinosa Lloréns; Matilde López Torres; Haydee Álvarez; Alexis Pellón Arrechea; Jorge Alejandro García; Rigoberto Escobedo Acosta; Oneida Correa Senciales; Xiomara Rodríguez Petit; Yadiana León; Yamilé Álvarez Llaguno; Rosario Morejón Montano; Jacqueline Gutiérrez Navarrete; Heikel Lezcano; Marlenys Agramonte; Elsa Pérez Despaigne
2005-01-01
La Ciudad de La Habana, principal centro político, administrativo y cultural del país, concentra gran parte de las actividades económicas de la nación, ya sean de naturaleza industrial, de servicios, científicas y el turismo. Todo ello conlleva a una elevada generación de Residuos Sólidos Urbanos (RSU) en relación con otras ciudades cubanas. La inexistencia de soluciones adecuadas y eficientes para el tratamiento y la disposición final, así como el manejo inadecuado de dichos residuos, potenc...
International Nuclear Information System (INIS)
Uetsuka, Hiroshi; Nakamura, Jinichi; Kinoshita, Motoyasu
1998-01-01
JAERI has performed cooperative researches with many Japanese agencies and companies by means of the Halden Boiling Heavy Water Reactor (HBWR) which is located at Halden in Norway. These cooperative researches are carried out based on the contracts of the cooperative researches, which are revised every three years, in accordance with the renewal of the participation of JAERI to the OECD Halden Reactor Project. This report summaries the objectives, contents and the outlines of the achievements of the cooperative researches during the three years from 1994 January to 1996 December. During the period, ten cooperative researches had been carried out, and two of them had finished during the period and other eight researches has been continued to the next three year period. There are many research items, and most of them are irradiation test researches of advanced fuel and cladding concerned with the high burnup utilization of LWR fuel or MOX fuel irradiation researches to prepare for the introduction of Plutonium utilization in LWRs. The researches of fuel irradiation usually take long time because of the characteristics of these kind of research work, and three years are usually not enough to obtain some achievements from the irradiation tests. Therefore, eight tests have been continued after the three year period. In this report, the achievements of the continued researches to the next three year period are not final one but a kind of progress report. (author) kind of progress report. (author)
El taller docente, ¿Cómo hacerlo más eficaz?
Directory of Open Access Journals (Sweden)
Wilfredo Guibert Reyes
2001-04-01
Full Text Available Se realizó un estudio descriptivo mediante la observación de 60 talleres docentes realizados por profesores de MGI en los policlínicos docentes Reina y Santos Suárez de Ciudad de La Habana, en el período noviembre/1994-mayo/1996, con el propósito de determinar normas de utilidad práctica en su empleo que aumenten la eficiencia en su utilización. Se empleó una guía de observaciones y se realizó un taller con los profesores de más experiencia sobre el taller docente. En la mayoría de los talleres eficientes los residentes y profesores se preparaban previamente y estos últimos realizaban una motivación inicial buena; en los aspectos organizativos hubo diferencias entre los talleres eficientes y los ineficientes, y la evaluación por el profesor fue lo predominante. Se concluyó con un conjunto de normas prácticas que contribuyen de forma importante a que el taller docente sea más eficazA descriptive study was carried out by observing 60 workshops conducted by professors of General Comprehensive Medicine in "Reina" and "Santos Suárez" Teaching Polyclinics of Havana City from November, 1994, to May, 1996, in order to determine norms of practical usefulness that increase the efficiency of their use. A guide of observations was utilized and a workshop was held with these professors having more experience on this topic. In most of the efficient workshops the residents and professors prepared themselves previously and the initial motivation was good. As regards the organizational aspects, there were differences between the efficient and the inefficient workshops and the evaluation made by the professor prevailed. It was concluded with a series of practical norms that contribute in an important way to make the teaching workshop more efficient
Directory of Open Access Journals (Sweden)
Patricia Volkow
2000-06-01
Full Text Available OBJETIVO: Describir los resultados de diez años de vigilancia de infecciones intrahospitalarias (II en un centro oncológico. MATERIAL Y MÉTODOS: Es un estudio descriptivo, retrospectivo, del programa de vigilancia del Comité de Vigilancia y Control de Infecciones Intrahospitalarias del Instituto Nacional de Cancerología, realizado en 1997. Se utilizaron los criterios de infección intrahospitalaria por sitio propuestos por el Centro para la Prevención y el Control de Enfermedades de Atlanta, Georgia, de Estados Unidos de América, en 1972. De junio de 1986 a diciembre de 1996, se estudiaron 62 733 egresos. La vigilancia se realizó mediante la revisión de los expedientes de pacientes con fiebre, de aquellos que reciben antibióticos y de posoperados en los pisos de hospitalización y revisión de cultivos. Se calcularon las tasas de II por episodios/100 egresos. RESULTADOS: La tasa de infecciones intrahospitalarias por 100 egresos fue de 4.4 en 1986; 7.7, en 1987; 8.1, en 1988; 5.9, en 1989; 4.6, en 1990; 5.1, en 1991; 4.3, en 1992; 5.4, en 1993; 7.6, en 1994; 7.1, en 1995, y 8.5, en 1996. El germen más frecuentemente aislado en las II fue Escherichia coli. Los aislamientos de hongos y los de enterococo se incrementaron en casi siete veces desde 1987. CONCLUSIONES: Se observó un incremento en la tasa de infecciones hospitalarias en los últimos cuatro años. Al menos dos factores contribuyeron a esta tendencia: la aplicación de un sistema de vigilancia más experimentado, el cual hizo que disminuyera el subregistro, y el aumento real en la frecuencia de tales infecciones.OBJECTIVE: To describe the results of ten years of nosocomial infection (NI surveillance in an oncology center. MATERIAL AND METHODS: This is a descriptive study of the Infection Control and Surveillance Program Committee at the Instituto Nacional de Cancerología, conducted in 1997. From June 1986 to December 1996, we surveyed 62 733 hospital discharge records
Directory of Open Access Journals (Sweden)
Jacqueline JIMÉNEZ POLANCO
2009-11-01
Full Text Available RESUMEN: Este artículo analiza los resultados de los comicios presidenciales de 1994, en los que Joaquín Balaguer obtuvo el triunfo por un estrecho margen. Previamente se identifican los principales rasgos específicos del sistema político dominicano y se describe el denso entramado de pactos preelectorales, así como las características de la campaña electoral, marcada también por la crisis política haitiana. Seguidamente se describe la situación política derivada del apretado resultado electoral, que culminó con la reforma constitucional aprobada el 14 de agosto de 1994. Por último, la autora analiza la evolución de las fuerzas políticas ante las elecciones presidenciales de agosto de 1996.ABSTRACT: This article analyzes the results of the Presidential Elections of 1994, in which Joaquín Balaguer got the Presidency for a narrow gap. Previously, the author identify the main specific features of Dominican political system and describe the dense framework of preelectoral pacts and the characteristics of electoral campaign marked also by the Haitian political crisis. Later she describes the political situation which finished with the constitutional reform approved 14 August 1994. Finally, the author studies the evolution of political forces before the Presidential Elections of August 96.
EPA released the final report, Analysis of Total Food Intake and Composition of Individual’s Diet Based on USDA’s 1994-1996, 98 Continuing Survey of Food Intakes by Individuals (CSFII). The consumption of food by the general population is a significant route of potential ...
International Nuclear Information System (INIS)
Biggs, J.R.; Bennett, K.D.; Fresquez, P.R.
1997-07-01
Small mammals were sampled at two waste burial sites at Area G, Technical Area (TA) 54 and a control site within the proposed Area G expansion area in 1996 to (1) identify radionuclides that are present within rodent tissues at waste burial sites, (2) to compare the amount of radionuclide uptake by small mammals at waste burial sites to a control site, and (3) to identify the primary mode of contamination to small mammals, either through surface contact or ingestion/inhalation. Three composite samples of approximately five animals per sample were collected at each site. Pelts and carcasses of each animal were separated and analyzed independently. Samples were analyzed for 241 Am, 90 Sr, 238 Pu, 239 Pu, total U, 137 Cs, and 3 H. Higher levels of total U, 241 Am, 238 Pu, and 239 Pu were detected in pelts as compared to the carcasses of small mammals at TA-54. Concentrations of other measured radionuclides in carcasses were nearly equal to or exceeded the mean concentrations in the pelts. Due to low sample sizes in total number of animals captured, statistical analysis to compare site to site could not be conducted. However, mean concentrations of total U, 238 Pu, 239 Pu, and 137 Cs in rodent carcasses were higher at Site 1 than site 2 or the Control Site and 241 Am was higher at Site 2 than Site 1 or the Control Site
Recycling of actinides and nuclear waste products. Annual report from the research programme 1996
International Nuclear Information System (INIS)
Konings, R.J.M.; Bakker, K.; Dodd, D.H.; Gruppelaar, H.; De Haas, J.B.M.; Kloosterman, J.L.
1997-07-01
The research program on the title subject started in 1994 and is planned to be completed in 1998. In this period several technical and scientific aspects of recycling and transmutation are investigated in different projects. The results of the 1996 projects are summarized and described in this report. The 1996 projects concern (1) the chemistry of actinides and inert matrices to test and characterize the matrices and actinide compounds in order to develop uranium-free fissionable materials for the transmutation of actinides; (2) the transmutation of plutonium in light water reactors (LWR) to assess and increase the burnup of plutonium and to assess the safety of plutonium transmutation in LWRs; (3) the radiological consequences of different nuclear fuel cycles; (4) and a reactor physics analysis of new thorium-based reactor systems to study the possibility to reduce the amount of long-living radioactive waste materials by means of the use of thorium-based compounds in a high-temperature reactor (HTR) or accelerators. 15 figs., 6 tabs., 23 refs
MARQUETTI, MARIA DEL CARMEN; CARUS, FERNANDO; AGUILERA, LUCITA; NAVARRO, AGUSTIN
1995-01-01
Se realiza un análisis de la relación entre el número de focos de Aedes aegypti, las precipitaciones y las temperaturas ocurridas en las épocas de lluvia y seca durante los años 1982 a 1992, en el municipio 10 de Octubre, en Ciudad de La Habana. No se encontró correlación entre el número de focos y las precipitaciones ocurridas en ambas estaciones, así como tampoco entre el número de focos y las temperaturas, por lo que se enfatiza la necesidad de mantener una estricta vigilancia durante todo...
Directory of Open Access Journals (Sweden)
Natividad Hernández
2014-06-01
Full Text Available Se evaluó durante 6 meses el comportamiento de 13 especies de peces de la fauna dulceacuícola cubana, que fueron puestas en contacto con Salmonella enteritidis var danyz en concentración de 10 8 ufc/mL. En la evaluación se utilizaron los alevinos y juveniles procedentes de reservorios naturales, de la Estación de Guanímar y de Manpostón, ubicadas en Batabanó, Gaunímar, Guajaibón y La Lisa (Ciudad de la Habana. Antes de los ensayos, los peces fueron sometidos a 15 días de adaptación al cautiverio. Durante las evaluaciones, se registraron los parámetros fisicoquímicos del agua de los acuarios, detectándose incremento en los valores de nitritos y nitratos después de 48 horas de haberse colocado el inóculo. Se registraron los valores extremos de talla y peso de los peces, que comparados con el grupo control no evidenciaron diferencias significativas y al finalizar el ensayo todos los peces presentaron aspecto físico normal; por lo que se determinó que la dosis utilizada de Salmonella enteritidis var. danysz fue inocua para las diferentes especies de peces.
Energy in 1996; L`energie en 1996
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-12-31
Six charts are presented and discussed concerning energy utilization in France during the 1970-1996 period: national energy bill, energy intensity ratios, imported crude oil costs, energy-induced carbon dioxide emissions, operating ability ratios of EDF nuclear plants, France`s energy independence ratios. 1996 has seen an strong increase (+31%) in the energy bill, reaching 77 billions Francs, combining an increase in energy consumption and dollar exchange rate and a decline in energy conservation; carbon dioxide emission are taking up again after a strong decrease in the 80`s
International Nuclear Information System (INIS)
1995-01-01
The Uranium Industry Annual 1994 (UIA 1994) provides current statistical data on the US uranium industry's activities relating to uranium raw materials and uranium marketing during that survey year. The UIA 1994 is prepared for use by the Congress, Federal and State agencies, the uranium and nuclear electric utility industries, and the public. It contains data for the 10-year period 1985 through 1994 as collected on the Form EIA-858, ''Uranium Industry Annual Survey.'' Data collected on the ''Uranium Industry Annual Survey'' (UIAS) provide a comprehensive statistical characterization of the industry's activities for the survey year and also include some information about industry's plans and commitments for the near-term future. Where aggregate data are presented in the UIA 1994, care has been taken to protect the confidentiality of company-specific information while still conveying accurate and complete statistical data. A feature article, ''Comparison of Uranium Mill Tailings Reclamation in the United States and Canada,'' is included in the UIA 1994. Data on uranium raw materials activities including exploration activities and expenditures, EIA-estimated resources and reserves, mine production of uranium, production of uranium concentrate, and industry employment are presented in Chapter 1. Data on uranium marketing activities, including purchases of uranium and enrichment services, and uranium inventories, enrichment feed deliveries (actual and projected), and unfilled market requirements are shown in Chapter 2
Results from the hydrodynamic element of the 1994 entrapment zone study in Suisun Bay
Burau, J.R.; Gartner, J.W.; Stacey, M.
1998-01-01
The entrapment zo as long been considered an important region of the San Francisco estuary. It has been the subject of several previous studies, and its location has been suggested as an index of condition of the estuarine ecosystem.A close correlate of this location, X2 1, is now used as a management objective on the basis that X2 is correlated with the abundance or survival of several estuarine-dependent species. X2 is a crude tool to use for this purpose, but it can be refined only through improved understanding of the various mechanisms underlying these correlations. These mechanisms probably differ among species, but for species resident in and near the entrapment zone, the correlation with X2 may be due to variations in intenSity oftrapping mechanisms with pOSition of the entrapment zone. Therefore, it is worthwhile to investigate these trapping mechanisms, the nature of the entrapment zone as habitat, and the responses of the entrapment zone to changes in X2 or outflow from the Sacramento-San Joaquin Delta. Studies ofthe entrapment zone ofthe San Francisco estuary have been conducted in springs of 1994, 1995, and 1996. These studies have been funded by the Interagency Ecological Program and conducted by scientists from IEP member agencies, the Romberg Tiburon Center for Environmental Studies, Bodega Marine Laboratory, and the University of California at Santa Cruz. This report presents results from 1994, a low-flow year. Subsequent reports will describe results from 1995 and 1996 and highlight differences among years. This report is organized in chapters that comprise more-or-Iess independent papers, with an introductory chapter for the entire study. This Executive Summary presents highlights of the overall study plan and summarizes the major findings.
Directory of Open Access Journals (Sweden)
José Alberto Méndez González
2007-06-01
Full Text Available Se realizó un estudio transversal en pacientes de 15 a 65 años de edad del área de salud del Policlínico “Ángel A. Aballí ” del municipio Habana Vieja, pertenecientes a 14 consultorios seleccionados del médico de la familia, en el período comprendido entre octubre del 2005 y julio del 2006, con el objetivo de estimar la prevalencia y gravedad de la enfermedad periodontal y determinar los factores de riesgo asociados con esta. Se seleccionó una muestra de 229 pacientes por el método de selección aleatoria con probabilidad proporcional al tamaño de los consultorios del médico de la familia. La gingivitis fue la afección más prevalente asociada con factores como caries, obturaciones deficientes, higiene deficiente, maloclusiones y personas hipertensas tratadas con Nifedipina . De los factores estudiados, el hábito de fumar, la higiene deficiente y el consumo de nifedipina tuvieron asociación estadísticamente significativa en relación con la periodontitis .
Directory of Open Access Journals (Sweden)
Oto Higuita
2014-12-01
Full Text Available RESUMEN Este artículo de investigación, presenta rutas de análisis histórico en torno a los alcances y falencias que dejaron los diálogos de Paz en Colombia entre las Frac-Ep y el Gobierno Nacional durante el siglo XX, el papel que han jugado los medios de comunicación en dichos procesos y una descripción analítica de los discursos de Oslo y la Habana, que dan inicio al actual proceso de Negociación en la Habana; se resalta el profundo alcance que este proceso de negociaciones marca en la última década en Colombia, en lo que concierne a la posible terminación del conflicto armado y la construcción de una paz estable y duradera. ABSTRACT This research article presents routes of historical analysis over the scope and shortcomings left by the talks of peace in Colombia between FARC-EP and the National government during the twentieth century, as well as the role played by the mass media in those processes and an analytical description of the discourses in Oslo and Havana, initiating the current process of negotiations at Havana; the deep scope of this process of negotiations marks in the last decade in Colombia, is highlighted with regard to the possible termination of the armed conflict and the construction of a stable and lasting peace.
Directory of Open Access Journals (Sweden)
Rebeca Fajardo Luig
2008-12-01
Full Text Available Se realizó un estudio de casos y controles en el Hospital Ginecoobstétrico "América Arias", que abarcó el período 2004-2006, con el objetivo de identificar la asociación del bajo peso al nacer con algunos factores de riesgo conocidos de esta entidad. El grupo de estudio estuvo constituido por 108 mujeres residentes en Centro Habana, que parieron un recién nacido vivo bajo peso, y el grupo control por 216 mujeres, que tuvieron un neonato normopeso. De los recién nacidos bajo peso, un 65 % fueron pretérmino, un 39 % CIUR y un 4 % presentó la combinación de ambas entidades. Se demostró que existe relación entre el bajo peso al nacer y las edades maternas menor de 20 (14,8 % de los casos y mayor de 35 años (23,1 % de los casos, la baja talla materna (15,7 % de los casos, la baja escolaridad (17,5 % de los casos, el antecedente materno de hijo con bajo peso (13,8 % de los casos, el período intergenésico corto (69,4 % de los casos, el hábito de fumar (60,1 % de los casos, la desnutrición materna al inicio de la gestación (58,3 % de los casos y la ganancia materna insuficiente de peso durante el embarazo (54,6 % de los casos. El asma bronquial (13,8 %, la hipertensión arterial crónica (12,9 %, la preeclampsia (18,5 % y la anemia (18,5 % fueron las enfermedades más frecuentes encontradas en el grupo de estudio.A case-control study was conducted at "América Arias" Gynecoobstetric Hospital from 2004 to 2006 aimed at identifying the asociation of low birth weight with some risk factors known in this entity. The study group was composed of 108 females living in Centro Habana that gave birth a live low birth weight infant, and a control group that was made up of 216 females that had a normoweight infant. Of the low birth weight infants, 65 % were preterm, 39 % RIUG and 4 % presented a combination of both entities It was proved that there is a relationship between low birth weight and the maternal age under 20 (14.8 % of the cases and
Asiki, Gershim; Baisley, Kathy; Kamali, Anatoli; Kaleebu, Pontiano; Seeley, Janet; Newton, Robert
2015-04-01
To characterise trends over time in smoking and alcohol consumption in a rural Ugandan population between 1994 and 2011. We used self-reported data from a long-standing population cohort - the General Population Cohort. From 1989 to 1999, the study population comprised about 10 000 residents of 15 adjacent villages. From 1999, 10 more villages were added, doubling the population. Among adults (≥13 years, who comprise about half of the total study population), data on smoking were collected in 1994/1995, 2008/2009 and in 2010/2011. Data on alcohol were collected in 1996/1997, 2000/2001, 2009/2010 and 2010/2011. The reported prevalence of smoking among men was 17% in 1994/1995, 14% in 2008/2009 and 16% in 2010/2011; equivalent figures for women were 1.5%, 1% and 2%. In the most recent time period, for both sexes combined, prevalence of smoking increased from 1.5% in those aged <29 years, to 18% in those 50+ years (P < 0.001); prevalence was 14.8% in the lowest tertile of socio-economic status, decreasing to 3.7% in the highest (P < 0.001). For alcohol consumption, current drinking was reported by 39% in 1996/1997, 35% in 2000/2001 and 28% in 2010/2011; men were more likely to drink than women (32.9% vs. 23.5% in 2010/2011) and consumption increased with age (P < 0.001); and was associated with low socio-economic status, riskier sexual behaviour and being HIV positive (P < 0.001). In this rural Ugandan population, consumption of cigarettes and alcohol is higher among men than women, increases with age and is more frequent among those with low socio-economic status. We find no evidence of increases in either exposure over time. © 2014 John Wiley & Sons Ltd.
Presidencia del CSIC
1994-01-01
Con esta memoria queremos dar cuenta, como en años anteriores, de los aspectos más importantes del funcionamiento de la Institución durante 1994. Algunos datos de carácter general ponen de manifiesto que el CSIC continúa siendo el Organismo Público de Investigación más importante de España por su volumen de recursos y actividades. Durante 1994 trabajaron en La Institución 6.156 personas entre personal científico investigador, técnico de apoyo a la investigación y de administración y ser...
Energy balance Flanders 1994: disparity method; Energiebalans Vlaanderen 1994: verschilmethode
Energy Technology Data Exchange (ETDEWEB)
Smekens, K.; Vanhoof, B.
1997-07-01
In this report the energy balance of Flanders for 1994 is presented, together with an estimate of the CO2-emissions. Apart from data about 1994, comparable data about the 1990-1994 period are presented in order to give a picture of the evolution of both the energy consumption and the CO2-emissions in Flanders. The energy balance was calculated by subtracting the energy balances of the Walloon and Brussels region from the Belgian one. Afterwards, these results were corrected as far as specific Flemish energy data were available. For the calculation of the CO2-emissions the IPCC guidelines for greenhouse inventories were used. In 1991, the primary energy consumption in Flanders was 1489.9 PJ, the gross inland consumption was 1309.8 PJ. The final energy consumption amounted 971.7 PJ. The total CO2-emission was 73,086 kton (excluding emissions from international aviation and marine bunkering). Compared to 1990, the gross inland consumption had increased some 7.3 per cent by 1994, the final energy consumption 12.3 per cent and the CO2-emissions 8.3 per cent. In view of the planned CO2-emission reduction of 10 per cent by the year 2010, the figures quoted above show that there is still a long way to go to reach this objective.
Directory of Open Access Journals (Sweden)
Ana Sittenfeld
2004-03-01
Full Text Available Se describe una nueva especie de euglena aislada de las Pailas de Barro Caliente del Volcán Rincón de la Vieja, Costa Rica. Esta especie se caracteriza por habitar sitios ácidos y calientes. Euglena pailasensis sp. nov. tiene como características principales: la ausencia de flagelos, presencia de filamentos similares a "pilis", presencia de cloroplastos con pirenoides atravesados por varios tilacoides, además, es termotolerante y acido-tolerante. Los análisis filogenéticos para el gen ADNr 18S y la secuencia del gen para la enzima Gap C indican que la nueva especie está relacionada con E. mutabilis. Las características taxonómicas basadas en la morfología, biología y secuencia del ADNr 18S y los genes GAP C, son discutidas y comparadas con otras especies relativamente cercanas al géneroAnew species of euglena isolated from a hot and acid mud pool located in Las Pailas de Barro, Volcán Rincón de la Vieja, Costa Rica is described. This species inhabits hot and acid environments. Euglena pailasensis sp. nov. main features are: the absence of flagella, the presence filaments like "pilis", the presence of chloroplasts with pyrenoids crossed by several tylakoids, and acid and heat tolerance. Molecular phylogeny studies using 18S rDNA and Gap C genes indicated that the new species is related to E mutabilis. Its taxonomic characters based on morphology, biology and sequence of the 18S rDNA and Gap C genes are discussed and compared with other closely related species of the genus
Directory of Open Access Journals (Sweden)
José Ronzón León
1998-01-01
Full Text Available El artículo tiene como tema el estudio de la epidemia de fiebre amarilla, en 1905, en los puertos de Veracruz, La Habana y New Orleans. El objetivo de este artículo es analizar la epidemia de fiebre amarilla que se convirtió en una pandemia que afectó dichos puertos. La finalidad es comprender la presencia de esta enfermedad en estos puertos y los efectos que tuvo en las relaciones políticas y comerciales de la región, mismos que condujeron a la búsqueda de políticas sanitarias y de saneamiento urbano.
Reacción a la tuberculina entre escolares de noveno grado de Ciudad de La Habana, Cuba
Directory of Open Access Journals (Sweden)
Borroto Gutiérrez Susana M.
2003-01-01
Full Text Available OBJETIVOS: Determinar la proporción de personas que reaccionan a la tuberculina como indicador de la prevalencia de infección tuberculosa en escolares de 14 años de Ciudad de La Habana, Cuba. MÉTODOS: Mediante un muestreo monoetápico por conglomerados se aplicaron 1 936 pruebas de Mantoux (tuberculina a estudiantes de noveno grado del curso escolar 1999-2000 (cohorte de los nacidos en 1985 de 20 escuelas secundarias básicas seleccionadas aleatoriamente en Ciudad de La Habana, Cuba. Las pruebas se realizaron según la técnica estándar recomendada por la Organización Mundial de la Salud y se evaluaron a las 72 horas. Se calcularon los porcentajes de reactividad y el diámetro medio de las induraciones cutáneas en la cohorte y según el sexo. Las comparaciones de medias y porcentajes se realizaron mediante la prueba de ji al cuadrado con 95% de confiabilidad. Se usó el programa Epi Info v. 6.0. RESULTADOS: Noventa y seis por ciento de las pruebas leídas fueron negativas (0-4 mm, 2,5% fueron dudosas (5-9 mm y 1,5% resultaron positivas (> 10 mm. El porcentaje de reactividad disminuyó a 0,1% cuando se utilizó un valor de corte de 15 mm. El diámetro medio de las induraciones fue de 0,41 mm y no se detectó ninguna diferencia estadísticamente significativa en función del sexo. CONCLUSIONES: La proporción de personas que reaccionaron a la tuberculina, usando como punto de corte un diámetro de induración cutánea de 10 mm, fue muy baja (1,5% en este estudio y mucho más baja (0,1% cuando se utilizó 15 mm como punto de corte. Si se toma en cuenta la baja frecuencia de tuberculosis bacilífera en Cuba y que hay una relación inversa entre el tiempo transcurrido desde la aplicación de la vacuna a base del bacilo de Calmette-Guérin (BCG y la intensidad de la respuesta a la tuberculina, las reacciones cutáneas con un diámetro de induración > 10 mm podrían ser la expresión de una infección natural, por lo que, en ese caso, la
Princeton Plasma Physics Laboratory Annual Site Environmental Report for Calendar Year 1996
Energy Technology Data Exchange (ETDEWEB)
J.D. Levine; V.L. Finley
1998-03-01
The results of the 1996 environmental surveillance and monitoring program for the Princeton Plasma Physics Laboratory (PPPL) are presented and discussed. The purpose of this report is to provide the US Department of Energy and the public with information on the level of radioactive and nonradioactive pollutants, if any, that are added to the environment as a result of PPPL's operations. During Calendar Year 1996, PPPL's Tokamak Fusion Test Reactor (TFTR) continued to conduct fusion experiments. Having set a world record on November 2, 1994, by achieving approximately 10.7 million watts of controlled fusion power during the deuterium-tritium (D-T) plasma experiments, researchers turned their attention to studying plasma science experiments, which included ''enhanced reverse shear techniques.'' Since November 1993, more than 700 tritium-fueled experiments were conducted, which generated more than 4 x 10(superscript 20) neutrons and 1.4 gigajoules of fusion energy. In 1996, the overall performance of Princeton Plasma Physics Laboratory was rated ''excellent'' by the US Department of Energy in the Laboratory Appraisal report issued in early 1997. The report cited the Laboratory's consistently excellent scientific and technological achievements and its successful management practices, which included high marks for environmental management, employee health and safety, human resources administration, science education, and communications. Groundwater investigations continued under a voluntary agreement with the New Jersey Department of Environmental Protection. PPPL monitored for the presence of nonradiological contaminants, mainly volatile organic compounds (components of degreasing solvents) and petroleum hydrocarbons (past leaks of releases of diesel fuel from underground storage tanks). Also, PPPL's radiological monitoring program characterized the ambient, background levels of tritium in the environment and
Princeton Plasma Physics Laboratory Annual Site Environmental Report for Calendar Year 1996
International Nuclear Information System (INIS)
J.D. Levine; V.L. Finley
1998-01-01
The results of the 1996 environmental surveillance and monitoring program for the Princeton Plasma Physics Laboratory (PPPL) are presented and discussed. The purpose of this report is to provide the US Department of Energy and the public with information on the level of radioactive and nonradioactive pollutants, if any, that are added to the environment as a result of PPPL's operations. During Calendar Year 1996, PPPL's Tokamak Fusion Test Reactor (TFTR) continued to conduct fusion experiments. Having set a world record on November 2, 1994, by achieving approximately 10.7 million watts of controlled fusion power during the deuterium-tritium (D-T) plasma experiments, researchers turned their attention to studying plasma science experiments, which included ''enhanced reverse shear techniques.'' Since November 1993, more than 700 tritium-fueled experiments were conducted, which generated more than 4 x 10(superscript 20) neutrons and 1.4 gigajoules of fusion energy. In 1996, the overall performance of Princeton Plasma Physics Laboratory was rated ''excellent'' by the US Department of Energy in the Laboratory Appraisal report issued in early 1997. The report cited the Laboratory's consistently excellent scientific and technological achievements and its successful management practices, which included high marks for environmental management, employee health and safety, human resources administration, science education, and communications. Groundwater investigations continued under a voluntary agreement with the New Jersey Department of Environmental Protection. PPPL monitored for the presence of nonradiological contaminants, mainly volatile organic compounds (components of degreasing solvents) and petroleum hydrocarbons (past leaks of releases of diesel fuel from underground storage tanks). Also, PPPL's radiological monitoring program characterized the ambient, background levels of tritium in the environment and from the TFTR stack; the data are presented in this report
KURRI progress report 1996. April 1996 - March 1997
International Nuclear Information System (INIS)
1997-11-01
This report describes the activities of the Research Reactor Institute, Kyoto University (KURRI) during the fiscal year (FY) of 1996. A total of 1506 researchers visited the KURRI to perform 106 experimental applications or to attend 17 symposia and 3 workshops. At the end of a three-year period, the scientific achievements of two research projects, 'Residual Stress and Strip Investigations of Metallic Materials by Neutron Scattering' and 'Radiation Protection to the Manageable Ionizing Radiation in the KUR facilities' were reviewed during the annual Scientific Meeting of the KURRI, held on Jan 21-23, 1997. The five-year modernization Program of the KUR and its related facirities was in progress since the reorganization for a Center of Excellence on April 1, 1995. In the FY, 1996 the maintenance and close inspections of the heavy water facility and the graphite thermal column were carried out during the reactor shutdown from Feb 24, 1997 to May 9, 1997. A total of 174 reports of project and general researches in 1996 were outlined. (M.N.)
KURRI progress report 1996. April 1996 - March 1997
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-11-01
This report describes the activities of the Research Reactor Institute, Kyoto University (KURRI) during the fiscal year (FY) of 1996. A total of 1506 researchers visited the KURRI to perform 106 experimental applications or to attend 17 symposia and 3 workshops. At the end of a three-year period, the scientific achievements of two research projects, `Residual Stress and Strip Investigations of Metallic Materials by Neutron Scattering` and `Radiation Protection to the Manageable Ionizing Radiation in the KUR facilities` were reviewed during the annual Scientific Meeting of the KURRI, held on Jan 21-23, 1997. The five-year modernization Program of the KUR and its related facirities was in progress since the reorganization for a Center of Excellence on April 1, 1995. In the FY, 1996 the maintenance and close inspections of the heavy water facility and the graphite thermal column were carried out during the reactor shutdown from Feb 24, 1997 to May 9, 1997. A total of 174 reports of project and general researches in 1996 were outlined. (M.N.)
Directory of Open Access Journals (Sweden)
M. Fernández Salgado
2002-01-01
Full Text Available A partir de una solicitud de la Oficina del Historiador de la Habana se conformó un grupo de trabajo integrado por losautores antes mencionados para diseñar un mecanismo de giro, bajo la acción del viento, que permitiera que la estatua delmitológico Mercurio, ubicada en la cúpula de la Lonja del Comercio de La Habana, pudiera girar y de esta forma presentarla menor resistencia a la fuerte acción del viento que se genera en la señalada zona.Para evaluar la resistencia de los elementos que componen el mecanismo, determinar la calidad de los materiales a emplear,definir los refuerzos necesarios y precisar el apriete de los pernos de fijación se utilizó el Método de los Elementos Finitos,el cual a través de la modelación físico matemática del sistema permite obtener las isozonas de tensiones equivalentes, lasisozonas de desplazamientos y las fuerzas actuantes en los lugares de fijación.Como resultado del trabajo realizado se diseñó y construyó el mecanismo de giro para la estatua, el que se encuentrainstalado y funcionando de acuerdo a los requisitos solicitados desde el pasado mes de marzo del año en curso.Palabras claves: diseño, rodetes de bola, resistencia mecánica, elementos finitos._____________________________________________________________________________Abstract.By request of the Havana Historian Office is created a group composed by the authors in order to design a turningmechanism, under the action of wind, for the statue of Mercurio, been located in the dome of the Lonja del Comercio de LaHaban. This turning system should be design with the minor resistance to the strong action of the wind generated in thesignal zone.In order to evaluate the resistance of the elements for the mechanism, the quality of the materials to define the necessaryreinforcements and specify the fasteners of fixation, the Finite Elements Method was utilized. The physical mathematicalmodel of the system allowed to get the isozones of equivalent
International Nuclear Information System (INIS)
Dorner, B.
1995-01-01
This yearbook describes the organization of ILL, the experimental facilities, visits and events, director's report, and the ILL-ESRF-EMBL cooperation. There were 10 colleges in ILL during 1994, a report of each is presented. Reports of ILL's departments are given: Directorate Service, Science Division (four groups + small projects), Projects and Techniques Division, Reactor Division and Administration Division. Finally, communication, including conference contributions, seminars and workshops, and publications (ILL Report 1994) are listed. (R.P.) 174 figs.; 9 tabs
Directory of Open Access Journals (Sweden)
Hugo Grisales Romero
2002-11-01
Full Text Available Objetivos. Examinar los cambios en la esperanza de vida en Medellín, Colombia, entre los trienios de 1989-1991 y 1994-1996, en relación con los cuatro grupos de causas de muerte utilizados convencionalmente en los estudios sobre la carga de morbilidad: grupo 1, enfermedades transmisibles, perinatales, maternas y nutricionales; grupo 2, enfermedades no transmisibles; grupo 3, traumatismos; grupo 4, causas mal definidas. Estas últimas se excluyeron del análisis debido a su ambigüedad. Métodos. Para hacer los cálculos se utilizó el método descrito por J. H. Pollard en 1986, con ayuda del programa Microsoft Excel, usando las fórmulas requeridas para su aplicación. Las operaciones fueron verificadas con el programa EPIDAT (versión 3.0 no oficial. Resultados. Entre el primer y segundo trienio (1994-1996 y 1989-1991, respectivamente se observó una ganancia total de 1,93 años en la esperanza de vida al nacer, la cual subió de 62,13 a 64,06 años. Esta ganancia fue mayor en los hombres que en las mujeres (2,42 y 1,09 años, respectivamente. Al aplicar el método de Pollard, se advirtió una ganancia en la esperanza de vida general de 2,03 años para el total de la población. La ganancia en el sexo femenino se concentró en las edades extremas (niñas de 1 a 4 años y mujeres mayores de 54, y en los hombres en las edades intermedias (entre los 25 y 44 años. Se destaca, además, que en ambos sexos la mayor pérdida porcentual en la esperanza de vida se presentó en el grupo de 15 a 19 años (23% en los hombres y 4% en las mujeres, aproximadamente. El grupo 1 de causas de defunción se asoció con una pérdida de la esperanza de vida en los hombres (0,04 años, mientras que en el grupo 2 se observó en ambos sexos un aumento de dicha esperanza (0,60 años para los hombres y 0,55 años para las mujeres. Se destaca que la mayor ganancia masculina en la esperanza de vida se relacionó con una reducción de la mortalidad por traumatismos (1
Directory of Open Access Journals (Sweden)
Grisales Romero Hugo
2002-01-01
Full Text Available Objetivos. Examinar los cambios en la esperanza de vida en Medellín, Colombia, entre los trienios de 1989-1991 y 1994-1996, en relación con los cuatro grupos de causas de muerte utilizados convencionalmente en los estudios sobre la carga de morbilidad: grupo 1, enfermedades transmisibles, perinatales, maternas y nutricionales; grupo 2, enfermedades no transmisibles; grupo 3, traumatismos; grupo 4, causas mal definidas. Estas últimas se excluyeron del análisis debido a su ambigüedad. Métodos. Para hacer los cálculos se utilizó el método descrito por J. H. Pollard en 1986, con ayuda del programa Microsoft Excel, usando las fórmulas requeridas para su aplicación. Las operaciones fueron verificadas con el programa EPIDAT (versión 3.0 no oficial. Resultados. Entre el primer y segundo trienio (1994-1996 y 1989-1991, respectivamente se observó una ganancia total de 1,93 años en la esperanza de vida al nacer, la cual subió de 62,13 a 64,06 años. Esta ganancia fue mayor en los hombres que en las mujeres (2,42 y 1,09 años, respectivamente. Al aplicar el método de Pollard, se advirtió una ganancia en la esperanza de vida general de 2,03 años para el total de la población. La ganancia en el sexo femenino se concentró en las edades extremas (niñas de 1 a 4 años y mujeres mayores de 54, y en los hombres en las edades intermedias (entre los 25 y 44 años. Se destaca, además, que en ambos sexos la mayor pérdida porcentual en la esperanza de vida se presentó en el grupo de 15 a 19 años (23% en los hombres y 4% en las mujeres, aproximadamente. El grupo 1 de causas de defunción se asoció con una pérdida de la esperanza de vida en los hombres (0,04 años, mientras que en el grupo 2 se observó en ambos sexos un aumento de dicha esperanza (0,60 años para los hombres y 0,55 años para las mujeres. Se destaca que la mayor ganancia masculina en la esperanza de vida se relacionó con una reducción de la mortalidad por traumatismos (1
Directory of Open Access Journals (Sweden)
Isabel Exner
2014-06-01
Full Text Available Desde principios de los años noventa, inicio de la crisis y las transformaciones de la sociedad cubana, en la fisonomía de la cuidad de La Habana se hace presente un nuevo tipo de jóvenes y de cultura juvenil: los raperos cubanos se mueven en una esfera de traducción y encuentro con fenómenos culturales globales, cuya recepción en Cuba es sólo reciente. El movimiento vivo y creciente del hip hop articula su compromiso con las circunstancias cambiadas de su contexto cultural, social y económico, mediante diversas manifestaciones estéticas y representaciones de variada medialidad. Su afán de entender e interpretar los procesos de la realidad que los rodea lleva a los raperos a establecer relaciones múltiples con diferentes campos de la sociedad y cultura cubanas de hoy. En su estética alternativa se refleja –a pesar de los esfuerzos cooptativos por parte de las instancias de política cultural– la creciente diversificación de la sociedad cubana.
Directory of Open Access Journals (Sweden)
Germán Vergel Rivera
1995-04-01
Full Text Available El tratamiento adecuado para la hipertensión arterial es imprescindible para disminuir las complicaciones que de ella se derivan. El grado de cumplimiento del tratamiento medicamentoso indicado, así como posibles factores que incidan en él y la relación entre su cumplimiento y el control de la presión arterial, fueron los objetivos de este trabajo realizado con 756 pacientes hipertensos dispensarizados en consultorios de médicos de la familia de los municipios 10 de Octubre y Guanabacoa en Ciudad de La Habana. En 10 de Octubre, los pacientes resultaron ser más cumplidores del tratamiento medicamentoso que en el municipio Guanabacoa. La edad, el sexo y la escolaridad no influyeron significativamente en ello, aunque, se observó un mayor cumplimiento por los pacientes mayores de 65 años. La falta de información y disciplina de la población fueron las causas principales del no cumplimiento. El tratamiento antihipertensivo utilizado parece ser eficaz para controlar la hipertensión arterial.
Radiation monitoring. Report covering period 1 Oct 1994 - 31 Dec 1994
International Nuclear Information System (INIS)
1995-01-01
This quarterly report on radiation monitoring in the Manchester Area uses experimental data and graphs compiled using archive materials to present a picture of gamma radiation air monitoring between 1st October 1994 and 31st December 1994. Compiled for local fire and civil defense authorities and pollution advisory body, data was collected at ten outstations. Temperature, barometric pressure, UVA and UVB readings were taken. Performance of equipment, including maintenance and outages at outstations is included. (UK)
Energy Technology Data Exchange (ETDEWEB)
Moere, H
1997-04-01
The sources for the radioactivity are the nuclear weapons tests and the Chernobyl accident in 1986. Milk is sampled and measured as an important indicator of the Chernobyl load of radionuclides that cows can metabolize and that will ultimately give a dose to humans. Milk was responsible for 13-19% of the total intake of {sup 137}Cs from foodstuffs for the average person in 1994. Our milk measurement program covered 90% of all produced consumption milk in Sweden in 1995. Milk samples are taken every second month from the dairies. {sup 90}Sr is only measured on pooled yearly samples from some dairies; these dairies covered 50% of the total production of consumption milk in Sweden in 1995. The mean value per year of {sup 137}Cs for the whole country has decreased from 0.52 to 0.26 Bq/l between 1991 and 1996, which corresponds to a committed effective dose equivalent for humans of 1.1-0.50 microSv for {sup 137}Cs. For {sup 90}Sr during the 1991-1996 period the country-wide mean varied between 0.08 and 0.06 Bq/l, resulting in a committed effective dose equivalent of 0.4-0.3 microSv. 7 refs.
Mainstreaming gender equality in the sustainable development process: 1992-1996.
1997-01-01
One of the major contributions of Economic Commission for Africa (ECA) in the mainstreaming of gender equality into a sustainable development process was organizing the 5th African Regional Conference on Women in November 1994, in which a comprehensive policy document was formulated and adopted by all African governments. The policy contained in a document entitled the African Platform for Action (APA), which promotes the advancement of women through sustainable development. Its recommendations are being implemented together with the Global Platform for Action (GPA). To ensure the implementation of APA and GPA, ECA has set up various monitoring and implementation-coordinating groups such as the African Regional Coordinating Committee and the African Women's Communications and Development Network. In addition, ECA also facilitated the creation of the African Women Committee for Peace in November 1996, which will ensure the participation of women in the peace process at the highest level. All work programs of the ECA are expected to mainstream gender in their plans and activities.
International Nuclear Information System (INIS)
Perkins, C.J.
1997-01-01
On September 9, 1992, the US Environmental Protection Agency (EPA) issued General Permit No. WA-R-00-OOOF, Authorization to Discharge Under the National Pollutant Discharge Elimination System (NPDES) for Storm Water Discharges Associated with Industrial Activity to the US Department of Energy, Richland Operations Office (RL). RL submitted a Notice of Intent to comply with this permit to EPA in conformance with the General Permit requirements on October 1, 1992. On February 14, 1994, EPA issued a Storm Water General Permit Coverage Notice and assigned WA-R-00-Al7F as the Hanford Site's National Pollutant Discharge Elimination System (NPDES) storm water permit number. The Hanford Site Storm Water Pollution Prevention Plan (SWPPP) (WHC 1996a) was certified by J. E Rasmussen, Director Environmental Assurance, RL, on September 24, 1996, in compliance with Part IV.B(i) of the General Permit. As required by General Permit No. WA-R-00-OOOF (WA-R-00-Al7F), Section IV, Part D, Section 4.c, an annual report must be developed by RL and retained on site to verify that the requirements listed in the General Permit are being implemented. The previous Hanford Site Storm Plater Comprehensive Site Compliance Evaluation Report (WHC 1996b) addressed the period from July 1995 through June 1996. This document fulfills the requirement to prepare an annual report and contains the results of inspections of the storm water outfalls listed in the SWPPP (WHC 1996a). This report also describes the methods used to conduct the 1100 Storm Plater Comprehensive Site Compliance Evaluation (SWCSCE) as required in Part IV, Section D.4.c in the General Permit; summarizes the results of the compliance evaluation; and documents significant leaks and spills. The reporting year for this SWCSCE report is July 1, 1996 through June 30, 1997
International Nuclear Information System (INIS)
1996-06-01
The text of the Agreement (and protocol thereof) between Saint Kitts and Nevis and the International Atomic Energy Agency for the application of safeguards in connection with the Treaty on the Non-Proliferation of Nuclear Weapons is reproduced in this document for the information of all Members. The Agreement was approved by the Agency's Board of Governors on 12 September 1994 and signed in Vienna on 10 July 1995 and in Basseterre on 7 May 1996. The Agreement entered into force, pursuant to Article 24, on 7 May 1996. The Protocol entered into force on the same day, pursuant to Article II
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-06-01
The text of the Agreement (and protocol thereof) between Saint Kitts and Nevis and the International Atomic Energy Agency for the application of safeguards in connection with the Treaty on the Non-Proliferation of Nuclear Weapons is reproduced in this document for the information of all Members. The Agreement was approved by the Agency`s Board of Governors on 12 September 1994 and signed in Vienna on 10 July 1995 and in Basseterre on 7 May 1996. The Agreement entered into force, pursuant to Article 24, on 7 May 1996. The Protocol entered into force on the same day, pursuant to Article II.
Slining, M M; Popkin, B M
2013-08-01
There are increasing global concerns about improving the dietary intakes of children and adolescents. In the United States (U.S.), the focus is on reducing energy from foods and beverages that provide empty calories from solid fats and added sugars (SoFAS). We examine trends in intakes and sources of solid fat and added sugars among U.S. 2-18 year olds from 1994 to 2010. Data from five nationally representative surveys, the Continuing Survey of Food Intakes by Individuals Surveys (1994-1996) and the What We Eat In America, National Health and Nutrition Examination Surveys (2003-2004, 2005-2006, 2007-2008 and 2009-2010) were used to examine key food sources and energy from solid fats and added sugars. Sample sizes ranged from 2594 to 8259 per survey period, for a total of 17 268 observations across the five surveys. Food files were linked over time to create comparable food groups and nutrient values. Differences were examined by age, race/ethnicity and family income. Daily intake of energy from SoFAS among U.S. 2-18 year olds decreased from 1994 to 2010, with declines primarily detected in the recent time periods. Solid fats accounted for a greater proportion of total energy intake than did added sugars. Although the consumption of solid fats and added sugars among children and adolescents in the U.S. decreased between 1994-1998 and 2009-2010, mean intakes continue to exceed recommended limits. © 2013 The Authors. Pediatric Obesity © 2013 International Association for the Study of Obesity.
Detection of leaks in underground storage tanks using electrical resistance methods: 1996 results
International Nuclear Information System (INIS)
Ramirez, A.; Daily, W.
1996-10-01
This document provides a summary of a field experiment performed under a 15m diameter steel tank mockup located at the Hanford Reservation, Washington. The purpose of this test was to image a contaminant plume as it develops in soil under a tank already contaminated by previous leakage and to determine whether contaminant plumes can be detected without the benefit of background data. Measurements of electrical resistance were made before and during a salt water release. These measurements were made in soil which contained the remnants of salt water plumes released during previous tests in 1994 and in 1995. About 11,150 liters of saline solution were released along a portion of the tank's edge in 1996. Changes in electrical resistivity due to release of salt water conducted in 1996 were determined in two ways: (1) changes relative to the 1996 pre-spill data, and (2) changes relative to data collected near the middle of the 1996 spill after the release flow rate was increased. In both cases, the observed resistivity changes show clearly defined anomalies caused by the salt water release. These results indicate that when a plume develops over an existing plume and in a geologic environment similar to the test site environment, the resulting resistivity changes are easily detectable. Three dimensional tomographs of the resistivity of the soil under the tank show that the salt water release caused a region of low soil resistivity which can be observed directly without the benefit of comparing the tomograph to tomographs or data collected before the spill started. This means that it may be possible to infer the presence of pre-existing plumes if there is other data showing that the regions of low resistivity are correlated with the presence of contaminated soil. However, this approach does not appear reliable in defining the total extent of the plume due to the confounding effect that natural heterogeneity has on our ability to define the margins of the anomaly
International Nuclear Information System (INIS)
Snihs, J.O.; Johansson, Mai; Grapengiesser, S.; Bennerstedt, T.
1996-04-01
Until now the Swedish program for radiation protection work in central and Eastern europe has been granted 55 MSEK by the Swedish government. The projects are assessed, planned and performed in close cooperation with partner organizations in the East. Since 1994, radiation protection cooperation concerning the former Soviet Navy training reactors in Paldiski, Estonia, is included in Radiation Protection East. The government has granted 8 MSEK for this purpose. This report presents a summary over some 150 projects, their status, allocated funds and their distribution over countries and project areas. The presentation is updated up to March 1996. 7 figs
LA GOBERNABILIDAD SOCIALISTA DE LOS ESPACIOS LITORALES: EL CASO DE CIUDAD DE LA HABANA, CUBA
Directory of Open Access Journals (Sweden)
José Manuel Mateo Rodriguez
2009-12-01
Full Text Available La irrupción, a partir de comienzos de la década de los años 1960 de un proyecto socialista en Cuba, constituyó un cambio radical en la forma de gobernar las sociedades en el hemisferio occidental. Por primera vez en América Latina, un país se proponía cambiar de manera estructural los fundamentos de organización de la sociedad capitalista, y construir un proyecto de sociedad basada en el socialismo. El presente artículo, pretende exponer como se han llevado a cabo los cambios en la organización de los espacios litorales de Ciudad de La Habana, en la construcción del estilo socialista de desarrollo. Pretende en particular reflexionar sobre los desafíos, que en los inicios del siglo XXI enfrenta la sociedad cubana, para pasar a la conquista de la sostenibilidad, como fundamento para hacer más eficiente y duradera la gobernabilidad. Al final se ha realizado una síntesis de los problemas ambientales y las posibles soluciones, vinculada a un abordaje integrado con la dinámica litoral y las distintas formas de utilización. Las sugerencias acciones a medio y largo plazo, incluso con ejemplos de acciones ya desarrolladas en otros tramos del litoral cubano.
UNFINISHED JOURNEY Project. Quarterly report, September 1994--December 1994
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-02-01
In September, 1994, the U.S. Department of Energy (Nevada Operations Office) made a $199,708 grant (through the Mathematics, Science, and Technology Education Program), to the UNFINISHED JOURNEY Project. The Project began in April, 1994, to develop and implement an innovative model of student outreach by San Jose State University (SJSU) to underserved, underrepresented student populations of the East Side Union High School District (ESUHSD). The Project was formed by a consortium involving SJSU, ESUHSD, some 20 private sector organizations (foundations/corporations), numerous local community/professional organizations, and approximately 100 private funders. This proposal to the U.S. Department of Energy was to have the Department join this unique partnership to focus University outreach to underserved student populations to pursue careers in mathematics, science, and technology.
Escobar, Arturo; Regueiro, Olga Sanchez
2002-01-01
The presence of aflatoxin B1 was analyzed in imported food and feedstuffs of national production in the period of 1990 through 1996, destined to animal and human consumption using an immunoenzymatic reagent kit (Aflacen, Ckure, la Habana, Cuba) with a detection limit of 0.3 microg/kg. It was found that the 17.04% of a total of 4,594 analyzed samples presented aflatoxin B1, and the biggest percentages were in sorghum and peanut with an 83.3 and 40.4%, respectively. The corn, oat, wheat, and soy are fundamental raw ingredients in the elaboration of concentrates. Percentages of contamination with aflatoxin B1 of 23.3, 10.7, 25, and 4.6 were found in corn, oat, wheat, and soy, respectively. Other analyzed foods like rice, beans, and peas presented percentages of contamination with aflatoxin B1 inferior to 5% of the analyzed samples. It was found that more than 455 samples surpassed the value of 10 microg/kg. Corn and peanut products present a high demand in population showing levels of contamination superior to 50 microg/kg. The 11.3% of the samples contaminated with aflatoxin B1 have values between 1 and 20 microg/kg, where peanut and concentrates show the highest percentages (21.9 and 18.7), respectively. These results show levels of aflatoxin B1 in the population that constitute a great risk for human and animal health.
2007-06-01
DefenceInternet/Defence- News/MilitaryOperations/SpecialForcesSupportGroupFormsInWales. htm. 60. Victor Alonso, “GAL, terrorismo de estado ” (GAL, terrorism of...Guerrilla Movement,” El Financiero , 18 Novem- ber 1994, as translated in FBIS-LAT-94-226, pp. 12-13 c. Orlando Ortíz, Genaro Vázquez, 3rd ed. (Mexico City...Backgrounder No. 660, 5 July 1988 b. Tomás Tenorio Galinda, “Una vieja visión de la guerrilla” c. “The Announced Guerrilla Movement,” El Financiero 97
Directory of Open Access Journals (Sweden)
Liuba Alonso Carbonell
2010-09-01
Full Text Available El cambio de propelente en la formulación del salbutamol spray por uno protector de la capa de ozono requiere de evidencias que justifiquen su aceptabilidad en la población expuesta a este. En tal sentido se realizó un estudio en Ciudad de La Habana con el propósito de evaluar y comparar la aceptabilidad del producto ventolin con propelente ecológico y el salbutamol spray de producción nacional, posterior a una intervención educativa. Los 841 pacientes incluidos fueron distribuidos entre los municipios de forma proporcional al número de inscriptos para salbutamol spray en cada uno (ponderación municipal de acuerdo con el número de inscriptos. La selección de los pacientes se realizó por conveniencia del total de inscritos en cada farmacia principal municipal. La mayor parte de los encuestados coincide en que el tamaño, la forma del envase y la boquilla son adecuados. El sabor del producto fue considerado agradable discretamente superior en los que emplearon el salbutamol, mientras que la presentación en general fue más aceptada en el caso del ventolin. El control de los síntomas fue similar para ambos grupos. No existieron diferencias marcadas en la aceptabilidad de ambos productos farmacéuticos, a pesar de esto se encontró una aceptabilidad discretamente superior en el caso del ventolin. Estos resultados respaldan la introducción del propelente tetrafluoretano, específicamente el HFC 134, en la fabricación del salbutamol spray dado que el nivel de aceptabilidad del producto ventolin con este propelente ecológico es similar al encontrado para el salbutamol spray producido y comercializado actualmente en Cuba.The change of propellant in spray Salbutamol formula by other of the ozone layer requires of evidences justifying its acceptability in population exposed to it. The aim of present study in Ciudad de La Habana was to assess and to compare the acceptability of Ventolin as an ecological propellant and the Cuban spray
Energy Technology Data Exchange (ETDEWEB)
Aziz, K Jahja; Nurdin, Efendi; Safei, Purnama; Arie, Widowati [BATAN, Jakarta (Indonesia); Virginia, S Calix; Marsongkohadi,
1998-10-01
Beginning in 1994, a total of 3 (three) workshops (`The Utilization of Research Reactors-Neutron Scattering`) have been held yearly in Jakarta. Back in December 1994, a joint research collaboration on the subject of superionic conductors between PNRI and BATAN was proposed and approved by the steering committee. The two principal scientists were V.S. Calix (PNRI) and AK Jahja (BATAN). The general arrangement was that PNRI is responsible for the sample preparation and the preliminary studies on the samples` physical properties (e.g., x-ray studies, DSC thermal measurements and frequency -dependent resistivity studies), whereas BATAN is responsible for structural studies using HRPD neutron diffraction measurements. For the period of December 1994 - December 1995, the superionic samples were the single phase {beta}`-alumina and the double phase {beta},{beta}-alumina (K{sub 1+x}Fe{sub 11}O{sub 17}). Neutron diffraction measurements were supposed to be taken at room- and elevated temperatures. For the period of November 1996 - November 1997, new compounds have been proposed, in this case it is the non-stoichiometric Cu-based Rubidium Copper Iodide Chloride compounds, again the distribution of responsibility/workload stays the same as previously agreed to by BATAN and PNRI. The full report and results of this cooperation is presented. Activities covered so far at both laboratories are outlined. Although the high temperature neutron scattering measurements have not been completed, a further cooperation involving the preparation and neutron scattering measurements of materials in thin-film and single crystalline morphology is proposed. (author)
[Ontario Hydro]. 1994 corporate budget and 1994--1996 business plan
International Nuclear Information System (INIS)
1994-01-01
Ontario Hydro's Corporate mission is to make Ontario Hydro a leader in energy efficiency and sustainable development, and to provide its customers with safe and reliable energy services at competitive prices. This document summarizes the Corporation's work and financial results planned for the previous year and forecast for the two following years. It represents a consolidation of business plans prepared by the various Business Units
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-12-01
This report presents the activities and accomplishments of the Philippine Nuclear Research Institute (PNRI) for fiscal year 1994. The highlights of the report are the following: (a) technology transfer and commercialization; (b) nuclear services; (c) research and development focusing S and T efforts towards Philippines 2000; (d) special S and T events; (e) nuclear safety and regulations on ensuring safety of the public and the environment; (f) manpower development on expanding nuclear capability; (g) enhancing local and foreign linkages; (h) and administrative services. List of 1994 IAEA research contracts, experts/missions, foreign travel of PNRI and non-PNRI personnel, and technical papers are also included in this report.
International Nuclear Information System (INIS)
1995-01-01
This report presents the activities and accomplishments of the Philippine Nuclear Research Institute (PNRI) for fiscal year 1994. The highlights of the report are the following: a) technology transfer and commercialization; b) nuclear services; c) research and development focusing S and T efforts towards Philippines 2000; d) special S and T events; e) nuclear safety and regulations on ensuring safety of the public and the environment; f) manpower development on expanding nuclear capability; g) enhancing local and foreign linkages; h) and administrative services. List of 1994 IAEA research contracts, experts/missions, foreign travel of PNRI and non-PNRI personnel, and technical papers are also included in this report
Strategic Performance Options in Professional Service Organizations
Doorewaard, J.A.C.M.; Meihuizen, H.E.
2000-01-01
In the current debate on HRM and organisational performance (Mahoney and Pandian, 1992; Storey, 1992; Paauwe, 1994; Wright et al, 1994; Flood et al, 1995; Becker and Gerhardt, 1996; Boxall, 1996; Mueller, 1996; Beatty and Schneider, 1997; Coff, 1997; Guest, 1997; Paauwe and Richardson, 1997; Boxall
Energy Technology Data Exchange (ETDEWEB)
1994-09-01
This report describes the research conducted in the High Energy Physics Division of Argonne National Laboratory during the period of January 1, 1994-June 30, 1994. Topics covered here include experimental and theoretical particle physics, advanced accelerator physics, detector development, and experimental facilities research. Lists of division publications and colloquia are included.
International Nuclear Information System (INIS)
1994-09-01
This report describes the research conducted in the High Energy Physics Division of Argonne National Laboratory during the period of January 1, 1994-June 30, 1994. Topics covered here include experimental and theoretical particle physics, advanced accelerator physics, detector development, and experimental facilities research. Lists of division publications and colloquia are included
International Nuclear Information System (INIS)
Wagner, R.; Schoessow, P.; Talaga, R.
1995-04-01
This report describes the research conducted in the High Energy Physics Division of Argonne National Laboratory during the period of July 1, 1994--December 31, 1994. Topics covered here include experimental and theoretical particle physics, advanced accelerator physics, detector development, and experimental facilities research. Lists of division publications and colloquia are included
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-05-01
This is the annual report of the Swedish Nuclear Fuel and Waste Management Co (SKB). Part 1 of the report contains an overview of the SKB activities in different fields, and part 2 gives a description of the research and development work on nuclear waste disposal performed during 1996. Lectures and publications as well as reports issued during 1996 are listed in part 3, and summaries of the reports are listed in part 4. The task of SKB is to transport, store and dispose of the spent nuclear fuel and radioactive wastes from the nuclear power plants and to perform the research and development and other measures necessary for this work. SKB is the owner of CLAB, the Central Interim Storage Facility for spent fuel, located at Oskarshamn. CLAB was taken into operation in July 1985 and by the end of 1996 about 2500 tons of spent fuel have been received. At Forsmark the Final Repository for Radioactive Operational Waste (SFR) was taken into operation in April 1988. The repository is situated in crystalline rock under the Baltic Sea. SFR has currently a capacity of about 60000 m{sup 3} or waste. At the end of 1996 at total of 21000 m{sup 3} of waste has been deposited. Transportation from the reactor sites to CLAB and SFR is made by a specially designed ship, M/S Sigyn. The total cost for R,D and D during 1996 amounted to 124 MSEK (about 15 MUSD).
International Nuclear Information System (INIS)
1997-05-01
This is the annual report of the Swedish Nuclear Fuel and Waste Management Co (SKB). Part 1 of the report contains an overview of the SKB activities in different fields, and part 2 gives a description of the research and development work on nuclear waste disposal performed during 1996. Lectures and publications as well as reports issued during 1996 are listed in part 3, and summaries of the reports are listed in part 4. The task of SKB is to transport, store and dispose of the spent nuclear fuel and radioactive wastes from the nuclear power plants and to perform the research and development and other measures necessary for this work. SKB is the owner of CLAB, the Central Interim Storage Facility for spent fuel, located at Oskarshamn. CLAB was taken into operation in July 1985 and by the end of 1996 about 2500 tons of spent fuel have been received. At Forsmark the Final Repository for Radioactive Operational Waste (SFR) was taken into operation in April 1988. The repository is situated in crystalline rock under the Baltic Sea. SFR has currently a capacity of about 60000 m 3 or waste. At the end of 1996 at total of 21000 m 3 of waste has been deposited. Transportation from the reactor sites to CLAB and SFR is made by a specially designed ship, M/S Sigyn. The total cost for R,D and D during 1996 amounted to 124 MSEK (about 15 MUSD)
ITER council proceedings: 1996
International Nuclear Information System (INIS)
1997-01-01
Records of the 10. ITER Council Meeting (IC-10), held on 26-27 July 1996, in St. Petersburg, Russia, and the 11. ITER Council Meeting (IC-11) held on 17-18 December 1996, in Tokyo, Japan, are presented, giving essential information on the evolution of the ITER Engineering Design Activities (EDA) and the cost review and safety analysis. Figs, tabs
International Nuclear Information System (INIS)
1996-06-01
The text of the Agreement (and the Protocol thereof) between the Government of the Commonwealth of Dominica and the International Atomic Energy Agency for the application of safeguards in connection with the Treaty on the Non-Proliferation of Nuclear Weapons is reproduced in this document for the information of all Members. The Agreement was approved by the Agency's Board of Governors on 12 September 1994 and signed in Vienna on 10 July 1995 and in Roseau, Dominica on 3 May 1996. The Agreement entered into force, pursuant to Article 24, on 3 May 1996. The Protocol entered into force on the same day, pursuant to Article II
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-06-01
The text of the Agreement (and the Protocol thereof) between the Government of the Commonwealth of Dominica and the International Atomic Energy Agency for the application of safeguards in connection with the Treaty on the Non-Proliferation of Nuclear Weapons is reproduced in this document for the information of all Members. The Agreement was approved by the Agency`s Board of Governors on 12 September 1994 and signed in Vienna on 10 July 1995 and in Roseau, Dominica on 3 May 1996. The Agreement entered into force, pursuant to Article 24, on 3 May 1996. The Protocol entered into force on the same day, pursuant to Article II.
International Nuclear Information System (INIS)
1996-01-01
Six charts are presented and discussed concerning energy utilization in France during the 1970-1996 period: national energy bill, energy intensity ratios, imported crude oil costs, energy-induced carbon dioxide emissions, operating ability ratios of EDF nuclear plants, France's energy independence ratios. 1996 has seen an strong increase (+31%) in the energy bill, reaching 77 billions Francs, combining an increase in energy consumption and dollar exchange rate and a decline in energy conservation; carbon dioxide emission are taking up again after a strong decrease in the 80's
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-10-01
This report presents the activities and accomplishments of the Philippine Nuclear Research Institute (PNRI) for the calendar year 1996. The highlights of the accomplishment is about the nuclear and allied services, research development, nuclear safety and regulations, and the general administration and linkages. Also, the special S and T events especially the holding of the 2nd Philippine Nuclear Congress with Dr. Hans Blix, Director General of the IAEA, as the keynote speaker; and the celebration of the 100th year of discovery of radioactivity (1896-1996) are included in this report.
International Nuclear Information System (INIS)
1997-01-01
This report presents the activities and accomplishments of the Philippine Nuclear Research Institute (PNRI) for the calendar year 1996. The highlights of the accomplishment is about the nuclear and allied services, research development, nuclear safety and regulations, and the general administration and linkages. Also, the special S and T events especially the holding of the 2nd Philippine Nuclear Congress with Dr. Hans Blix, Director General of the IAEA, as the keynote speaker; and the celebration of the 100th year of discovery of radioactivity (1896-1996) are included in this report
Monthly energy review: September 1996
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-09-01
Energy production during June 1996 totaled 5.6 quadrillion Btu, a 0.5% decrease from the level of production during June 1995. Energy consumption during June 1996 totaled 7.1 quadrillion Btu, 2.7% above the level of consumption during June 1995. Net imports of energy during June 1996 totaled 1.6 quadrillion Btu, 4.5% above the level of net imports 1 year earlier. Statistics are presented on the following topics: energy consumption, petroleum, natural gas, oil and gas resource development, coal, electricity, nuclear energy, energy prices, and international energy. 37 figs., 59 tabs.
Directory of Open Access Journals (Sweden)
René Villaboy Zaldivar
2015-01-01
Full Text Available A propósito de que la República del Ecuador fuera el país invitado de honor a la XXIII Feria Internacional del Libro de la Habana, numerosas ediciones relacionadas con la literatura, el arte, la historia, la política y, en general, sobre la rica cultura del país andino vieron la luz en febrero de 2014. A una de ellas dedico este comentario. Se trata de Eloy Alfaro y Cuba en el siglo XIX, del historiador ecuatoriano Germán Rodas Chaves, publicada con excelente factura dentro de la colección investigaciones del Fondo Editorial de la Casa de las Américas.
National Research Council Canada - National Science Library
Merrill, Lex
1997-01-01
... only), a higher age at first intercourse (for males only) and fewer different sexual partners. The 1994 female recruits report a nonsignificantly higher percentage of total contact childhood sexual abuse...
Orloff, S L; Bulterys, M; Vink, P; Nesheim, S; Abrams, E J; Schoenbaum, E; Palumbo, P; Steketee, R W; Simonds, R J
2001-09-01
To evaluate implementation of 1994 United States Public Health Service guidelines for zidovudine (ZDV) use in HIV-infected women and their newborns by describing the prevalence of use of perinatal ZDV and other antiretrovirals and by investigating determinants of not receiving perinatal ZDV. The Perinatal AIDS Collaborative Transmission Study is a prospective cohort study designed to collect information related to mother-to-child HIV transmission that was conducted in New York City (NY), Newark (NJ), Baltimore (MD), and Atlanta (GA), U.S.A. The current analysis was restricted to infants born between July 1994 and June 1998. Utilization rates for antenatal, intrapartum, and neonatal ZDV increased from 41% to 70% during the 4-year period. Use of combination antiretrovirals increased from fewer than 2% of women in 1994 to 1995 to 35% in 1997 to 1998. Antenatal and neonatal ZDV use increased each year, but intrapartum ZDV use reached a plateau after 1996. Mother-infant pairs with the following characteristics were less likely to have received a complete 3-part ZDV regimen: older maternal age, CD4 count >500 cells/microl, preterm birth, cocaine or heroin use during pregnancy, positive newborn drug screen test result, and smoking or alcohol use during pregnancy. By multivariate logistic regression adjusted for hospital and year of birth, cocaine or heroin use during pregnancy (odds ratio [OR], 2.3; 95% confidence interval [CI], 1.6-3.3), maternal CD4 count (OR, 0.4; 95% CI, 0.2-0.8; comparing 500 cells/microl), and preterm birth (OR, 1.6; 95% CI, 1.1-2.5) remained independently associated with not receiving the complete ZDV regimen. ZDV use by pregnant HIV-infected women and their infants has increased dramatically since publication of the 1994 guidelines. Nevertheless, women who abuse substances, give birth preterm, or have less advanced immunosuppression, were at substantial risk of not receiving the complete ZDV regimen.
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-09-30
In April 1994, the Department of Energy (DOE) Strategic Plan was issued. This Plan presents the Department`s strategic outlook in response to a changing world. It discusses the Department`s unique capabilities; its mission, vision, and core values; and key customer and stakeholder considerations. The DOE Strategic Plan lists business strategies and critical success factors which are intended to aid the Department in accomplishing its mission and reaching its vision of itself in the future. The Office of Inspector General (OIG) has an important role in carrying out the goals and objectives of the Secretary`s Strategic Plan. The ultimate goal of the OIG is to facilitate positive change by assisting its customers, responsible Government officials, in taking actions to improve programs and operations. The Inspector General annually issues his own Strategic Plan that contains program guidance for the next fiscal year. As part of its responsibility in carrying out the OIG mission, the Office of the Deputy Inspector General for Audit Services (Office of Audit Services) publishes an Annual Work Plan that sets forth audits that are planned for the next fiscal year. Selection of these audits is based on the overall budget of the Department, analyses of trends in Departmental operations, guidance contained in the agency`s strategic plans, statutory requirements, and the expressed needs and audit suggestions of Departmental program managers and OIG managers and staff. This work plan includes audits that are carried over from FY 1995 and audits scheduled to start during FY 1996. Audits included in the plan will be performed by OIG staff.
1994 Site Environmental Report
International Nuclear Information System (INIS)
1995-05-01
The 1994 Site Environmental Report summarizes environmental activities at Lawrence Berkeley Laboratory (LBL) for the calendar year (CY) 1994. The report strives to present environmental data in a manner that characterizes the performance and compliance status of the Laboratory's environmental management programs when measured against regulatory standards and DOE requirements. The report also discusses significant highlight and planning efforts of these programs. The format and content of the report are consistent with the requirements of the US Department of Energy (DOE) Order 5400.1, General Environmental Protection Program
1994 Site Environmental Report
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-05-01
The 1994 Site Environmental Report summarizes environmental activities at Lawrence Berkeley Laboratory (LBL) for the calendar year (CY) 1994. The report strives to present environmental data in a manner that characterizes the performance and compliance status of the Laboratory`s environmental management programs when measured against regulatory standards and DOE requirements. The report also discusses significant highlight and planning efforts of these programs. The format and content of the report are consistent with the requirements of the US Department of Energy (DOE) Order 5400.1, General Environmental Protection Program.
Environmental radioactivity 1996
International Nuclear Information System (INIS)
1997-01-01
Environmental Radioactivity in New Zealand and Rarotonga : annual report 1996 was published in May this year. The 1996 environmental radioactivity monitoring programme included, as usual, measurements in New Zealand and the Cook Islands of atmospheric, deposited and dairy product radioactivity. The environment in the New Zealand and Cook Island regions has now virtually returned to the situation in the 'pre-nuclear' era. The contination of monitoring, although at a reduced level of intensity, is basically to ensure that any change from the present state, due to any source of radioactivity does not go undetected or unquestioned. (author)
Comportamiento de la retinopatía de la prematuridad en la provincia La Habana
Directory of Open Access Journals (Sweden)
Olga Lidia Baños Carmona
Full Text Available Objetivo: evaluar el comportamiento de la retinopatía de la prematuridad en los nacidos con menos de 1 750 g o menos de 35 semanas de gestación. Métodos: se realizó un estudio retrospectivo, observacional, descriptivo en el período comprendido de enero de 2005 a septiembre de 2010, en los servicios de neonatología de la provincia La Habana. Se estudió el total de recién nacidos vivos (207 con menos de 35 semanas de edad gestacional y un peso inferior a 1 750 g al nacer ingresados en las unidades de cuidados intensivos neonatales de este territorio. Resultados: el 42,8 % correspondió con los nacidos entre las semanas 33 y 34,6, y un 42,8 % con un peso entre 1 250 y 1 499 g. El 89,8 % de los recién nacidos presentaron una retina inmadura y un 10,1 % desarrolló retinopatía de la prematuridad. El 88,8 % de los tratados con láser evolucionaron favorablemente. Conclusiones: la retinopatía de la prematuridad ha disminuido en los últimos años a pesar de que existe un incremento en el bajo peso al nacer y prematurez. La edad gestacional menor de 34,6 semanas, el peso al nacer menor de 1 500 g y el síndrome de dificultad respiratoria fueron los factores más importante en la aparición de la retinopatía. Con el diagnóstico precoz de la enfermedad se trató oportunamente, logrando disminuir las secuelas y mejoría de la calidad de vida.
Natural gas annual 1994: Volume 2
International Nuclear Information System (INIS)
1995-11-01
The Natural Gas Annual provides information on the supply and disposition of natural gas to a wide audience including industry, consumers, Federal and State agencies, and educational institutions. This report, Volume 2, presents historical data fro the Nation from 1930 to 1994, and by State from 1967 to 1994
Natural gas annual 1994: Volume 2
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-11-01
The Natural Gas Annual provides information on the supply and disposition of natural gas to a wide audience including industry, consumers, Federal and State agencies, and educational institutions. This report, Volume 2, presents historical data fro the Nation from 1930 to 1994, and by State from 1967 to 1994.
Energy Technology Data Exchange (ETDEWEB)
Zondlo, J.; Stiller, A.
1996-10-25
This quarterly report covers activities during the period from July 1, 1996 through September 30, 1996 on the development of carbon products precursor materials from coal. The first year of the project ended in February, 1996; however, the WVU research effort continued through August 14, 1997 on a no-cost extension of the original contract. PETC chose to exercise the option for continuation of the projects and $100,000 became available on August 9, 1996. The objective for year two is to focus on development of those carbon products from coal-based solvent extract precursors which have the greatest possibility for commercial success.
Directory of Open Access Journals (Sweden)
Fidel Angel Núñez
1997-01-01
Full Text Available Se realizó un estudio sobre la calidad del diagnóstico coproparasitológico en 77 laboratorios de la red de salud pública de la provincia Ciudad de La Habana, Cuba. El procedimiento se basó en la entrega a cada jefe de laboratorio de un modelo de encuesta, y una bolsa de nylon conteniendo 10 viales plásticos con distintos especímenes parasitarios, preservados en formaldehído al 7%. Recogidos los resultados en las primeras 72 horas después de su entrega, se realizó la evaluación mediante una escala de puntuación establecida. La mayoría de los laboratorios aprobaron (70%; sin embargo aún existen centros, sobre todo policlínicas, con calificaciones deficientes. Los municipios con resultados más desfavorables fueron, Lisa, Marianao y Habana del Este, alcanzándose mejores resultados en los hospitales que en las policlínicas. En el análisis de Protozooarios, el mejor diagnosticado fué Giardia lamblia, con solo un centro que erró al identificarlo. Las mayores dificultades se presentaron en Blastocystis hominis con 61% de fallas, Endolimax nana, con 24,6%, y Entamoeba histolytica, con 22%. Entre los helmintos, la mayor aprobación fué en Trichuris trichiura y los errores diagnósticos predominaron con Fasciola hepatica y Taenia sp., ambos con 66,2% de fallas. Dados los resultados obtenidos, hemos organizado una intervención educativa en la red de laboratorios de la provincia.An external quality assessment in coproparasitology was carried out in 77 laboratories from Havana City. A questionnaire and ten plastic vials with different intestinal parasites in a small nylon bag, duly sealed, were sent to each laboratory. Answers were collected during the 72 hours after delivery. Results were analyzed by means of a computer program. The majority of the laboratories (70% passed the test; the municipalities with the worst scores in the province were Lisa, Marianao, and Habana del Este. Better results were obtained among technologists working
Household vehicles energy consumption 1994
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-08-01
Household Vehicles Energy Consumption 1994 reports on the results of the 1994 Residential Transportation Energy Consumption Survey (RTECS). The RTECS is a national sample survey that has been conducted every 3 years since 1985. For the 1994 survey, more than 3,000 households that own or use some 6,000 vehicles provided information to describe vehicle stock, vehicle-miles traveled, energy end-use consumption, and energy expenditures for personal vehicles. The survey results represent the characteristics of the 84.9 million households that used or had access to vehicles in 1994 nationwide. (An additional 12 million households neither owned or had access to vehicles during the survey year.) To be included in then RTECS survey, vehicles must be either owned or used by household members on a regular basis for personal transportation, or owned by a company rather than a household, but kept at home, regularly available for the use of household members. Most vehicles included in the RTECS are classified as {open_quotes}light-duty vehicles{close_quotes} (weighing less than 8,500 pounds). However, the RTECS also includes a very small number of {open_quotes}other{close_quotes} vehicles, such as motor homes and larger trucks that are available for personal use.
1996: Disarmament at a critical juncture
International Nuclear Information System (INIS)
1997-01-01
The document contains edited transcript of the presentations made by Joseph Rotblat, winner of the Nobel Prize, and by Minoru Ohmuta and Hidehiko Yoko-o, speaking for the Mayors of Hiroshima and Nagasaki, at the United Nations on 25 April 1996, excerpts from the panel discussion on South Asia at a Critical Turning Point held on 24 September 1996, and extensive excerpts from the panel discussions held 22-24 October 1996 during Disarmament Week at the United Nations
Bathymetry for Louisiana, Geographic NAD83, LOSCO (1994) [bathymetry_NOAA_1994
Louisiana Geographic Information Center — This is a line data depicting the offshore bathymetry_NOAA_1994 for Louisiana. The contour interval is 2 meters. These data were derived from point depths depicted...
International Nuclear Information System (INIS)
Klett, D.E.; Hogan, R.E.; Tanaka, Tadayoshi
1994-01-01
This volume of 83 papers constitutes the Proceedings of the 1994 International Solar Energy Conference held March 27--30, 1994 in San Francisco, California. The Conference was jointly sponsored by the Solar Energy Division of the American Society of Mechanical Engineers, The Japan Society of Mechanical Engineers and the Japan Solar Energy Society. This is the fourth cooperation between ASME, JSME and JSES in cosponsoring the International Solar Energy Conference. The papers cover a wide range of solar technologies from low temperature solar ponds and desalinization to high temperature concentrators for space applications and central receivers for terrestrial power generation. Other topics covered include solar detoxification of hazardous waste, dish Stirling systems, solar cooling, photovoltaics, building energy analysis and conservation, simulation, and testing and measurement techniques. All papers were indexed separately for the data base
Eesti proosa 1996 : midagi olulist : [katkend] / Udo Uibo
Uibo, Udo, 1956-
2009-01-01
Katkend Udo Uibo artiklist "Eesti proosa 1996 : midagi olulist". Katkendis vaadeldakse Jüri Ehlvesti romaani "Ikka veel Bagdadis" (Tartu : EÜS Veljesto kirjastus, 1996) ja novellikogu "Krutsiaania" (Tallinn : Tuum, 1996)
Activities of the wintering party of the 36th Japanese Antarctic Research Expedition, 1995-1996
Directory of Open Access Journals (Sweden)
Shigemi Meshida
1997-11-01
Full Text Available The wintering party of the 36th Japanese Antarctic Research Expedition (JARE-36 executed its planned activities at Syowa and Dome Fuji Stations from 1995 to 1996. The wintering party at Syowa Station, consisting of 31 personnel, carried out its observations and logistic work from February 1,1995 to January 31,1996. Routine and some specific observations for studies of upper atmosphere physics, meteorology, solid earth geophysics, biology and medical science were performed without any serious problems for a full year. Continuous observation of the magnetosphere had started using an HF radar system constructed during the austral summer of 1994/95. A seed plant was discovered near Nurume Lake, Langhovde. It was the first report of a seed plant growing in continental Antarctica. An architect took part in the wintering party for the first time and maintained decrepit buildings. Support work for the wintering party at Dome Fuji Station was one of the principal tasks at Syowa Station. A trip to the Dome Fuji Station was carried out to transport supplies and fuel in the austral spring of 1995. The first wintering activities at Dome Fuji Station started from January 29,1995. The wintering party, consisting of 9 personnel, carried out meteorological and glaciological observations together with deep ice core drilling and some construction work. Consequently, ice cores of 600m depth were obtained successfully.
Institute of Nuclear Chemistry and Technology annual report 1994
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-12-31
This annual report is a collection of short communications being a review of scientific activity of the Institute of Nuclear Chemistry and Technology, Warsaw, Poland in 1994. The papers are gathered into several branches as follows: radiation chemistry and physics (16 papers); radiochemistry, stable isotopes, nuclear analytical methods, chemistry in general (17 papers); radiobiology (6 papers); nuclear technologies and methods (30 papers). The annual report of INCT-1994 contains also a general information about the Institute, the full list of papers published in 1994, information about Nukleonika - the International Journal of Nuclear Research being edited in INCT, the list of patent granted and patent applications in 1994, information about conferences organized by the Institute, the list of Ph.D. and D.Sc. finished in 1994 as well as the list of research projects and contracts being realized in INCT during 1994.
Institute of Nuclear Chemistry and Technology annual report 1994
International Nuclear Information System (INIS)
1995-01-01
This annual report is a collection of short communications being a review of scientific activity of the Institute of Nuclear Chemistry and Technology, Warsaw, Poland in 1994. The papers are gathered into several branches as follows: radiation chemistry and physics (16 papers); radiochemistry, stable isotopes, nuclear analytical methods, chemistry in general (17 papers); radiobiology (6 papers); nuclear technologies and methods (30 papers). The annual report of INCT-1994 contains also a general information about the Institute, the full list of papers published in 1994, information about Nukleonika - the International Journal of Nuclear Research being edited in INCT, the list of patent granted and patent applications in 1994, information about conferences organized by the Institute, the list of Ph.D. and D.Sc. finished in 1994 as well as the list of research projects and contracts being realized in INCT during 1994
Institute of Nuclear Chemistry and Technology annual report 1994
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-12-31
This annual report is a collection of short communications being a review of scientific activity of the Institute of Nuclear Chemistry and Technology, Warsaw, Poland in 1994. The papers are gathered into several branches as follows: radiation chemistry and physics (16 papers); radiochemistry, stable isotopes, nuclear analytical methods, chemistry in general (17 papers); radiobiology (6 papers); nuclear technologies and methods (30 papers). The annual report of INCT-1994 contains also a general information about the Institute, the full list of papers published in 1994, information about Nukleonika - the International Journal of Nuclear Research being edited in INCT, the list of patent granted and patent applications in 1994, information about conferences organized by the Institute, the list of Ph.D. and D.Sc. finished in 1994 as well as the list of research projects and contracts being realized in INCT during 1994.
Fuel oil and kerosene sales 1994
International Nuclear Information System (INIS)
1995-01-01
This publication contains the 1994 survey results of the ''Annual Fuel Oil and Kerosene Sales Report'' (Form EIA-821). This is the sixth year that the survey data have appeared in a separate publication. Prior to the 1989 report, the statistics appeared in the Petroleum Marketing Annual (PMA)for reference year 1988 and the Petroleum Marketing Monthly (PMM) for reference years 1984 through 1987. The 1994 edition marks the 11th annual presentation of the results of the ongoing ''Annual Fuel Oil and Kerosene Sales Report'' survey. Distillate and residual fuel oil sales continued to move in opposite directions during 1994. Distillate sales rose for the third year in a row, due to a growing economy. Residual fuel oil sales, on the other hand, declined for the sixth year in a row, due to competitive natural gas prices, and a warmer heating season than in 1993. Distillate fuel oil sales increased 4.4 percent while residual fuel oil sales declined 1.6 percent. Kerosene sales decreased 1.4 percent in 1994
Austad, C; Kvien, T K; Olsen, I C; Uhlig, T
2015-01-01
To examine changes in patient reported outcome measures (PROs) over 15 years in a representative population of patients with rheumatoid arthritis (RA), with a particular focus on gender differences. Patients in the Oslo RA register filled in questionnaires including the Modified Health Assessment Questionnaire (MHAQ), the Short-Form 36 (SF-36) with physical (PCS) and mental component summaries and derived utility (SF-6D), visual analogue scales (VAS) for pain, patient global assessment of disease (PtGA) and fatigue, and checklists of medication commonly used in the treatment of RA. Data were collected at five time points during a 15-year period from 1994. Mixed model analyses were used to analyse longitudinal changes in PROs from 1994 to 1996, 2001, 2004 and 2009. Data were available from 829-1025 RA patients at each time point. PROs were statistically significantly improved from 1994 to 2009 (MHAQ, SF-36 PCS, SF-6D, pain VAS, PtGA VAS and fatigue VAS; all p<0.001), and also with clinically important improvement. Men reported significantly better health status than women in 1994, but women improved significantly more than men over 15 years with a reduction of the gender gap in 2009. Antirheumatic medication was increasingly used over 15 years with no gender differences. RA patients reported statistically significantly improved health status for most PROs from 1994 to 2009. Women improved most, and although they still reported higher disease impact than men, the gender differences were small at the final data collection in 2009. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-07-01
This energy balance of the Santa Catarina State presents the following main topics that can be outstanding: economic aspects; supply and demand of energy by source 1980-1996; energy consumption by sector 1980/1996; energy interchange; and balance of the transformation centers 1980/1996.
2010-01-01
medical flight screening and the aeromedical waiver process ( Olea & Ree, 1994; Ree & Carretta, 1996; Ree, Carretta, & Teachout, 1995). Currently, the...Student pilots with high scores on ability tests are more likely to complete training ( Olea & Ree, 1994; Ree & Carretta, 1996; Ree, Carretta, & Teachout...Matrix differential calculus with applications in statistics and econometrics. New York, NY: John Wiley. Olea , M., & Ree, M.J. (1994
Directory of Open Access Journals (Sweden)
Angela Peña
2009-12-01
Full Text Available Hasta 1990 el modelo de desarrollo cubano había tenido éxito según los niveles observables de equidad e inclusión social casi tendientes a la homogenización. No obstante, existe una parte de la población que, a pesar de la igualdad de oportunidades que este sistema universal de servicios sociales ha ofrecido y ofrece, reproduce sus condiciones de pobreza sin lograr superarlas. La activación del capital social de las personas que viven en condiciones de pobreza en los territorios periféricos de Ciudad de la Habana contribuye a la reproducción de este fenómeno más que a superarlo.
Charm decays and high energy photoproduction. Final report, April 1994--May 1997
International Nuclear Information System (INIS)
Lopez, A.M.
1997-01-01
This project involved continued participation by the Physics Department at the Mayaguez Campus of the University of Puerto Rico (UPR) in high energy physics experiments carried out at Fermilab. The UPR is a member of the E831 collaboration which includes Fermilab and leading US, Italian, Brazilian and Korean universities. E831 is an upgrade to the E687 spectrometer with the goal of a tenfold increase in the statistics for the study of the photoproduction and decay of charmed particles. This spectrometer has been significantly upgraded to maintain and expand its capabilities even at considerably higher beam intensities. E687 completed its last data run in January 1992. Approximately 100,000 charm events were fully reconstructed from this data and results of the analysis have appeared in several publications. The UPR has been participating in E687 since 1985 when the experiment was in its early stages of construction. A grant from the DOE Division of High Energy Physics (starting in April 1994) and another from the DOE EPSCoR Program (starting in October 1994) allowed a considerable increase in the activities of the UPR group. Given the group's capable performance, the responsibilities assigned to it by the collaboration have increased to the point where they now include four major detectors in E831. All four detectors were ready on time for the start of the E831 run in July 1996. This is a remarkable performance if one considers that there is only one senior member in the group and that the students are all MS or undergraduate students. The group has also been active in the development of simulation, data acquisition and analysis software
Accelerator operation in 1995-1996
International Nuclear Information System (INIS)
Loyer, F.
1998-01-01
This report presents the operation of the GANIL accelerator between 1995 and 1996. A table is given in which the time distribution of the accelerator operation in the two years is indicated as: beam availability, time devoted to nuclear and non-nuclear physics research, radioactive ion separator operation, industrial irradiation, machine studies and maintenance. A statistics of the accelerated elements and their energy (MeV/u) shows an increase in the number of beam types and new beams from 18 and 9, respectively, in 1995 to 19 and 11 respectively in 1996. The report mentions also the safety incident of June 9, 1995, the failures in operation in 1995-1996 and events connected to SISSI, UGS-R and THI operations
Progress Report 1994-1995; Rapport d`Activite 1994-1995
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-12-31
This first volume of 1994 to 1995 activity report, of Nuclear Physics Institute (Orsay, France) gives a general overview of the research programs conducted in the fields of nuclear structure and quantum mechanics. The main topics are: structure of atomic nuclei, physics of nuclei in excited states, field theory, hadronic physics, quantum mechanics of chaotic systems. (D.L.).
Progress Report 1994-1995; Rapport d`Activite 1994-1995
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-12-31
This first volume of 1994 to 1995 activity report, of Nuclear Physics Institute (Orsay, France) gives a general overview of the research programs conducted in the fields of nuclear structure and quantum mechanics. The main topics are: structure of atomic nuclei, physics of nuclei in excited states, field theory, hadronic physics, quantum mechanics of chaotic systems. (D.L.).
Progress Report 1994-1995; Rapport d`Activite 1994-1995
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-12-31
This second volume of 1994 to 1995 activity report, of Nuclear Physics Institute (Orsay, France) gives a general overview of the research programs conducted in the fields of accelerators, detectors, multi channel data acquisition systems. The main topics are: tandem electrons accelerators, beam shaping, targets, control electronics, strip detection chambers, data acquisition electronics, and data acquisition software. (D.L.).
Directory of Open Access Journals (Sweden)
Caleb D McMahan
Full Text Available The distributions of many Northern Hemisphere organisms have been influenced by fluctuations in sea level and climatic conditions during Pleistocene interglacial periods. These cycles are associated with range contraction and refugia for northern-distributed organisms as a response to glaciers. However, lower sea levels in the tropics and sub-tropics created available habitat for expansion of the ranges of freshwater organisms. The goal of this study was to use ecological niche modeling to test the hypothesis of north to south range expansion of Vieja maculicauda associated with Pleistocene glacial cycles. Understanding the biogeography of this widespread species may help us better understand the geology and interconnectivity of Central American freshwaters. Occurrence data for V. maculicauda was based on georeferencing of all museum records of specimens recovered from FishNet2. General patterns of phylogeographic structure were assessed with mtDNA. Present day niche models were generated and subsequently projected onto paleoclimatic maps of the region during the Last Interglacial, Last Glacial Maximum, and mid-Holocene. Phylogenetic analysis of mtDNA sequence data showed no phylogeographic structure throughout the range of this widespread species. Present day niche models were congruent with the observed distribution of V. maculicauda in Central America. Results showed a lack of suitable freshwater habitat in northern Central America and Mexico during the Last Interglacial, with greatest range expansion during the Last Glacial Maximum and mid-Holocene. Results support the hypothesis of a north to south range expansion of V. maculicauda associated with glacial cycles. The wide distribution of this species compared to other closely related cichlids indicates the latter did not respond to the degree of V. maculicauda in expansion of their distributions. Future work aimed at comparisons with other species and modeling of future climatic scenarios
Directory of Open Access Journals (Sweden)
Juan Andrés Bisset Lazcano
2006-06-01
Full Text Available OBJETIVOS: Identificar los factores ecológicos locales que pudieron incidir en la mayor infestación vectorial con Aedes aegypti observada en cuatro áreas de salud urbanas de Ciudad de La Habana, Cuba, así como los tipos de depósitos con mayor número de larvas. MÉTODOS: Estudio descriptivo en cuatro áreas de salud (Docente, 28 de Enero, 26 de Julio y 1.° de Enero del municipio Playa, Ciudad de La Habana, Cuba, seleccionadas por la presencia reiterada del vector del dengue en el año 2003. Entre abril de 2004 y marzo de 2005 se inspeccionaron todos los locales de las manzanas seleccionadas. Se caracterizaron los depósitos existentes con agua (tipo, cantidad y ubicación y los factores ecológicos observados (existencia de patio y de sombra, forma en que estaban tapados los tanques, presencia de materia orgánica en ellos e higiene de la vivienda. Se contaron las larvas y pupas de mosquitos de cada depósito mediante filtración. La identificación taxonómica de las pupas se realizó con microscopio estereoscópico. RESULTADOS: Los depósitos en que se encontraron larvas y pupas de A. aegypti con mayor frecuencia en todas las áreas fueron los tanques bajos y los pequeños depósitos artificiales. En tres de las áreas estudiadas la mayor cantidad de pupas se encontró en los tanques bajos (88,6%, 100% y 56,6%, de los cuales 90,9% se encontraban destapados o tapados solo parcialmente, mientras que en el área restante los pequeños depósitos artificiales fueron los más frecuentes (85,7%. Se encontró correlación entre el número de depósitos infestados en las viviendas con la presencia de patio (ji2 = 29,59; P = 0,0001, de sombra parcial (ji2 = 4,108; P = 0,0001, de vegetación (ji2 = 43,59; P = 0,0001 y de árboles (ji2 = 101,459; P = 0,0001, así como con la mala higiene (c² = 53,76; P = 0,0001. CONCLUSIÓN: Los depósitos artificiales, especialmente los tanques bajos y los recipientes pequeños, son las criaderos más frecuentes
National Oceanic and Atmospheric Administration, Department of Commerce — Temperature profile data were collected using surface seawater intake, bucket, and XBT casts from multiple vessels in a world wide distribution from June 29, 1994 to...
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-03-01
The subcommittee held the 1st meeting in August 1994 and the 2nd in March 1995, when preceding fiscal year's research results, fiscal 1994 research plans, fiscal 1994 research results, etc., were introduced, and deliberated. In the study of hydrorefining of naphtha, kerosene, and light oil fractions, a nitrogen concentration level of not more than 5 ppm was achieved by refining oils from Indonesian coal. Studies were also made about the two-step hydrorefining system, the relationship between the coal oil refining level and sludge formation, etc. In the research for the development of novel catalysts for upgrading coal oil, the active life of a nickel-supporting catalyst for hydrogenation at the 1st step was somewhat prolonged with an increase in the amount of nickel. In the study of coal liquefaction conditions, an AWIP method was deliberated, wherein liquefaction process waste water was utilized as one of catalytic component adjusting materials. For upgrading liquefaction key technologies, studies were made for catalyst improvement and pretreatment method development, and about the behavior of liquefaction reaction in a high boiling solvent-aided process. (NEDO)
Directory of Open Access Journals (Sweden)
Ronaldo Ramírez
2004-01-01
Full Text Available Interpretación selectiva de investigación recién terminada en tres barrios de La Habana por grupo internacional de investigadores urbanos. El propósito de la investigación fue examinar la influencia de un conjunto de factores en el éxito o fracaso de proyectos comunitarios en los barrios. Esta versión examina el factor origen de los proyectos en el barrio Pogolotti cuyas condiciones de vida, especialmente de vivienda, son muy precarias. El documento describe brevemente el contexto crítico de los procesos urbanos en Cuba hoy y examina las formas de organización creadas para estimular la participación comunitaria en iniciativas que contribuyan a mejorar las condiciones materiales, a expresar valores culturales y artísticos y a desarrollar relaciones de solidaridad y respeto mutuo entre los vecinos. Pogolotti, el primer barrio obrero cubano, construido a principios del siglo XX, aparece a través de su historia, de sus residentes y de una serie de proyectos, unos exitosos y otros fracasados, que ilustran la creatividad de su sociedad civil y la creciente flexibilidad con que las instituciones públicas han tenido que responder a las demandas de la crisis.
Cobal, M; Costanzo, D; David, M; Davidek, T; Efthymiopoulos, I; Khubua, J I; Kulchitskii, Yu A; Kuzmin, M V; Lund-Jensen, B; Leitner, R; Mazzoni, E; Mosidze, M; Némécek, S; Nessi, Marzio; Pantea, D; Sala, P; Solodkov, A; Stanek, B; Vichou, I
1998-01-01
In April 1996 a second combined electromagnetic and hadronic ATLAS calorimeter prototype test beam was performed. The response to pions and electrons of various energies (10, 20, 40, 50, 80, 100, 150 and 300~GeV) at an incident $\\theta$ angle of $12^0$ was investigated. The energy released by pions in the prototype was reconstructed using a minimal set of corrections introduced to take into account various detector effects ("benchmark" approach). A weighting method 'a la H1' was applied too. Energy resolution, $e$/$\\pi$ and linearity were calculated. Finally, the transverse and longitudinal pion shower developments were examined as well as the longitudinal leakage. The signal released by muons was analyzed. The noise was evaluated for both the detectors. The results were compared with those obtained in the previous combined test beam, performed in September 1994.
KURRI progress report 1994. April 1994 - March 1995
International Nuclear Information System (INIS)
1995-10-01
In this progress report, the activities at the Research Reactor Institute, Kyoto University (KURRI), during fiscal year 1994 are described. KURRI is a research institute for the joint use by universities, and the main research facilities are the Kyoto University reactor (KUR) with 5 MW maximum output, Kyoto University critical assembly (KUCA), a 46 MeV electron linear accelerator and a 6 0Co γ ray irradiation facility. In fiscal year 1994, 161 applications and 1780 visiting researchers were accepted. In the great Hanshin earthquake, no serious damage occurred in the KURRI facilities. The plan of reorganizing the research divisions and modernizing the KUR and its related facilities was officially started in April, 1995. Old 16 small research divisions were reorganized into 6 large divisions of nuclear safety research, neutron research, nuclear energy science, fuel cycle and environment, applied nuclear science and radiation life science. As for the modernization of the facilities, the replacement of the heavy water thermal neutron facility, the installation of a high temperature irradiation facility, the improvement of the radioactive handling facility in Hot Laboratory and so on will be carried out in five years. The research activities, publications, meetings and others are reported. (K.I.)
Directory of Open Access Journals (Sweden)
Martha C Híjar-Medina
1999-10-01
Full Text Available OBJETIVO: Evaluar el efecto de intervenciones realizadas en la autopista, tanto en la ocurrencia de lesiones por accidentes de tráfico, como en la gravedad de las mismas. MÉTODOS: Se realizó un análisis comparativo de dos estudios transversales realizados en 1994 y 1996 en los que se investigó la ocurrencia de lesiones en los conductores de vehículos a motor que sufrieron accidente en la autopista, Cuernavaca, México. RESULTADOS: Para 1994 la tasa de accidentes fue de 7,96 / 100.000 vehículos y para 1996 fue de 8,49 / 100.000 vehículos, incremento no significativo (p>0,05. Para 1994 la tasa de lesionados fue de 2,10 / 100.000 vehículos y para 1996 de 1,35 / 100.000 vehículos, disminución significativa (pOBJETIVO: Avaliar o efeito das intervenções em uma rodovia, na ocorrência e gravidade de ferimentos por acidente. MÉTODOS: Foi feita uma análise comparativa de dois estudos transversais em 1994 e 1996. RESULTADOS: Em 1994 a taxa foi de 7,96 acidentes/100.000 veículos e em 1996, 8,49/100.000 veículos. O aumento não foi significante (p>0.05. O índice de motoristas feridos em 1994 foi de 2,10/100.000 veículos e de 1,35/100.000 veículos em 1996, o que representa uma redução significante (pOBJECTIVE: To evaluate the effect of interventions at a highway, in the occurrence and severity of injuries by traffic accidents. METHOD: It was made a comparative analysis of two cross-sectional studies in 1994 and 1996. RESULTS: In 1994 the rate was 7.96 accidents/ 100,000 vehicles and in 1996 8.49 / 100,000 vehicles. The increase was not significant (p>0.05. The rate of injured drivers in 1994 was of 2.10 / 100,000 vehicles and of 1.35 / 100,000 vehicles in 1996, which was a significant decrease (p<0.000. The self-report of use of seat belt (63.46% versus 76.6%, the small vehicles involved in accidents (7.9% versus 37.7%, nocturnal schedule (23.7% versus 31.8% and in Mexico-Cuernavaca direction (45% versus 66.7%, were more frequent in
The Indigenous World, 1994-95 = El Mundo Indigena, 1994-95.
Jensen, Marianne, Comp.; Sjorslev, Inger, Comp.
1995-01-01
This annual publication examines political, legal, social, and educational issues concerning indigenous peoples in various countries around the world during 1994-95. Part I highlights news events and ongoing situations in specific countries. In the United States and Canada, these include: (1) the arrest of three Canadian Inuit hunters for the…
Energy Technology Data Exchange (ETDEWEB)
Amodei, R.; Bard, E.; Brong, B.; Cahoon, F.; Jasper, K.
1998-11-01
The Atlanta metropolitan region was the location of one of the most ambitious Intelligent Transportation Systems (ITS) deployments in the United States. This deployment included several individual projects--a Central Transportation Management Center (TMC), six Traffic Control Centers (TCCs), one Transit Information Center (TIC), The Travel Information Showcase (TIS), and the extension of the Metropolitan Atlanta Rapid Transit Authority (MARTA) Rail network and the new high-occupancy vehicle (HOV) lanes on I-85 and I-75. The 1996 Atlanta Centennial Olympic Games and Paralympic Games created a focus for these projects. All of these systems were to be brought on-line in time for the Olympic Games. This report presents the findings of the 1996 Olympic and Paralympic Games Events Study--a compilation of findings of system performance, the benefits realized, and the lessons learned during their operations over the event period. The study assessed the performance of the various Travel Demand Management (TDM) plans employed for Olympic Games traffic management.
International nuclear power status 1994; International kernekraftstatus 1994
Energy Technology Data Exchange (ETDEWEB)
Hoejerup, C.F.; Majborn, B.; Oelgaard, P.L. [eds.
1995-02-01
This report is the first in a planned series of annual reports covering the international development in the field of nuclear power. The report deals with: statistical information on the electricity produced by nuclear power plants; major safety-related incidents in 1994; the development in Sweden, Eastern Europe, and the rest of the world; the trends of development of a number of reactor types; the trends of development in the fuel cycle. (au).
International Nuclear Information System (INIS)
1996-01-01
The annual report including financial statements of the Canada-Nova Scotia Offshore Petroleum Board (the Board) was presented for the fiscal year ending March 31, 1996. The Board's responsibilities include ensuring safe working conditions for offshore petroleum activities, protection of the environment during offshore petroleum operations, and management of offshore petroleum resources. In February of 1996, the successful completion of the CP3A well at Cohasset added in excess of 1,000,000 barrels of recoverable oil to the field. The report also discussed efforts towards improved levels of communication with government departments, agencies and other organizations having an interest in offshore oil activities, agreements concluded with the Canadian Coast Guard and the Canadian Transportation Accident Investigation and Safety Board, the Canada-Nova Scotia Environmental Coordinating Committee, the National Energy Board, and the Canada-Newfoundland Offshore Petroleum Board. During the fiscal year production amounted to 7.5 million barrels of Scotia light crude oil. In another highlight, exploratory permit was issued for the Sable Island field, a proposed development of six gas fields, effective January 1, 1996. tabs
Directory of Open Access Journals (Sweden)
Gutiérrez Baños, Fernando
2002-03-01
Full Text Available En el verano de 1999 quedaron al descubierto tras su restauración las pinturas murales de estilo gótico lineal de los siglos XIII y XIV que se encontraron en noviembre de 1997 en el brazo meridional del crucero de la catedral vieja de Salamanca. Por su cantidad, por su calidad y por la riqueza de su iconografía estos descubrimientos consolidan la importancia de Salamanca en el panorama de la pintura de estilo gótico lineal. No pretendo abordar en este momento un estudio de conjunto acerca de estas pinturas, que reservo para otra ocasión, sino estudiar un aspecto iconográfico relevante de estos descubrimientos que entronca con el objeto de interés de la profesora Domínguez Rodríguez en un artículo publicado no hace mucho tiempo en las páginas de esta revista.…
Indicadores bacteriológicos de contaminación fecal en la Bahía de la Habana
Directory of Open Access Journals (Sweden)
Lisse López Pérez
2013-08-01
Full Text Available Objetivos. Cuantifi car los indicadores bacteriológicos de contaminación fecal en la Bahía deLa Habana. Metodología. En muestreos realizados desde abril/2010 hasta febrero/2011, mediantemétodos de fermentación en tubos múltiples (NMP, se determinaron las concentraciones de coliformestermotolerantes (CTT, Escherichia coli, estreptococos fecales (EF, enterococos intestinales (ENTen agua, y Clostridium perfringens en los sedimentos superfi ciales. Resultados. Las concentracionesde CTT y E. coli excedieron los valores límites de la normativa cubana para contacto indirecto con lasaguas de la bahía, lo que demuestra la infl uencia negativa de los vertimientos de drenajes albañales yríos de la ciudad. EF y ENT fueron buenos indicadores bacterianos, medidos en el lugar y al momentode la descarga del residual proveniente de los drenajes, aunque estos resultados desafían su usocomo indicadores para evaluar la calidad microbiológica de la bahía. Este resultado se deriva desu bien conocida inactivación por la luz solar en zonas tropicales y la aparente presencia de ácidoshúmicos en las aguas de la bahía. Conclusiones. Los indicadores bacterianos y la relación estadísticaencontrada entre ellos resultaron indicativos de una gran contaminación fecal reciente y crónica enla bahía y zonas costeras, que ha permanecido así desde años anteriores.
Sanitary landfill groundwater monitoring report. Fourth quarter 1994 and 1994 summary
International Nuclear Information System (INIS)
1995-02-01
Eighty-nine wells of the LFW series monitor groundwater quality in the Steed Pond Aquifer (Water Table) beneath the Sanitary Landfill at the Savannah River Site (SRS). These wells are sampled quarterly to comply with the South Carolina Department of Health and Environmental Control Domestic Waste Permit DWP-087A and as part of the SRS Groundwater Monitoring Program. Dichloromethane, a common laboratory contaminant, and trichloroethylene were the most widespread constituents exceeding standards during 1994. Benzene, chloroethene (vinyl chloride), 1,2-dichloroethane, 1,1-dichloroethylene, 1,2-dichloropropane, gross alpha, mercury, nonvolatile beta, tetrachloroethylene, and tritium also exceeded standards in one or more wells. The groundwater flow direction in the Steed Pond Aquifer (Water Table) beneath the Sanitary Landfill was to the southeast (universal transverse Mercator coordinates). The flow rate in this unit was approximately 140 ft/year during first and fourth quarters 1994
SKB Annual Report 1994. Including summaries of technical reports issued during 1994
International Nuclear Information System (INIS)
1995-05-01
The report gives an overview of SKB activities in different fields, and a description of R and D on nuclear waste disposal performed during 1994. SKB is in charge of a comprehensive program on geological disposal of nuclear waste. The total cost for R and D 1994 was 186 MSEK of which 59 MSEK were investments in the Aespoe Hard Rock Laboratory. Some of the main areas for SKB research are: Groundwater movements; Bedrock stability; Groundwater chemistry and nuclide migration; Methods and instruments for in situ characterization of crystalline bedrock; Characterization and leaching of spent fuel; Properties of bentonite for buffer, backfilling and sealing; Radionuclide transport in biosphere and dose evaluation; Development of performance and safety assessment methodology and assessment models; Construction of an underground research laboratory. 66 figs, 6 tabs
SKB Annual Report 1994. Including summaries of technical reports issued during 1994
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-05-01
The report gives an overview of SKB activities in different fields, and a description of R and D on nuclear waste disposal performed during 1994. SKB is in charge of a comprehensive program on geological disposal of nuclear waste. The total cost for R and D 1994 was 186 MSEK of which 59 MSEK were investments in the Aespoe Hard Rock Laboratory. Some of the main areas for SKB research are: Groundwater movements; Bedrock stability; Groundwater chemistry and nuclide migration; Methods and instruments for in situ characterization of crystalline bedrock; Characterization and leaching of spent fuel; Properties of bentonite for buffer, backfilling and sealing; Radionuclide transport in biosphere and dose evaluation; Development of performance and safety assessment methodology and assessment models; Construction of an underground research laboratory. 66 figs, 6 tabs.
Site environmental report for 1994. Environmental report, January--December 1994
International Nuclear Information System (INIS)
1994-01-01
This document is the 1994 site environmental report for the Rocky Flats Environmental Technology Site for January thru December. Compliance programs, radiological and nonradiological monitoring, and significant issues and events are described. In addition, the methodology for radiation dose assessment and the Environmental Restoration, Waste Management, and Quality Assurance programs are discussed
BENSC. Experimental reports 1994
International Nuclear Information System (INIS)
Kirschbaum, Y.; Gast, H.; Michaelsen, R.
1995-05-01
This volume contains the guest groups' experimental reports describing experimental work carried out on the Berlin Scattering Center in 1994. These experimental reports are intended as interim summaries. (HP)
Status Report of INIS Operations April 1996 - April 1997
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-07-01
The total number of records announced in Atomindex volume 27 (1996) was 80,516. A total of 77 Members sent input for volume 27 (1996) (78 for volume 26 (1995)). The INIS Secretariat carried out a comprehensive effort in 1996 to encourage Liaison Officers to participate more actively in INIS. Liaison Officers of 17 countries were contacted in July to remind them that they did not send any input since the beginning of 1996. As a result of this activity 10 countries sent input for the first time in 1996.
Status Report of INIS Operations April 1996 - April 1997
International Nuclear Information System (INIS)
1997-01-01
The total number of records announced in Atomindex volume 27 (1996) was 80,516. A total of 77 Members sent input for volume 27 (1996) (78 for volume 26 (1995)). The INIS Secretariat carried out a comprehensive effort in 1996 to encourage Liaison Officers to participate more actively in INIS. Liaison Officers of 17 countries were contacted in July to remind them that they did not send any input since the beginning of 1996. As a result of this activity 10 countries sent input for the first time in 1996
Report for 1994 on applied superconductivity
International Nuclear Information System (INIS)
1994-01-01
In the report for 1994, scientists and engineers interested in the applications of superconductivity are informed in as short a form as possible of a survey on the current international state of development (December 1994). The report is mainly concerned with progress made in the last 12-18 months. It is assumed that well-established results of research and development of previous years are known. (orig./MM) [de
Monthly energy review, August 1994
Energy Technology Data Exchange (ETDEWEB)
1994-08-29
Energy production during May 1994 totaled 5.6 quadrillion Btu, a 2.4-percent increase from the level of production during May 1993. Coal production increased 13.3 percent, natural gas production rose 1.7 percent, and petroleum production decreased 2.5 percent. All other forms of energy production combined were down 8.3 percent from the level of production during May 1993. Energy consumption during May 1994 totaled 6.6 quadrillion Btu, 3.6 percent above the level of consumption during May 1993. Natural gas consumption increased 8.7 percent, coal consumption rose 4.6 percent, and petroleum consumption was up 3.6 percent. Consumption of all other forms of energy combined decreased 5.8 percent from the level 1 year earlier. Net imports of energy during May 1994 totaled 1.5 quadrillion Btu, 14.3 percent above the level of net imports 1 year earlier. Net imports of petroleum increased 8.4 percent, and net imports of natural gas were up 23.2 percent. Net exports of coal fell 16.8 percent from the level in May 1993.
Monthly energy review, July 1994
Energy Technology Data Exchange (ETDEWEB)
1994-07-26
Energy production during April 1994 totaled 5.5 quadrillion Btu, a 2.2-percent increase from the level of production during April 1993. Coal production increased 11.8 percent, petroleum production fell 4.0 percent, and natural gas production decreased 0.3 percent. All other forms of energy production combined were down 2.9 percent from the level of production during April 1993. Energy consumption during April 1994 totaled 6.7 quadrillion Btu, 1.4 percent above the level of consumption during April 1993. Petroleum consumption increased 3.9 percent, coal consumption rose 1.1 percent, and natural gas consumption decreased 1.5 percent. Consumption of all other forms of energy combined decreased 0.4 percent from the level 1 year earlier. Net imports of energy during April 1994 totaled 1.5 quadrillion Btu, 8.7 percent above the level of net imports 1 year earlier. Net imports of petroleum increased 4.5 percent, and net imports of natural gas were up 18.5 percent. Net exports of coal fell 9.2 percent from the level in April 1993.
Monthly energy review, June 1994
Energy Technology Data Exchange (ETDEWEB)
1994-06-01
Energy production during March 1994 totaled 5.9 quadrillion Btu, a 3.7-percent increase from the level of production during March 1993. Coal production increased 15.7 percent, petroleum production fell 4.1 percent, and natural gas production decreased 1.1 percent. All other forms of energy production combined were up 0.5 percent from the level of production during March 1993. Energy consumption during March 1994 totaled 7.5 quadrillion Btu, 1.3 percent below the level of consumption during March 1993. Natural gas consumption decreased 3.6 percent, petroleum consumption fell 1.6 percent, and coal consumption remained the same. Consumption of all other forms of energy combined increased 3.7 percent from the level 1 year earlier. Net imports of energy during March 1994 totaled 1.5 quadrillion Btu, 6.7 percent above the level of net imports 1 year earlier. Net imports of petroleum increased 3.2 percent, and net imports of natural gas were up 15.7 percent. Net exports of coal rose 2.1 percent from the level in March 1993.
Directory of Open Access Journals (Sweden)
Vázquez Cienfuegos, Sigfrido
2013-08-01
Full Text Available During the difficult political and economic situation of 1807-1808, an institutional change that could have had a serious effect on the correlation of powers in Havana took place: Godoy’s creation of the Admiralty in 1807. The establishment of the institution had a significant influence on how the events unfolded during those critical moments in the island’s history. However, its short-lived existence has made its influence go by virtually unnoticed in Cuban politics by researchers specializing in this period.En la difícil coyuntura política y económica de 1807-1808 se produjo un cambio institucional que pudo variar de manera importante la correlación de poderes en La Habana: la creación del Almirantazgo por Manuel Godoy en 1807. El intento de instauración de la institución influyó de manera significativa en el desarrollo de los acontecimientos en aquellos momentos claves en la historia de la isla. Sin embargo, la efímera existencia de la misma ha motivado que su influencia haya pasado casi desapercibida para los principales investigadores especializados en la época.
Shell Canada Limited 1996 annual report
International Nuclear Information System (INIS)
1996-01-01
Shell Canada Resources Limited is one of Canada's largest producers of crude oil, natural gas, natural gas liquids, sulphur and bitumen. This annual report for 1996 presented a summary review of operations and a summary of the Company's audited consolidated financial statements. Overall, the resources business delivered exceptional results in 1996. The oil products and chemicals businesses did not perform as well as expected. This less than satisfactory performance of the oil products and chemicals divisions of the the Company is reflected in the financial returns which, after excluding revenues from asset sales, left operating earnings $ 59 million below those of 1996. tabs., figs
International Nuclear Information System (INIS)
Kuehne, G.; Gschwend, B.
1997-01-01
This annex to the PSI Annual Report 1996 reports on the progress achieved by the PSI Department II during 1996 in the fields of radiation medicine, radiopharmacy, radiation hygiene, positron emission tomography and medical radiobiology. figs., tab., refs
FY 1994 report on the Coal Gasification Committee; 1994 nendo sekitan gasuka iinkai hokokusho
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-03-01
The paper reported activities of the Coal Gasification Committee in FY 1994. The 1st Coal Gasification Committee Meeting was held on May 18,1994, the 2nd Meeting on October 28, 1994, and the 3rd Meeting on February 21, 1995. Report/discussion were made about activities of each section meeting and the progress of the development of coal gasification technology. For the 50 t/d HYCOL pilot plant, disassembly examination was conducted. As a result of the examination, the high-temperature gas corrosion caused by gas product against metal members was negligible, but against members in the wet corrosion environment, SCC, intergranular corrosion and pitting corrosion were generated. About members used in the high-temperature environment, it was made clear that Ir was applicable to thermowell, high chromia-base sintered products were applicable to non-cooling hearth tapping materials, and high chromia-base indeterminate-formed materials were applicable to water-cooled fireproofing wall. Based on the data obtained through the operational study of a 50 t/d pilot plant, conceptual design was made of a coal gasification hydrogen production plant of a scale of demonstration plant. (NEDO)
Directory of Open Access Journals (Sweden)
Maria Auxiliadora de Souza Mendes Gomes
2005-08-01
Full Text Available Este artigo apresenta uma avaliação da intervenção realizada pela Secretaria Municipal de Saúde do Rio de Janeiro(SMS-RJ (estratégias de organização e qualificação da assistência neonatal na rede municipal, incluindo a ampliação dos leitos neonatais de risco, com o objetivo de reduzir a mortalidade neonatal. Analisamos as mudanças ocorridas no atendimento dos diferentes prestadores do setor público (período 1994/2000, na taxa de mortalidade neonatal dos nascimentos ocorridos nas instituições do Sistema Único de Saúde (1995/2000 e o perfil das internações em quatro Unidades de Terapia Intensiva Neonatal (UTIN da SMS-RJ (2000. Encontramos a concentração do atendimento neonatal de risco nas unidades municipais (de 28,0% do atendimento de nascidos vivos prematuros, em 1994, para 67,0% em 2000, redução na mortalidade neonatal dos nascimentos ocorridos no SUS (de 19,9 óbitos por mil nascidos vivos em 1996 para 15,5 em 2000. Não houve redução nas taxas de prematuridade e baixo peso ao nascer entre as mães residentes no Município do Rio de Janeiro. Na análise das internações nas UTIN encontramos elevada proporção de neonatos de mães moradoras de outros municípios, 14,0% de mães que não realizaram pré-natal e 32,0% de mortalidade entre neonatos com peso ao nascer This article analyzes an intervention by the Rio de Janeiro Municipal Health Department (SMS-RJ, Brazil, to reduce the neonatal mortality rate (strategies for organizing and upgrading neonatal care in the municipal system, including an increase in the number of neonatal high-risk beds. We studied the trends in neonatal mortality rate (1995/2000, neonatal care provided in different public hospitals (1994/2000, and admissions profile and mortality in four neonatal intensive care units (NICUs under the SMS-RJ (2000. There was a concentration of high-risk neonatal care in the municipal hospitals (an increase from 28.0% of the care provided for live premature
National Oceanic and Atmospheric Administration, Department of Commerce — Hydrophysical, hydrochemical, meteorological, and other data were collected using bottle and XBT casts in Pacific Ocean from January 1, 1994 to December 31, 1994....
Drinking in transition: trends in alcohol consumption in Russia 1994-2004
Directory of Open Access Journals (Sweden)
Perlman Francesca JA
2010-11-01
Full Text Available Abstract Background Heavy alcohol consumption is widespread in Russia, but studying changes in drinking during the transition from Communism has been hampered previously by the lack of frequent data. This paper uses 1-2 yearly panel data, comparing consumption trends with the rapid concurrent changes in economic variables (notably around the "Rouble crisis", shortly preceding the 1998 survey round, and mortality. Methods Data were from 9 rounds (1994-2004 of the 38-centre Russia Longitudinal Monitoring Survey. Respondents aged over 18 were included (>7,000 per round. Trends were measured in alcohol frequency, quantity per occasion (by beverage type and 2 measures of potentially hazardous consumption: (i frequent, heavy spirit drinking (≥80 g per occasion of vodka or samogon and >weekly (ii consuming samogon (cheap home-distilled spirit. Trends in consumption, mean household income and national mortality rates (in the same and subsequent 2 years were compared. Finally, in a subsample of individual male respondents present in both the 1996 and 1998 rounds (before and after the financial crash, determinants of changes in harmful consumption were studied using logistic regression. Results Frequent, heavy spirit drinking (>80 g each time, ≥weekly was widespread amongst men (12-17% throughout, especially in the middle aged and less educated; with the exception of a significant, temporary drop to 10% in 1998. From 1996-2000, samogon drinking more than doubled, from 6% to 16% of males; despite a decline, levels were significantly higher in 2004 than 1996 in both sexes. Amongst women, frequent heavy spirit drinking rose non-significantly to more than 1% during the study. Heavy frequent male drinking and mortality in the same year were correlated in lower educated males, but not in women. Individual logistic regression in a male subsample showed that between 1996 and1998, those who lost their employment were more likely to cease frequent, heavy
Drinking in transition: trends in alcohol consumption in Russia 1994-2004
2010-01-01
Background Heavy alcohol consumption is widespread in Russia, but studying changes in drinking during the transition from Communism has been hampered previously by the lack of frequent data. This paper uses 1-2 yearly panel data, comparing consumption trends with the rapid concurrent changes in economic variables (notably around the "Rouble crisis", shortly preceding the 1998 survey round), and mortality. Methods Data were from 9 rounds (1994-2004) of the 38-centre Russia Longitudinal Monitoring Survey. Respondents aged over 18 were included (>7,000 per round). Trends were measured in alcohol frequency, quantity per occasion (by beverage type) and 2 measures of potentially hazardous consumption: (i) frequent, heavy spirit drinking (≥80 g per occasion of vodka or samogon and >weekly) (ii) consuming samogon (cheap home-distilled spirit). Trends in consumption, mean household income and national mortality rates (in the same and subsequent 2 years) were compared. Finally, in a subsample of individual male respondents present in both the 1996 and 1998 rounds (before and after the financial crash), determinants of changes in harmful consumption were studied using logistic regression. Results Frequent, heavy spirit drinking (>80 g each time, ≥weekly) was widespread amongst men (12-17%) throughout, especially in the middle aged and less educated; with the exception of a significant, temporary drop to 10% in 1998. From 1996-2000, samogon drinking more than doubled, from 6% to 16% of males; despite a decline, levels were significantly higher in 2004 than 1996 in both sexes. Amongst women, frequent heavy spirit drinking rose non-significantly to more than 1% during the study. Heavy frequent male drinking and mortality in the same year were correlated in lower educated males, but not in women. Individual logistic regression in a male subsample showed that between 1996 and1998, those who lost their employment were more likely to cease frequent, heavy drinking; however, men
La oficina de conservación y rehabilitación de la ciudad histórica de Santiago 1994-2001
Directory of Open Access Journals (Sweden)
Fernández Hermida, Ramón
2003-08-01
Full Text Available The Prize U'N. HABITAT Dubai 2002 of Good Practices offered to Santiago of Compostela by the "Protection and rehabilitation of the historic city and integration with its natural environment " was collected by the Mayor Xosé Sánchez Bugallo and by Vice-Mayor responsible for the historic city Encarna Otero. and is an extra ordinary recognition to the cooperation and supportive work carried out during more than one decade by citizens, town planners, builders, political and others social agents with the objective to recover its Historic City. The indispensable implication coordinated in the project of the different competent administrations, the Spanish Stat e, the Xunta of Galicia and the City Hall . was possible thanks to the creation of a stable entity of cooperation, the Consortium of the City, prompted by the Real Patronage of Santiago de Compostela. N° 439 of Informes de la Construcción september/october1995 dedicated monographically to Santiago, closed with an article in which the young Office of Conservation and Rehabilitation of the Historic City. already created in 1994. was presented. Since then the effort carried out for the rehabilitation of the historic city between 1994 and 200 I deserved the international recognition with the Prize Europe Nostra 1996 . the Prize Gubbio 1996 of the Historic Association of Centers of Italy, the European Prize 01 Town planning 199 7/1998 of the European Commission, the Prize Tower Guinigi 2001 and the referred Prize Dubai 2002 of Good Practices. In the article that now is presented. elaborate jointly by the architects that from the beginings of the Office 01 Conservation and Rehabilitation developed the programs 01 rehabilitation under the technical direction 01Javier Ramos. a brief review is done of the different concepts. instruments 01 management al' reflections that have fed in practice daily the urban process of recovery the Patrimony of the Humanity inhabited that it represents Compostela
Chronique de jurisprudence suisse (1996-2004)
DEFF Research Database (Denmark)
Cavaleri, Sylvie Cécile
2005-01-01
The article reviews case law on the Swiss Statute on Private International Law from 1996 to 2004. Sylvie Cavaleri's contribution concerns provisions on insolvency and bankruptcy.......The article reviews case law on the Swiss Statute on Private International Law from 1996 to 2004. Sylvie Cavaleri's contribution concerns provisions on insolvency and bankruptcy....
IEA Bioenergy Annual Report 1994
International Nuclear Information System (INIS)
1995-01-01
The report describes the work in the Executive Committee and includes short reports from the four tasks which have been in operation 1992-94: Task VIII - Efficient and Environmentally-Sound Biomass Production Systems; Task IX - Harvesting and Supply of Woody Biomass for Energy; Task X - Biomass Utilization; Task XI - The Conversion of Municipal Solid Waste Feedstocks to Energy. The three new tasks (XII-XIV) for the period 1995-97 approved during 1994 are presented in the report. At the end of 1994 there were sixteen Contracting Parties to the IEA Bioenergy Agreement - Fifteen countries plus the European Commission. 164 refs
IEA Bioenergy Annual Report 1994
Energy Technology Data Exchange (ETDEWEB)
1995-01-31
The report describes the work in the Executive Committee and includes short reports from the four tasks which have been in operation 1992-94: Task VIII - Efficient and Environmentally-Sound Biomass Production Systems; Task IX - Harvesting and Supply of Woody Biomass for Energy; Task X - Biomass Utilization; Task XI - The Conversion of Municipal Solid Waste Feedstocks to Energy. The three new tasks (XII-XIV) for the period 1995-97 approved during 1994 are presented in the report. At the end of 1994 there were sixteen Contracting Parties to the IEA Bioenergy Agreement - Fifteen countries plus the European Commission. 164 refs
CSIR Research Space (South Africa)
CSIR
1994-01-01
Full Text Available This report provides highlights on the activities and achievements of CSIR in the year 1994. An outline of the CSIR structure and financial reports are also presented in the report....
Electric trade in the United States 1994
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-08-01
Wholesale trade in electricity plays an important role for the US electric utility industry. Wholesale, or bulk power, transactions allow electric utilities to reduce power costs, increase power supply options, and improve reliability. In 1994, the wholesale trade market totaled 1.9 trillion kilowatthours, about 66% of total sales to ultimate consumers. This publication, Electric Trade in the United States 1994 (ELECTRA), is the fifth in a series of reports on wholesale power transactions prepared by the Office of Coal, Nuclear, Electric and Alternate Fuels, Energy Information Administration (EIA). The electric trade data are published biennially. The first report presented 1986 data, and this report provides information on the electric power industry during 1994.
Electric trade in the United States 1994
International Nuclear Information System (INIS)
1998-08-01
Wholesale trade in electricity plays an important role for the US electric utility industry. Wholesale, or bulk power, transactions allow electric utilities to reduce power costs, increase power supply options, and improve reliability. In 1994, the wholesale trade market totaled 1.9 trillion kilowatthours, about 66% of total sales to ultimate consumers. This publication, Electric Trade in the United States 1994 (ELECTRA), is the fifth in a series of reports on wholesale power transactions prepared by the Office of Coal, Nuclear, Electric and Alternate Fuels, Energy Information Administration (EIA). The electric trade data are published biennially. The first report presented 1986 data, and this report provides information on the electric power industry during 1994
Directory of Open Access Journals (Sweden)
Armando Rodríguez
Full Text Available Abstract: First-line health services with a primary health care approach are a strong trigger for adequate health-care-seeking behavior. Research on the association between prevalence of chronic diseases and acute illnesses and use of health services emphasizes the importance of socioeconomic determinants in such patterns of utilization. In a cross-sectional study of 408 families in Centro Habana, Cuba, home interviews were conducted between April and June 2010 to analyze socio-demographic determinants of acute and chronic health problems and use of formal health services. Bivariate and logistic regression models were used. 529 persons reported a chronic disease. During the previous month, 155 of the latter reported an exacerbation and 50 experienced an unrelated acute health problem. 107 persons without chronic diseases reported acute health problems. Age was the strongest determinant of chronic disease prevalence. Adult women and the elderly were more likely to report acute problems. Acute patients with underlying chronic disease used formal services more often. No socio-demographic variable was associated with services use or consultation with the family physician. While the family physician is defined as the system's entry-point, this was the case for only 54% of patients that had used formal services, thus compromising the physician's role in counseling patients and summarizing their health issues. The importance of chronic diseases highlights the need to strengthen the family physician's pivotal role. New economic policies in Cuba, stimulating self-employment and private initiative, may increase the strain on the exclusively public health care system. Still, the Cuban health system has demonstrated its ability to adapt to new challenges, and the basic premises of Cuba's health policy are expected to be preserved.
Performance profiles of major energy producers 1996
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-01-01
This publication examines developments in the operations of the major US e energy-producing companies on a corporate level, by major line of business, by major function within each line of business, and by geographic area. In 1996, 24 companies filed Form EIA-28. The analysis and data presented in this report represents the operations of the Financial Reporting System companies in the context of their worldwide operations and in the context of the major energy markets which they serve. Both energy and nonenergy developments of these companies are analyzed. Although the focus is on developments in 1996, important trends prior to that time are also featured. Sections address energy markets in 1996; key financial developments; oil and gas exploration, development, and production; downstream petroleum in 1996; coal and alternative energy; and foreign direct investment in US energy. 30 figs., 104 tabs.
Performance profiles of major energy producers 1996
International Nuclear Information System (INIS)
1998-01-01
This publication examines developments in the operations of the major US e energy-producing companies on a corporate level, by major line of business, by major function within each line of business, and by geographic area. In 1996, 24 companies filed Form EIA-28. The analysis and data presented in this report represents the operations of the Financial Reporting System companies in the context of their worldwide operations and in the context of the major energy markets which they serve. Both energy and nonenergy developments of these companies are analyzed. Although the focus is on developments in 1996, important trends prior to that time are also featured. Sections address energy markets in 1996; key financial developments; oil and gas exploration, development, and production; downstream petroleum in 1996; coal and alternative energy; and foreign direct investment in US energy. 30 figs., 104 tabs
International Nuclear Information System (INIS)
Harrach, R.J.; Gallegos, G.M.; Tate, P.J.
1997-01-01
This summary provides an overview of LLNL's environmental activities in 1996, including radiological and nonradiological surveillance, effluent and compliance monitoring, remediation, assessment of radiological releases and doses, and determination of the impact of LLNL operations on the environment and public health
International Nuclear Information System (INIS)
1994-01-01
Progress achieved on the development of the RTAL system during the quarter, May 1 through July 31, 1994 is reported. The work included NEPA analysis, drawings, prototype system construction, and on-site prototype demonstration
Directory of Open Access Journals (Sweden)
Célia Landmann Szwarcwald
2001-10-01
Full Text Available Neste estudo, aplicou-se um modelo espaço-temporal para examinar a disseminação espacial da epidemia de AIDS entre os casos adultos do Município do Rio de Janeiro em três períodos: 1988-1990, 1991-1993 e 1994-1996. As regiões administrativas foram as unidades geográficas de estudo. Posteriormente, realizou-se análise espacial dos casos pediátricos por transmissão vertical do HIV, por período de nascimento, 1985-1990 e 1991-1996. Para a totalidade dos casos adultos, o período inicial é caracterizado por um conglomerado poligonal em torno da Zona Portuária, que se expande na direção oeste-leste. Entre os casos homossexuais, o crescimento in situ predominou, notando-se arrefecimento da disseminação espacial nos últimos anos. Entre os casos heterossexuais, a epidemia demonstrou expansão geográfica expressiva, sobretudo de 1988-1990 a 1991-1993. Entre os casos do sexo feminino, no último período, houve a formação de um conglomerado de taxas elevadas na direção noroeste, que compreende áreas muito pobres. Entre 1991 e 1996, observou-se correlação significativa das taxas de incidência de AIDS perinatal com o índice de concentração de pobreza. Os resultados sugerem que o entendimento da dinâmica espaço-temporal da epidemia pode subsidiar, de forma relevante, as ações preventivas.This study uses a spatial-temporal model to analyze the spatial spread of the AIDS epidemic (adult cases in the municipality of Rio de Janeiro, Brazil, during three periods: 1988-1990, 1991-1993, and 1994-1996. City districts were used as the geographic units of analysis. A spatial analysis was also performed for pediatric AIDS cases due to vertical HIV transmission, according to period of birth, 1985-90 and 1991-96. For total adult AIDS cases, the initial period was characterized by a polygonal cluster located around the harbor area, which expanded from west to east. Among homosexual cases, in situ growth predominated, and a decrease in
Decontamination systems information and research program. Quarterly report, January 1996--March 1996
International Nuclear Information System (INIS)
1996-04-01
West Virginia University (WVU) and the US Department of Energy, Morgantown Energy Technology Center (DOE/METC) entered into a Cooperative Agreement in August 1992 titled open-quotes Decontamination Systems Information and Research Programsclose quotes (DOE Instrument No.: DE-FC21-92MC29467). Requirements stipulated by the Agreement require WVU to submit quarterly Technical Progress reports. This report contains the efforts of the research projects comprising the Agreement for the 1st calendar quarter of 1996. For the period January 1 through December 31, 1996 twelve projects have been selected for funding, and the Kanawha Valley will continue under a no-cost extension. Three new projects have also been added to the program. This document describes these projects involving decontamination, decommissioning and remedial action issues and technologies
1996 annual report; Rapport annuel 1996
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-12-31
This 1996 issue of the annual report of the French Commissariat a l`Energie Atomique (CEA) gives a general overview of CEA organization, activities, human resources, international relations and external communication with some budgetary informations. The main activities described concern the national defence, the fuel cycle, the nuclear reactors, the condensed matter and life sciences, the advanced technologies, the protection and transfer of knowledge and technologies, the environmental activities, the management and processing of nuclear wastes, the nuclear protection and safety, the technical and scientific information, the teaching and training, the scientific prizes, the committees, councils and commissions. (J.S.).
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-07-01
This energy balance of the Santa Catarina State presents the following main topics that can be outstanding: panorama of the energy matrix; supply and demand of energy by source 1983-1996; energy consumption by sector 1983/1996; socio-economic aspects; resources and reserves energy; and balance of the transformation centers 1984/1996.
National Oceanic and Atmospheric Administration, Department of Commerce — During September 20-23, 1993 and May 9-12, 1994, a total of 200 samples were collected at proposed dredge disposal sites along the Intercoastal Waterway in Aransas...
The Indigenous World, 1996-97 = El Mundo Indigena, 1996-97.
Erni, Christian, Ed.
This annual publication (published separately in English and Spanish) examines political, legal, social, and educational issues concerning indigenous peoples around the world during 1996-97. Part I highlights news events and ongoing situations in specific countries. In North America, these include threats of proposed oil drilling on sacred sites…
Energy Technology Data Exchange (ETDEWEB)
Harrach, R.J.
1996-01-01
This summary provides an overview of LLNL`s environmental activities in 1996, including radiological and nonradiological surveillance, effluent and compliance monitoring, remediation, assessment of radiological releases and doses, and determination of the impact of LLNL operations on the environment and public health.
FY 1996 Congressional budget request: Budget highlights
Energy Technology Data Exchange (ETDEWEB)
1995-02-01
The FY 1996 budget presentation is organized by the Department`s major business lines. An accompanying chart displays the request for new budget authority. The report compares the budget request for FY 1996 with the appropriated FY 1995 funding levels displayed on a comparable basis. The FY 1996 budget represents the first year of a five year plan in which the Department will reduce its spending by $15.8 billion in budget authority and by $14.1 billion in outlays. FY 1996 is a transition year as the Department embarks on its multiyear effort to do more with less. The Budget Highlights are presented by business line; however, the fifth business line, Economic Productivity, which is described in the Policy Overview section, cuts across multiple organizational missions, funding levels and activities and is therefore included in the discussion of the other four business lines.
Tendencias de infecciones intrahospitalarias en un centro oncológico, 1986-1996
Directory of Open Access Journals (Sweden)
Volkow Patricia
2000-01-01
Full Text Available OBJETIVO: Describir los resultados de diez años de vigilancia de infecciones intrahospitalarias (II en un centro oncológico. MATERIAL Y MÉTODOS: Es un estudio descriptivo, retrospectivo, del programa de vigilancia del Comité de Vigilancia y Control de Infecciones Intrahospitalarias del Instituto Nacional de Cancerología, realizado en 1997. Se utilizaron los criterios de infección intrahospitalaria por sitio propuestos por el Centro para la Prevención y el Control de Enfermedades de Atlanta, Georgia, de Estados Unidos de América, en 1972. De junio de 1986 a diciembre de 1996, se estudiaron 62 733 egresos. La vigilancia se realizó mediante la revisión de los expedientes de pacientes con fiebre, de aquellos que reciben antibióticos y de posoperados en los pisos de hospitalización y revisión de cultivos. Se calcularon las tasas de II por episodios/100 egresos. RESULTADOS: La tasa de infecciones intrahospitalarias por 100 egresos fue de 4.4 en 1986; 7.7, en 1987; 8.1, en 1988; 5.9, en 1989; 4.6, en 1990; 5.1, en 1991; 4.3, en 1992; 5.4, en 1993; 7.6, en 1994; 7.1, en 1995, y 8.5, en 1996. El germen más frecuentemente aislado en las II fue Escherichia coli. Los aislamientos de hongos y los de enterococo se incrementaron en casi siete veces desde 1987. CONCLUSIONES: Se observó un incremento en la tasa de infecciones hospitalarias en los últimos cuatro años. Al menos dos factores contribuyeron a esta tendencia: la aplicación de un sistema de vigilancia más experimentado, el cual hizo que disminuyera el subregistro, y el aumento real en la frecuencia de tales infecciones.
Petroleum supply annual 1996: Volume 1
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-06-01
The Petroleum Supply Annual (PSA) contains information on the supply and disposition of crude oil and petroleum products. The publication reflects data that were collected from the petroleum industry during 1996 through annual and monthly surveys. The PSA is divided into two volumes. This first volume contains three sections: Summary Statistics, Detailed Statistics, and Refinery Capacity; each with final annual data. The summary statistics section show 16 years of data depicting the balance between supply, disposition and ending stocks for various commodities including crude oil, motor gasoline, distillate fuel oil, residual fuel oil, jet fuel propane/propylene, and liquefied petroleum gases. The detailed statistics section provide 1996 detailed statistics on supply and disposition, refinery operations, imports and exports, stocks, and transportation of crude oil and petroleum products. The refinery capacity contain listings of refineries and associated crude oil distillation and downstream capacities by State, as of January 1, 1997, as well as summaries of corporate refinery capacities and refinery storage capacities. In addition, refinery receipts of crude oil by method of transportation for 1996 are provided. Also included are fuels consumed at refineries, and lists of shutdowns, sales, reactivations, and mergers during 1995 and 1996. 16 figs., 59 tabs.
Petroleum supply annual 1996: Volume 1
International Nuclear Information System (INIS)
1997-06-01
The Petroleum Supply Annual (PSA) contains information on the supply and disposition of crude oil and petroleum products. The publication reflects data that were collected from the petroleum industry during 1996 through annual and monthly surveys. The PSA is divided into two volumes. This first volume contains three sections: Summary Statistics, Detailed Statistics, and Refinery Capacity; each with final annual data. The summary statistics section show 16 years of data depicting the balance between supply, disposition and ending stocks for various commodities including crude oil, motor gasoline, distillate fuel oil, residual fuel oil, jet fuel propane/propylene, and liquefied petroleum gases. The detailed statistics section provide 1996 detailed statistics on supply and disposition, refinery operations, imports and exports, stocks, and transportation of crude oil and petroleum products. The refinery capacity contain listings of refineries and associated crude oil distillation and downstream capacities by State, as of January 1, 1997, as well as summaries of corporate refinery capacities and refinery storage capacities. In addition, refinery receipts of crude oil by method of transportation for 1996 are provided. Also included are fuels consumed at refineries, and lists of shutdowns, sales, reactivations, and mergers during 1995 and 1996. 16 figs., 59 tabs
1996 Activity report; Rapport d`activite 1996
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-12-31
The 1996 activity report of the Direction for Waste Management of the CEA, is presented. Its activities have been developed in the framework of the general CEA cleaning plan, and include the management of wastes generated before 1992 in R and D CEA facilities, the disposal of spent fuels generated by research reactors (Orphee and Siloe) or prototype reactors (EL4 at Brennilis), and the dismantling and cleaning of obsolete facilities such as the plutonium radiochemistry building at Fontenay-aux-Roses and the pilot workshop at Marcoule
National Oceanic and Atmospheric Administration, Department of Commerce — Temperature, salinity, and other data were collected from bottle and CTD casts from the Nathaniel B. Palmer from 09 November 1994 to 08 December 1994. Data were...
Analogue Signal Processing: Collected Papers 1994-95
DEFF Research Database (Denmark)
1996-01-01
This document is a collection of the papers presented at international conferences and in international journals by the analogue signal processing group of Electronics Institute, Technical University of Denmark, in 1994 and 1995.......This document is a collection of the papers presented at international conferences and in international journals by the analogue signal processing group of Electronics Institute, Technical University of Denmark, in 1994 and 1995....
Yucca Mountain Biological Resources Monitoring Program. Progress report, January 1994--December 1994
International Nuclear Information System (INIS)
1995-07-01
The US Department of Energy (DOE) is required by the Nuclear Waste Policy Act of 1982 (as amended in 1987) to study and characterize the suitability of Yucca Mountain as a potential geological repository for high-level nuclear waste. During site characterization, the DOE will conduct a variety of geotechnical, geochemical, geological, and hydrological studies to determine the suitability of Yucca Mountain as a potential repository. To ensure that site characterization activities do not adversely affect the environment at Yucca Mountain, a program has been implemented to monitor and mitigate potential impacts and ensure activities comply with applicable environmental regulations. This report describes the activities and accomplishments of EG and G Energy Measurements, Inc. (EG and G/EM) from January 1994 through December 1994 for six program areas within the Terrestrial Ecosystem component of the environmental program for the Yucca Mountain Site Characterization Project (YMP): Site Characterization Effects, Desert Tortoises (Gopherus agassizii), Habitat Reclamation, Monitoring and Mitigation, Radiological Monitoring, and Biological Support
Decontamination systems information and research program. Quarterly report, January 1996--March 1996
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-04-01
West Virginia University (WVU) and the US Department of Energy, Morgantown Energy Technology Center (DOE/METC) entered into a Cooperative Agreement in August 1992 titled {open_quotes}Decontamination Systems Information and Research Programs{close_quotes} (DOE Instrument No.: DE-FC21-92MC29467). Requirements stipulated by the Agreement require WVU to submit quarterly Technical Progress reports. This report contains the efforts of the research projects comprising the Agreement for the 1st calendar quarter of 1996. For the period January 1 through December 31, 1996 twelve projects have been selected for funding, and the Kanawha Valley will continue under a no-cost extension. Three new projects have also been added to the program. This document describes these projects involving decontamination, decommissioning and remedial action issues and technologies.
Lake Roosevelt fisheries and limnological research. Annual report 1996
International Nuclear Information System (INIS)
Cichosz, T.A.; Shields, J.P.; Underwood, K.D.; Scholz, A.; Tilson, M.B.
1997-05-01
The Lake Roosevelt Monitoring/Data Collection Program resulted from a merger between the Lake Roosevelt Monitoring Program and the Lake Roosevelt Data Collection Project. This project will model biological responses to reservoir operations, evaluate the effects of releasing hatchery origin kokanee salmon and rainbow trout on the fishery, and evaluate the success of various stocking strategies. In 1996, limnological, reservoir operation, zooplankton, and tagging data were collected. Mean reservoir elevation, storage volume and water retention time were reduced in 1996 relative to the last five years. In 1996, Lake Roosevelt reached a yearly low of 1,227 feet above mean sea level in April, a yearly high of 1,289 feet in July, and a mean yearly reservoir elevation of 1,271.4 feet. Mean monthly water retention times in Lake Roosevelt during 1996 ranged from 15.7 days in May to 49.2 days in October. Average zooplankton densities and biomass were lower in 1996 than 1995. Daphnia spp. and total zooplankton densities peaked during the summer, whereas minimum densities occurred during the spring. Approximately 300,000 kokanee salmon and 400,000 rainbow trout were released into Lake Roosevelt in 1996. The authors estimated 195,628 angler trips to Lake Roosevelt during 1996 with an economic value of $7,629,492
Lake Roosevelt Fisheries and Limnological Research : 1996 Annual Report.
Energy Technology Data Exchange (ETDEWEB)
Cichosz, Thomas A.; Underwood, Keith D.; Shields, John; Scholz, Allan; Tilson, Mary Beth
1997-05-01
The Lake Roosevelt Monitoring/Data Collection Program resulted from a merger between the Lake Roosevelt Monitoring Program and the Lake Roosevelt Data Collection Project. This project will model biological responses to reservoir operations, evaluate the effects of releasing hatchery origin kokanee salmon and rainbow trout on the fishery, and evaluate the success of various stocking strategies. In 1996, limnological, reservoir operation, zooplankton, and tagging data were collected. Mean reservoir elevation, storage volume and water retention time were reduced in 1996 relative to the last five years. In 1996, Lake Roosevelt reached a yearly low of 1,227 feet above mean sea level in April, a yearly high of 1,289 feet in July, and a mean yearly reservoir elevation of 1,271.4 feet. Mean monthly water retention times in Lake Roosevelt during 1996 ranged from 15.7 days in May to 49.2 days in October. Average zooplankton densities and biomass were lower in 1996 than 1995. Daphnia spp. and total zooplankton densities peaked during the summer, whereas minimum densities occurred during the spring. Approximately 300,000 kokanee salmon and 400,000 rainbow trout were released into Lake Roosevelt in 1996. The authors estimated 195,628 angler trips to Lake Roosevelt during 1996 with an economic value of $7,629,492.
International Nuclear Information System (INIS)
Geslin, J.K.; Moyer, T.C.
1995-01-01
This report summarizes lithologic logging of core from boreholes at Yucca Mountain, Nevada, conducted from March 1994 to June 1994. Units encountered during logging include Quaternary-Tertiary alluvium and colluvium, Tertiary Rainier Mesa Tuff, all units in the Tertiary Paintbrush Group, and Tertiary Calico Hills Formation. Logging results are presented in a table of contact depths for core from unsaturated zone neutron (UZN) boreholes and graphic lithologic logs for core from north ramp geology (NRG) boreholes
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-07-01
This 13th edition presents the Energy Information Administration`s historical energy statistics. For most series, statistics are given for every year from 1949 through 1994; thus, this report is well-suited to long-term trend analyses. It covers all major energy activities, including consumption, production, trade, stocks, and prices for all major energy commodities, including fossil fuels and electricity. Statistics on renewable energy sources are also included: this year, for the first time, usage of renewables by other consumers as well as by electric utilities is included. Also new is a two-part, comprehensive presentation of data on petroleum products supplied by sector for 1949 through 1994. Data from electric utilities and nonutilities are integrated as ``electric power industry`` data; nonutility power gross generation are presented for the first time. One section presents international statistics (for more detail see EIA`s International Energy Annual).
Water levels in the Yucca Mountain Area, Nevada, 1996
International Nuclear Information System (INIS)
Graves, R.P.
1998-01-01
Water levels were monitored in 24 wells in the Yucca Mountain area, Nevada, during 1996. Twenty-two wells representing 28 depth intervals were monitored periodically, generally on a monthly basis, and 2 wells representing 3 depth intervals were monitored both hourly and periodically. All wells monitor water levels in Tertiary volcanic rocks except one that monitors water levels in paleozoic carbonate rocks. Water levels were measured using either calibrated steel tapes or a pressure sensor. Mean water-level altitudes in the Tertiary volcanic rocks ranged from about 727.86 to about 1,034.58 meters above sea level during 1996. The mean water-level altitude in the well monitoring the Paleozoic carbonate rocks was about 752.57 meters above sea level during 1996. Mean water-level altitudes for 1996 were an average of about 0.06 meter lower than 1995 mean water-level altitudes and 0.03 meter lower than 1985--95 mean water-level altitudes. During 1996, water levels in the Yucca Mountain area could have been affected by long-term pumping at the C-hole complex that began on May 8, 1996. Through December 31, 1996, approximately 196 million liters were pumped from well UE-25 c number-sign 3 at the C-hole complex. Other ground-water pumpage in the Yucca Mountain area includes annual pumpage from water-supply wells UE-25 J-12 and UE-25 J-13 of approximately 163 and 105 million liters, respectively, and pumpage from well USW G-2 for hydraulic testing during February and April 1996 of approximately 6 million liters
Activity report 1993-1994; Rapport d`activite 1993-1994
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-05-01
This reports presents the Leon Brillouin Laboratory (LLB) activity during 1993-1994. Concerning the physico-chemical and biological systems, polymers are still a main field of the LLB. New ideas and experiments appeared also in the field water, ionic solids, polyelectrolyte and biologicals systems. Concerning structures and phase transitions, activity in the field of crystalline structures has been reinforced. Disordered systems, metallurgy and material fields were also developed. Concerning magnetism and superconductivity, important results were obtained. (TEC). 159 refs., 241 figs., 29 tabs.
Progress Report 1994-1995; Rapport d`Activite 1994-1995
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-12-31
This third volume of 1994 to 1995 activity report, of Nuclear Physics Institute (Orsay, France) gives a general overview of the research programs conducted in the fields of nuclear structure (exotic nuclei, discrete high spin states). Other topics have been studied in high excitation energy states and giant resonances, and in nucleus-nucleus collision and hot nuclei. Other topics deal with radiochemistry, in particular for optical spectroscopy and physico-chemical studies on actinides and trans-actinides. (D.L.). 340 refs.
Progress Report 1994-1995; Rapport d`Activite 1994-1995
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-12-31
This third volume of 1994 to 1995 activity report, of Nuclear Physics Institute (Orsay, France) gives a general overview of the research programs conducted in the fields of nuclear structure (exotic nuclei, discrete high spin states). Other topics have been studied in high excitation energy states and giant resonances, and in nucleus-nucleus collision and hot nuclei. Other topics deal with radiochemistry, in particular for optical spectroscopy and physico-chemical studies on actinides and trans-actinides. (D.L.). 340 refs.
Theoretical atomic physics for fusion. 1994 Annual Report
International Nuclear Information System (INIS)
Pindzola, M.S.
1994-01-01
The understanding of electron-ion collision processes in plasmas remains a key factor in the ultimate development of nuclear fusion as a viable energy source for the nation. The author's 1993-1994 research proposal delineated several areas of research in electron-ion scattering theory. In the paragraphs below the author summarizes 1994 efforts
Energy Technology Data Exchange (ETDEWEB)
Stefanini, Alberto M; Cinausero, M; Pengo, Ruggero [eds.; Istituto Nazionale di Fisica Nucleare, Legnaro, Padova (Italy). Lab. Nazionali di Legnaro
1998-12-31
This paper describes the activities of the Laboratori Nazionali di Legnaro (LNL) of INFN during 1996. The main field of research of the laboratory is experimental nuclear physics with the use of the heavy-ion beams from the XTU Tandem accelerator and from the new ALPI Linac booster.
International Nuclear Information System (INIS)
Stefanini, Alberto M.; Cinausero, M.; Pengo, Ruggero
1997-01-01
This paper describes the activities of the Laboratori Nazionali di Legnaro (LNL) of INFN during 1996. The main field of research of the laboratory is experimental nuclear physics with the use of the heavy-ion beams from the XTU Tandem accelerator and from the new ALPI Linac booster
Automated System Marketplace 1994.
Griffiths, Jose-Marie; Kertis, Kimberly
1994-01-01
Reports results of the 1994 Automated System Marketplace survey based on responses from 60 vendors. Highlights include changes in the library automation marketplace; estimated library systems revenues; minicomputer and microcomputer-based systems; marketplace trends; global markets and mergers; research needs; new purchase processes; and profiles…
Energy Technology Data Exchange (ETDEWEB)
Vaishnys, P; Krenevichius, R; Alejev, A; Demchenko, M [State Nuclear Power Safety Inspectorate (VATESI), Vilnius (Lithuania); and others
1998-12-31
The first annual report of VATESI - Lithuanian Nuclear Safety Authority`s activity is presented and cover description of the main results in 1996. VATESI was established in 1991 recently after regaining of independence when Ignalina NPP come into jurisdiction of Republic of Lithuania. Since the establishment in six year period of operation VATESI developed its activities considerably and now is able to perform the functions of independent regulator of nuclear safety in Lithuania. The main fields of VATESI activities in 1996 were evaluation of the safety of Ignalina NPP, supervision of Ignalina NPP`s operational safety, control of the implementation of safety improvement program SIP-1 in Ignalina NPP, development of new regulatory legislation according to IAEA standards and practices, accountancy and control of nuclear materials, regulation of radioactive waste management. Detailed description of all these activities is provided in the report. In 1996 there were no safety significant events in Ignalina NPP according to the INES scale, only five events received qualification as level 1 events. 2 tabs.,10 figs.
Lyons, E T; Tolliver, S C; Collins, S S; Drudge, J H
2001-05-22
Research carried out during the last 4 years (1996-1999) of an 11-year study of the prevalence of internal parasites naturally transmitted to horse foals born on the same pasture on a farm in central Kentucky is presented here. Horses in this herd were not treated with any antiparasitic compound for over 20 years except for a replacement stallion in 1994. A total of 22 species, including 12 species of small strongyles, were recovered in the 4-year period. Transmission patterns of all species (n=35) of endoparasites recovered are compared for the 11-year study. Some of the changes were an increase in number of Thelazia lacrymalis and Anoplocephala perfoliata and a decrease in Gasterophilus intestinalis, Parascaris equorum, and Strongylus vulgaris. Clinical problems associated with parasitism were not observed in any of the 92 foals in the long-term investigation.
Affirmative Action Plans, January 1, 1994--December 31, 1994. Revision
Energy Technology Data Exchange (ETDEWEB)
1994-02-16
This document is the Affirmative Action Plan for January 1, 1994 through December 31, 1994 for the Lawrence Berkeley Laboratory, University of California (``LBL`` or ``the Laboratory.``) This is an official document that will be presented upon request to the Office of Federal Contract Compliance Programs, US Department of Labor. The plan is prepared in accordance with the Executive Order 11246 and 41 CFR Section 60-1 et seq. covering equal employment opportunity and will be updated during the year, if appropriate. Analyses included in this volume as required by government regulations are based on statistical comparisons. All statistical comparisons involve the use of geographic areas and various sources of statistics. The geographic areas and sources of statistics used here are in compliance with the government regulations, as interpreted. The use of any geographic area or statistic does not indicate agreement that the geographic area is the most appropriate or that the statistic is the most relevant. The use of such geographic areas and statistics is intended to have no significance outside the context of this Affirmative Action Plan, although, of course, such statistics and geographic areas will be used in good faith with respect to this Affirmative Action Plan.
Poverty in Mexico in the 1990s
Salas, Jesus Manuel
2003-01-01
This paper explores poverty trends in Mexico during the 1990's using three different definitions of poverty. The paper then uses poverty convergence analysis to explore the pre-crisis (1992-1994), the crisis (1994-1996), and the recovery periods (1996-1998). Finally, the paper incorporates a regional analysis in order to examine these poverty effects in greater detail.
Electric power monthly, April 1994
Energy Technology Data Exchange (ETDEWEB)
1994-04-01
The Electric Power Monthly (EPM) presents monthly electricity statistics. The purpose of this publication is to provide energy decisionmakers with accurate and timely information that may be used in forming various perspectives on electric issues that lie ahead. This publication provides monthly statistics at the U.S., Census division, and State levels for net generation, fossil fuel consumption and stocks, quantity and quality of fossil fuels, cost of fossil fuels, electricity sales, revenue, and average revenue per kilowatthour of electricity sold. Data on net generation, fuel consumption, fuel stocks, quantity and cost of fossil fuels are also displayed for the North American Electric Reliability Council (NERC) regions. This April 1994 issue contains 1993 year-end data and data through January 1994.
International Nuclear Information System (INIS)
1995-01-01
The following main activities of the CUAEPP performed in 1994 are outlined: adopting of regulatory acts after coming into force of Vienna Convention and Atomic Energy Law, activities of INIS Centre, nuclear facilities safety control, emergency events at the Kozloduj NPP, results from safety probabilistic assessment, radiation protection, safety control of the ionizing radiation sources utilization, state of uranium mining, review of radiation incidents. 17 figs
International Nuclear Information System (INIS)
1994-01-01
The Scottish Universities Research and Reactor Centre (SURRC) at East Kilbride provides research and teaching facilities associated with a research reactor for the Scottish Universities. The document contains details of current (1994) research programs. Research covers a broad range of subjects, often pursued with the collaboration of other institutions. A wide range of experimental facilities exists funded by a mixture of grants and commercial contracts. (UK)
Mixed Waste Management Facility groundwater monitoring report: Third quarter 1994
International Nuclear Information System (INIS)
1994-12-01
Currently, 125 wells monitor groundwater quality in the uppermost aquifer beneath the Mixed Waste Management Facility (MWMF) at the Savannah River Site. Samples from the wells are analyzed for selected heavy metals, herbicides/pesticides, indicator parameters, radionuclides, volatile organic compounds, and other constituents. As in previous quarters, tritium and trichloroethylene were the most widespread elevated constituents during third quarter 1994. Sixty-four (51%) of the 125 monitoring wells contained elevated tritium activities. Trichloroethylene concentrations exceeded the final PDWS in 22 (18%) wells. Chloroethene, 1,1-dichloroethylene, and tetrachloroethylene, elevated in one or more wells during third quarter 1994, also occurred in elevated levels during second quarter 1994. These constituents generally were elevated in the same wells during both quarters. Gross alpha, which was elevated in only one well during second quarter 1994, was elevated again during third quarter. Mercury, which was elevated during first quarter 1994, was elevated again in one well. Dichloromethane was elevated in two wells for the first time in several quarters
IEA FBC Biannual report 1993-1994
Energy Technology Data Exchange (ETDEWEB)
Hupa, M.; Matinlinna, J.
1995-12-31
This publication is the 14th report (biannual, 1993-1994) of the Executive Committee of the International Energy Agency (IEA) Implement Agreement for Co-operation in the Filed of Fluidized Bed Conversion of Fuels Applied to Clean Energy Production. It has been submitted to IEA in accordance with the provisions of the agreement. This report is edited by Aabo Akademi University, Finland, which has been the operating agent during 1994. The report includes contributions from all the participating member countries. During this period Aabo Akademi University received additional financial support from the Combustion and Gasification Programme LIEKKI 2 of Finland
Directory of Open Access Journals (Sweden)
Ethel Sánchez
2004-03-01
Full Text Available Los euglenoides son eucariotas unicelulares flagelados que habitan ambientes acuáticos y suelos de una gran diversidad de ecosistemas. Este trabajo presenta la descripción morfológica ultraestructural del euglenoide E. pailasensis aislado de las fuentes de lodo caliente de las "pailas de barro" en el Volcán Rincón de la Vieja, Guanacaste, Costa Rica. La temperatura de estos sitios puede variar entre 38 y 98° C y puede tener un pH entre 1 y 4. El estudio se realizó utilizando microscopia electrónica de barrido y transmisión. El euglenoide está constituido por una célula típica que puede medir de 30 a 45 µm de largo y 8-10 µm de ancho, con membrana externa, película, cloroplastos, mitocondrias, núcleo, pigmentos granulares y demás organelas citoplasmáticas de un eucarionte. Esta delimitado por una membrana continua y por una película compuesta de aproximadamente 40 - 90 mionemas que miden entre 0.8 y 1.0 µm de ancho, dispuestas helicoidalmente sobre la célula. Se observó 5 cloroplastos elongados por célula, de 1-2 µm de diámetro y 6-12 µm de largo, delimitados por tres membranas y localizados en la periferia celular. Este posee glóbulos osmiofílicos y un pirenoide penetrado por pocos tilacoides. El material nutritivo se almacena en gránulos de paramilón y las mitocondrias presentan las crestas en disposición radial hacia el interior del lumen. La zona de la ámpula se observó sin flagelo y se notó una red de fibrillas que envuelve el espécimen. Las características ultraestructurales observadas en este estudio, no permiten explicar la capacidad de E. pailasensis para habitar en el ambiente volcánico extremo de las Pailas de Barro CalienteThe euglenoids are unicellular eukaryotic flagellates living in a diversity of soils and aquatic environments and ecosystems. This study describes the ultrastructure of an euglenoid isolated from the surface of a boiling mud pool with temperatures ranging from 38 to 98°C and p
Directory of Open Access Journals (Sweden)
Carmen Acosta
2001-06-01
Full Text Available Se realizó un estudio seroepidemiológico con 207 gestantes, residentes en el municipio Marianao de Ciudad de la Habana, con la finalidad de conocer la presencia de anticuerpos IgG anti-rubéola, anti-citomegalovirus y anti-herpes simple (1 y 2; el nivel de positividad se expresó como la relación de la fluorescencia de la muestra con respecto a la del control positivo, para un nivel de corte de 0,3 para rubéola, 0,2 para citomegalovirus y 0,185 para herpes simple. Las seroconversiones se expresaron como el incremento de esta relación con respecto a la determinación realizada en el primer trimestre de embarazo. El 91,3% de las gestantes resultaron positivas para rubéola, el 92,7% para citomegalovirus y el 98,1% para herpes simple. Se sugiere la valoración de aspectos fundamentales relacionados con estas infecciones dentro del Programa Nacional de Atención a las Embarazadas.
Cogema in 1996: increasing turnover and stable net results
International Nuclear Information System (INIS)
Anon.
1997-01-01
This short article gives some financial informations about the Cogema group for 1996. The net result for 1996 reached 977 millions of French Francs (FF) with respect to 973 for the previous year. The turnover reached 34.427 billions of FF in 1996 and 30.611 in 1995, which represents a 12.5% growth. In the mining sector, the turnover has decreased to 2.853 billions of FF with respect to 3.238 in 1995. In the engineering and industry services sector the turnover of the overall companies, with the exception of Cogema, has considerably progressed (2.199 billions of FF in 1996, 1.738 in 1995). (J.S.)
Metropolitan Optical Networks 1996 Annual Report
DEFF Research Database (Denmark)
Kristensen, Martin; Jouanno, Jean-Marc; Malone, Kevin
1997-01-01
The report desribes the reasearch carried out in the ACTS-project METON (Metropolitan Optical Networks) in 1996. L.M. Ericsson is prime contractor and 12 partners are involved in the project including DTU, i.e. EMI and MIC.......The report desribes the reasearch carried out in the ACTS-project METON (Metropolitan Optical Networks) in 1996. L.M. Ericsson is prime contractor and 12 partners are involved in the project including DTU, i.e. EMI and MIC....
Europe and Asia in Space, 1993-1994.
1993-01-01
For Privatization", Aviation Week and Space Technology, 27 June 1994, pp. 22-23. 96. "RKK Energia Issues Stock Due to Privatization Order", Space News...multi-year renovation project was undertaken in Kourou to support not only the forthcoming Ariane 5 but also the con- tinuing Ariane 4 missions. By...via the newly formed Lockheed- Khrunichev- Energia joint venture. By the end of 1994 no commercial Proton launches had been undertaken, and the first
Petroleum industry 1996; L`industrie petroliere 1996
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-12-31
A survey on petroleum industry activities in France and in the world in 1996 is presented. The different parts and themes of the study are: evolution of the petroleum market (international and French markets, supply and demand, prices, mark-up and taxation in France and in Europe); activities in the petroleum industries (exploration and production, maritime transportation, inland transportation and storage, refining, quality of petroleum products and substitution fuels, oil distribution); environment and safety (refining, distribution and evolution of products, pipeline and maritime transportation, exploration and production); situation of the sector`s companies (oil groups, para-petroleum French industry, scientific and technical research)
Petroleum industry 1996; L`industrie petroliere 1996
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-12-31
A survey on petroleum industry activities in France and in the world in 1996 is presented. The different parts and themes of the study are: evolution of the petroleum market (international and French markets, supply and demand, prices, mark-up and taxation in France and in Europe); activities in the petroleum industries (exploration and production, maritime transportation, inland transportation and storage, refining, quality of petroleum products and substitution fuels, oil distribution); environment and safety (refining, distribution and evolution of products, pipeline and maritime transportation, exploration and production); situation of the sector`s companies (oil groups, para-petroleum French industry, scientific and technical research)
Energy Balance of the Santa Catarina State - Series 1980 -1996
International Nuclear Information System (INIS)
1997-01-01
This energy balance of the Santa Catarina State presents the following main topics that can be outstanding: economic aspects; supply and demand of energy by source 1980-1996; energy consumption by sector 1980/1996; energy interchange; and balance of the transformation centers 1980/1996
JAERI TIARA annual report 1994. V.4. April 1994 - March 1995
Energy Technology Data Exchange (ETDEWEB)
Tanaka, Ryuichi; Seguchi, Tadao; Nashiyama, Isamu [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment; eds.; and others
1995-10-01
This annual report describes research activities which have been performed with the JAERI TIARA (Takasaki Ion Accelerators for Advanced Radiation Application) facilities from April 1, 1994 to March 31, 1995. Summary reports of 86 papers and briaf descriptions on status of TIARA in the period are contained. A list of publications, the type of research collaborations and organization of TIARA are also given as appendices. (author).
JAERI TIARA annual report 1994. V.4. April 1994 - March 1995
International Nuclear Information System (INIS)
Tanaka, Ryuichi; Seguchi, Tadao; Nashiyama, Isamu
1995-10-01
This annual report describes research activities which have been performed with the JAERI TIARA (Takasaki Ion Accelerators for Advanced Radiation Application) facilities from April 1, 1994 to March 31, 1995. Summary reports of 86 papers and briaf descriptions on status of TIARA in the period are contained. A list of publications, the type of research collaborations and organization of TIARA are also given as appendices. (author)
1994 Asia/Pacific mining yearbook and suppliers' source
Energy Technology Data Exchange (ETDEWEB)
1994-01-01
Contains a series of articles covering various aspects of the mining and minerals industries of Australia, New Zealand, Malaysia, Indonesia, Thailand, Laos, Vietnam, the Philippines, Russia, China, Myanmar, India and Papua New Guinea. Also contains the 1994 mining products and services buyer's guide, and the 1994 mining suppliers' source directory which provides information on the companies listed in the buyer's guide.
Research laboratories annual report 1994
International Nuclear Information System (INIS)
1996-01-01
The publication is the 1994 annual report of the Israel atomic energy commission in a new format. The report includes three invited papers and a bibliographic list of publications by the commission scientific researches
Research laboratories annual report 1994
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-10-01
The publication is the 1994 annual report of the Israel atomic energy commission in a new format. The report includes three invited papers and a bibliographic list of publications by the commission scientific researches.
Kuidas valiti president 1996. aastal? / Rein Toomla
Toomla, Rein, 1951-
2002-01-01
Autor leiab 1996. aasta presidendivalimisi analüüsides, et oluliseks tuleb pidada seda, et valimised suudeti põhiseaduses ettenähtud korras läbi viia ning ei pidanud käivituma erakorraliste valimiste mehhanism. Tabelid: 1995. a. Riigikogu valimised; Riigikogu fraktsioonid 1996. a. suvel; Toetus presidendikandidaatidele; Presidendivalimised Riigikogus; Arvatavasti Lennart Meri poolt; Arvatavasti Arnold Rüütli poolt; Presidendivalimised Valimiskogus
National Oceanic and Atmospheric Administration, Department of Commerce — During September 1995 and May 1996, a total of 100 drop samples were taken in Upper Galveston Bay to assess potential oil spill damage to salt marsh habitats and...
Die dialektiek in die waardes van die 1996 Grondwet
Directory of Open Access Journals (Sweden)
J Swanepoel
1998-11-01
Full Text Available In his paper The Dialectics in the Values of the 1996 Constitution Jan Swanepoel discusses various value statements in the 1996 Constitution of the Republic of South Africa and focuses the attention on indications of a lack of coherence as far as these value statements are concerned.He does this against the background of some introductory perspectives on the 1996 Constitution. In this regard he points out that the 1996 Constitution, as successor to the 1993 Constitution with its set of thirty four constitutional principles, can be regarded as a document of political and ideological compromise. He points out that constitutions (and in particular the value statements in Bills of Rights generally tend to be formulated rather broadly in order to promote flexibility and adaptability. He also focuses the attention on the fact that such a dialectic of values point to the variety of interests that has to be harmonized in a modern state, something which is unmistakably the case in South Africa with its heterogeneous society.The 1996 Constitution contains a variety of "value terms". A closer study of these terms does, however, indicate that these terms (value, principle, foundation, and the like are not used in a very systematic or technical fashion.The problems regarding the value statements are, however, not only of a terminological nature. There are also some substantive problems, as becomes clear from a discussion of value terms in the Preamble and in Sections 1 and 7 of the 1996 Constitution. Swanepoel indicates that a tension exists between what can be called the "process" formulation in section 1(a and the "state of affairs" formulation of the values in section 7(1. . While section 1(a speaks of "the achievement of equality" and "the advancement of human rights and freedoms", section 7(1 simply makes mention of "equality" and "freedom". The dialectic between these two formulations is discussed with reference to other relevant sections of the 1996
Eficiencia del programa de prevención de anemia falciforme en Ciudad de La Habana
Directory of Open Access Journals (Sweden)
Marcos Raúl Martín Ruiz
2000-10-01
Full Text Available Con vistas a evaluar la eficiencia del programa cubano de prevención de anemia falciforme en Ciudad de La Habana, se realizó un estudio retrospectivo en gestantes portadoras en 2 períodos: 1995-97 y 1998. Los parámetros evaluados fueron los siguientes: edad gestacional en la que la pareja concluye su estudio del riesgo, y causas de no terminación del estudio. El principal resultado fue que el 76,6 % en 1995-97 y 83,6 % en 1998 de las parejas de alto riesgo detectadas por primera vez concluyeron el estudio antes de las 22 semanas de edad gestacional. Asimismo, hubo disminución de la proporción de gestantes no localizadas del 12,6 % al 4,5 %. Se recoge un aumento de la proporción de inasistentes del 14,6 al 19,5 %, probablemente a causa de gestantes que ya conocían el riesgo con anterioridad. Estos resultados muestran un progresivo aumento en la eficiencia del programa. Se requiere continuar incrementando su eficienciaIn order to evaluate the efficiency of the Cuban Program of Prevention of Sickle Cell Anemia in Havana City, a retrospective study was conducted among pregnant carriers in 2 periods: 1995-97 and 1998. The following parameters were evaluated: gestational age at which the couple concluded their risk study and the causes not to end the study. The main result was that 76,6 % in 1995-97 and 83,6 % in 1998 of the high risk couples detected for the first time finished the study before the 22 weeks of gestational age. Likewise, it was observed a reduction of the number of non-localized expectants from 12,6 % to 4,5 %. There was an increase in the proportion of non-attendants from 14,6 to 19,5 %, probably due to the fact that some pregnant women already knew the risk. These results showed a progressive increase in the efficiency of the program. It is necessary to continue improving its efficiency
Indicación temprana de electroforesis de hemoglobina a gestantes de Ciudad de La Habana
Directory of Open Access Journals (Sweden)
Marcos Raúl Martín Ruiz
2000-06-01
Full Text Available Con el propósito de lograr la detección temprana de parejas de alto riesgo de tener hijos con anemia falciforme en una edad gestacional lo más temprana posible, se estableció en el sistema nacional de salud en 1991-92 que el pesquisaje de hemoglobinas anormales en gestantes se hiciera en la captación del embarazo. Para evaluar la medida se consideraron 9 424 indicaciones de 80 áreas de salud de Ciudad de La Habana en 1999, con un 86,5 % de indicaciones tempranas globalmente, mientras que en 1992 fue 46,4 %. En la distribución de áreas de salud por intervalos según porcentaje de indicación temprana, se encontró: 75 al 84 %: 26 áreas de salud (32,5 %; 85-89 %: 29 (36,3 %; 90-94 %: 25 (31,3 %; y 95 % y más: ninguno. Se muestra en los resultados una notable mejoría en el cumplimiento de la medida. Todavía es necesario mejorar la divulgación y principalmente en áreas de salud todavía con insuficiencias.In order to detect as early as possible those couples at high risk for having children with sickle cell anemia, it was established in the national health system in l991-92 that the screening of abnormal hemoglobins in pregnant women should be made at the time of catchment. To evaluate the measure 9 424 indications of 80 health areas in Havana City were evaluated in l999, with 86,5% of early indications, whereas in l992 it was 46,4%. In the distribution of health areas by intervals according to the percentage of early indication the following results were obtained: 75-84%: 26 health areas (32,5%; 85-89%: 29 (36,3%; 90-94%: 25 (31,3% and 95% and over: none. It is observed a significant improvement concerning the fulfillment of this measure. It is still necessary to enhance spreading, mainly in those health areas with deficiencies
Directory of Open Access Journals (Sweden)
Vásquez Ordoñez Rafael
1997-12-01
Full Text Available El presente artículo describe y analiza el comportamiento del sector agrícola del país durante 1996. Para ello, hemos estudiado la evolución de cada una de las variables más importantes del sector, tales como el crecimiento del Producto Bruto Agrícola, el crédíto, los precios, las importaciones y exportaciones, la estructura de tenencia de la tierra, las inversiones y el desempeño de los productos agrícolas más significativos.This article deals with the agriculture in Colombia during 1996. Founded on some indicators such as growth of the production, land reform, credits, prizes, balance of payment, etc. It gathers information and analyses the mains economics and management techniques carried out by Agriculture Ministery, to garantee an appropriate administration of the agricultural sector in Colombia. It has also been consideret the suitable actions to solve the mains problems of the agricultural sector. Finally, some results obtained to december 1996 are presented.
1996 annual report; Rapport annuel 1996
Energy Technology Data Exchange (ETDEWEB)
Scheller, M [CEO, 75 - Paris (France)
1997-12-31
The 1996 annual report of the French national office of aerospace studies and researches (ONERA) presents the missions, organization, financial and operating highlights, sites and workforce, research activity, facilities, international relations and human resources of this company. ONERA`s research goals are the following: spanning the spectrum of civil and military aircraft requirements, feeding the booming civil aviation market, the development of tomorrow`s supersonic transport, the French-German cooperation on future helicopters design, design of aircraft and missile navigation instruments, applied research and simulation on turbo-machineries, development support for Ariane rocket and reentry vehicles, earth and space observation, ground and airborne radars, tactical and strategic missiles, hypersonic propulsion, development of new materials and enhanced numerical simulation. (J.S.)
1996 annual report; Rapport annuel 1996
Energy Technology Data Exchange (ETDEWEB)
Scheller, M. [CEO, 75 - Paris (France)
1996-12-31
The 1996 annual report of the French national office of aerospace studies and researches (ONERA) presents the missions, organization, financial and operating highlights, sites and workforce, research activity, facilities, international relations and human resources of this company. ONERA`s research goals are the following: spanning the spectrum of civil and military aircraft requirements, feeding the booming civil aviation market, the development of tomorrow`s supersonic transport, the French-German cooperation on future helicopters design, design of aircraft and missile navigation instruments, applied research and simulation on turbo-machineries, development support for Ariane rocket and reentry vehicles, earth and space observation, ground and airborne radars, tactical and strategic missiles, hypersonic propulsion, development of new materials and enhanced numerical simulation. (J.S.)
Houston Ship Channel 1993-1994
National Oceanic and Atmospheric Administration, Department of Commerce — Between May 5, 1993 and September 19, 1994, we collected quantitative 1-m2 area drop samples and measured a variety of habitat attributes using field surveys and...
Activity report 1994-1998; Rapport d'activite 1994-1998
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-07-01
The emergence of new energy, chemicals and materials markets for agricultural products has created a need for major sustainable research. With this end in mind the scientific interest group AGRICE (AGRiculture for Chemicals and Energy) was created in 1994 by government bodies. This document presents a wide summary of the works in the following activities: the biofuels, the biomaterials and biomolecules, the oil-ester ethanol-ETBE and lignocellulosic processing chains, the environmental and economic evaluation, a financial statement. (A.L.B.)
Zure depositie in Nederland: Scenarioresultaten voor 1994 en 2000
Schutter MAA; de Leeuw FAAM
1991-01-01
By means of an atmospheric transport model estimates have been made of the total potential acid deposition in the Netherlands for the years 1980, 1985, 1994 and 2000. Spatial resolution of the calculation was 5 x 5 km2. Emission inventories appied for 1994 and 2000 are based on the emission
Directory of Open Access Journals (Sweden)
Aguilera Manzano, José María
2007-06-01
Full Text Available This paper provides a “biographical record” of all journals and printing press of Havana between 1824 and 1845. Each description highlights the more salient features of the journal and printing press. The objective of this exercise was to show the different texts with different underlying ideologies that were produced at this time in Havana. To add depth to this work, some magazines and newspapers of that period have been ‘reconstructed’ in a virtual way, by putting together those numbers available in Cuba with those that have survived only in Spanish collections.
El objetivo de esta investigación ha sido la elaboración de una “ficha biográfica” de todas las publicaciones periódicas e imprentas de La Habana entre 1824 y 1845. En ellas hemos descrito los rasgos más significativos de cada obra, con el objetivo de poner de manifiesto cómo se editaron periódicos que respondían a ideologías muy diversas. Junto a ello, de forma paralela, hemos intentado averiguar qué números de estos textos están disponibles actualmente en las colecciones existentes en Cuba y España. Esto nos ha permitido “reconstruir” obras que sólo se conservan de forma parcial a uno y otro lado del Atlántico.
International Nuclear Information System (INIS)
1994-01-01
Syncrude Canada Ltd. is the world's largest producer of custom made crude oil from the oil sands, and the largest single source of oil in Canada. This annual report claimed many outstanding achievements for 1994. A new production record resulted in higher revenue, lower unit operating costs, increased cash flow, improved productivity, and higher net income. With a focus on technology development and continuous improvement in operations, including environment, health and safety performance, operating results are projected to improve further. The formation of the Canadian Oil Sands Network for Research and Development (CONRAD) early in 1994 was a major step assuring maximum leverage from every dollar expended to realize this objective. Production of Syncrude Sweet Blend is expected to rise by over 10 million barrels to 81 million barrels a year at an average cash operating expenditure of Can$12.00/ barrel by the year 2000. The Corporation's business plans include capital investments for major projects, such as the North Mine hydrotransport, product quality enhancements, and upgrading facilities expansion. 4 tabs., 1 fig
AGS experiments -- 1995, 1996 and 1997
Energy Technology Data Exchange (ETDEWEB)
Depken, J.C.; Presti, P.L.
1997-12-01
This report contains (1) FY 1995 AGS schedule as run; (2) FY 1996 AGS schedule as run; (3) FY 1997 AGS schedule as run; (4) FY 1998--1999 AGS schedule (proposed); (5) AGS beams 1997; (6) AGS experimental area FY 1995 physics program; (7) AGS experimental area FY 1996 physics program; (8) AGS experimental area FY 1997 physics program; (9) AGS experimental area FY 1998--1999 physics program (proposed); (10) a listing of experiments by number; (11) two-page summaries of each experiment, in order by number; and (12) listing of publications of AGS experiments.
AGS experiments - 1995, 1996 and 1997
International Nuclear Information System (INIS)
Depken, J.C.; Presti, P.L.
1997-12-01
This report contains (1) FY 1995 AGS schedule as run; (2) FY 1996 AGS schedule as run; (3) FY 1997 AGS schedule as run; (4) FY 1998--1999 AGS schedule (proposed); (5) AGS beams 1997; (6) AGS experimental area FY 1995 physics program; (7) AGS experimental area FY 1996 physics program; (8) AGS experimental area FY 1997 physics program; (9) AGS experimental area FY 1998--1999 physics program (proposed); (10) a listing of experiments by number; (11) two-page summaries of each experiment, in order by number; and (12) listing of publications of AGS experiments
January 1994 Northridge, USA Images
National Oceanic and Atmospheric Administration, Department of Commerce — At 4:31 am local time (12:31 GMT) on Monday, January 17, 1994, a magnitude 6.8 earthquake twenty miles west northwest of downtown Los Angeles awoke nearly everyone...
Lawrence Berkeley Laboratory 1994 site environmental report
International Nuclear Information System (INIS)
1995-05-01
The 1994 Site Environmental Report summarizes environmental activities at Lawrence Berkeley Laboratory (LBL) for the calendar year (CY) 1994. The report strives to present environmental data in a manner that characterizes the performance and compliance status of the Laboratory's environmental management programs when measured against regulatory standards and DOE requirements. The report also discusses significant highlight and planning efforts of these programs. The format and content of the report are consistent with the requirements of the U.S. Department of Energy (DOE) Order 5400.1, General Environmental Protection Program
Lawrence Berkeley Laboratory 1994 site environmental report
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-05-01
The 1994 Site Environmental Report summarizes environmental activities at Lawrence Berkeley Laboratory (LBL) for the calendar year (CY) 1994. The report strives to present environmental data in a manner that characterizes the performance and compliance status of the Laboratory`s environmental management programs when measured against regulatory standards and DOE requirements. The report also discusses significant highlight and planning efforts of these programs. The format and content of the report are consistent with the requirements of the U.S. Department of Energy (DOE) Order 5400.1, General Environmental Protection Program.
Kurylo, M. J.; Kaye, J. A.; Decola, P. L.; Friedl, R. R.; Peterson, D. B.
1997-01-01
This document is issued in response to the Clean Air Act Amendment of 1990, Public Law 101-549, which mandates that the National Aeronautics and Space Administration (NASA) and other key agencies submit triennial report to congress and the Environmental Protection Agency. NASA is charged with the responsibility to report on the state of our knowledge of the Earth's upper atmosphere, particularly the Stratosphere. Part 1 of this report summarizes the objectives, status, and accomplishments of the research tasks supported under NASA's Upper Atmosphere Research Program and Atmospheric Chemistry Modeling and Analysis Program for the period of 1994-1996. Part 2 (this document) presents summaries of several scientific assessments, reviews, and summaries. These include the executive summaries of two scientific assessments: (Section B) 'Scientific Assessment of Ozone Depletion: 1994'; (Section C) 'l995 Scientific Assessment of the Atmospheric Effects of Stratospheric Aircraft); end of mission/series statements for three stratospherically-focused measurement campaigns: (Section D) 'ATLAS End-of-Series Statement'; (Section E) 'ASHOE/MAESA End-of-Mission Statement'; (Section F) 'TOTE/VOTE End-of-Mission Statement'; a summary of NASA's latest biennial review of fundamental photochemical processes important to atmospheric chemistry 'Chemical Kinetics and Photochemical Data for Use in Stratospheric Modeling'; and (Section H) the section 'Atmospheric Ozone Research" from the Mission to Planet Earth Science Research Plan, which describes NASA's current and future research activities related to both tropospheric and stratospheric chemistry.
STAR: Visualization and infrastructure software. Progress report, 1996
International Nuclear Information System (INIS)
Moore, C.F.
1996-11-01
One of the two primary experiments approved for day-one operation at the Relativistic Heavy Ion Collider (RHIC) is the Solenoidal Tracker at RHIC (STAR). This report summarizes the work carried out by personnel from the University of Texas at Austin on the STAR experiment at RHIC during the calendar year 1995--1996. Topics covered are: (1) STAR visualization; (2) DFM, the Data File Manager; (3) LEV: Logging of Environment and Version Information; (4) TBR: the Table Browser; (5) STIC (Star Idl Compiler); (6) CDS (Code Style checker); (7) TOP (Table Operators); (8) Publications 1995--1996; (i) Abstracts of conference or symposium proceedings and reports 1995--1996; and (10) Personnel
STAR: Visualization and infrastructure software. Progress report, 1996
Energy Technology Data Exchange (ETDEWEB)
Moore, C.F.
1996-11-01
One of the two primary experiments approved for day-one operation at the Relativistic Heavy Ion Collider (RHIC) is the Solenoidal Tracker at RHIC (STAR). This report summarizes the work carried out by personnel from the University of Texas at Austin on the STAR experiment at RHIC during the calendar year 1995--1996. Topics covered are: (1) STAR visualization; (2) DFM, the Data File Manager; (3) LEV: Logging of Environment and Version Information; (4) TBR: the Table Browser; (5) STIC (Star Idl Compiler); (6) CDS (Code Style checker); (7) TOP (Table Operators); (8) Publications 1995--1996; (i) Abstracts of conference or symposium proceedings and reports 1995--1996; and (10) Personnel.
Petroleum supply annual 1994. Volume 1
International Nuclear Information System (INIS)
1995-01-01
The Petroleum Supply Annual (PSA) contains information on the supply and disposition of crude oil and petroleum products. The publication reflects data that were collected from the petroleum industry during 1994 through annual and monthly surveys. The PSA is divided into two volumes. This first volume contains four sections: Summary Statistics, Detailed Statistics, Refinery Capacity, and Oxygenate Capacity each with final annual data. The second volume contains final statistics for each month of 1994, and replaces data previously published in the Petroleum Supply Monthly (PSM). The tables in Volumes 1 and 2 are similarly numbered to facilitate comparison between them. Below is a description of each section in Volume 1 of the PSA
International Nuclear Information System (INIS)
1996-01-01
This first volume of 1994 to 1995 activity report, of Nuclear Physics Institute (Orsay, France) gives a general overview of the research programs conducted in the fields of nuclear structure and quantum mechanics. The main topics are: structure of atomic nuclei, physics of nuclei in excited states, field theory, hadronic physics, quantum mechanics of chaotic systems. (D.L.)
International Nuclear Information System (INIS)
1996-01-01
This second volume of 1994 to 1995 activity report, of Nuclear Physics Institute (Orsay, France) gives a general overview of the research programs conducted in the fields of accelerators, detectors, multi channel data acquisition systems. The main topics are: tandem electrons accelerators, beam shaping, targets, control electronics, strip detection chambers, data acquisition electronics, and data acquisition software. (D.L.)
Proceedings of the 1994 DOE/NREL Hydrogen Program Review, April 18--21, 1994, Livermore, California
Energy Technology Data Exchange (ETDEWEB)
1994-07-01
The US Department of Energy has conducted programs of research and development in hydrogen and related technologies since 1975. The current program, conducted in accordance with the DOE Hydrogen Program Plan FY 1993--FY 1997 published in June 1992, establishes program priorities and guidance for allocating funding. The core program, currently under the Office of Energy Management, supports projects in the areas of hydrogen production, storage, and systems research. At an annual program review, each research project is evaluated by a panel of technical experts for technical quality, progress, and programmatic benefit. This Proceedings of the April 1994 Hydrogen Program Review compiles all research projects supported by the Hydrogen Program during FY 1994. For those people interested in the status of hydrogen technologies, we hope that the Proceedings will serve as a useful technical reference. Individual reports are processed separately.
Critical Secondary Military Occupational Specialty (MOS) Study
2002-12-20
total population. E 3 500 400 300 200 100 0 INON 1993 382 1994 304 ISEP I 25 I 23 1995 229 19 1996 446 53 1997 441 57 1998 1999...1994 1995 1996 199711998 1999 2000 2001 2002 2003 LNONJ287J210 ; 147 ISEP 15 ! 7 i 18 156 7 197 197 201 L L_ 192 178 ’ 207 214 14 18 J29 20
1996 NRC annual report. Volume 13
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-10-01
This 22nd annual report of the US Nuclear Regulatory Commission (NRC) describes accomplishments, activities, and plans made during Fiscal Year 1996 (FH 1996)--October 1, 1995, through September 30, 1996. Significant activities that occurred early in FY 1997 are also described, particularly changes in the Commission and organization of the NRC. The mission of the NRC is to ensure that civilian uses of nuclear materials in the US are carried out with adequate protection of public health and safety, the environment, and national security. These uses include the operation of nuclear power plants and fuel cycle plants and medical, industrial, and research applications. Additionally, the NRC contributes to combating the proliferation of nuclear weapons material worldwide. The NRC licenses and regulates commercial nuclear reactor operations and research reactors and other activities involving the possession and use of nuclear materials and wastes. It also protects nuclear materials used in operation and facilities from theft or sabotage. To accomplish its statutorily mandated regulatory mission, the NRC issues rules and standards, inspects facilities and operations, and issues any required enforcement actions.
1996 NRC annual report. Volume 13
International Nuclear Information System (INIS)
1997-01-01
This 22nd annual report of the US Nuclear Regulatory Commission (NRC) describes accomplishments, activities, and plans made during Fiscal Year 1996 (FH 1996)--October 1, 1995, through September 30, 1996. Significant activities that occurred early in FY 1997 are also described, particularly changes in the Commission and organization of the NRC. The mission of the NRC is to ensure that civilian uses of nuclear materials in the US are carried out with adequate protection of public health and safety, the environment, and national security. These uses include the operation of nuclear power plants and fuel cycle plants and medical, industrial, and research applications. Additionally, the NRC contributes to combating the proliferation of nuclear weapons material worldwide. The NRC licenses and regulates commercial nuclear reactor operations and research reactors and other activities involving the possession and use of nuclear materials and wastes. It also protects nuclear materials used in operation and facilities from theft or sabotage. To accomplish its statutorily mandated regulatory mission, the NRC issues rules and standards, inspects facilities and operations, and issues any required enforcement actions
Landelijk Meetnet Regenwatersamenstelling. Meetresultaten 1994
Somhorst MHM; Stolk AP; LLO
1996-01-01
Measurements to determine the chemical composition of precipitation in the Netherlands were carried out in 1994. Measurements were taken from 4-weekly samples obtained from the National Precipitation Chemistry Monitoring Network (LMRe). Samples from 15 stations were analysed for main components and
NREL Photovoltaic Program. FY 1994 annual report, October 1, 1993--September 30, 1994
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-06-01
This report summarizes the in-house and subcontracted research and development activities under the National renewable Energy Laboratory (NREL) Photovoltaics (PV) program for fiscal year 1994. Research is organized under the following areas; PV program management; crystalline silicon and advanced devices; thin-film PV technologies; PV manufacturing; PV module and system performance and engineering; and PV applications and markets.
Analogue Signal Processing: Collected Papers 1996-97
DEFF Research Database (Denmark)
1997-01-01
This document is a collection of the papers presented at international conferences and in international journals by the analogue signal processing group of the Department of Information Technology, Technical University of Denmark, in 1996 and 1997.......This document is a collection of the papers presented at international conferences and in international journals by the analogue signal processing group of the Department of Information Technology, Technical University of Denmark, in 1996 and 1997....
1996 site environmental report, January--December 1996
International Nuclear Information System (INIS)
Cellamare, R.; Dannatt, G.; Dubrow, M.
1997-09-01
This report provides information about environmental programs and compliance with environmental regulations in calendar year 1996 (CY96) at the Stanford Linear Accelerator Center (SLAC). SLAC is a national laboratory operated by Stanford University under contract with the US Department of Energy (DOE) and is devoted to experimental and theoretical research in elementary particle physics in basic sciences using synchrotron radiation, and in accelerator physics and technology. The most significant information in this report is summarized briefly in the following sections: (1) releases; (2) environmental restoration; (3) hazardous and radioactive wastes; (4) air quality; (5) storm water and industrial wastewater; (6) PCB's; (7) assessments; (8) environmental radiological program; (9) groundwater; and (10) additional information
Directory of Open Access Journals (Sweden)
Pilar Marchante Castellanos
Full Text Available En 1863 el poder colonial español aplicó una reforma de la enseñanza en Cuba que dio lugar al Plan de Estudios de 1863 en la Real Universidad de La Habana en virtud del cual adquirió vida propia por primera vez la Facultad de Farmacia. Se exponen las principales transformaciones que experimentó la Universidad a partir de esa reforma, así como los aspectos esenciales que caracterizaron los primeros años de existencia de la Facultad de Farmacia, su plan de estudios, los títulos de algunas tesis presentadas en las academias semanales, sus catedráticos y algunos datos estadísticos sobre los resultados docentes de los estudiantes. El curso 1870-1871 marcó el fin de la primera etapa de aplicación del plan de 1863, cuando se le hicieron algunas modificaciones, fundamentalmente como represalia del Gobierno de la Isla ante la cada vez más fuerte conciencia nacional y el estallido de la primera guerra por la independencia de Cuba. Se hace una breve referencia al contexto político-social en el que se desenvolvió la vida universitaria durante ese período.
Development of an international standard on instruments setpoints based on ISA S67.04 - 1994
International Nuclear Information System (INIS)
Quinn, E.L.
1996-01-01
This is a summary of the application for and development of an international standard on instrument setpoints, based on the Instrument Society of America (ISA) Standard S67.04 - 1994. The forum this new standard was proposed in is the International Electrotechnique Commission (IEC), based in Geneva, Switzerland, which is the international commission which oversees electrical and instrumentation standards for all applications around the world. The Instrument Society of America (ISA) is a United States based Society for the advancement of instrumentation and controls related science and technology and has 30,000 members. A division within the ISA is the Standard and Practices board which has over 5000 members actively involved in standards development and approval. In 1994, the ISA SP67, Nuclear Power Plant Standards Committee authorized that the IEC be approached to develop and issue an IEC standard on Instrument Setpoints. This application was formally submitted in January, 1995 to the IEC and approved for ballot to member countries in June, 1995. Approval for standard development by IEC was received in October, 1995 and the first draft vas issued in February, 1996, and is currently under review by the IEC working group. It is very important to focus on the approach that the U.S. and other countries are taking toward development of IEC standards that can apply to all nuclear instrumentation applications around the world. By referencing IEC standards in design specification, vendors can be solicited from many different countries, thereby ensuring that the highest quality products can be used. This also offsets the need to specify individual standards in the specification, based on the country that each vendor solicited, represents. In summary, this standard development process, with support from the American National Standards Institute (ANSI) will assist U.S. suppliers in competing in the global market for products and services into the next century. (author)
[A commentary on the Ruling of the Tribuna Constitucional 212/1996 of 19 December 1996 (I)].
González Morán, L
1998-01-01
This article is a commentary on Spain's Constitutional Court's ruling of 19 December 1996 (STC 212/1996), on the challenge (596/89) on grounds of alleged unconstitutionality made against Law 42/1988, 28 December, which regulates the donation of human embryos and foetuses or the cells, tissues and organs therefrom. The article is structured as follows: it opens with a summary of Law 42/1988, since this is felt necessary to understand the subsequent challenge made on grounds of alleged unconstitutionality. We then provide specific details of the challenge and the resulting ruling, before concluding with some critical remarks on the aforementioned Law and ruling.
Elementary particle physics. Progress report, July 1992--October 1994
International Nuclear Information System (INIS)
Izen, J.M.
1994-10-01
The University of Texas at Dallas (UTD) is participating in two e + e - , experiments, Beijing Spectrometer (BES) and BABAR, the PEP-11 B Factory detector. The UTD group consists of Profs. Joseph M. Izen and Xinchou Lou, seven Ph.D. students. A post-doc is requested to join them in this work. BES explores the physics of the τ-charm threshold region. Associated production of τ and charmed mesons allow for absolute branching fraction measurements with good control of backgrounds. BES is uniquely positioned to study the leptonic and hadronic decays of quarkonia. The Beijing Electron Positron Collider (BEPC) delivers luminosities an order of magnitude higher than earlier facilities. BES and BEPC will be upgraded following the 1994-5 run, and will resume data taking in Fall, 1996 with an improved detector and a Three-fold increase in luminosity. The raison d'etre of BABAR is the exploration of CP violation in the B meson system. An asymmetric storage ring is required to observe the time-dependence of the CP asymmetry. Other BABAR physics includes measurements of CKM matrix elements, rare B decays, penguin diagrams, B s decays, and precision measurements of τ and D meson decays. The scheduled BABAR turn-on in 1999 provides the UTD group with a natural evolution with continuous physics during this period. Professors Joseph M. Izen and Xinchou Lou are leading the BES and BABAR program at UTD. Both have specialized in e + e - collider experiments and share 22 years of experience at the SPEAR, BEPC, CESR, PETRA, SLC and LEP rings
International Nuclear Information System (INIS)
1995-07-01
Article VI.J of the Agency's Statute requires the Board of Governors to submit 'an annual report to the General Conference concerning the affairs of the Agency and any projects approved by the Agency'. This report covers the period 1 January to 31 December 1994
Hanford protoype surface barrier status report: FY 1994
International Nuclear Information System (INIS)
Gee, G.W.; Freeman, H.D.; Walters, W.H. Jr.; Ligotke, M.W.; Campbell, M.D.; Ward, A.L.; Link, S.O.; Smith, S.K.; Gilmore, B.G.; Romine, R.A.
1994-12-01
A full-scale prototype surface barrier has been constructed at the 200 BP-1 Operable Unit in the 200 East Area of the Hanford Site. The prototype barrier has been built to evaluate design, construction, and performance features of a surface barrier that may be used for in-place disposal of wastes at the Hanford Site. The design basis and construction of the prototype have been documented. A testing and monitoring plan has been published outlining specific tests planned for the prototype. The current report describes initial testing activities conducted in FY 1994 and outlines activities for testing and monitoring at the prototype barrier in the future. Asphalt permeability was tested during construction of the prototype in April and May 1994. Cores taken from the asphalt concrete layer were tested in the laboratory and found to have hydraulic conductivities below 1E-09 cm/s. Field measurements of hydraulic conductivity taken on the asphalt concrete using a specially-designed falling head permeameter were more than ten times higher than those from core tests. The higher values are attributed to transient flow through the permeameter seal. In spite of this difficulty, the more rapid field measurements (1-day tests in the field compared to 3 months in the laboratory) gave values as low as IE-09 cm/s and averaged about IE-08 cm/s. Samples of fluid-applied asphalt material, used as a sealant on the asphalt concrete layer, were. tested in the laboratory and found to have hydraulic conductivities below IE-10 cm/s. Measurements of hydraulic conductivity taken on an adjacent asphalt test pad using a sealed double-ring infiltrometer (SDRI) were initiated in September 1994 and are expected to be completed in November 1994. Construction of the prototype surface barrier was completed in August 1994
1996 technical progress report
International Nuclear Information System (INIS)
1997-01-01
Summaries of the researches are grouped into programs as follows: research and development in food and agriculture; research and development in health, environment and industry which includes all the PNRI research projects in 1996; scientific and technological services; and the nuclear regulations, licensing and safeguards of the institute
Swiss electricity statistics 1996
International Nuclear Information System (INIS)
1997-01-01
This detailed article discusses the following subjects: Survey of electricity supply in Switzerland in 1996; The Swiss electricity balance; Electric power generation; Electric power consumption; Generation, consumption and loads on selected days; Energy trade with other countries; Expansion capacities until 2003; Financial situation and appendix. (orig./RHM) [de
1996 technical progress report
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-12-31
Summaries of the researches are grouped into programs as follows: research and development in food and agriculture; research and development in health, environment and industry which includes all the PNRI research projects in 1996; scientific and technological services; and the nuclear regulations, licensing and safeguards of the institute.
Coastal Massachusetts Submerged Aquatic Beds 1994-1996 Geodatabase
National Oceanic and Atmospheric Administration, Department of Commerce — The Coastal Change Analysis Program (C-CAP) at NOAA Office for Coastal Management partnered with The Massachusetts Department of Environmental Protection Wetlands...
Coastal Massachusetts Submerged Aquatic Beds 1994-1996 Biotic
National Oceanic and Atmospheric Administration, Department of Commerce — The Coastal Change Analysis Program (C-CAP) at NOAA Office for Coastal Management partnered with The Massachusetts Department of Environmental Protection Wetlands...
Coastal Massachusetts Submerged Aquatic Beds 1994-1996 Substrate
National Oceanic and Atmospheric Administration, Department of Commerce — The Coastal Change Analysis Program (C-CAP) at NOAA Office for Coastal Management partnered with The Massachusetts Department of Environmental Protection Wetlands...
Coastal Massachusetts Submerged Aquatic Beds 1994-1996 Geoform
National Oceanic and Atmospheric Administration, Department of Commerce — The Coastal Change Analysis Program (C-CAP) at NOAA Office for Coastal Management partnered with The Massachusetts Department of Environmental Protection Wetlands...
Progress report 1996 - 1997; Rapport d'activite 1996 - 1997
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-07-01
This report reviews the activities of the laboratory for the years 1996 and 1997. Laboratory's activities are driven by an important international program on particle physics and astro-particles. 9 topics are presented: 1) physics at LHC: the ATLAS experiment, 2) the search for a new physics at LEP : DELPHI experiment, 3) neutrino oscillations: NOMAD and TONIC experiments, 4) the experiments H1 at HERA, 5) CP breaking: BABAR experiment, 6) DO experiment at the Tevatron, 7) gamma radiation sources: CAT experiment, 8) supernova, and 9) the project of the AUGER observatory.
Budget estimates, fiscal years 1994--1995
International Nuclear Information System (INIS)
1993-04-01
This report contains the fiscal year budget justification to Congress. The budget provides estimates for salaries and expenses and for the Office of the Inspector General for fiscal years 1994 and 1995
Mortality rates among children and teenagers living in Inuit Nunangat, 1994 to 2008.
Oliver, Lisa N; Peters, Paul A; Kohen, Dafna E
2012-09-01
Because Vital Statistics data do not include information on Inuit identity in all jurisdictions, mortality rates cannot be calculated specifically for Inuit. However, Inuit in Canada are geographically concentrated--78% live in Inuit Nunangat, and 82% of the area's total population identify as Inuit. While there are limitations, geographic approaches can be employed to calculate mortality for the population of that area. The Vital Statistics Database (1994 to 2008) and population estimates were used to calculate age-standardized mortality rates (ASMRs) in five-year intervals around the 1996 and 2006 Census years. Mortality rates were calculated for 1- to 19-year-olds living in Inuit Nunangat and those living elsewhere in Canada. The ASMR in 2004-2008 for 1- to 19-year-olds in Inuit Nunangat was 188.0 deaths per 100,000 person-years at risk, five times the rate (35.3) elsewhere in Canada. The disparity had not narrowed over the previous decade. In Inuit Nunangat, injuries were responsible for 64% of deaths of children and teenagers, compared with 36% in the rest of Canada. The persistently high mortality rates for children and teenagers living in Inuit Nunangat, compared with the rest of Canada, are important in understanding the health and socio-economic situation of residents of this region.
Energy Balance of the Sao Paulo State -1997. Base year 1996
International Nuclear Information System (INIS)
1997-01-01
This energy balance of the Santa Catarina State presents the following main topics that can be outstanding: panorama of the energy matrix; supply and demand of energy by source 1983-1996; energy consumption by sector 1983/1996; socio-economic aspects; resources and reserves energy; and balance of the transformation centers 1984/1996
1996 Annual report; 1996 Informe anual
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-12-31
This annual report present information of the main activities on the scope of the radiation protection and nuclear safety of the Nuclear Regulatory Authority (ARN) of the Argentina during 1996. The activities are developed in 10 chapters and 2 appendices, were are described the activities and the bases of the Argentine Regulatory System. The followings chapters and appendices are: 1.-Evolution of the nuclear regulatory activities in the Argentina since the beginnings in the CNEA. 2.-Regulatory system, laws and regulations. 3.-Institutional relations with national and international organizations. 4. and 5.-Safeguards and inspections of the nuclear installations. 6.-Radiation control of the occupational and public doses. 7.-Radiological emergencies. 8.-Projects and tasks scientific-technological. 9.-Training courses and meetings. 10.-Economic and human recourses. Appendix I.-Regulatory documentation. Appendix II.- Inspections of nuclear installations.
National Oceanic and Atmospheric Administration, Department of Commerce — Phytoplankton data were collected using net casts from the USCGC POLAR SEA in the Arctic Ocean. Data were collected from 26 July 1994 to 26 August 1994. Data were...
DEFF Research Database (Denmark)
Andersen, M. S.; Dengsøe, N.; Brendstrup, S.
The report gives an ex-post evaluation of the Danish waste tax from 1987 to 1996. The evaluation shows that the waste tax has had a significant impact on the reductions in taxable waste. The tax has been decisive for the reduction in construction and demolition waste, while for the heavier...
Analysis and evaluation of operational data. Annual report, 1996
International Nuclear Information System (INIS)
1997-12-01
The United States Nuclear Regulatory Commission's Office for Analysis and Evaluation of Operational Data (AEOD) has published reports of its activities since 1984. The first report covered January through June of 1984, and the second report covered July through December of 1984. After those first two semiannual reports, AEOD published annual reports of its activities from 1985 through 1993. Beginning with report for 1986, AEOD Annual Reports have been published as NUREG-1272. Beginning with the report for 1987, NUREG-1272 has been published in two parts, No. 1 covering power reactors and No. 2 covering nonreactors (changed to 'nuclear materials' with the 1993 report). AEOD changed its annual report from a calendar year (CY) to a fiscal year report, and added part No. 3 covering technical training, beginning with the combined Annual Report for CY 1994 and fiscal year 1995, NUREG-1272, Vol. 9, Nos. 1-3. This report, NUREG-1272, Vol. 10, No. 2, covers nuclear materials and presents a review of the events and concerns associated with the use of licensed material in applications other than power reactores. NUREG-1272, Vol. 10, No. 1, covers power reactors and presents an overview of the fiscal year 1996 operating experience of the nuclear power industry from the NRC perspective. NUREG-1272, Vol. 10, No. 3, covers technical training and presents the activities of the Technical Training Center in support of the NRC's mission. Throughout these reports, whenever information is presented for a calendar year, it is so designated. Fiscal year information is designated by the four digits of the fiscal year
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-08-01
This document summarizes significant enforcement actions that have been resolved during the period of January-June 1996. The report includes copies of Orders and Notices of Violations sent by the Nuclear Regulatory Commission to individuals with respect to the enforcement actions.
International Nuclear Information System (INIS)
1996-08-01
This document summarizes significant enforcement actions that have been resolved during the period of January-June 1996. The report includes copies of Orders and Notices of Violations sent by the Nuclear Regulatory Commission to individuals with respect to the enforcement actions
International Nuclear Information System (INIS)
Collier, J.G.
1992-01-01
When the UK electricity industry was privatised, the Government stated that in 1994 it would undertake a review of the prospects for nuclear power. The future role of nuclear power will be viewed against the improved performance of the nuclear utilities; the success being achieved on the construction of Sizewell B; and the economics taking into account environmental benefits. The chairman of Nuclear Electric reviews the current position of Nuclear Power in Britain and puts the case for nuclear power in the future. (author)
Savannah River Site environmental report for 1996 summary
International Nuclear Information System (INIS)
Arnett, M.W.
1997-01-01
The Savannah River Site (SRS) publishes an environmental report each year to provide environmental monitoring and surveillance results to the US department of Energy (DOE), the public, Congress, state and federal regulators, universities, local governments, the news media, environmental and civic groups. The Savannah River Site Environmental Report for 1996 (WSRC-TR-97-0171) contains detailed information on site operations, environmental monitoring and surveillance programs, environmental compliance activities, and special projects for the calendar year 1996. The purpose of this document is to give a brief overview of the site and its activities, to summarize the report and the impact of 1996 SRS operations on the environment and the public, and to provide a brief explanation of radiation and dose
Rygevaner blandt 11-15-årige, 1984-1994
DEFF Research Database (Denmark)
Due, E P; Holstein, B E
1997-01-01
The objectives are to describe smoking habits among 11-15-year olds in Denmark in the period 1984-1994 and to describe the association between smoking and social background factors. The article reports data about children at the age of 11, 13 and 15 years from four cross-sectional studies in 1984...... smoke every day is 0%, 1%, 3%, 4%, 17%, and 11%. In conclusion, smoking habits among children changed considerably from the 1950's to 1980's. The smoking habits have not changed much since the 1980's apart from a slight delay in first smoking-experience. Udgivelsesdato: 1997-Feb-17......-1985, 1988, 1991 and 1994 (n = 678, 1667, 1860 and 4046) based on stratified random samples of schools. Data were collected by standardized questionnaires. Median age for first smoking experience changed from approx 12 years in 1984-1985 to approx. 14 years in 1994. The proportion of smokers among 15 year...
JAERI TANDEM and V.D.G. annual report 1994. April 1, 1994 - March 31, 1995
International Nuclear Information System (INIS)
Suzuki, Yasuo; Ikezoe, Hiroshi; Iwamoto, Akira; Sataka, Masao; Shinohara, Nobuo; Takeuchi, Suehiro; Shoji, Tokio; Okabe, Takashi
1995-10-01
This annual report describes research activities which have been performed with the JAERI tandem accelerator and the Van de Graaff accelerator from April 1, 1994 to March 31, 1995. Summary reports of 47 papers, and list of publications, personnel and cooperative researches with universities are contained. (author)
JAERI TANDEM and V.D.G. annual report 1994. April 1, 1994 - March 31, 1995
Energy Technology Data Exchange (ETDEWEB)
Suzuki, Yasuo; Ikezoe, Hiroshi; Iwamoto, Akira; Sataka, Masao; Shinohara, Nobuo; Takeuchi, Suehiro; Shoji, Tokio; Okabe, Takashi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; eds.
1995-10-01
This annual report describes research activities which have been performed with the JAERI tandem accelerator and the Van de Graaff accelerator from April 1, 1994 to March 31, 1995. Summary reports of 47 papers, and list of publications, personnel and cooperative researches with universities are contained. (author).
Quarterly coal report, October--December 1996
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-05-01
The Quarterly Coal Report (QCR) provides comprehensive information about US coal production, distribution, exports, imports, receipts, prices, consumption, and stocks to a wide audience, including Congress, Federal and State agencies, the coal industry, and the general public. Coke production, consumption, distribution, imports, and exports data are also provided. This report presents detailed quarterly data for October through December 1996 and aggregated quarterly historical data for 1990 through the third quarter of 1996. Appendix A displays, from 1988 on, detailed quarterly historical coal imports data. To provide a complete picture of coal supply and demand in the US, historical information has been integrated in this report. 8 figs., 72 tabs.
Indian Academy of Sciences (India)
Maynard Smith says" fifteen years later, when I decided to leave engineering and train as a biologist, I entered. RESONANCE I March 1996. S Thangavelu is with Statistics and Mathematics Unit,. Indian Statistical Institute, R V College Post, Banga- lore 560 059. University College, London, where Haldane was at that time a ...
LLE review. Quarterly report, January 1994--March 1994, Volume 58
Energy Technology Data Exchange (ETDEWEB)
Simon, A. [ed.
1994-07-01
This volume of the LLE Review, covering the period Jan - Mar 1994, contains articles on backlighting diagnostics; the effect of electron collisions on ion-acoustic waves and heat flow; using PIC code simulations for analysis of ultrashort laser pulses interacting with solid targets; creating a new instrument for characterizing thick cryogenic layers; and a description of a large-aperture ring amplifier for laser-fusion drivers. Three of these articles - backlighting diagnostics; characterizing thick cryogenic layers; and large-aperture ring amplifier - are directly related to the OMEGA Upgrade, now under construction. Separate abstracts have been prepared for articles from this report.
Directory of Open Access Journals (Sweden)
Thouret
2006-01-01
Full Text Available The MOZAIC programme collects ozone and water vapour data using automatic equipment installed on board five long-range Airbus A340 aircraft flying regularly all over the world since August 1994. Those measurements made between September 1994 and August 1996 allowed the first accurate ozone climatology at 9–12 km altitude to be generated. The seasonal variability of the tropopause height has always provided a problem when constructing climatologies in this region. To remove any signal from the seasonal and synoptic scale variability in tropopause height we have chosen in this further study of these and subsequent data to reference our climatology to the altitude of the tropopause. We define the tropopause as a mixing zone 30 hPa thick across the 2 pvu potential vorticity surface. A new ozone climatology is now available for levels characteristic of the upper troposphere (UT and the lower stratosphere (LS regardless of the seasonal variations of the tropopause over the period 1994–2003. Moreover, this new presentation has allowed an estimation of the monthly mean climatological ozone concentration at the tropopause showing a sine seasonal variation with a maximum in May (120 ppbv and a minimum in November (65 ppbv. Besides, we present a first assessment of the inter-annual variability of ozone in this particular critical region. The overall increase in the UTLS is about 1%/yr for the 9 years sampled. However, enhanced concentrations about 10–15 % higher than the other years were recorded in 1998 and 1999 in both the UT and the LS. This so-called '1998–1999 anomaly' may be attributed to a combination of different processes involving large scale modes of atmospheric variability, circulation features and local or global pollution, but the most dominant one seems to involve the variability of the North Atlantic Oscillation (NAO as we find a strong positive correlation (above 0.60 between ozone recorded in the upper troposphere and the NAO
An outbreak of meningococcal meningitis in Gauteng, Spring 1996 ...
African Journals Online (AJOL)
Objective. To describe a Neisseri.a meningitidis outbreak in Gauteng during the period 1 July to 31 December 1996. Design. A descriptive study. Setting. Patients with meningococcal meningitis in Gauteng who had been diagnosed by laboratory means, or notified during the period 1 July to 31 December 1996.
High Temperature Materials Laboratory seventh annual report, October 1993--September 1994
Energy Technology Data Exchange (ETDEWEB)
Tennery, V.J.; Teague, P.A.
1994-12-01
The High Temperature Materials Laboratory (HTML) has completed its seventh year of operation as a designated Department of Energy User Facility at the Oak Ridge National Laboratory. Growth of the User Program has been demonstrated by the number of institutions executing user agreements since the HTML began operation in 1987. A total of 193 nonproprietary agreements (91 industry and 102 university) and 41 proprietary agreements (39 industry and two university) are now in effect. This represents an increase of 21 nonproprietary user agreements during FY 1994. Forty-one states are represented by these users. During FY 1994, the HTML User Program evaluated 106 nonproprietary proposals (46 from industry, 52 from universities, and 8 from other government facilities) and 8 proprietary proposals. The HTML User Advisory Committee approved about ninety-five percent of those evaluated proposals, sometimes after the prospective user revised the proposal based on comments from the Committee. This annual report discusses FY 1994 activities in the individual user centers, as well as plans for the future. It also gives statistics about users and their proposals and FY 1994 publications, and summarizes nonproprietary research projects active in FY 1994.
Estimates of emergency operating capacity in U.S. manufacturing industries: 1994--2005
Energy Technology Data Exchange (ETDEWEB)
Belzer, D.B.
1997-02-01
To develop integrated policies for mobilization preparedness, planners require estimates and projections of available productive capacity during national emergency conditions. This report develops projections of national emergency operating capacity (EOC) for 458 US manufacturing industries at the 4-digit Standard Industrial Classification (SIC) level. These measures are intended for use in planning models that are designed to predict the demands for detailed industry sectors that would occur under conditions such as a military mobilization or a major national disaster. This report is part of an ongoing series of studies prepared by the Pacific Northwest National Laboratory to support mobilization planning studies of the Federal Emergency Planning Agency/US Department of Defense (FEMA/DOD). Earlier sets of EOC estimates were developed in 1985 and 1991. This study presents estimates of EOC through 2005. As in the 1991 study, projections of capacity were based upon extrapolations of equipment capital stocks. The methodology uses time series regression models based on industry data to obtain a response function of industry capital stock to levels of industrial output. The distributed lag coefficients of these response function are then used with projected outputs to extrapolate the 1994 level of EOC. Projections of industrial outputs were taken from the intermediate-term forecast of the US economy prepared by INFORUM (Interindustry Forecasting Model, University of Maryland) in the spring of 1996.
Fitzpatrick, Stella, Ed.; Mace, Jane, Ed.
This collection of 17 papers, presented at a conference in May 1996, documents some of the current thinking about adult literacy education in Great Britain. The first of the three sections of the papers, "Some Context," contains two analyses of the political and economic realities within which potential participants in adult literacy and…
Bloom, R W
1997-01-01
There is theoretical and empirical research supporting the hypothesis that virtual reality technology (VRT) can be efficaciously applied to attenuate the symptoms of mental disorders (Baer, 1996; Rothbaum et al, 1995a, 1995b; Rothbaum et al, 1996.) Yet there is also research suggesting psychiatric therapeutic applications of VRT may induce noxious or unexpected psychological consequences (Kolasinski, 1996; Muscott & Gifford, 1994; Regan & Price, 1994; Regan & Ramsey, 1996; Strickland, 1995.) A prudent conclusion would be to advocate ever more sophisticated studies on psychiatric therapeutic applications of VRT concerning (1) increasing the overall socioadaptiveness of patients, (2) the robustness of moderating, modifying, or other intermediary variables effecting or affecting VRT therapeutic efficacy, and (3) variables, processes, and hypotheses generated from VRT applications in non-psychiatric fields.
Abstracts and papers of the 1996 International RERTR Meeting
International Nuclear Information System (INIS)
1996-10-01
The 1996 International Meeting on Reduced Enrichment for Research and Test Reactors (RERTR) was sponsored by the Korea Atomic Energy Research Institute and the International Atomic Energy Agency and was held in Seoul, Korea, on 6-10 October 1996. The abstracts and available papers that were presented at this meeting are provided. The most important subject dealt with was progress of the Reduced Enrichment Research and Test Reactor (RERTR) Program. The major events, findings, and activities of 1996 are reviewed with the results which the RERTR Program has achieved by the end of 1995 in collaboration of the ANL and its many international partners
Abstracts and papers of the 1996 International RERTR Meeting
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-10-01
The 1996 International Meeting on Reduced Enrichment for Research and Test Reactors (RERTR) was sponsored by the Korea Atomic Energy Research Institute and the International Atomic Energy Agency and was held in Seoul, Korea, on 6-10 October 1996. The abstracts and available papers that were presented at this meeting are provided. The most important subject dealt with was progress of the Reduced Enrichment Research and Test Reactor (RERTR) Program. The major events, findings, and activities of 1996 are reviewed with the results which the RERTR Program has achieved by the end of 1995 in collaboration of the ANL and its many international partners.
Climatological relevance of major USA weather losses during 1991-1994
Changnon, David; Changnon, Stanley A.
1998-01-01
Two insurance indices, which integrate storm types with their losses from 1948 to 1994, were examined to assess the frequency and intensity of damaging weather in the USA from 1991 to 1994. These indices adjust for changing socio-economic conditions, allowing meaningful temporal assessment of 1991-1994 conditions against those in earlier years.Catastrophes, as defined by property loss insurers, were assessed for two groups, those 707 storms with insured losses between 10 and 100 million and those 189 with greater than 100 million. Both categories experienced their greatest frequency and caused more loss during the 1991-1994 period than in any prior period. However, the temporal behaviour of annual frequency and losses for both categories were very different, with steady increases found for the 10 to 100 million catastrophes, while the number of >100 million catastrophes exhibited a high-low-high distribution and the annual cost distribution was flat with a few isolated peaks. For both categories the temporal behaviour of storm intensity was similar, with moderate intensities found in the recent period and the highest intensities in the 1950s. The crop-hail losses were high in 1992-1994, and the annual loss costs for the 1948-1994 period had a U-shaped time distribution similar to that of the >100 million catastrophes.Weather conditions (USA mean temperature and surface cyclone frequency) were found to largely define: (i) when major, highly expensive weather events occur (and their annual losses), and (ii) how intense catastrophic storm conditions and crop-damaging hailstorms are during each year. Conversely, the shifting target (population as an index) for damaging (non-hurricane) storms across the USA is the major factor in creating storms with losses reaching into the low (10 million) to moderate ($100 million) range.
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-12-31
The 1996 annual progress report, from the French Department of Energy, reviews the key points of the French policy for energy and raw materials: competitiveness, environmental protection, long term supply safety, and public service. 1996 was marked by positive results for the French energy industry, difficulties for the oil refining industry, and a new impetus for renewable energies. Five surveys are presented: nuclear safety in Eastern Europe, the european directive on electric power domestic market, evolution of the oil market, conditions of refining in France, and restructuring of the Mine bureau (BRGM). 40 prominent facts are briefly reviewed, concerning sustainable energy development, nuclear energy, electric power and gas, coal, oil products, raw materials. Diagrams on energy and raw materials are also included
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-12-31
The 1996 annual progress report, from the French Department of Energy, reviews the key points of the French policy for energy and raw materials: competitiveness, environmental protection, long term supply safety, and public service. 1996 was marked by positive results for the French energy industry, difficulties for the oil refining industry, and a new impetus for renewable energies. Five surveys are presented: nuclear safety in Eastern Europe, the european directive on electric power domestic market, evolution of the oil market, conditions of refining in France, and restructuring of the Mine bureau (BRGM). 40 prominent facts are briefly reviewed, concerning sustainable energy development, nuclear energy, electric power and gas, coal, oil products, raw materials. Diagrams on energy and raw materials are also included
Energy Technology Data Exchange (ETDEWEB)
1993-10-01
This is the third Office of Inspector General (OIG)Annual Work Plan. Its purpose is to summarize work completed in Fiscal Year (FY) 1993, identify ongoing projects from previous fiscal years which the OIG intends to continue into FY 1994, and announce planned projects which the OIG intends to begin in FY 19994.
IAEA Newsbriefs. V. 9, no. 4(66). Oct 1994
International Nuclear Information System (INIS)
1994-01-01
This issue gives brief information on the following topics: IAEA Analyzing effect of US-DPRK Agreed Framework, Statement to General Assembly in New-York, Council on Foreign Relations, 19 October 1994, Congress of the European Nuclear Society, 4 October 1994, IAEA General Conference, 19 September 1994, Illicit Trafficking in Nuclear Materials, IAEA Director General Blix honoured, Ukraine and IAEA sign Safeguards Agreement, International Convention on Nuclear Safety, Highlights of the 1994 General Conference, IAEA safeguards in the DPRK, Monitoring and verification in Iraq, IAEA safeguards system, Measures against illicit trafficking in nuclear materials, African nuclear-weapon-free zone, South Africa's participation in IAEA activities, Application of IAEA safeguards in the Middle East, IAEA technical co-operation activities, Technical assistance in the Middle East, Radioactive waste management, Water resources and production, IAEA budget and extrabudgetary resources for 1995, Staffing of the IAEA Secretariat, Nuclear safety and radiological protection, Scientific Programme at the General Conference, Environmental monitoring, High-energy accelerators and radioactive waste management, Global food security and sustainability, Other meetings, Air Transport of Radioactive materials, Accelerators for Research, Water Resources, Radiation Technologies in Health Care, Spent Fuel Storage, Nuclear Techniques in Agriculture, Comprehending Radiation Risks, Environmental Impact of Radioactive Releases, Strengthening Radiation Protection Infrastructures, and other short information
IAEA Newsbriefs. V. 9, no. 4(66). Oct 1994
Energy Technology Data Exchange (ETDEWEB)
NONE
1994-12-31
This issue gives brief information on the following topics: IAEA Analyzing effect of US-DPRK Agreed Framework, Statement to General Assembly in New-York, Council on Foreign Relations, 19 October 1994, Congress of the European Nuclear Society, 4 October 1994, IAEA General Conference, 19 September 1994, Illicit Trafficking in Nuclear Materials, IAEA Director General Blix honoured, Ukraine and IAEA sign Safeguards Agreement, International Convention on Nuclear Safety, Highlights of the 1994 General Conference, IAEA safeguards in the DPRK, Monitoring and verification in Iraq, IAEA safeguards system, Measures against illicit trafficking in nuclear materials, African nuclear-weapon-free zone, South Africa`s participation in IAEA activities, Application of IAEA safeguards in the Middle East, IAEA technical co-operation activities, Technical assistance in the Middle East, Radioactive waste management, Water resources and production, IAEA budget and extrabudgetary resources for 1995, Staffing of the IAEA Secretariat, Nuclear safety and radiological protection, Scientific Programme at the General Conference, Environmental monitoring, High-energy accelerators and radioactive waste management, Global food security and sustainability, Other meetings, Air Transport of Radioactive materials, Accelerators for Research, Water Resources, Radiation Technologies in Health Care, Spent Fuel Storage, Nuclear Techniques in Agriculture, Comprehending Radiation Risks, Environmental Impact of Radioactive Releases, Strengthening Radiation Protection Infrastructures, and other short information
International Nuclear Information System (INIS)
1997-02-01
In accordance with Article VII.4 of the Regional Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology 1987 and extended in 1992, a draft report of activities for the calendar year 1996 is submitted
Petroleum supply annual 1994, Volume 2
International Nuclear Information System (INIS)
1995-06-01
The Petroleum Supply Annual (PSA) contains information on the supply and disposition of crude oil and petroleum products. The publication reflects data that were collected from the petroleum industry during 1994 through annual and monthly surveys. The PSA is divided into two volumes. This first volume contains four sections: Summary Statistics, Detailed Statistics, Refinery Capacity, and Oxygenate Capacity each with final annual data. The second volume contains final statistics for each month of 1994, and replaces data previously published in the Petroleum Supply Monthly (PSM). The tables in Volumes 1 and 2 are similarly numbered to facilitate comparison between them. Explanatory Notes, located at the end of this publication, present information describing data collection, sources, estimation methodology, data quality control procedures, modifications to reporting requirements and interpretation of tables. Industry terminology and product definitions are listed alphabetically in the Glossary
The 1994 Goddard Conference on Space Applications of Artificial Intelligence
Hostetter, Carl F. (Editor)
1994-01-01
This publication comprises the papers presented at the 1994 Goddard Conference on Space Applications of Artificial Intelligence held at the NASA/GSFC, Greenbelt, Maryland, on 10-12 May 1994. The purpose of this annual conference is to provide a forum in which current research and development directed at space applications of artificial intelligence can be presented and discussed.
KURRI progress report 1995. April 1995 - March 1996
International Nuclear Information System (INIS)
1996-11-01
1995 is the first year into the 'second life' of KURRI. Following the suggestion of the Science Council, the research divisions were reorganized from old 16 divisions into 6 large divisions on April 1, 1995, and the five year modernization program of the Kyoto University reactor (KUR) and its related facilities was begun. The KUR added 1,165 h of operation during the past fiscal year. 2,002 researchers in total visited the KURRI to perform 148 experimental applications or to attend 16 symposia and 6 workshops. At the end of three year period, the scientific achievements of five research projects were reviewed during the annual scientific meeting of the KURRI held on January 25 and 26, 1996. On March 18, 1996, the KURRI celebrated the reorganization of the Center of Excellence, and the international symposium on the advance in neutron optics and the related research facilities was held for the following three days. The replacement of the heavy water facility was carried out during the reactor shutdown from December, 1995 to May, 1996. The user operation of the KUR was resumed on July 15, 1996. In this book, research activities, organization, research divisions and laboratories, the operation and development of facilities, radiation protection and monitoring, publications, meetings and seminars are reported. (K.I.)
KURRI progress report 1995. April 1995 - March 1996
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-11-01
1995 is the first year into the `second life` of KURRI. Following the suggestion of the Science Council, the research divisions were reorganized from old 16 divisions into 6 large divisions on April 1, 1995, and the five year modernization program of the Kyoto University reactor (KUR) and its related facilities was begun. The KUR added 1,165 h of operation during the past fiscal year. 2,002 researchers in total visited the KURRI to perform 148 experimental applications or to attend 16 symposia and 6 workshops. At the end of three year period, the scientific achievements of five research projects were reviewed during the annual scientific meeting of the KURRI held on January 25 and 26, 1996. On March 18, 1996, the KURRI celebrated the reorganization of the Center of Excellence, and the international symposium on the advance in neutron optics and the related research facilities was held for the following three days. The replacement of the heavy water facility was carried out during the reactor shutdown from December, 1995 to May, 1996. The user operation of the KUR was resumed on July 15, 1996. In this book, research activities, organization, research divisions and laboratories, the operation and development of facilities, radiation protection and monitoring, publications, meetings and seminars are reported. (K.I.)
Prevención y control del parasitismo intestinal en la atención primaria de salud
Directory of Open Access Journals (Sweden)
Rebeca Margarita Laird Pérez
2000-02-01
Full Text Available Se valoró la capacidad técnica de Médicos Generales Integrales, técnicos del laboratorio de parasitología y epidemiólogos de las áreas de salud del municipio Centro Habana, de enero a abril de 1996, con el objetivo de evaluar la calidad de la atención primaria de salud para la prevención y control del parasitismo intestinal. Se aplicaron eneustas, controles de calidad externos, y entrevistas individuales a profundidad. Se encontró que no existe integración en las acciones de los grupos evaluados, detectándose dificultades médicas para la prevención y control de las parasitosis intestinales, deficiencias técnicas en los laboratorios y desconocimientos del programa de parasitismo intestinal por los epidemiólogos. Se recomienda la capacitación de técnicos y profesionales, y la confección de una metodología que permita reorientar y optimizar el programa nacional de parasitismo intestinalThe technical capacity of the General Comprehensive Physicians, parasitology laboratory technicians and epidemiologists from the health area of "Centro Habana" municipality was assessed from January to April, 1996, aimed at evaluating the quality of primary health care in relation to the prevention and control of intestinal parasitism. Surveys, external quality controls and individual interviews were made. It was found that there was no integration in the actions of the evaluated groups. Medical difficulties for the prevention and control of intestinal parasitosis as well as technical deficiencies in the laboratories were found. It was observed that epidemiologists had little knowledge about the program of intestinal parasitism. The training of technicians and professionals and the creation of a methodology that allows to reorient and optimize the national program of intestinal parasitism were recommended
Landelijk Meetnet Bodemkwaliteit; Resultaten 1996
Groot MSM; Bronswijk JJB; Leeuwen TC van; LEI-DLO; LBG
2001-01-01
This report contains the results of the National Soil Monitoring Network of the Netherlands in 1996, the fourth year of sampling. The network represents the cooperative effort of the National Institute of Public Health and the Environment (RIVM), the Agriculture Economics Research Institute
Landelijk Meetnet Regenwatersamenstelling. Meetresultaten 1996
Boschloo DJ; Stolk AP; LLO
1999-01-01
This report presents the results of the chemical composition measurements of precipitation in the Netherlands in 1996. Measurements were performed on 4-weekly samples obtained from the National Precipitation Chemistry Monitoring Network. Samples from 15 stations were analysed for main components and
NORTH CAROLINA GROUNDWATER RECHARGE RATES 1994
North Carolina Groundwater Recharge Rates, from Heath, R.C., 1994, Ground-water recharge in North Carolina: North Carolina State University, as prepared for the NC Department of Environment, Health and Natural Resources (NC DEHNR) Division of Enviromental Management Groundwater S...
Water supply at Los Alamos during 1996. Progress report
International Nuclear Information System (INIS)
McLin, S.G.; Purtymun, W.D.; Maes, M.N.; Longmire, P.A.
1997-12-01
Production of potable municipal water supplies during 1996 totaled about 1,368.1 million gallons from wells in the Guaje, Pajarito, and Otowi well fields. There was no water used from either the spring gallery in Water Canyon or from Guaje Reservoir during 1996. About 2.6 million gallons of water from Los Alamos Reservoir was used for lawn irrigation. The total water usage in 1996 was about 1,370.7 million gallons, or about 131 gallons per day per person living in Los Alamos County. Groundwater pumpage was up about 12.0 million gallons in 1996 compared with the pumpage in 1995. This report fulfills requirements specified in US Department of Energy (DOE) Order 5400.1 (Groundwater Protection Management Program), which requires the Los Alamos National Laboratory (LANL) to monitor and document groundwater conditions below Pajarito Plateau and to protect the regional aquifer from contamination associated with Laboratory operations. Furthermore, this report also fulfills special conditions by providing information on hydrologic characteristics of the regional aquifer, including operating conditions of the municipal water supply system
2016-01-01
negotiated settlement. The 13 cases were Indonesia (Aceh), Northern Ireland, Bosnia, Chechnya , the Lebanese Civil War, Burundi, Kampuchea, Tajikistan...COIN loss Chechnya I 1994–1996 1 –7 –6 COIN loss Bosnia 1992–1995 0 –6 –6 COIN loss Laos 1959–1975 2 –7 –5 COIN loss Nagorno-Karabakh 1992–1994 0 –5...Somoza) 1978–1979 0 –6 –6 COIN loss Chechnya I 1994–1996 1 –7 –6 COIN loss Bosnia 1992–1995 0 –6 –6 COIN loss Laos 1959–1975 2 –7 –5 COIN loss
Progress report 1996 - 1997; Rapport d'activite 1996 - 1997
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-07-01
This report reviews the activities of the laboratory for the years 1996 and 1997. Laboratory's activities are driven by an important international program on particle physics and astro-particles. 9 topics are presented: 1) physics at LHC: the ATLAS experiment, 2) the search for a new physics at LEP : DELPHI experiment, 3) neutrino oscillations: NOMAD and TONIC experiments, 4) the experiments H1 at HERA, 5) CP breaking: BABAR experiment, 6) DO experiment at the Tevatron, 7) gamma radiation sources: CAT experiment, 8) supernova, and 9) the project of the AUGER observatory.
Houston prefreshman enrichment program (Houston PREP). Final report, June 10, 1996--August 1, 1996
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-10-01
The 1996 Houston Pre-freshman Enrichment Program (PREP) was conducted on the campus of the University of Houston-Downtown from June 10 to August 1, 1996. Program Participants were recruited from the Greater Houston area. All participants were identified as high achieving students with an interest in learning about the engineering and science professions. The goal of the program was to better prepare our pre-college youth prior to entering college as mathematics, science and engineering majors. The program participants were middle school and high school students from the Aldine, Alief, Channel View, Crockett, Cypress-Fairbanks, Fort Bend, Galena Park, Houston, Humble, Katy, Klein, North Forest, Pasadena, Private, and Spring Branch Independent School Districts. Of the 197 students starting the program, 170 completed, 142 students were from economically and socially disadvantage groups underrepresented in the engineering and science professions, and 121 of the 197 were female. Our First Year group for 1996 composed of 96% minority and women students. Our Second and Third Year students were 100% and 93.75% minority or women respectively. This gave an overall minority and female population of 93.75%. This year, special efforts were again made to recruit students from minority groups, which caused a significant increase in qualified applicants. However, due to space limitations, 140 applicants were rejected. Investigative and discovery learning were key elements of PREP. The academic components of the program included Algebraic Structures, Engineering, Introduction to Computer Science, Introduction to Physics, Logic and Its Application to Mathematics, Probability and Statistics, Problem Solving Seminar using computers and PLATO software, SAT Preparatory Seminars, and Technical Writing.
Energy Technology Data Exchange (ETDEWEB)
Hueper, R. [ed.
1995-08-01
The reactor safety R and D work of the Karlsruhe Research Centre (FZKA) has been part of the Nuclear Safety Research Projet (PSF) since 1990. The present annual report 1994 summarizes the R and D results. The research tasks are coordinated in agreement with internal and external working groups. The contributions to this report correspond to the status of early 1995. An abstract in English precedes each of them, whenever the respective article is written in German. (orig.) [Deutsch] Seit Beginn 1990 sind die F+E-Arbeiten des Forschungszentrum Karlsruhe (FZKA) zur Reaktorsicherheit im Projekt Nukleare Sicherheitsforschung (PSF) zusammengefasst. Der vorliegende Jahresbericht 1994 enthaelt Beitraege zu aktuellen Fragen der Sicherheit von Leichtwasserreaktoren und innovativen Systemen sowie der Umwandlung von minoren Aktiniden. Die konkreten Forschungsthemen und -vorhaben werden mit internen und externen Fachgremien laufend abgestimmt. An den beschriebenen Arbeiten sind die folgenden Institute und Abteilungen des FZKA beteiligt: Institut fuer Materialforschung IMF I, II, III; Institut fuer Neutronenphysik und Reaktortechnik INR; Institut fuer Angewandte Thermo- und Fluiddynamik IATF; Institut fuer Reaktorsicherheit IRS; Hauptabteilung Ingenieurtechnik HIT; Hauptabteilung Versuchstechnik HVT sowie vom KfK beauftragte externe Institutionen. Die einzelnen Beitraege stellen den Stand der Arbeiten zum Fruehjahr 1995 dar und sind entsprechend dem F+E-Programm 1994 numeriert. Den in deutscher Sprache verfassten Beitraege sind Kurzfassungen in englischer Sprache vorangestellt. (orig.)
EIA publications directory 1996
International Nuclear Information System (INIS)
1997-05-01
This edition of the EIA Publications Directory contains titles and abstracts of periodicals and one-time reports produced by the Energy Information Administration (EIA) from January through December 1996. The body of the Directory contains citations and abstracts arranged by broad subject categories; metadata, coal, oil and gas, nuclear, electricity, renewable and energy/alternative fuels, multifuel, end-use consumption, models, and forecasts
Oregon's forest products industry: 1994.
Franklin R. Ward
1997-01-01
This report presents the findings of a survey of primary forest products industries in Oregon for 1994. The survey included the following sectors: lumber; veneer; pulp and board; shake and shingle; export; and post, pole, and piling. Tables, presented by sector and for the industry as a whole, include characteristics of the industry, nature and flow of logs consumed,...
Annual report and accounts 1994
International Nuclear Information System (INIS)
1995-11-01
This report outlines the work of the RPII during 1994. The main developments included the transition of the personnel dosimetry service from the use of film dosimeters to TLDs and during the year the Institute intensified its efforts to create an informed public recognition of the health hazard associated with exposure to radon gas in buildings
Annual report and accounts 1994
International Nuclear Information System (INIS)
1994-01-01
The Annual Report of the Southern Electric Group presents the Chairman's statement, and a review by the Chief Executive which covers productivity and efficiency, VAT, subsidiaries, associated activity, energy efficiency, safety and caring for the environment. This is followed by a financial review, the director's report, and the annual accounts for the year ended 31 March 1994. (UK)
Monthly energy review, December 1994
International Nuclear Information System (INIS)
1994-12-01
This monthly publication contains statistical data on energy resources in the United States. Petroleum, natural gas, coal, electricity, and nuclear energy are covered. Additional sections include an energy overview, energy consumption, oil and gas resource development and energy prices. This issue includes a market assessment of alternative-fuel vehicles in the Atlanta private fleet for 1994
Giving USA 1997: The Annual Report on Philanthropy for the Year 1996.
Kaplan, Ann E., Ed.
This report presents a comprehensive review of private philanthropy in the United States during 1996. After a preliminary section, the first section presents data on giving, using text, graphs, and charts. Sections cover: overall 1996 contributions; changes in giving by source and use; total giving (1966-1996); inflation-adjusted giving in 5-year…
National Research Council Canada - National Science Library
Moore, John
2004-01-01
.... Success in these operations has been elusive. The US interventions in Panama 1989-1991 Somalia 1992- 1994 and Haiti 1994-1996 provide excellent case studies for determining the foundational causes of its poor performance...
FY 1994 report on the Coal Liquefaction Committee; 1994 nendo sekitan ekika iinkai hokokusho
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-03-01
The paper reported the FY 1994 activities of the Coal Liquefaction Committee. The Coal Liquefaction Committee in this fiscal year was held on November 29, 1994 (1st) and March 22, 1995 (2nd), and report was made on the bituminous coal liquefaction study and state of the R and D of liquefaction base technology. Report was also made on the state of construction of bituminous coal liquefaction PP, outline of the results of the PSU operation, outline of the 11th Japan-U.S. JTM, etc. In the liquefaction base study, report/discussion were made about the improvement/rationalization of liquefaction process, study of innovative technology of coal liquefaction, study of coal liquefaction conditions, study for higher liquefaction element technology, project on the internationalization of coal liquefaction technology, etc. As to the relation of the entrained bed coal gasification power plant, report/discussion were made about survey/study on the processing of coal for coal gasification use (survey of coal kind selection, development of information processing system for coal conversion technology). Besides, as a topic, report was made on the economical evaluation/calculation of a commercial plant for brown coal liquefaction. (NEDO)
International Nuclear Information System (INIS)
1998-03-01
This report presents estimated costs and cost indices for domestic oil and natural gas field equipment and production operations for 1994, 1995, 1996, and 1997. The costs of all equipment and services are those in effect during June of each year. The sums (aggregates) of the costs for representative leases by region, depth, and production rate were averaged and indexed. This provides a general measure of the increased or decreased costs from year to year for lease equipment and operations. These general measures do not capture changes in industry-wide costs exactly because of annual variations in the ratio of the total number of oil wells to the total number of gas wells. The detail provided in this report is unavailable elsewhere. The body of this report contains summary tables, and the appendices contain detailed tables. Price changes for oil and gas, changes in taxes on oil and gas revenues, and environmental factors (compliance costs and lease availability) have a significant impact on the number and cost of oil and gas wells drilled. These changes also impact the cost of oil and gas equipment and production operations
Digital Repository Service at National Institute of Oceanography (India)
Shanas, P.R.; SanilKumar, V.; Hithin, N.K.
and studied the validity of these observations against ship-reported and buoy data. Many studies have been undertaken on how best to use the data available from satellite observation systems in wave models (Mastenbroek, 1994; Young and Glowacki, 1996... Sea wave model. Journal of Geophysical Research 10, 5829–5849. Young, I.R., 1994. Global ocean wave statistics obtained from satellite observations. Applied Ocean Research 16, 235-248. Young, I.R., Glowacki, T.J., 1996. Assimilation of altimeter...
International Nuclear Information System (INIS)
1997-07-01
Article VI.J of the Agency's Statute requires the Board of Governors to submit 'an annual report to the General Conference concerning the affairs of the Agency and any projects approved by the Agency'. This report covers the period 1 January to 31 December 1996
Hazards Control Department 1996 Annual Report
Energy Technology Data Exchange (ETDEWEB)
Richards, J.
1997-06-30
This annual report on the activities of the Hazards Control Department (HCD) in 1996 is part of the department's continuing effort to foster a working environment at Lawrence Livermore National Laboratory where every person has the means, ability, and desire to work safely. The significant accomplishments and activities, the various services provided, and research into Environment, Safety, and Health (ES&H) issues by HCD would not have been possible without the many and ongoing contributions by its employees and support personnel. The HCD Leadership Team thanks each and every one in the department for their efforts and work in 1996 and for their personal commitment to keeping one of the premier research and scientific institutions in the world today a safe and healthy place.
International Nuclear Information System (INIS)
1996-01-01
This third volume of 1994 to 1995 activity report, of Nuclear Physics Institute (Orsay, France) gives a general overview of the research programs conducted in the fields of nuclear structure (exotic nuclei, discrete high spin states). Other topics have been studied in high excitation energy states and giant resonances, and in nucleus-nucleus collision and hot nuclei. Other topics deal with radiochemistry, in particular for optical spectroscopy and physico-chemical studies on actinides and trans-actinides. (D.L.)
[Bibliometric map of Spain 1996-2004: biomedicine and health sciences].
Méndez-Vásquez, Raúl Isaac; Suñén-Pinyol, Eduard; Cervelló, Rosa; Camí, Jordi
2008-03-01
The study presents the bibliometric analysis of the Spanish scientific output in biomedicine during 1996-2004. This is the last edition of a series of bibliometric studies aimed to characterize the Spanish scientific performance in biomedicine. The analysis was restricted to citable documents for which simple and composite bibliometric indicators were obtained at different aggregation levels: fields, autonomous regions, institutional sectors and research centres. The documents were selected according to the Journal Citation Reports, and were assigned to affiliation centres following an integer counting scheme after an exhaustive normalization of the affiliation addresses. Compared to the period 1994-2002, research activity in biomedicine grew as much as Spain: 8.9% in the number of documents; 22.5% citations; 12.5% citation per document average and 27.2% international cooperation. Besides, biomedicine showed the highest citation per document average compared to other major fields. International cooperation in biomedicine (27.2%) reached the European average. The documents published in international cooperation account for the half of citations to documents in biomedicine. The number of documents and citations belonging to the clinic medicine subfield and to the health sector showed the highest growth. In general, these results reproduce the tendencies described in prior studies. The documents in biomedicine showed a highly asymmetric distribution among institutional sectors, autonomous regions, scientific fields and research centres. The remarkably increase in the output of clinical medicine field and in the health sector could be the consequence of important science policy actions undertaken in these areas in the last years.
Analysis and evaluation of operational data. Annual report, 1996
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-12-01
The United States Nuclear Regulatory Commission`s Office for Analysis and Evaluation of Operational Data (AEOD) has published reports of its activities since 1984. The first report covered January through June of 1984, and the second report covered July through December of 1984. After those first two semiannual reports, AEOD published annual reports of its activities from 1985 through 1993. Beginning with report for 1986, AEOD Annual Reports have been published as NUREG-1272. Beginning with the report for 1987, NUREG-1272 has been published in two parts, No. 1 covering power reactors and No. 2 covering nonreactors (changed to `nuclear materials` with the 1993 report). AEOD changed its annual report from a calendar year (CY) to a fiscal year report, and added part No. 3 covering technical training, beginning with the combined Annual Report for CY 1994 and fiscal year 1995, NUREG-1272, Vol. 9, Nos. 1-3. This report, NUREG-1272, Vol. 10, No. 2, covers nuclear materials and presents a review of the events and concerns associated with the use of licensed material in applications other than power reactores. NUREG-1272, Vol. 10, No. 1, covers power reactors and presents an overview of the fiscal year 1996 operating experience of the nuclear power industry from the NRC perspective. NUREG-1272, Vol. 10, No. 3, covers technical training and presents the activities of the Technical Training Center in support of the NRC`s mission. Throughout these reports, whenever information is presented for a calendar year, it is so designated. Fiscal year information is designated by the four digits of the fiscal year.
Energy Technology Data Exchange (ETDEWEB)
Rothman, E.Z. [ed.
1995-05-01
This report is a summary of activities carried out at the National Synchrotron Light Source during 1994. It consists of sections which summarize the work carried out in differing scientific disciplines, meetings and workshops, operations experience of the facility, projects undertaken for upgrades, administrative reports, and collections of abstracts and publications generated from work done at the facility.
International Nuclear Information System (INIS)
Rothman, E.Z.
1995-05-01
This report is a summary of activities carried out at the National Synchrotron Light Source during 1994. It consists of sections which summarize the work carried out in differing scientific disciplines, meetings and workshops, operations experience of the facility, projects undertaken for upgrades, administrative reports, and collections of abstracts and publications generated from work done at the facility
DOE occupational radiation exposure. Report 1992--1994
International Nuclear Information System (INIS)
1997-01-01
The DOE Occupational Radiation Exposure Report, 1992-1994 reports occupational radiation exposures incurred by individuals at US Department of Energy (DOE) facilities from 1992 through 1994. This report includes occupational radiation exposure information for all DOE employees, contractors, subcontractors, and visitors. This information is analyzed and trended over time to provide a measure of the DOE's performance in protecting its workers from radiation. Occupational radiation exposure at DOE has been decreasing over the past 5 years. In particular, doses in the higher dose ranges are decreasing, including the number of doses in excess of the DOE limits and doses in excess of the 2 rem Administrative Control Level (ACL). This is an indication of greater attention being given to protecting these individuals from radiation in the workplace
Spent nuclear fuel discharges from U.S. reactors 1994
International Nuclear Information System (INIS)
1996-02-01
Spent Nuclear Fuel Discharges from US Reactors 1994 provides current statistical data on fuel assemblies irradiated at commercial nuclear reactors operating in the US. This year's report provides data on the current inventories and storage capacities at these reactors. Detailed statistics on the data are presented in four chapters that highlight 1994 spent fuel discharges, storage capacities and inventories, canister and nonfuel component data, and assembly characteristics. Five appendices, a glossary, and bibliography are also included. 10 figs., 34 tabs
Alberta oil and gas industry : annual statistics for 1996
International Nuclear Information System (INIS)
1997-01-01
Alberta's 1996 annual and historical statistics for the supply and disposition of the following oil and gas products was presented: (1) crude oil and equivalent, (2) natural gas, (3) ethane, (4) propane, (5) butanes, (6) natural gas liquids, and (7) sulphur. Statistics regarding the deliveries and average price of the products and statistical data on drilling activity during 1996 were also included. Tables
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-06-01
The Electric and Magnetic Fields (EMF) Research and Public Information Dissemination (RAPID) Program was authorized by the Energy Policy Act of 1992 as a near-term effort to expand and accelerate the research needed to address the EMF issue. As required by this legislation, the EMF Interagency Committee, the National EMF Advisory Committee (NEMFAC), and the National Academy of Sciences (NAS) are providing valued input and advice for the direction of this program. With this input and advice, the Department of Energy (DOE) and the National Institute of Environmental Health Sciences (NIEHS) have developed and are implementing five-year program plans. Multi-year health effects research projects and related EMF measurement and exposure assessment projects are underway using funds appropriated in fiscal years 1994, 1995, and 1996 together with voluntary non-Federal contributions. The results of these research projects, along with the results of other EMF research, will be used as input to the hazard evaluation effort, which is the focus of the EMF RAPID Program. A coordinated interagency program is underway to communicate needed information on the EMF issue in a clear manner to the public and other decision makers.
International Nuclear Information System (INIS)
1996-01-01
The 1996 activity report of the Direction for Waste Management of the CEA, is presented. Its activities have been developed in the framework of the general CEA cleaning plan, and include the management of wastes generated before 1992 in R and D CEA facilities, the disposal of spent fuels generated by research reactors (Orphee and Siloe) or prototype reactors (EL4 at Brennilis), and the dismantling and cleaning of obsolete facilities such as the plutonium radiochemistry building at Fontenay-aux-Roses and the pilot workshop at Marcoule
The Illegal Immigration Reform and Immigrant Responsibility Act of 1996: an overview.
Fragomen, A T
1997-01-01
"On September 30, 1996, President Clinton signed the Illegal Immigration Reform and Immigrant Responsibility Act of 1996 (1996 Act), Pub. L. No. 104-208, 110 Stat. 3009. After an intense lobbying effort by the business community, most provisions relating to legal immigration were omitted from the final bill. Instead, the 1996 Act focuses on illegal immigration reform and includes some of the toughest measures ever taken against illegal immigration." Aspects considered include border enforcement, penalities against alien smuggling and document fraud, deportation and exclusion proceedings, employer sanctions, welfare provisions, and changes to existing refugee and asylum procedures. excerpt
Annual report of SPring-8, 1996
International Nuclear Information System (INIS)
1997-01-01
This report summarizes the activities of the SPring-8 Project in 1996. The purpose of the SPring-8 Project is to construct the world's most brilliant synchrotron radiation source in the soft and hard x-ray regions. The construction of the facility started in 1990, and the Project approaches its final stage of construction with the most outstanding progress in 1996 being the successful commissioning of the injector linac and the booster synchrotron. Installation of the linac was completed by the end of 1995 and the power test of the entire system started in January 1996. After the RF aging of the waveguide and accelerator columns for three months, the commissioning of the linac started on August 1 and it succeeded to accelerate electrons up to 1 GeV one week later. As for the booster synchrotron, its installation and precise alignment were completed in September. After the full power test of two months, the synchrotron commissioning started on December 6. Electrons were accelerated up to 8 GeV on December 16. The installation of all magnets in the storage ring was completed and the precise alignment of focusing magnets is under way. The installation of vacuum chambers and RF cavities has already been completed and the evacuation test is going on. The commissioning of the storage ring is scheduled in March, 1997. (M.N.)
DOE occupational radiation exposure 1996 report
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-12-31
The goal of the US Department of Energy (DOE) is to conduct its radiological operations to ensure the health and safety of all DOE employees including contractors and subcontractors. The DOE strives to maintain radiation exposures to its workers below administrative control levels and DOE limits and to further reduce these exposures and releases to levels that are ``As Low As Reasonably Achievable`` (ALARA). The DOE Occupational Radiation Exposure Report, 1996 provides summary and analysis of the occupational radiation exposure received by individuals associated with DOE activities. The DOE mission includes stewardship of the nuclear weapons stockpile and the associated facilities, environmental restoration of DOE and precursor agency sites, and energy research. Collective exposure at DOE has declined by 80% over the past decade due to a cessation in opportunities for exposure during the transition in DOE mission from weapons production to cleanup, deactivation and decommissioning, and changes in reporting requirements and dose calculation methodology. In 1996, the collective dose decreased by 10% from the 1995 value due to decreased doses at five of the seven highest-dose DOE sites. For 1996, these sites attributed the reduction in collective dose to the completion of several decontamination and decommissioning projects, reduced spent fuel storage activities, and effective ALARA practices. This report is intended to be a valuable tool for managers in their management of radiological safety programs and commitment of resources.
DOE occupational radiation exposure 1996 report
International Nuclear Information System (INIS)
1996-01-01
The goal of the US Department of Energy (DOE) is to conduct its radiological operations to ensure the health and safety of all DOE employees including contractors and subcontractors. The DOE strives to maintain radiation exposures to its workers below administrative control levels and DOE limits and to further reduce these exposures and releases to levels that are ''As Low As Reasonably Achievable'' (ALARA). The DOE Occupational Radiation Exposure Report, 1996 provides summary and analysis of the occupational radiation exposure received by individuals associated with DOE activities. The DOE mission includes stewardship of the nuclear weapons stockpile and the associated facilities, environmental restoration of DOE and precursor agency sites, and energy research. Collective exposure at DOE has declined by 80% over the past decade due to a cessation in opportunities for exposure during the transition in DOE mission from weapons production to cleanup, deactivation and decommissioning, and changes in reporting requirements and dose calculation methodology. In 1996, the collective dose decreased by 10% from the 1995 value due to decreased doses at five of the seven highest-dose DOE sites. For 1996, these sites attributed the reduction in collective dose to the completion of several decontamination and decommissioning projects, reduced spent fuel storage activities, and effective ALARA practices. This report is intended to be a valuable tool for managers in their management of radiological safety programs and commitment of resources
OCRWM Bulletin, summer/fall 1994
International Nuclear Information System (INIS)
1994-01-01
This publication consists of two parts, OCRWM Bulletin, and Of Mountains ampersand Science which is about the Yucca Mountain project. The OCRWM bulletin provides information about OCRWM activities, program update to Congress, reorganization, training provided on OCRWM database, OCRWM calendar, and exhibit schedule for 1994. Recent work at the Yucca Mountain project such as the tunnel boring machines are presented in layman's term
Gene : CBRC-SARA-01-1996 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1996 Novel UN D UNKNOWN NU2C_ANTFO 0.004 26% gb|AAQ05281.1| NADH dehydrogenase subunit B [Metas...equoia glyptostroboides] 0.044 26% MILMLFLLGSSPRSLIHPRAILKTFPIVCCCLYAFCSLTSLILSLAVL
Electric power annual 1994. Volume 2, Operational and financial data
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-11-28
This year, the annual is published in two volumes. Volume I focused on US electric utilities and contained final 1994 data on net generation, fossil fuel consumption, stocks, receipts, and cost. This Volume II presents annual 1994 summary statistics for the electric power industry, including information on both electric utilities and nonutility power producers. Included are preliminary data for electric utility retail sales of electricity, associated revenue, and average revenue per kilowatthour of electricity sold (based on form EIA-861) and for electric utility financial statistics, environmental statistics, power transactions, and demand- side management. Final 1994 data for US nonutility power producers on installed capacity and gross generation, as well as supply and disposition information, are also provided in Volume II. Technical notes and a glossary are included.
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-12-31
Due to financial boundary conditions and greater industrially orientated targets, the project was restructured in its third phase. The general theme `Mathematical modelling and laser measurement technique of combustion processes` was made more precise by the central questions of the Sub-heading `Modelling and validation`. It applies equally as target for the three part projects (a) Modelling process, (b) Standard flames (c) Coal and solid combustion, soot formation, radiation. Due to the preliminary work done, good progress was achieved in all projects, in some cases discoveries were made and new types of projects were developed. The quality and quantity of the basic data as input parameters for modelling and validation data as test parameters for the prediction of the models was expanded further by comparison of different methods of measurement. [Deutsch] Aufgrund der finanziellen Randbedingungen und der staerker industrieorientierten Zielsetzungen wurde das Projekt in seiner dritten Phase neu strukturiert. Das Generalthema `Mathematische Modellierung und Lasermesstechnik von Verbrennungsvorgaengen` wurde um die zentralen Fragestellungen als Zwischenueberschrift praezisiert: `Modellierung und Validierung`. Sie gilt fuer die drei Teilprojekt (a) Modellierungsverfahren (b) Standardflammen (c) Kohle- und Feststoffverbrennung, Russbildung, Strahlung in gleichem Mass als Zielsetzung. In allen Vorhaben konnten aufgrund der geleisteten Vorarbeit gute Fortschritte erzielt werden, in einigen Faellen Entdeckungen gemacht und neuartige Verfahren entwickelt werden. Die Qualitaet und Quantitaet der Basisdaten als Eingangsgroessen fuer die Modellierung und der Validierungsdaten als Testgroessen fuer die Voraussagen der Modelle konnten durch Vergleich unterschiedlicher Messmethoden generell weiter ausgebaut werden. (orig.)
JAERI TANDEM and V.D.G. annual report 1996. April 1, 1996 - March 31, 1997
International Nuclear Information System (INIS)
Takeuchi, Suehiro; Ikezoe, Hiroshi; Iwamoto, Akira; Sataka, Masao; Nagame, Yuichiro; Shoji, Tokio; Okabe, Takashi; Maekawa, Hiroshi
1997-09-01
This annual report describes research activities which have been performed with the JAERI tandem accelerator and the Van de Graaf accelerator from April 1, 1996 to March 31, 1997. Summary reports of 48 papers, and list of publications, personnel and cooperative researches with universities are contained. (author)
Directory of Open Access Journals (Sweden)
Abel Cabrera Martínez
2007-12-01
Full Text Available Se realizó un estudio descriptivo de corte transversal, cuyo universo estuvo constituido por la población mayor de 50 años perteneciente a Ciudad de La Habana, en el período comprendido entre junio de 2004 a junio del 2005. Para la determinación del tamaño de la muestra se asumió como universo los 633 396 habitantes mayores de 50 años de Ciudad Habana, con una estimación de la prevalencia esperada de 4,0 %, un error aceptable del 3 % y un efecto de diseño de 70 %. Se efectuó un muestreo sistemático por conglomerados y se determinó como muestra 2 760 habitantes de Ciudad de La Habana, representada por 46 cluster de 60 individuos cada uno. Se definió como ceguera la agudeza visual con corrección, inferior a 20/400 y la deficiencia visual grave como la agudeza visual con corrección >20/400 y The universe of a cross-sectional descriptive study, which was carried out from June 2004 to June 2005, was made up of people aged over 50 years, who lived in the City of Havana. In order to determine the sample size, 633 396 over 50 years-old inhabitants were taken as the universe of study, with an expected prevalence estimation of 4.0 %, an allowable error of 3 % and a design effect of 70 %. On the basis of these data, systematic cluster sampling was made to determine a sample of 2 760 inhabitants from the City of Havana, represented by 46 clusters of 60 subjects each. Blindness was defined as corrected visual acuity lower than 20/400 and severe visual shortage as corrected visual acuity >20/400 and <20/200 in the best eye and with the best available correction. An inter-observer variation to reduce errors for this reason was also made. The study coverage was 98.4 % of the selected sample. The blindness prevalence by sex was 2.4 %. Prevalence of bilateral blind persons by age increases from 2.6 % at 50 years to 15,2 % at 80 years and over. The most important causes of bilateral blindness were cataract (50 %, glaucoma (26 % and diabetic
Radioactivity in food and the environment, 1996
International Nuclear Information System (INIS)
1997-09-01
This report continues the series which combines the results of the radioactivity monitoring programmes previously published by MAFF in two documents: the 'Terrestrial Radioactivity Monitoring Programme (TRAMP) Report: Radioactivity in food and agricultural products in England and Wales' and the 'Aquatic Environment Monitoring Report: Radioactivity in surface and coastal waters of the British Isles' (AEMR). For the first time the report includes the results of all environmental monitoring for radioactivity carried out on behalf of the regulatory authority in Scotland. These results were previously presented in the 'Statistical Bulletin: Environmental Monitoring for Radioactivity in Scotland' (e.g. The Scottish Office, (1996). Measurements in 1996 included the analysis of samples of food and other materials from the environment and detection of beta and gamma dose rates in the environment. The results show that radionuclide concentrations and radiation dose rates were generally similar to those in 1995. However, near Sellafield, despite the general downward trend in disposals from the site during 1996, there were some increases in concentrations of technetium-99 and carbon-14 in marine foodstuffs reflecting disposals from and operations on the site in previous years. These operations included processing of stored wastes and the operation of the Enhanced Actinide Removal Plant (EARP). The Thermal Oxide Reprocessing Plant (THORP) continued its commissioning phase in 1996 and its disposals had little effect on food and the marine environment. The results of the monitoring have been interpreted in terms of public radiation exposures using data on activity levels in food and local surveys to establish potential 'critical groups' of people likely to be most exposed. (author)
1994 Baseline biological studies for the Device Assembly Facility at the Nevada Test Site
Energy Technology Data Exchange (ETDEWEB)
Townsend, Y.E. [ed.; Woodward, B.D.; Hunter, R.B.; Greger, P.D.; Saethre, M.B.
1995-02-01
This report describes environmental work performed at the Device Assembly Facility (DAF) in 1994 by the Basic Environmental Monitoring and Compliance Program (BECAMP). The DAF is located near the Mojave-Great Basin desert transition zone 27 km north of Mercury. The area immediately around the DAF building complex is a gentle slope cut by 1 to 3 m deep arroyos, and occupied by transitional vegetation. In 1994, construction activities were largely limited to work inside the perimeter fence. The DAF was still in a preoperational mode in 1994, and no nuclear materials were present. The DAF facilities were being occupied so there was water in the sewage settling pond, and the roads and lights were in use. Sampling activities in 1994 represent the first year in the proposed monitoring scheme. The proposed biological monitoring plan gives detailed experimental protocols. Plant, lizard, tortoise, small mammal, and bird surveys were performed in 1994. The authors briefly outline procedures employed in 1994. Studies performed on each taxon are reviewed separately then summarized in a concluding section.
Reactor Operations informal monthly report December 1994
International Nuclear Information System (INIS)
1994-12-01
Reactor operations at the MRR and HFBR reactors at Brookhaven National Laboratory are presented for December 1994. Reactor run-time and power levels, instrumentation, mechanical maintenance, occurrence reports, and safety information are included
Planning integration FY 1996 program plan. Revision 1
International Nuclear Information System (INIS)
1995-09-01
This Multi-Year Program Plan (MAP) Planning Integration Program, Work Breakdown Structure (WBS) Element 1.8.2, is the primary management tool to document the technical, schedule, and cost baseline for work directed by the US Department of Energy (DOE), Richland Operations Office (RL). As an approved document, it establishes an agreement between RL and the performing contractors for the work to be performed. It was prepared by Westinghouse Hanford Company (WHC) and Pacific Northwest Laboratory (PNL). The MYPPs for the Hanford Site programs are to provide a picture from fiscal year (FY) 1996 through FY 2002. At RL Planning and Integration Division (PID) direction, only the FY 1996 Planning Integration Program work scope has been planned and presented in this MAP. Only those known significant activities which occur after FY 1996 are portrayed in this MAP. This is due to the uncertainty of who will be accomplishing what work scope when, following the award of the Management and Integration (M ampersand I) contract
Atomic energy in Lithuania: Nuclear safety in 1996
International Nuclear Information System (INIS)
Vaishnys, P.; Krenevichius, R.; Alejev, A.; Demchenko, M.
1997-01-01
The first annual report of VATESI - Lithuanian Nuclear Safety Authority's activity is presented and cover description of the main results in 1996. VATESI was established in 1991 recently after regaining of independence when Ignalina NPP come into jurisdiction of Republic of Lithuania. Since the establishment in six year period of operation VATESI developed its activities considerably and now is able to perform the functions of independent regulator of nuclear safety in Lithuania. The main fields of VATESI activities in 1996 were evaluation of the safety of Ignalina NPP, supervision of Ignalina NPP's operational safety, control of the implementation of safety improvement program SIP-1 in Ignalina NPP, development of new regulatory legislation according to IAEA standards and practices, accountancy and control of nuclear materials, regulation of radioactive waste management. Detailed description of all these activities is provided in the report. In 1996 there were no safety significant events in Ignalina NPP according to the INES scale, only five events received qualification as level 1 events
International Nuclear Information System (INIS)
2000-01-01
The emergence of new energy, chemicals and materials markets for agricultural products has created a need for major sustainable research. With this end in mind the scientific interest group AGRICE (AGRiculture for Chemicals and Energy) was created in 1994 by government bodies. This document presents a wide summary of the works in the following activities: the biofuels, the biomaterials and biomolecules, the oil-ester ethanol-ETBE and lignocellulosic processing chains, the environmental and economic evaluation, a financial statement. (A.L.B.)
International Nuclear Information System (INIS)
1995-05-01
This reports presents the Leon Brillouin Laboratory (LLB) activity during 1993-1994. Concerning the physico-chemical and biological systems, polymers are still a main field of the LLB. New ideas and experiments appeared also in the field water, ionic solids, polyelectrolyte and biologicals systems. Concerning structures and phase transitions, activity in the field of crystalline structures has been reinforced. Disordered systems, metallurgy and material fields were also developed. Concerning magnetism and superconductivity, important results were obtained. (TEC). 159 refs., 241 figs., 29 tabs
Canadian Petroleum Products Institute 1996 annual review
International Nuclear Information System (INIS)
1996-01-01
The Canadian Petroleum Products Institute (CPPI) is an association of Canadian companies involved in the downstream sector of the petroleum industry which includes refining, distributing and marketing of petroleum products. CPPI's mandate includes: (1) establishing environmental policies, (2) establishing working relationships with governments to develop public policy, (3) developing guidelines for the safe handling of petroleum products, and (4) providing information about the petroleum industry to the public. Canada's 19 refineries processed an average of 1.5 million barrels of crude oil per day in 1996. Domestic sources of crude made up 61 per cent of crude oil processed in 1996. Total exports during the year amounted to 105 million barrels. Some of the issues that the CPPI focused on during 1996 included the controversy over the future of the octane enhancing fuel additive MMT, fuel quality standards for transportation fuels and reformulated fuels, gasoline pricing, air quality and workplace safety. CPPI members' participation in the Voluntary Challenge and Registry (VCR) program towards reducing greenhouse gas emissions was also discussed. The industry was also actively involved in seeking to improve its refinery wastewater discharges
Classification of huminite-ICCP System 1994
Energy Technology Data Exchange (ETDEWEB)
Sykorova, I. [Institute of Rock Structure and Mechanics, Academy of Science of the Czech Republic, V Holesovicka 41, 182 09 Prague 8 (Czech Republic); Pickel, W. [Coal and Organic Petrology Services Pty Ltd, 23/80 Box Road, Taren Point, NSW 2229 (Australia); Christanis, K. [Department of Geology, University of Patras, 26500 Rio-Patras (Greece); Wolf, M. [Mergelskull 29, 47802 Krefeld (Germany); Taylor, G.H. [15 Hawkesbury Cres, Farrer Act 2607 (Australia); Flores, D. [Departamento de Geologia, Faculdade de Ciencias do Porto, Praca de Gomes Teixeira, 4099-002 Porto (Portugal)
2005-04-12
In the new classification (ICCP System 1994), the maceral group huminite has been revised from the previous classification (ICCP, 1971. Int. Handbook Coal Petr., suppl. to 2nd ed.) to accommodate the nomenclature to changes in the other maceral groups, especially the changes in the vitrinite classification (ICCP, 1998. The new vitrinite classification (ICCP System 1994). Fuel 77, 349-358.). The vitrinite and huminite systems have been correlated so that down to the level of sub-maceral groups, the two systems can be used in parallel. At the level of macerals and for finer classifications, the analyst now has, according to the nature of the coal and the purpose of the analysis, a choice of using either of the two classification systems for huminite and vitrinite. This is in accordance with the new ISO Coal Classification that covers low rank coals as well and allows for the simultaneous use of the huminite and vitrinite nomenclature for low rank coals.
Energy Technology Data Exchange (ETDEWEB)
Sotic, O [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)
1994-12-01
Activities related to revitalisation of the RA reactor stared in 1986, were continued in 1991. A number of interventions on the reactor components were finished that are supposed to enable continuous and reliable operation. The last, and at the same time largest action, related to exchange of complete reactor instrumentation is underway, but it is behind the schedule in 1991 because the delivery of components from USSR is late. Production of this instruments is financed by the IAEA according to the contract signed in December 1988 with Russian Atomenergoexport. According to this contract, it has been planned that the RA reactor instrumentation should be delivered to the Vinca Institute by the end of 1990. Only 56% of the instrumentation was delivered until September 1991. Since then any delivery of components to Yugoslavia was stopped because of the temporary embargo imposed by the IAEA. In 1991 most of the existing RA reactor instrumentation was dismantled, only the part needed for basic measurements when reactor is not operated, was maintained. Activities related to improvement of Russian project were continued in 1994. Control and maintenance of the reactor components was done regularly and efficiently. Extensive repair of the secondary coolant loop is almost finished and will be completed in the first part of 1995 according to existing legal procedures and IAEA recommendations. Fuel inspection by the IAEA safeguards inspectors was done on a monthly basis. There have been on the average 47 employees at the RA reactor which is considered sufficient for maintenance and repair conditions. Research reactor RA Annual report for year 1991 is divided into two main parts to cover: (1) operation and maintenance and (2) activities related to radiation protection. [Serbo-Croat] U 1994. godini nastavljeni su poslovi na revitalizaciji reaktora RA, zapocetoj 1986. godine. Okoncan je niz zahvata na opremi postrojenja kojima ce se u narednom periodu omoguciti kontinualan i
Educación para el Ocio: Ha llegado la hora de un nuevo objetivo para una vieja idea.
Directory of Open Access Journals (Sweden)
Susan Hutchinson
2012-01-01
Full Text Available La Educación para el Ocio nos sitúa ante una vieja idea, que está siendo examinada con renovado vigor en Canadá. Profesionales e investigadores de diversas disciplinas (por ejemplo, en el ámbito de Salud, la Justicia, la Educación o la Recreación reconocen, cada vez más, que son muchas las personas que pueden beneficiarse del ocio y de las oportunidades de recreación en sus comunidades, aún cuando son bastantes las no pueden hacerlo porque carecen de alfabetización en ocio. Esto es, de los conocimientos, habilidades y confianza que se necesitan para darle un significado personal, que incida positivamente en su bienestar y calidad de vida. La Educación para el Ocio es un medio clave para mejorar la alfabetización en ocio. El texto presenta un modelo de educación para el ocio desarrollado por la Dra. Brenda Robertson, argumentando cómo y por qué la Educación para el Ocio es necesaria para abordar la salud mental y el bienestar de las personas que sufren marginación en sus comunidades. Complementariamente se presentan algunas recomendaciones para avanzar esta Educación, como un componente fundamental de la agenda nacional para la recreación en Canadá.--------------------------------------------------------------------Leisure education is an old idea that is being examined with renewed vigour in Canada. Practitioners and researchers from various disciplines (e.g., health, justice, education, recreation are recognising anew that many people who could benefit from leisure or recreation opportunities in their communities are unable to do so because they lack leisure literacy. Leisure literacy refers to the knowledge, skills and confidence to engage in personally meaningful, health-enhancing leisure. Leisure education is a key means to enhance leisure literacy. The paper presents a model of leisure education developed by Dr. Brenda Robertson and argues for how and why leisure education is needed to address the mental health and well
Vereinigte Elektrizitaetswerke Westfalen AG. Annual report 1994
International Nuclear Information System (INIS)
1995-01-01
The tasks and activities of this German electric utility are described. The annual report for 1994 contains a large number of financial data (e.g. balance sheet, profit- and -loss account, etc.). (UA) [de
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-10-01
The report is intended as information for the German Bundestag and Bundesrat as well as for the general population interested in issues of radiological protection. The information presented in the report shows that in 1996, the radiation dose to the population was low and amounted to an average of 4 millisievert (mSv), with 60% contributed by natural radiation sources, and 40% by artificial sources. The major natural source was the radioactive gas radon in buildings. Anthropogenic radiation exposure almost exclusively resulted from application of radioactive substances and ionizing radiation in the medical field, for diagnostic purposes. There still is a potential for reducing radiation doses due to these applications. In the reporting year, there were 340 000 persons occupationally exposed to ionizing radiation. Only 15% of these received a dose different from zero, the average dose was 1.8 mSv. The data show that the anthropogenic radiation exposure emanating from the uses of atomic energy or applications of ionizing radiation in technology is very low. (orig./CB) [Deutsch] Der vorliegende Bericht ueber die `Umweltradioaktivitaet und Strahlenbelastung im Jahr 1996` richtet sich an Bundestag und Bundesrat und darueber hinaus an alle an Fragen des Strahlenschutzes interessierte Buerger. Der Bericht belegt, dass die Strahlenbelastung der Bevoelkerung im Jahr 1996 gering war und insgesamt durchschnittlich 4 Millisievert (mSv) betrug. Dieser Wert war zu 60% auf natuerliche und zu 40% auf kuenstliche Strahlenquellen zurueckzufuehren. Den wesentlichen Beitrag zur natuerlichen Strahlenbelastung lieferte das radioaktive Gas Radon in Wohnungen. Die zivilisatorische Strahlenexposition der Bevoelkerung wurde fast ausschliesslich durch die Anwendung radioaktiver Stoffe und ionisierender Strahlen in der Medizin im Rahmen der Diagnostik hervorgerufen. Hier bestehen nach wie vor Moeglichkeiten zur Reduktion der Strahlenbelastung. Im Jahre 1996 waren 340 000 Personen beruflich
CEA 1996 survey of accounting policies and practices
International Nuclear Information System (INIS)
Constant, M.
1997-01-01
A survey of accounting policies and practices of some of Canada's largest electrical utilities was presented. The first survey was done in 1981 and then updated in 1986, 1991 and 1996. The dominating issues affecting accounting practices in the 1996 survey were regulation versus deregulation, corporate governance, risk management, research and development costs, new ventures, and environmental liabilities. The Survey examined eight areas of accounting concern, among them financial statement concepts, statement of operations, assets, liabilities, equity, special topics, and financial ratios and other statistics
DOE occupational radiation exposure. Report 1992--1994
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-05-01
The DOE Occupational Radiation Exposure Report, 1992-1994 reports occupational radiation exposures incurred by individuals at US Department of Energy (DOE) facilities from 1992 through 1994. This report includes occupational radiation exposure information for all DOE employees, contractors, subcontractors, and visitors. This information is analyzed and trended over time to provide a measure of the DOE`s performance in protecting its workers from radiation. Occupational radiation exposure at DOE has been decreasing over the past 5 years. In particular, doses in the higher dose ranges are decreasing, including the number of doses in excess of the DOE limits and doses in excess of the 2 rem Administrative Control Level (ACL). This is an indication of greater attention being given to protecting these individuals from radiation in the workplace.
Monitoring programme. Radioactive substances report for 1994
International Nuclear Information System (INIS)
1995-09-01
In the United Kingdom, Her Majesty's Inspectorate of Pollution commissions independent monitoring of radioactive discharges to the environment. This report presents the results of such monitoring for 1994. It covers nuclear sites, two non-nuclear sites which use large amounts of tritium and several landfill sites which receive low-level radioactive waste for controlled burial. The monitoring programme concentrates on activity levels in environmental materials that might result in exposure of the public to radiation from non-food pathways. The results show that exposures from these pathways in 1994 remain similar to those in previous years and in all cases are estimated to have been substantially lower than the International Commission on Radiological Protection's recommended dose limit of 1mSv per year. (6 figures; 20 tables; 29 references) (UK)
Supplement to the annual energy outlook 1994
Energy Technology Data Exchange (ETDEWEB)
NONE
1994-03-01
This report is a companion document to the Annual Energy Outlook 1994 (AEO94), (DOE/EIA-0383(94)), released in Jan. 1994. Part I of the Supplement presents the key quantitative assumptions underlying the AEO94 projections, responding to requests by energy analysts for additional information on the forecasts. In Part II, the Supplement provides regional projections and other underlying details of the reference case projections in the AEO94. The AEO94 presents national forecasts of energy production, demand and prices through 2010 for five scenarios, including a reference case and four additional cases that assume higher and lower economic growth and higher and lower world oil prices. These forecasts are used by Federal, State, and local governments, trade associations, and other planners and decisionmakers in the public and private sectors.
International Nuclear Information System (INIS)
1997-01-01
The 1996/1997 Annual Report of Atomic Energy of Canada Ltd. (AECL) is published and submitted to the Honourable member of parliament, Minister of Natural Resources. Included in this report are messages from marketing, commercial operations, product development, CANDU research, waste management, environmental management, financial review and copies of financial statements
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-07-01
The 1996/1997 Annual Report of Atomic Energy of Canada Ltd. (AECL) is published and submitted to the Honourable member of parliament, Minister of Natural Resources. Included in this report are messages from marketing, commercial operations, product development, CANDU research, waste management, environmental management, financial review and copies of financial statements.
Enfermedad meningocócica.Un estudio de caso control en Ciudad Habana, noviembre 2003-julio 2005
Directory of Open Access Journals (Sweden)
Antonio Pérez
2011-04-01
Full Text Available Cuba ejecuta un programa de inmunización antimeningocócica desde 1991. El propósito de este estudio fue identificar posibles factores asociados a la ocurrencia de casos en grupos de vacunados. Un total de nueve casos con enfermedad meningocócica (EM en Ciudad Habana se registraron en el período noviembre de 2003- julio 2005 en menores de 20 años, pero se estudiaron solo 7, por encontrarse uno fuera del país y otro fallecido. Se seleccionaron aleatoriamente 34 controles comunitarios para comparar con los casos e identificar algunos factores de riesgo asociados y evaluar los anticuerpos bactericidas y ELISA existentes contra la proteína de membrana externa del serogrupo B. El 100% de los casos estudiados presentó la forma meníngea, con una estadía hospitalaria promedio de 9,8 días y una letalidad de 14,3% (1/7. En el análisis bivariado se encontró la no lactancia materna asociada (OR 3,17 IC95%= 0,44-27,85 a la ocurrencia de la enfermedad, sin significación estadística (p>0,05 por el pequeño universo de estudio. Finalmente, la regresión logística multivariada indicó asociación con la no lactancia materna (OR 3,22 IC95%= 0,52-19,52 con la ocurrencia de la enfermedad, pero igualmente esta no fue significativa. La prueba de Mann Whitney para la comparación de los títulos de anticuerpos para el antígeno B en casos y controles mostró una diferencia muy significativa (p< 0,01 a favor de los enfermos, por la respuesta de la memoria inmune a la infección natural. La vacuna cubana es protectora para la enfermedad meningocócica serogrupo BC. En el 57% de los casos de EM los síntomas comenzaron como promedio cuatro años después de la aplicación de la segunda dosis de la vacuna.
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-11-01
This annual report describes research activities which have been performed with the JAERI TIARA (Takasaki Ion Accelerators for Advanced Radiation Application) facilities from April 1, 1996 to March 31, 1997. Summary reports of 88 papers and 4 brief descriptions on the status of TIARA in the period are contained. A list of publications, the type of research collaborations and organization of TIARA are also given as appendices. (J.P.N.)
Environmental surveillance at Los Alamos during 1994
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-07-01
This report describes environmental monitoring activities at Los Alamos National Laboratory for 1994. Data were collected to assess external penetrating radiation, airborne emissions, liquid effluents, radioactivity of environmental materials and food stuffs, and environmental compliance.
Environmental surveillance at Los Alamos during 1994
International Nuclear Information System (INIS)
1996-07-01
This report describes environmental monitoring activities at Los Alamos National Laboratory for 1994. Data were collected to assess external penetrating radiation, airborne emissions, liquid effluents, radioactivity of environmental materials and food stuffs, and environmental compliance
Pinellas Plant Annual Site Environmental Report for calendar year 1994
International Nuclear Information System (INIS)
1995-06-01
This report presents a comprehensive summary of the results of the Environmental Monitoring, Waste Management, and Environmental Restoration Programs at the Pinellas Plant, in Pinellas County, Florida for 1994. This report also includes the plant's performance in the areas of compliance with applicable regulatory requirements and standards and identifies major Environmental, Safety and Health Program initiatives and accomplishments for 1994. As a result of the end of Department of Energy Defense Programs mission production on September 30, 1994, considerable changes at the Pinellas Plant occurred. These changes, which included transitioning the plant toward alternate use in support of economic development and safe shutdown, both increased and heightened Environmental, Safety and Health responsibilities. In December 1994, the Department of Energy announced it had reached an agreement to sell the Pinellas Plant to the Pinellas County Industry Council in March 1995. The plant is being leased back by the Department of Energy through September 1997 to complete safe shutdown, reconfiguration, transfer of equipment to other Department of Energy production facilities, and transition to commercial ventures. Permit modifications and transfers will be completed during 1995 to reflect the new ownership by the Pinellas County Industry Council and to include new tenants as needed