WorldWideScience

Sample records for ha llegado bolonia

  1. Radioactividad natural y salud: ¿ha llegado el momento de prestarle más atención?

    Directory of Open Access Journals (Sweden)

    Enrique Estrada Vélez

    2008-12-01

    Full Text Available En la actualidad es frecuente que se tengan noticias de problemas de salud que en el pasado no se conocían o no eran preferentes. Hemos superado enfermedades prioritarias y la esperanza de vida ha aumen- tado, lo que aconseja empezar a prestar una mayor atención a la radioactividad natural por incidir en la oncogénesis y la teratogenicidad y, por otro lado, estar vinculada a factores y procesos nuevos como los edificios inteligentes en los que está implicado el radón por un lado y, sobre todo, a exposición debida a la explotación del agua fósil por otro.La radioactividad natural no origina procesos agudos, siempre está ligada a procesos crónicos, en los que el daño incide en los sistemas de información genética: el ADN como molécula individual y el cromosoma como un todo, dando origen a procesos oncológicos, por lo que es un cancerígeno per se de gran importancia. En este artículo se hace una llamada de atención sobre la implicación de la radioactividad natural en los edificios, en el agua, etc., de ciertas zonas geográficas con altos niveles de radioactividad natural.

  2. El rol de la enfermera coordinadora de asistencia ventricular en España: el futuro ya ha llegado

    Directory of Open Access Journals (Sweden)

    Patricia Conejero-Ferrer

    2016-10-01

    Full Text Available Los dispositivos de asistencia ventricular han revolucionado el tratamiento de los pacientes con insuficiencia cardiaca avanzada refractaria al tratamiento médico, como puente al trasplante, y más recientemente también como terapia de destino. Debido al incremento en el número de pacientes tratados con este tipo de dispositivos, y al manejo específico y diferenciado que requieren, se ha producido en los últimos tiempos la necesidad de creación de un nuevo rol en el equipo ventricular assist device: una enfermera especializada o ventricular assist device coordinator (formada en hospitales pioneros en implantación de estos dispositivos, que se encargue de la gestión de casos y del seguimiento de estos pacientes. Desde nuestra experiencia, creemos que esta figura es necesaria ya que mejoraría los resultados clínicos (reducción de complicaciones, y sería el pivote central de coordinación de estos pacientes aumentando su calidad de vida, disminuyendo la cifra de reingresos, y sobre todo, aumentando la satisfacción del paciente y su familia.

  3. Palacio de los deportes, en Bolonia

    Directory of Open Access Journals (Sweden)

    Zauli, Bruno

    1959-07-01

    Full Text Available Como consecuencia de los acuerdos del Comité Olímpico Nacional Italiano, se ha construido, recientemente, en Bolonia, sobre los terrenos a tal objeto cedidos por el Ayuntamiento de aquella ciudad italiana, un amplio palacio de deportes. La cancha de este edificio cubierto podrá transformarse en pistas para tenis, baloncesto, hockey sobre patines, patinaje, boxeo, gimnasia, conciertos, etc.

  4. Natural radioactivity and health: is it the moment to pay more attention? Radioactividad natural y salud: ¿ha llegado el momento de prestarle más atención?

    Directory of Open Access Journals (Sweden)

    Enrique Estrada Vélez

    2008-12-01

    Full Text Available At the moment, it is more usual to be aware of health problems, which were not given priority in the past .We, have overcome previous health problems to which we have given importance and life expectancy has increased and inconsequence we do now require to give more attention to natural radioactivity because it affects oncological and genetic problems. On the one hand, it is connected with new processes or factors regarding, for example building techniques and materials which include radon and on the other hand, to exposure by exploitation to fossil water. Natural radioactivity does not produce acute illness but it is always linked to chronic illness, in which to damage affects the genetic information: the AND as a simple molecule and the chromosome as a whole, which gives rise to oncological processes. Therefore natural radioactivity is a cancer producing agent “per se” of mayor significance. In this opinion paper we are seeking awareness of how natural radioactivity affects the buildings, water, etc. in there particular geographical areas with high levels of natural radioactivity.En la actualidad es frecuente que se tengan noticias de problemas de salud que en el pasado no se conocían o no eran preferentes. Hemos superado enfermedades prioritarias y la esperanza de vida ha aumen- tado, lo que aconseja empezar a prestar una mayor atención a la radioactividad natural por incidir en la oncogénesis y la teratogenicidad y, por otro lado, estar vinculada a factores y procesos nuevos como los edificios inteligentes en los que está implicado el radón por un lado y, sobre todo, a exposición debida a la explotación del agua fósil por otro. La radioactividad natural no origina procesos agudos, siempre está ligada a procesos crónicos, en los que el daño incide en los sistemas de información genética: el ADN como molécula individual y el cromosoma como un todo, dando origen a procesos oncológicos, por lo que es un cancerígeno per se de

  5. Edificio en Bolonia

    Directory of Open Access Journals (Sweden)

    Tagliaventi, Ivo

    1964-06-01

    Full Text Available This building belongs to a branch of a German firm of car manufacturers. The ground area covered by the building is about 550 m2. The basement is taken up with a store of spare parts. The ground floor serves as workshop and garage. There are two storeys occupied with the firms' offices, and five more storeys devoted to living apartments. The latter have an independent stairs. The volume distribution of this project has been carefully thought out, so that its various functions can be served in the best possible manner, within an integrated architectural conception. Materials have also been chosen to harmonise as much as possible with the general character of the building, and the reinforced concrete structure has been left partly visible, both externally and internally. The design of the apartments is such that these are not too expensive, since they are meant to be occupied by people of the middle income group. The various flats only differ from each other in slight variations. The external aspect of the building shows a dynamic and contrasting quality, which takes fully into account the sorrounding environment.Este edificio, que ha sido construido por la filial de una casa alemana de automóviles, tiene una superficie media de 550 m2 por planta y consta de: sótano, para el almacenamiento de las piezas de recambio; planta baja, utilizada para talleres y garajes, que se extiende hasta la zona ocupada por la nave preexistente; dos plantas, destinadas a oficinas de dicha filial, y cinco plantas, ocupadas por viviendas. Estas últimas están servidas por escaleras independientes. Gracias a cuidadosos estudios volumétricos se han podido obtener las debidas articulaciones y espacios requeridos para el correcto uso del edificio y diferenciar sus distintas partes, dedicadas a misiones diversas, de manera que, incluso dentro de una unidad arquitectónica y constructora, la forma pueda denunciar claramente la función. La misma finalidad se ha

  6. Políticas educativas, educación superior y proceso de Bolonia en Latinoamérica

    OpenAIRE

    César Geronimo Tello

    2015-01-01

    En Latinoamérica el proceso de Bolonia se presenta como una provocación para pensar y reflexionar sobre la necesidad de consolidación del espacio de Educación Superior en nuestra región. Del mismo modo, este proceso europeo fue asumiendo un rol director en la globalización neoliberal en la Educación Superior de nuestros contextos académicos. Por lo tanto en este artículo argumentamos que la Educación Superior Europea en el marco del proceso de Bolonia ha sido considerada un gran éxito para aq...

  7. Perspectivas y repercusiones del Proceso de Bolonia en Iberoamérica

    OpenAIRE

    Tiana, Alejandro

    2016-01-01

    El Proceso de Bolonia constituye uno de los desarrollos más importantes experimentados en el ámbito de la educación superior en los dos últimos siglos. Su impacto ha trascendido las fronteras europeas, alcanzando su eco a otras regiones. En el ámbito iberoamericano también se le ha prestado atención, aunque muchos estudiosos de los sistemas universitarios coinciden en subrayar la dificultad que ofrece su aplicación directa en la región. Esos juicios cualificados podrían hacer pensar que se tr...

  8. Mineralogía y génesis de las arcillas de las unidades del Campo de Gibraltar. V. Unidad de Bolonia

    Directory of Open Access Journals (Sweden)

    Ruiz Cruz, M. D.

    1990-04-01

    Full Text Available The mineralogical results of the Bolonia Unit are analysed in the work. The Cabrito-l section is characterized by the mineralogical association kaolinite-illite-interestratified I-S, and is similar to the section of Punta Tarifa series of the Algeciras Unit. The Pulido section, characterized by the mineralogical association (kaolinite-illite-chlorite, may be considered as the most distal zone of the «areniscoso-micaceo» flysch of the Algeciras Unit. The most significant difference between the fine fractions of these Units is the remarkable development, in the Bolonia Unit, of authigenic chlorites, whose composition shows a diagenetic environment rich in Fe and Mg. On the other hand, the mineralogical composition of the fine fraction has made possible the identification in the Bolonia Unit, not only the «areniscas del Aljibe» levels, but also clay levels of Aljibe Unit, which has not been noticed until now. These mineralogical and lithological aspects lead to consider the Bolonia Unit as an intermediate Unit between the Algeciras and the Aljibe ones.En este trabajo se recogen los resultados obtenidos a partir del estudio mineralógico de la Unidad de Bolonia. De los perfiles estudiados, el del Cabrito, caracterizado por la asociación mineralógica caolinita-ilita, interestratificados I-E, es similar en gran medida a la serie tipo punta Tarifa de la Unidad de Algeciras. El perfil del Pulido, caracterizado por la asociación (caolinita-ilita-clorita puede interpretarse como la parte más distal del flysch areniscoso-micáceo de la Unidad de Algeciras. La diferencia más notable en la mineralogía de la fracción fina entre ambas Unidades se refiere al desarrollo notable, en Bolonia, de cloritas autigénicas, cuya composición indica un medio diagenético rico en Fe y Mg. Por otra parte, la mineralogía de la fracción fina ha permitido identificar en la Unidad de Bolonia no sólo los niveles de areniscas del Aljibe sino tambi

  9. La docencia universitaria ante el proceso de Bolonia

    OpenAIRE

    Naval, C. (Concepción); Sobrino-Morrás, Á. (Ángel); Pérez-Sancho, C. (Carlota)

    2006-01-01

    El compromiso político de construir un espacio europeo de educación superior (EEES) —adoptado formalmente en la Declaración de Bolonia, 1999— sumerge a la universidad europea en un complejo proceso de reestructuración a fin de armonizar —no unificar— las estructuras de educación superior europeas antes del año 2010. El llamado EEES responde a varias motivaciones: un afán por conseguir un sistema común de titulaciones que asegure el reconocimiento y compatibilidad de lo...

  10. Solar and electric automobiles: An idea whose time has come; Automoviles solares y electricos: Una idea cuyo tiempo ha llegado

    Energy Technology Data Exchange (ETDEWEB)

    Padilla, Beatriz [Academia de la Investigacion Cientifica, A. C., Mexico, D. F. (Mexico)

    1992-12-31

    Given the dependence of our transport system in combustible hydrocarbons that, besides generating serious pollution levels, eventually will become scarce, severely affecting the world economy- it is compulsory to develop non polluting transportation, capable of operating with alternative energies. In the avant-guard of this technological achievement are the competition solar automobiles, that have made great contributions (particularly for the rigorous application of the design for efficiency principles) in the development of the applicable technology to the electric vehicles. Tonatiuh is the first competition solar car built in Mexico. In 1993 Tonatiuh will compete in the Rally Formula Sol in Mexico and in the World Solar of Australia. A superficial comparison of electric vehicles with vehicles equipped with internal combustion motors, demonstrates the great advantages of the first ones, most of all at the light of the current technological advances propitiated by laws that demand them for the sale of electric vehicles. This incipient industry presents a great opportunity for Mexico, since the markets are not saturated and exist large areas of research and development. For improvement of the air quality in Mexico city, the electric vehicle would have a very positive impact, mostly applied to public transportation. [Espanol] Dada la dependencia de nuestro sistema de transporte en hidrocarburos combustibles que, ademas de generar graves niveles de contaminacion eventualmente escacearan, afectando severamente la economia mundial - es imperativo desarrollar transportes no contaminantes capaces de operar con energias alternativas. En la vanguardia de esta avanzada tecnologia se encuentran los autos solares de carreras, los cuales han hecho grandes aportaciones (particularmente por la aplicacion rigurosa de los principios del diseno para eficiencia) el desarrollo de tecnologia aplicable a vehiculos electricos. Tonatiuh es el primer auto solar de carreras que se construye en Mexico. En 1993 Tonatiuh competira en la carrera Formula Sol en Mexico y en el World Solar Challenge de Australia. Una comparacion somera de vehiculos electricos con motores de combustion interna, demuestra las grandes ventajas de los primeros, sobre todo a la luz de los actuales avances tecnologicos propiciados por leyes que exigen la venta de vehiculos electricos. Esta naciente industria presenta una gran oportunidad para Mexico, ya que los mercados no estan saturados y existen amplias areas de investigacion y desarrollo. Para mejorar la calidad del aire en la ciudad de Mexico, los vehiculos electricos tendrian un impacto muy positivo, sobre todo aplicados en el transporte publico.

  11. Sostenibilización curricular en las universidades españolas. ¿ha llegado la hora de actuar?

    OpenAIRE

    Barrón, Ángela; Ferrer-Balas, Didac; Navarrete Salvador, Antonio

    2010-01-01

    Desde la Educación Superior se contempla la necesidad de incluir contenidos ambientales (económicos-sociales-naturales) en los curricula de las diferentes titulaciones para formar profesionales capaces de actuar críticamente en pos de la sostenibilidad. La CRUE viene trabajando en este sentido desde 2002, en 2005 aprobó unas directrices para la sostenibilización curricular en las universidades españolas. En la actualidad, desde la Comisión Sectorial para la Calidad Ambiental el...

  12. ¿Ha llegado la hora de la gestión de las listas de espera?

    Directory of Open Access Journals (Sweden)

    Bernal E.

    2002-01-01

    Full Text Available Las personas que ocupan una lista de espera sufren a menudo un riesgo adicional derivado del tiempo que pasa hasta que obtienen tratamiento; sin embargo, en otras ocasiones, las personas en lista no tienen necesidad del tratamiento por el que esperan. Ambos argumentos, contrastables con evidencias empíricas, serían suficientes para afirmar que debe llegar la gestión a las listas de espera dejando a un lado políticas más o menos oportunistas. Por políticas oportunistas se entiende mantener la mala información sobre listas o su "maquillaje", utilizar programas de autoconcertación sin más horizonte que llegar a final de año sin lista de más de seis meses, etcétera. El panorama no es del todo oscuro. Algunas iniciativas de gestión (incluso de Política con mayúscula se van abriendo paso y pueden entrar en la agenda de los próximos años. Así, cabe destacar la aplicación de tiempos de atención garantizada o la priorización de las listas en función de criterios explícitos. En todo caso, conviene recordar que, con la excepción de las colas producidas en las salas de espera de los centros de salud y aquéllas que se producen en las puertas de urgencias, el resto de colas del sistema están mediadas por la decisión de un médico. Así que una estrategia ineludible para gestionar las listas de espera consiste en atenuar los problemas derivados de la incertidumbre (o ignorancia con respecto al diagnóstico o al pronóstico de los pacientes.

  13. Generación automatizada de material docente en el marco del Plan Bolonia integrando LYX, SWEAVE Y R para Windows XP, Windows 7 Y Linux

    OpenAIRE

    Quesada López, Jorge

    2011-01-01

    Proyecto Fin de Carrera leído en la Universidad Rey Juan Carlos en el curso académico 2011/2012. Tutor del Proyecto: Javier Cano Cancela El Proceso de Bolonia ha supuesto un cambio importante en la manera en la que los profesores universitarios afrontan la preparación de material didáctico. Han tenido y tienen que elaborar, en muchos casos partiendo de cero, un gran número de documentos de apoyo a la docencia. Todo esto en un contexto en el que, cada vez más, se prima la atenci...

  14. Proceso de Bolonia (I): educación orientada a competencias

    OpenAIRE

    Palés, J. L. (Jorge Luis); Nolla i Domenjó, Maria; Oriol Bosch, Albert; Gual Sala, Arcadi

    2010-01-01

    El proceso de Bolonia se inició en 1999 con un compromiso político de los ministros de educación de cuatro países en Paris y se concretó un año después en la 'Declaración de Bolonia'. Este acuerdo puso en marcha un trascendente proceso de transformación educativa que impone a las universidades del Espacio Europeo de Educación Superior la obligación de orientar la educación de grado a la obtención de competencias.

  15. LA UNIVERSIDAD ESPAÑOLA Y EL PROCESO DE BOLONIA: CONSIDERACIONES PARA SU ANÁLISIS

    Directory of Open Access Journals (Sweden)

    Gustavo Toledo Lara

    2015-01-01

    Full Text Available En este artículo se presenta un análisis sobre la Universidad española vista desde el proceso de Bolonia. Este proceso reformista ha suscitado una serie de cambios que desde una perspectiva cualitativa, pueden identificarse con la finalidad de establecer un conjunto de criterios para analizar y explorar como ha sido el comportamiento del sector universitario de cara a esta iniciativa de reforma. Desde una perspectiva cualitativa, el análisis documental e interpretativo de fuentes primarias y secundarias constituyó un aspecto importante dentro del desarrollo de este artículo. El procedimiento metodológico giró en torno a las siguientes fases: Fase 1: Identificación del objeto de estudio, revisión de la literatura. Fase 2: Obtención de los datos. Fase 3: Análisis a nivel macro y micro (Políticas públicas impulsadas por los diferentes gobiernos españoles, revisión y análisis de leyes y decretos reales, análisis de datos y cifras oficiales. Fase 4: Conclusión e implicaciones de la investigación. Los resultados obtenidos evidenciaron mayor influencia del sector privado de la economía ante la reorientación de la financiación pública impulsando así, que las propuestas formativas de las universidades se inclinaran hacia los requerimientos profesionales propios de este sector. Se notó necesidad de continuar con avances en cuanto a la vinculación entre actividad docente e investigación. Sin embargo se apreció el impulso de la movilidad estudiantil, aumento del interés por aprender idiomas, posicionamiento de universidades españolas dentro de las 500 mejores universidades del mundo durante 10 años consecutivos y reconocimiento internacional de la investigación universitaria.

  16. Rusia en el Proceso de Bolonia: Compatibilidad, competitividad y movilidad académica

    Directory of Open Access Journals (Sweden)

    Edgar Demetrio Tovar García

    2014-05-01

    Full Text Available El presente artículo describe la inclusión de Rusia en el proceso de Bolonia. Además de la revisión bibliográfica, la descripción de los eventos y sus resultados con respecto a dos objetivos primordiales de la Declaración (compatibilidad-competitividad y movilidad académica son evidenciados y ejemplificados con información obtenida por medio de entrevistas a informantes clave, 35 estudiantes (entre ellos líderes estudiantiles y 12 profesores (entre ellos jefes de departamento de dos de las universidades moscovitas más grandes. Los resultados indican que el proceso de Bolonia en Rusia es incipiente, caracterizado por incredibilidad sobre la calidad de la educación superior rusa, corrupción, y baja movilidad académica.

  17. El Proceso de Bolonia y las nuevas competencias / The Bologna Process and the new skills

    Directory of Open Access Journals (Sweden)

    Marisa Montero Curiel

    2010-09-01

    Full Text Available Resumen: La construcción del Espacio Europeo de Educación Superior (EEES, más conocido como Proceso de Bolonia, constituye una magnífica oportunidad para que las universidades aborden un conjunto de reformas que les permita adaptarse a la nueva realidad social, la llamada Sociedad del Conocimiento, reformas orientadas en múltiples direcciones: en las metodologías docentes, en la estructura de las enseñanzas, en la garantía de los procesos de aprendizaje o en la calidad y, por supuesto, en potenciar la movilidad de estudiantes y profesores. En definitiva, es una transformación que afecta de lleno al concepto de la educación superior.La competencia se presenta como un fin que el estudiante deberá lograr en su fase universitaria. En esta nueva perspectiva, el papel del estudiante se modifica y cobra un significado especial; primero, porque él mismo deberá ser el motor que genere su aprendizaje y, segundo, porque no sólo aprenderá dentro de las instituciones superiores, sino que cualquier situación y experiencia educativa podrá acercarle al conocimiento a lo largo de toda su vida. También el profesor se ve sometido a una gran reforma: ahora no sólo tendrá que transmitir una serie de contenidos, sino que el enfoque deberá encaminar a abrir al alumno las puertas a un futuro profesional más amplio. Para ello, será fundamental una enseñanza coordinada, con mayor carga práctica y con una diversidad docente a la que quizá el sistema educativo español no siempre ha estado acostumbrado. Abstract: The construction of the European Space for Higer Education (ESHE, commonly known as the Bologna Process, is a great opportunity for universities to address a set of reforms that will enable the adaptation of the new social reality, the so-called Knowledge Society. These reforms are oriented in multiple directions: the teaching methodology, the structure of education, the guarantee of the learning process or quality and, of course, the

  18. ¿Ha llegado la hora de la gestión de las listas de espera? Has the time arrived for the management of waiting lists?

    Directory of Open Access Journals (Sweden)

    E. Bernal

    2002-10-01

    Full Text Available Las personas que ocupan una lista de espera sufren a menudo un riesgo adicional derivado del tiempo que pasa hasta que obtienen tratamiento; sin embargo, en otras ocasiones, las personas en lista no tienen necesidad del tratamiento por el que esperan. Ambos argumentos, contrastables con evidencias empíricas, serían suficientes para afirmar que debe llegar la gestión a las listas de espera dejando a un lado políticas más o menos oportunistas. Por políticas oportunistas se entiende mantener la mala información sobre listas o su "maquillaje", utilizar programas de autoconcertación sin más horizonte que llegar a final de año sin lista de más de seis meses, etcétera. El panorama no es del todo oscuro. Algunas iniciativas de gestión (incluso de Política con mayúscula se van abriendo paso y pueden entrar en la agenda de los próximos años. Así, cabe destacar la aplicación de tiempos de atención garantizada o la priorización de las listas en función de criterios explícitos. En todo caso, conviene recordar que, con la excepción de las colas producidas en las salas de espera de los centros de salud y aquéllas que se producen en las puertas de urgencias, el resto de colas del sistema están mediadas por la decisión de un médico. Así que una estrategia ineludible para gestionar las listas de espera consiste en atenuar los problemas derivados de la incertidumbre (o ignorancia con respecto al diagnóstico o al pronóstico de los pacientes.Individuals on the waiting list frequently suffer an additional risk caused by the mean time until they receive treatment; however, other individuals do not need the treatment for which they are waiting. Both arguments, which can be contrasted with empirical evidence, would be sufficient to affirm that waiting list management should be implemented, leaving aside policies that are more of less opportunistic. Opportunistic policies are understood as those providing misinformation on waiting lists or their "manipulation", and using programs of auto-coordination with the sole aim of reaching the end of the year without a waiting list of not more than six months, etc. The panorama is not completely bleak. Some management initiatives (and even Politics with a capital P are opening the way forward and may enter the Agenda in the next few years. In this context, the application of guaranteed times of medical care or the prioritization of waiting lists according to explicit criteria should be highlighted. It is worth remembering that, except for the queues in the waiting rooms of health centers and emergency departments, waiting lists are mediated by the decision of the physician. Therefore, an essential strategy for managing waiting lists consists of attenuating the problems caused by uncertainty (or ignorance of the patient's diagnosis or prognosis.

  19. La universidad española y el proceso de Bolonia: consideraciones para su análisis

    Directory of Open Access Journals (Sweden)

    Toledo Lara, Gustavo

    2015-05-01

    Full Text Available En este artículo se presenta un análisis sobre la Universidad española vista desde el proceso de Bolonia. Este proceso reformista ha suscitado una serie de cambios que desde una perspectiva cualitativa, pueden identificarse con la finalidad de establecer un conjunto de criterios para analizar y explorar como ha sido el comportamiento del sector universitario de cara a esta iniciativa de reforma. Desde una perspectiva cualitativa, el análisis documental e interpretativo de fuentes primarias y secundarias constituyó un aspecto importante dentro del desarrollo de este artículo. El procedimiento metodológico giró en torno a las siguientes fases: Fase 1: Identificación del objeto de estudio, revisión de la literatura. Fase 2: Obtención de los datos. Fase 3: Análisis a nivel macro y micro (Políticas públicas impulsadas por los diferentes gobiernos españoles, revisión y análisis de leyes y decretos reales, análisis de datos y cifras oficiales. Fase 4: Conclusión e implicaciones de la investigación. Los resultados obtenidos evidenciaron mayor influencia del sector privado de la economía ante la reorientación de la financiación pública impulsando así, que las propuestas formativas de las universidades se inclinaran hacia los requerimientos profesionales propios de este sector. Se notó necesidad de continuar con avances en cuanto a la vinculación entre actividad docente e investigación. Sin embargo se apreció el impulso de la movilidad estudiantil, aumento del interés por aprender idiomas, posicionamiento de universidades españolas dentro de las 500 mejores universidades del mundo durante 10 años consecutivos y reconocimiento internacional de la investigación universitaria

  20. La colmena del pasado: cinco siglos de arquitectura en la Plaza Mayor de Bolonia

    OpenAIRE

    Terán Viadero, Lucía

    2016-01-01

    [ES]Mi intención en este trabajo es examinar la historia urbanística y arquitectónica de la Plaza Mayor de Bolonia y, por tanto, el modo en que un amplio espacio público medieval se transformó en aquel foro cívico unitario y monumental que todavía hoy podemos ver, siempre teniendo en cuenta que cada una de las campañas de renovación de la plaza se planificó para responder no solo a las exigencias de carácter práctico del centro cívico, sino también a las intenciones y al programa ...

  1. El estudio del impacto de los movimientos sociales: el caso del movimiento estudiantil anti-Bolonia

    Directory of Open Access Journals (Sweden)

    Joseba Fernández González

    2014-06-01

    Full Text Available En esta artículo presentamos una introducción sobre cómo las investigaciones sobre movimientos sociales han enfocado el estudio del impacto de los movimientos sociales. Aludiremos en el primer punto a cómo la ausencia continuada de estudios sobre este asunto está justificada por las dificultades metodológicas a las que se enfrenta el investigador al determinar los impactos de los movimientos sociales. En el segundo punto, presentamos un repaso a una de las dimensiones que más preocupan a los investigadores (y activistas sobre movimientos sociales: la relación entre democracia, procesos de democratización y movimientos sociales. Finalmente, abordamos el estudio de los posibles impactos y resultados, a distintos niveles (biográficos, culturales y políticos, por parte de un movimiento concreto: el movimiento estudiantil anti-Bolonia. This article is an introduction to how social movements studies have dealt with the issue of the outcomes of social movements. Firstly, I will argue that the lack of a systematic research on the outcomes of social movements is due to methodological difficulties. Secondly, I will review one of the dimensions of social movements which has received more attention: the relationship between democracy, democratization processes and social movements. Finally, I will focus on a particular social movement (the student movement against the Bolonia Process in order to analyse the main possible outcomes of this movement at the biographical, cultural and political levels.

  2. España en la Universidad de Bolonia : vida académica y comunidad nacional (siglos XIII-XIV

    Directory of Open Access Journals (Sweden)

    Pascual Tamburri Bariain

    1997-01-01

    Full Text Available Ha primado, en el estudio de las Universidades medievales, el atractivo de la historia institucional sobre el indudable interés de la vida, inquietudes y perspectivas de los estudiantes mismos. Bolonia posee unas fuentes documentales notariales, los regisros fiscales de los Memoriali, y otros testimonios igualmente preciosos, que permiten trazar un panorama de la presencia española en la gran Universidad italiana a lo largo del primer tercio del siglo xiv. El objeto de la investigación es la vida, las actividades y la organización interna de la comunidad estudiantil española en Bolonia, y el papel de los jóvenes escolares, principalmente juristas, en la evolución del Estudio y de la ciudad. La conclusión esencial del trabajo es que las relaciones intelectuales entre Italia y España durante este período se basaron más en la presencia de estudiantes que en la de maestros (a diferencia del siglo anterior o que en los vínculos institucionales (como en la época posterior, dando como resultado una convivencia panhispánica imposible en otros contextos.Much effort has been devoted to the study of the transmission of the Román Law in the Western Middie Ages. Even if that work has proved extremely useful, the subject of the study have often been the ideas, and the political and legal institutions - thus forgetting the people that made their extensión possible. With the precious prívate documentation contained in the bolognese Memoriali, helped by additional Information offered by the local criminal court acts, here is analysed the Spanish presence in the first Hallan University in the first thirty years of the 14th century. The object of this research is the Ufe, activities and organisation of the Spaniards in Bologne, and ttie role of those young jurists in the municipal and University evolution. The main conclusión of the work is that the intellectual link between Italy and Spain over that period was based on the continuous affiuence

  3. La adecuación de la docencia de la radio y televisión a los postulados de Bolonia

    Directory of Open Access Journals (Sweden)

    Silvia Jiménez Martín

    2012-04-01

    Full Text Available Las nuevas propuestas metodológicas de la educación superior priorizan la empleabilidad de la población a través del desarrollo de las competencias y habilidades profesionales de los estudiantes para su rápida inserción al mercado laboral. En las Facultades de Ciencias de la Comunicación, la preparación práctica de los estudiantes se ha adelantado a los cambios propuestos por Bolonia gracias a los Departamentos de Comunicación Audiovisual, entre otros. Los docentes de radio y televisión han basado la profesionalización en el aprender a hacer o aprendizaje activo, la observación y la autoevaluación. Además, existen otras asimilaciones metodológicas que permiten establecer paralelismos entre el EEES y la adecuación, ya realizada en muchos aspectos, de las materias audiovisuales al nuevo concepto educativo.

  4. Perfil biográfico del canonista Juan Josef Alfranca y Castellote (1754-1817, rector del colegio de Bolonia

    Directory of Open Access Journals (Sweden)

    Astorgano Abajo, Antonio

    2009-06-01

    Full Text Available Juan Jose Alfranca y Castellote (Zaragoza, 8.III.1754 – Cuevas de Cañart [Teruel], 1817 of nobleman origin, doctor in canon laws by the universities of Zaragoza and Bolonia, wassuccesfully, schoolboy and rector of Saint Clement school for Spaniards in Bolonia (1780,1788, Mayor of crime in the courthouse of Seville, listener and one of the foundersof the Royal Courthouse of Extremadura (1791, and doctoral canon and then ecclesiastical governor of the Teruel diocese during the French invasion (1812. In this essay, the stages of his vital road are highlighted, as well as the features of his personality which are characterized by his uprightness and deep law knowledge and by his reformist and well educated atitude, as he made clear in the cross-examination to the Llerena Perty (1791.Juan José Alfranca y Castellote (Zaragoza, 8.III.54 – ¿Cuevas de Cañart? [Teruel], 1817, de origen infanzón, doctor en Cánones por las universidades de Zaragoza y Bolonia, fue sucesivamente, colegial y rector del Colegio de San Clemente de Españoles de Bolonia (1780-1788, alcalde del crimen de la Audiencia de Sevilla, oidor y uno de los fundadores de la Real Audiencia de Extremadura (1791 y canónigo doctoral y gobernador eclesiástico de la diócesis de Teruel durante la ocupación francesa (1812. En el presente trabajo se ponen de relieve las etapas de su trayectoria vital, así como los rasgos de su personalidad, caracterizada por su rectitud y profundos conocimientos jurídicos, y por su actitud reformista e ilustrada, como puso de manifiesto en el Interrogatorio del Partido de Llerena (1791.

  5. The impact of overlapping processes on rockfall hazard analysis - the Bolonia Bay study (southern Spain)

    Science.gov (United States)

    Fernandez-Steeger, T.; Grützner, C.; Reicherter, K.; Braun, A.; Höbig, N.

    2009-04-01

    For rockfall simulations, competitive case studies and data sets are important to develop and evaluate the models or software. Especially for empirical or data driven stochastic modelling the quality of the reference data sets has a major impact on model skills and knowledge discovery. Therefore, rockfalls in the Bolonia Bay close to Tarifa (Spain) were mapped. Here, the siliciclastic Miocene rocks (megaturbidites) are intensively joined and disaggregated by a perpendicular joint system. Although bedding supports stability as the dip is not directed towards the rock face, the deposits indicate a continuous process of material loss from the 80 m high cliff of the San Bartolome mountain front by single large rock falls. For more than 300 blocks data on size, shape, type of rock, and location were collected. The work concentrated on rockfall blocks with a volume of more than 2 m³ and up to 350 m³. Occasionally very long "runout" distances of up to 2 km have been observed. For all major source areas and deposits, runout analysis using empirical models and a numerical trajectorian model has been performed. The most empirical models are principally based on the relation between fall height and travel distance. Beside the "Fahrböschung" from Heim (1932) the "shadow angle" introduced by Evans and Hungr (1993) is most common today. However, studies from different sites show a wide variance of the angle relations (Dorren 2003, Corominas 1996). The reasons for that might be different environments and trigger mechanisms, or varying secondary effects such as post-depositional movement. Today, "semi" numerical approaches based on trajectorian models are quite common to evaluate the rockfall energy and the runout distance for protection measures and risk evaluations. The results of the models highly depend on the quality of the input parameters. One problem here might be that some of the parameters, especially the dynamic ones, are not easy to determine and the quality of the

  6. Mishima jo ha kyu

    Directory of Open Access Journals (Sweden)

    Matteo Casari

    2012-01-01

    Full Text Available Abstract – IT La grandezza artistica di Mishima si è espressa attraverso una eterogenea gamma di linguaggi tra i quali il teatro – nella drammaturgia ma anche nella saggistica, regia, recitazione e direzione di compagnia – ha avuto un ruolo di primo piano. Al pari di un uomo di scena Mishima inaugura, a partire dagli anni ’50, un processo di attenzione al proprio corpo come possibile, anzi necessario, veicolo di estrinsecazione etico-estetica tanto da poter istituire l’equazione corpo-teatro quale snodo profondo del suo processo creativo. Il corpo sognato e ottenuto da Mishima attraverso l’addestramento nel kendo, in altre arti marziali e nel body building si conformava ad un ideale estetico di matrice greco-classica assai lontano dal corpo teatrale nipponico. Il corpo come luogo di elaborazione e strumento di espressione autentica da realizzare con impegno, però, lo legano profondamente alle esperienze nascenti – tra gli anni ’50 e ’60 – delle avanguardie teatrali giapponesi. La metafora teatrale è spesso usata nella lettura critica del Mishima uomo e artista con accezione deteriore: un personaggio che dà spettacolo di sé con ripetute provocazioni tra le quali il suicidio del 25 novembre 1970 non sarebbe che l’esempio ultimo e più estremo. La costruzione di sé come personaggio, invece, sembrerebbe corrispondere ad una ben più profonda e meditata necessità di comporre la propria vita in una sapiente messa in scena di classica perfezione: i principi della scansione ritmico formale del jo ha kyu, pilastro teorico del teatro no codificato da Zeami tra XIV e XV secolo, offrono un valido modello di riferimento. Abstract – EN Mishima’s artistic greatness has been expressed through a diverse range of languages among wich theater – in dramaturgy as well as in written essays, as a director, performer and in company direction – played a central role. As a true front-man, Mishima – starting from the 50’s

  7. Aportaciones del Comunicado de Londres en el Proceso de Bolonia: conclusiones sobre los programas de doctorado y otros aspectos destacables

    Directory of Open Access Journals (Sweden)

    Guillem Antequera Gallego

    2007-09-01

    Full Text Available El pasado 18 de mayo de 2007, tuvo lugar en Londres el último de los encuentros bienales del Proceso de Bolonia, en el que se reunieron los ministros responsables de la educación superior de los países participantes. En el consiguiente London Communiqué se resumieron las valoraciones de los ministros sobre el estado en el que dicho proceso se halla. Así, se pasó revista a los avances consolidados, a aquellas deficiencias que aún no han recibido la atención necesaria, y a las medidas y estrategias urgentes para su definitiva conclusión. El presente texto da noticia de todas estas cuestiones y, con motivo de ofrecer al lector referencias adicionales sobre el contexto general, incluye una breve síntesis de otros documentos directamente relacionados con los temas más destacados en Londres 2007: los programas de doctorado y la figura del doctorando.

  8. Production and characterization of HA and SiHA coatings.

    Science.gov (United States)

    Tang, Qian; Brooks, Roger; Rushton, Neil; Best, Serena

    2010-01-01

    Plasma sprayed hydroxyapatite (HA) coatings on metallic prostheses have been used clinically in dentistry and orthopedics since the mid 1980s. The coating properties are dependent on the spraying parameters. Since silicon-substituted hydroxyapatite (SiHA) has been shown to offer improved bioactivity over phase pure HA, SiHA coatings have the potential for enhanced performance in clinical application. In this study, phase pure HA and 0.8 wt% SiHA powders were synthesized with similar particle size distribution and morphology. The powders were plasma sprayed onto Ti-6Al-4V substrates at 37 kW and 40 kW plasma gun input power respectively. Four kinds of samples were prepared, HAC 37, HAC 40, SiHAC 37 and SiHAC 40. Materials characterization showed that the coatings were of relatively high phase purity. In vitro cell culture demonstrated that human osteoblast cells grew well on all samples, with the highest cell growth observed on SiHA coatings produced under the lower plasma gun input power.

  9. Trinh T. Minh-ha

    DEFF Research Database (Denmark)

    Nelund, Sidsel; Trinh T, Minh-ha

    2012-01-01

    . Minh-ha holds the post of Professor of Gender and Women's Studies, and of Rhetoric at the University of California, Berkeley. She has lived, among other places, in Vietnam, USA, France, Senegal, and Japan and this geographic diversity is reflected in her work, in which several countries have been......Born in Vietnam, Trinh T. Minh-ha is known as a filmmaker, composer and writer. Contributing generously to these art forms, she was also a pioneer in the 1980’s theoretical conceptualisation of the Other, verbalising especially the position of women in developing countries. 
 Currently, Trinh T...

  10. Culto a los ancestros en época romana: los cipos funerarios de las necrópolis de Baelo Claudia (Bolonia, Cádiz

    Directory of Open Access Journals (Sweden)

    Jiménez Díez, Alicia

    2007-12-01

    Full Text Available A quite large number of proposals have been published about the meaning of a singular group of pieces (termed ‘dolls’ at the beginning of the twentieth century found in association with different tombs in the necropoleis of Baelo Claudia. In this paper I suggest we can only understand the funerary cippi of Bolonia within a wider ritual context that places these sculptures in relation with cult to ancestors (that are seen and represented as a community where individuals can not be differentiated not only in the tomb, but also in domestic and sanctuary contexts.Se han publicado propuestas muy diversas para explicar la función de un singular conjunto de piezas (bautizadas como “muñecos” a principios del siglo XX que se hallaron asociadas a distintos enterramientos de las necrópolis de Baelo Claudia. En el presente estudio se propone entender los cipos funerarios de Bolonia dentro de un contexto ritual más amplio que permite relacionarlos con el culto a los ancestros (concebidos y representados como una comunidad de carácter indiferenciado, no sólo en la tumba, sino también en ambientes domésticos y en santuarios.

  11. La asignatura Educación Comparada en el proceso de Bolonia : un estudio exploratorio de la opinión de los estudiantes = Comparative Education in Bologna process : an exploratory study about students’ opinion

    Directory of Open Access Journals (Sweden)

    Carmen M. Fernández

    2014-01-01

    Full Text Available El proceso de Bolonia ha supuesto una transformación profunda de los planes de estudio de la mayoría de los estudios. Ni el Grado de Pedagogía ni la asignatura Educación Comparada han podido eludir esta necesaria renovación. Ante esta coyuntura, el presente artículo plantea, por un lado, la reflexión docente realizada para ajustar esta materia a los nuevos requerimientos metodológicos y, por otro, una vez desarrollada la implementación de esta planificación, los resultados de un cuestionario aplicado a estudiantes para conocer su opinión respecto a la misma. En definitiva, en el proceso de autoevaluación de la propia práctica docente nos parece crucial contar con la opinión de los receptores de nuestra enseñanza, tratando de averiguar el grado de acierto en nuestras decisiones previas, así como en qué medida hemos conseguido los objetivos inicialmente planteados. La finalidad última será establecer algún tipo de conclusión acerca de la necesidad de incorporar ajustes para los cursos sucesivos, inscribiéndonos así en un proceso de autoevaluación formativa.Most higher education studies have been subjected to profound changes due to Bologna process. Neither the Bachelor Degree in Pedagogy nor the subject Comparative Education can avoid this renovation. Firstly, in this article we focus in our reflection to adjust our subject to the new methodological requirements, and secondly, once our teaching activity has been developed, we also present the results of a questionnaire answered by the students in which they show their opinion about the subject. In short, in the process of evaluation of our own teaching practice, it seems crucial for us to have the opinion of the students who receive our teaching. We will try to point out the degree of success in our previous decisions, and to demonstrate how long the initial goals have been achieved. The ultimate goal is to establish some sort of conclusions about the changes needed for

  12. Cómo trabajar más contenidos en Enfermería Geriátrica siguiendo las indicaciones de Bolonia y transformando la metodología docente How to work more content Geriatric Nursing following indications of Bologna and transforming the methodology teaching

    Directory of Open Access Journals (Sweden)

    Manuel Quintanilla Martínez

    2010-12-01

    Full Text Available La queja más frecuente de los profesores de una materia suele ser, "no tengo bastante tiempo para impartir la asignatura, ya que el nuevo plan de estudios me recorta los créditos de la asignatura". Siguiendo con la actual conceptualización del proceso de enseñanza/aprendizaje que conlleva un cambio/modificación del rol docente del profesor universitario, éste ha de sustituir su función de transmisor del conocimiento, por la de orientador/facilitador del aprendizaje, asesor y tutor de los alumnos en la búsqueda y construcción de forma autónoma del conocimiento. Es decir, el profesor pasa de transmisor a facilitador; ha de pasar por una fase de desaprendizaje del ser profesor y aprendizaje del ser tutor facilitador. La estrategia docente, aprovechando la coyuntura de la implementación del cambio promovido por los acuerdos de Bolonia, puede ser cambiar de metodología y utilizar el ABP/PBL (1.The most frequent complaint of teachers is often a matter, I have enough time to teach the subject, since the new curriculum I cut out the credits of the subject. Continuing with the current conceptualization of the teaching / learning that involves a change/modification of the teaching role of the university professor, who has to replace its role as transmitter of knowledge, by the counselor / facilitator of learning, assessor and tutor students in the search and construction of knowledge autonomously, ie the teacher moves from transmitter to facilitator, has to pass through a phase of unlearning of being a teacher and tutor learning to be a facilitator. The teaching strategy, taking advantage of the situation of the implementation of changes promoted by the Bologna agreement, may be the change of methodology and use the PBL (1.

  13. ANÁLISIS DE EVOLUCIÓN DE LA CONFIANZA EN LA INDUSTRIA DEL AUTOMÓVIL ¿HEMOS LLEGADO A LA CONFIANZA IDENTIFICATIVA?

    Directory of Open Access Journals (Sweden)

    Martín Rubio, I.

    2009-01-01

    Full Text Available El objetivo de este artículo es estudiar la evolución de la confianza en las relaciones entre los fabricantes de automóviles y sus proveedores. La importancia de la confianza para el buen funcionamiento de la relación ha sido reconocida ampliamente en la literatura económica, pero ahora es considerada un aspecto vital. Partimos el modelo de Lewicki y Bunker, debido a que se ha utilizado de manera intensiva en la literatura y se ajusta perfectamente a nuestros propósitos. Concluimos que en la industria del autómovil la confianza alcanza el estado de “Confianza Cognoscitiva”, sin llegar a la fase de Confianza Identificativa.

  14. El Proceso de Bolonia: hacia la creación del espacio común europeo de educación superior

    Directory of Open Access Journals (Sweden)

    Alberto Padilla Arias

    2009-01-01

    Full Text Available El intento de creación del "espacio europeo de educación superior" para impulsar la movilidad de estudiantes y personal universitario, mediante procedimientos de comparabilidad, reconocimiento y certificación de estudios, para beneficiarse de la diversidad de planes de estudio y proyectos de investigación, así como para capacitarse mejor para el mercado europeo, implica la práctica de la gobernanza; ese fenómeno es analizado a la luz de la nueva gestión pública. La idea es identificar éxitos y fracasos en la gestión de la educación superior europea, así como las resistencias, apertura y dificultades que están teniendo gobiernos e instituciones involucradas en el Proceso de Bolonia, pues las universidades mexicanas también operan en la globalización, desde su contexto americano, por lo que sus estructuras y formas de funcionamiento están cambiando en favor de la movilidad y la cooperación internacional.

  15. Matemáticas en los estudios de Economía y Gestión de Empresas en el marco de los acuerdos de Bolonia

    Directory of Open Access Journals (Sweden)

    Rodríguez Uria, Mª Victoria

    2003-01-01

    Full Text Available Los principios enunciados en la Declaración de Bolonia configuran un espacio europeo de educación superior, garantizando el flujo de estudiantes entre las universidades de los Estados de la Unión Europea. Se hace por ello imprescindible la armonización de los planes de estudios y de los programas en “un espacio basado en la tradición europea de la educación como servicio público....... que respete y valore una de sus principales características: la diversidad de instituciones y sistemas educativos en un entorno plurilingüístico y plurinacional.”1 Con este trabajo pretendemos continuar la reflexión y debate que empezamos el pasado año acerca de cuáles son las Matemáticas que deberíamos explicar, y como hacerlo, en los estudios económicoempresariales, en este nuevo marco.

  16. ha õhtu seltskonnalaud / Kaire Nurk

    Index Scriptorium Estoniae

    Nurk, Kaire, 1960-

    2005-01-01

    ha õhtusöömaaja teemast kunstis. Saksa kunstiajaloolase Horst Schwebeli poolt Leonardo da Vinci "Püha õhtusöömaaja" XX sajandi "töötlustes" välja toodud poliitilise agitatsiooni ja ühisest probleemist haaratud seltskonna kujutiste suunast. Laua kujutisest kunstis

  17. El aprendizaje en la era de la modulación: consecuencias del Proceso de Bolonia para la Enseñanza Superior

    Directory of Open Access Journals (Sweden)

    Ewald Terhart

    2006-01-01

    Full Text Available El autor discute a partir de su propia experiencia en diversas universidades los presupuestos, formas y repercusiones de la reestructuración de la enseñanza superior en dirección a una «modularización». Esta forma de configuración de los estudios constituye un elemento esencial en el así llamado «Proceso de Bolonia». Tras una exposición de los orígenes del concepto de modularización, el autor analiza las consecuencias y los problemas concretos derivados de la introducción de la modularización en facultades e institutos universitarios. Por lo que atañe a las universidades alemanas, esta modularización representa para muchas asignaturas un grado muy elevado de escolarización de los estudios. La reglamentación a que deben someterse tanto estudiantes como docentes se hace mucho mayor. Al mismo tiempo, también aumenta el potencial conflictivo en el seno del profesorado. Dado que la modularización provoca un crecimiento muy notable tanto de la demanda de clases, como de las tareas burocráticas que conllevan los exámenes y la extensión de certificados, pero ello sin que pueda esperarse un aumento paralelo de personal docente, la modularización incide notablemente en la configuración del puesto de trabajo del profesor universitario 

  18. La comunicación de la administración pública en las redes sociales: los casos de las ciudades de Buenos Aires y Bolonia

    Directory of Open Access Journals (Sweden)

    Mariano Ure

    2016-01-01

    Full Text Available El artículo profundiza en los modelos de gestión, la propuesta comuni cativa y las estrategias de las administraciones públicas para involucrarse con los ciudadanos en las redes sociales, a más de un lustro de la incorpo ración de los recursos de la web 2.0 en la comunicación oficial de las insti tuciones de gobierno, a través del estudio de caso comparado de dos entes locales urbanos, Buenos Aires (Argentina y Bolonia (Italia. Desde una perspectiva centrada en los paradigmas opuestos “conversacionalunidi reccional” y “abiertocerrado”, la investigación recoge los criterios de publi cación utilizados por los responsables de las cuentas oficiales de cada una de las ciudades, así como también la gramática de los mensajes y los suje tos y temas que se conectan en ellos. A su vez, analiza los contenidos de las publicaciones de las cuentas institucionales de ambas ciudades en Twitter, Facebook y YouTube durante un período de seis semanas entre los meses de octubre y diciembre de 2014, clasificándolas en categorías elaboradas con el fin de mostrar el nivel de reconocimiento y empoderamiento de los usuarios en calidad de ciudadanos. La diversidad de las propuestas comu nicativas observada entre los casos estudiados pone en discusión la defi nición acerca de las “buenas prácticas sociales”, y plantea la necesidad de ahondar en los márgenes reales que poseen las administraciones públicas para el aprovechamiento de las posibilidades de interacción que ofrecen las plataformas interactivas.

  19. Abordando la crisis de los Recursos Humanos para la Salud: ¿Hasta dónde hemos llegado? ¿Qué podemos esperar lograr al 2015?

    Directory of Open Access Journals (Sweden)

    Manuel M. Dayrit

    2011-06-01

    Full Text Available El reporte mundial de la Salud del 2006 (World Health Report 2006 ha identificado 57 países en los que la densidad de trabajadores de salud con respecto a la población general se encuentra por debajo del umbral crítico de 2,3 por 1000 habitantes. Esto significa que por debajo de este umbral crítico, un país no sería capaz de brindar los servicios básicos para su población, definidos como el 80% de coberturas de inmunización y 80% de atención calificada del parto. De los 57 países, 36 pertenecen al África. Este artículo revisa el progreso realizado por los países para afrontar su crisis de recursos humanos en salud. Cita tres de los estudios mundiales más recientes y los indicadores utilizados para medir el progreso. Asimismo, se presenta la experiencia de ocho países: Malawi, Perú, Etiopía, Brasil, Tailandia, Zambia y Mali. Ello brinda un panorama diverso de esfuerzos, retos y éxitos en cada uno de estos países. El artículo lanza la interrogante sobre si la meta de una reducción del 25% en el número de países en crisis puede lograrse para el año 2015, objetivo definido por la Asamblea Mundial de la Salud en el 2008. El optimismo que los autores quisieran mantener sobre los esfuerzos orientados a esta meta, debe ir sin embargo a la par con un adecuado nivel de inversión de los países en recursos humanos en salud. Los siguientes cuatro años nos mostrarán cuánto en realidad puede ser logrado.

  20. Abordando la crisis de los Recursos Humanos para la Salud: ¿Hasta dónde hemos llegado? ¿Qué podemos esperar lograr al 2015?

    Directory of Open Access Journals (Sweden)

    Manuel M. Dayrit

    Full Text Available El reporte mundial de la Salud del 2006 (World Health Report 2006 ha identificado 57 países en los que la densidad de trabajadores de salud con respecto a la población general se encuentra por debajo del umbral crítico de 2,3 por 1000 habitantes. Esto significa que por debajo de este umbral crítico, un país no sería capaz de brindar los servicios básicos para su población, definidos como el 80% de coberturas de inmunización y 80% de atención calificada del parto. De los 57 países, 36 pertenecen al África. Este artículo revisa el progreso realizado por los países para afrontar su crisis de recursos humanos en salud. Cita tres de los estudios mundiales más recientes y los indicadores utilizados para medir el progreso. Asimismo, se presenta la experiencia de ocho países: Malawi, Perú, Etiopía, Brasil, Tailandia, Zambia y Mali. Ello brinda un panorama diverso de esfuerzos, retos y éxitos en cada uno de estos países. El artículo lanza la interrogante sobre si la meta de una reducción del 25% en el número de países en crisis puede lograrse para el año 2015, objetivo definido por la Asamblea Mundial de la Salud en el 2008. El optimismo que los autores quisieran mantener sobre los esfuerzos orientados a esta meta, debe ir sin embargo a la par con un adecuado nivel de inversión de los países en recursos humanos en salud. Los siguientes cuatro años nos mostrarán cuánto en realidad puede ser logrado.

  1. Sterilisation effect study on granular hydroxyapatite (HA).

    Science.gov (United States)

    Saidu, M F; Mashita, M; Khadijah, K; Fazan, F; Khalid, K A

    2004-05-01

    Hydroxyapatite is a calcium phosphate bioceramic that has been shown by many authors to be biocompatible with bioactive properties. It is widely accepted as the best synthetic material available for surgical use as a bone graft substitute. HA granules produced by AMREC-SIRIM from local materials underwent 5 types of sterilisation techniques with different ageing periods. Samples were tested for chemical and phase composition and microbial contamination before and after being sterilised. From the microbiological tests done, none of the unsterilised positive control yielded a positive culture. Results from X-Ray diffraction studies found that all the sterilisation techniques did not chemically degrade or structurally change the HA granules significantly.

  2. Review of F. SAN VICENTE et al. (eds., “Perfiles para la historia y crítica de la gramática del español en Italia: siglos XIX y XX. Confluencia y cruces de tradiciones gramaticográficas”, Bolonia, Bononia University Press, 2014

    Directory of Open Access Journals (Sweden)

    Natalia Peñín Fernández

    2015-06-01

    Full Text Available Félix SAN VICENTE et al. (eds., “Perfiles para la historia y crítica de la gramática del español en Italia: siglos XIX y XX. Confluencia y cruces de tradiciones gramaticográficas”, Bolonia, Bononia University Press, 2014 [Book Review

  3. Characterization of New PEEK/HA Composites with 3D HA Network Fabricated by Extrusion Freeforming.

    Science.gov (United States)

    Vaezi, Mohammad; Black, Cameron; Gibbs, David M R; Oreffo, Richard O C; Brady, Mark; Moshrefi-Torbati, Mohamed; Yang, Shoufeng

    2016-05-26

    Addition of bioactive materials such as calcium phosphates or Bioglass, and incorporation of porosity into polyetheretherketone (PEEK) has been identified as an effective approach to improve bone-implant interfaces and osseointegration of PEEK-based devices. In this paper, a novel production technique based on the extrusion freeforming method is proposed that yields a bioactive PEEK/hydroxyapatite (PEEK/HA) composite with a unique configuration in which the bioactive phase (i.e., HA) distribution is computer-controlled within a PEEK matrix. The 100% interconnectivity of the HA network in the biocomposite confers an advantage over alternative forms of other microstructural configurations. Moreover, the technique can be employed to produce porous PEEK structures with controlled pore size and distribution, facilitating greater cellular infiltration and biological integration of PEEK composites within patient tissue. The results of unconfined, uniaxial compressive tests on these new PEEK/HA biocomposites with 40% HA under both static and cyclic mode were promising, showing the composites possess yield and compressive strength within the range of human cortical bone suitable for load bearing applications. In addition, preliminary evidence supporting initial biological safety of the new technique developed is demonstrated in this paper. Sufficient cell attachment, sustained viability in contact with the sample over a seven-day period, evidence of cell bridging and matrix deposition all confirmed excellent biocompatibility.

  4. Characterization of New PEEK/HA Composites with 3D HA Network Fabricated by Extrusion Freeforming

    Directory of Open Access Journals (Sweden)

    Mohammad Vaezi

    2016-05-01

    Full Text Available Addition of bioactive materials such as calcium phosphates or Bioglass, and incorporation of porosity into polyetheretherketone (PEEK has been identified as an effective approach to improve bone-implant interfaces and osseointegration of PEEK-based devices. In this paper, a novel production technique based on the extrusion freeforming method is proposed that yields a bioactive PEEK/hydroxyapatite (PEEK/HA composite with a unique configuration in which the bioactive phase (i.e., HA distribution is computer-controlled within a PEEK matrix. The 100% interconnectivity of the HA network in the biocomposite confers an advantage over alternative forms of other microstructural configurations. Moreover, the technique can be employed to produce porous PEEK structures with controlled pore size and distribution, facilitating greater cellular infiltration and biological integration of PEEK composites within patient tissue. The results of unconfined, uniaxial compressive tests on these new PEEK/HA biocomposites with 40% HA under both static and cyclic mode were promising, showing the composites possess yield and compressive strength within the range of human cortical bone suitable for load bearing applications. In addition, preliminary evidence supporting initial biological safety of the new technique developed is demonstrated in this paper. Sufficient cell attachment, sustained viability in contact with the sample over a seven-day period, evidence of cell bridging and matrix deposition all confirmed excellent biocompatibility.

  5. Intermonomer Interactions in Hemagglutinin Subunits HA1 and HA2 Affecting Hemagglutinin Stability and Influenza Virus Infectivity.

    Science.gov (United States)

    Wang, Wei; DeFeo, Christopher J; Alvarado-Facundo, Esmeralda; Vassell, Russell; Weiss, Carol D

    2015-10-01

    Influenza virus hemagglutinin (HA) mediates virus entry by binding to cell surface receptors and fusing the viral and endosomal membranes following uptake by endocytosis. The acidic environment of endosomes triggers a large-scale conformational change in the transmembrane subunit of HA (HA2) involving a loop (B loop)-to-helix transition, which releases the fusion peptide at the HA2 N terminus from an interior pocket within the HA trimer. Subsequent insertion of the fusion peptide into the endosomal membrane initiates fusion. The acid stability of HA is influenced by residues in the fusion peptide, fusion peptide pocket, coiled-coil regions of HA2, and interactions between the surface (HA1) and HA2 subunits, but details are not fully understood and vary among strains. Current evidence suggests that the HA from the circulating pandemic 2009 H1N1 influenza A virus [A(H1N1)pdm09] is less stable than the HAs from other seasonal influenza virus strains. Here we show that residue 205 in HA1 and residue 399 in the B loop of HA2 (residue 72, HA2 numbering) in different monomers of the trimeric A(H1N1)pdm09 HA are involved in functionally important intermolecular interactions and that a conserved histidine in this pair helps regulate HA stability. An arginine-lysine pair at this location destabilizes HA at acidic pH and mediates fusion at a higher pH, while a glutamate-lysine pair enhances HA stability and requires a lower pH to induce fusion. Our findings identify key residues in HA1 and HA2 that interact to help regulate H1N1 HA stability and virus infectivity. Influenza virus hemagglutinin (HA) is the principal antigen in inactivated influenza vaccines and the target of protective antibodies. However, the influenza A virus HA is highly variable, necessitating frequent vaccine changes to match circulating strains. Sequence changes in HA affect not only antigenicity but also HA stability, which has important implications for vaccine production, as well as viral adaptation

  6. ¿Sobrevivirán las universidades a la integración europea? Políticas de educación superior en la UE y en los Países Bajos antes y después de la Declaración de Bolonia

    Directory of Open Access Journals (Sweden)

    Chris Lorenz

    2009-01-01

    que la importancia general del "modelo holandés" para otros países de la Unión Europea, radica en el hecho de que el caso de los Países Bajos, en general, prefigura lo que sucederá a otros países de la Unión Europea, cuando las políticas de Bolonia se pongan en práctica.

  7. Los estudios de pedagogía en Europa en el contexto de la implantación del proceso de Bolonia y la situación de la Educación Comparada

    Directory of Open Access Journals (Sweden)

    Joan María Senent Sánchez

    2005-01-01

    Full Text Available El artículo nos presenta un análisis comparativo de la situación de los estudios superiores de carácter pedagógico en 23 países de Europa que han sido agrupados en 5 bloques: a Países anglofónos o de influencia británica: Reino Unido, Irlanda y Malta. b Escandinavia: Noruega, Finlandia, Dinamarca y Holanda. c Países de lengua o influencia alemana: Alemania, Austria y Eslovenia. d Europa del Este: República Checa, Eslovaquia y Polonia. e Países francófonos: Francia, Belgica, Luxemburgo y Suiza romance. . f Países meridionales: Portugal, España, Italia, Grecia y Chipre. El análisis se basa en la presencia de los estudios pedágógicos en los "grados" y "postgrados" de ese país, la estructura adoptada, las características del del programa de formación y su situación respecto a la adaptación al proceso de Bolonia. El artículo termina con la presentación de las conclusiones del informe, así como un breve análisis de la situación de la Educación Comparada en las universidades europeas, tanto como disciplina que como método de trabajo.

  8. Effect of n-HA with different surface-modified on the properties of n-HA/PLGA composite

    Energy Technology Data Exchange (ETDEWEB)

    Jiang Liuyun, E-mail: jlytxg@163.com [Chengdu Institute of Organic Chemistry, Chinese Academy of Sciences, Chengdu 610041 (China); Xiong Chengdong; Chen Dongliang [Chengdu Institute of Organic Chemistry, Chinese Academy of Sciences, Chengdu 610041 (China); Jiang Lixin [Chengdu Institute of Organic Chemistry, Chinese Academy of Sciences, Chengdu 610041 (China); Graduated School of Chinese Academy of Sciences, Beijing 100039 (China); Pang Xiubing [Zhejiang Apeloa Medical Technology Co. Ltd, Jinhua 322118 (China)

    2012-10-15

    Graphical abstract: The bend strength of n-HA/PLGA composite with the unmodified n-HA becomes lower than that of PLGA. However, when n-HA was modified by different methods, the bend strength of g-n-HA/PLGA composites gets a little increase than PLGA, and the g3-n-HA/PLGA shows the highest bend strength at 3% g3-n-HA loading amount in weight, reached 162 MPa, which was 24.4% higher than that of pure PLGA. Highlights: Black-Right-Pointing-Pointer A new surface modification method for n-HA of combining stearic acid with surface-grafting L-lactic was adopted. Black-Right-Pointing-Pointer Three different surface modification methods for n-HA were compared in detail. Black-Right-Pointing-Pointer The new surface modification method was the most ideal method in this study. Black-Right-Pointing-Pointer The g3-n-HA/PLGA composite had the highest bending strength, which would be potential to be used as bone fracture internal fixation materials. - Abstract: Three different surface modification methods for nano-hydroxyapatite (n-HA) of stearic acid, grafted with L-lactide, combining stearic acid and surface-grafting L-lactic were adopted, respectively. The surface modification reaction and the effect of different methods were evaluated by Fourier transformation infrared (FTIR), X-ray photoelectron spectra (XPS), thermal gravimetric analysis (TGA), transmission electron microscopy (TEM). The results showed that n-HA surfaces were all successful modified, and the modification method of combining stearic acid and surface-grafting L-lactic had the greatest grafting amount and the best dispersion among the three modification methods. Then, the n-HA with three different surface modification and unmodified n-HA were introduced into PLGA, respectively, and a serials of n-HA/PLGA composites with 3% n-HA amount in weight were prepared by solution mixing, and the properties of n-HA/PLGA composites were also investigated by electromechanical universal tester and scanning electron

  9. Effect of n-HA content on the isothermal crystallization, morphology and mechanical property of n-HA/PLGA composites

    Energy Technology Data Exchange (ETDEWEB)

    Liuyun, Jiang, E-mail: jlytxg@163.com [Chengdu Institute of Organic Chemistry, Chinese Academy of Sciences, Chengdu 610041 (China); Chengdong, Xiong [Chengdu Institute of Organic Chemistry, Chinese Academy of Sciences, Chengdu 610041 (China); Lixin, Jiang [Chengdu Institute of Organic Chemistry, Chinese Academy of Sciences, Chengdu 610041 (China); Graduated School of Chinese Academy of Sciences, Beijing 100039 (China); Dongliang, Chen; Qing, Li [Chengdu Institute of Organic Chemistry, Chinese Academy of Sciences, Chengdu 610041 (China)

    2013-03-15

    Graphical abstract: Effect of n-HA content on the isothermal crystallization, morphology and mechanical property of n-HA/PLGA composites was studied in details. The results showed that the addition of higher content of g-n-HA was favorable to promote the crystallization better in g-n-HA/PLGA composites, but it could also cause more agglomeration in PLGA matrix, as a result of worse mechanical properties, and the addition content of 3 wt% g-n-HA to PLGA matrix was an appropriate proportion, which had the highest bending strength among these g-n-HA/PLGA composites, and it might be potential to be used in biomedical fields in future. Highlights: ► The effect of n-HA content on the n-HA/PLGA composites was studied in detail. ► Isothermal crystallization, microstructure and mechanical property were studied. ► The relation between n-HA content and properties of n-HA/PLGA composite was found. ► An appropriate proportion of n-HA in n-HA/PLGA composite was obtained. - Abstract: A serials of g-n-HA/PLGA composites with surface-modified g-n-HA of 1%, 3%, 6%, 10% and 15% in weight were prepared by solution mixing. The isothermal crystallization, morphology and mechanical property of g-n-HA/PLGA composites were investigated by differential scanning calorimeter (DSC), scanning electron microscope (SEM) and electromechanical universal tester. The results showed that Avrami equation was suitable for describing the isothermal crystallization process in this system, and the crystallization rate of g-n-HA/PLGA composites containing more than 3 wt% g-n-HA was basically accord with the relational expression of T{sub 110} {sub °C} > T{sub 105°C} > T{sub 115°C} > T{sub 120°C}. Moreover, at the same Tc, crystallization rate was greatly enhanced with the increasing of g-n-HA acting as nucleate. However, the addition of higher content of g-n-HA would cause more agglomeration in PLGA matrix, so that the mechanical properties of g-n-HA/PLGA composites would gradually decrease. In

  10. ha Platoni ordeni sai kaks saarlast / Isa Andreas

    Index Scriptorium Estoniae

    Andreas, Isa

    2009-01-01

    ha Platoni päeval päeval jagas metropoliit Stefanus püha Platoni ordeneid aktiivsetele kirikutegelastele ning pühitseti Tartu piiskopiks arhimandriit Eelija(Ojaperv) ja Pärnu ja Saare piiskopiks arhimandriit Aleksander (Hopjorski)

  11. ¿Refundar Bolonia? : un análisis político de los discursos sobre el proceso de creación del espacio europeo de educación superior

    Directory of Open Access Journals (Sweden)

    César Cascante

    2009-01-01

    Full Text Available A partir del movimiento estudiantil de contestación al llamado Proceso de Bolonia, y a otros proyectos similares en otras zonas geográficas, se estudian, analizándolos políticamente, las líneas fundamentales de los dos discursos enfrentados. Esta controversia en torno al futuro de la universidad se sitúa en el contexto general de la crisis social que vive el capitalismo neoliberal y fundamentalmente de los problemas de precariedad y desempleo que afectan al conjunto de la población y a los jóvenes en particular. Por último se apuntan algunos aspectos que contribuyen a profundizar en el debate deshaciendo los falsos dilemas que los discursos dominantes enfrentados plantean al menos en tres terrenos: la crisis, el empleo y la universidad; la formación de profesionales en la universidad; y el papel social de la universidad.From the student movement of answer to the so called Bologna ´s Process, and to other similar projects in other geographical zones, the author studies, analyzing politically, the fundamental lines of both antagonistic speeches. This controversy around the future of the university takes place in the general context of the social crisis that livesthrough the neoliberal capitalism and fundamentally of the problems of precariousness and unemployment that affect the set of the population and the young people especially.Finally, the author indicates some aspects that help to penetrate into the debate undoing the false dilemm as that the dominant conflicting speeches raise at least in three areas: the crisis, the employment and the university; the professional’s formation (training in the university; and the social role of the university.

  12. Registration of two confection sunflower germplasm Lines, HA-R10 and HA-R11, Resistant to sunflower rust

    Science.gov (United States)

    Two confection sunflower (Helianthus annuus L.) germplasm lines, HA-R10 (Reg. No.xxx, PI670043) and HA-R11 (Reg. No.xxx, PI670044) were developed by the USDA-ARS Sunflower and Plant Biology Research Unit in collaboration with the North Dakota Agricultural Experiment Station and released December, 20...

  13. Registration of two double rust resistant germplasms, HA-R12 and HA-R13 for confection sunflower

    Science.gov (United States)

    The confection sunflower (Helianthus annuus L.) germplasms HA-R12 (Reg. No. ______, PI 673104) and HA-R13 (Reg. No. ______, PI 673105) were developed by the USDA-ARS, Sunflower and Plant Biology Research Unit in collaboration with the North Dakota Agricultural Experiment Station, and released in Jul...

  14. Design and fabrication of carbon fibers with needle-like nano-HA coating to reinforce granular nano-HA composites.

    Science.gov (United States)

    Wang, Xudong; Zhao, Xueni; Zhang, Li; Wang, Wanying; Zhang, Jing; He, Fuzhen; Yang, Jianjun

    2017-08-01

    Carbon fibers (CFs) with needle-like nano-hydroxyapatite (nHA) coating were first used as reinforcing materials named nHA-CFs to improve the mechanical properties of pure HA. A powder mixture containing nHA-CFs and granular nano-HA (gHA) was directly sintered by hot pressing at appropriate sintering pressure and temperature. A three-phase nHA-CFs/gHA composite was designed, fabricated, and used as an artificial bone. Results show that the bending strengths of the nHA-CFs/gHA composite are approximately 41.1% and 59.2% higher than those of CFs/gHA composite and pure HA, respectively. The possible reinforcing mechanism of nHA-CFs in the composite is also proposed at the end. When nHA-CFs are applied for preparation of nHA-CFs/gHA composites, the internal stress on its phase boundary with gHA matrix generated during cooling of sintered is significantly reduced due to the presence of the nHA coatings. It infers that nHA coatings on CFs might act as a bridge to control the forming of interfacial gaps between the gHA matrix and the CFs effectively. Our work provides additional insights into the feasibility of nHA-CFs/gHA composites as load-bearing implant materials in clinical applications. Copyright © 2017 Elsevier B.V. All rights reserved.

  15. A-Ha. Drum'n'bassi supernimi FABIO

    Index Scriptorium Estoniae

    2002-01-01

    7.sept. annab norra menukaim popansambel A-Ha Tallinnas Lauluväljakul kontserdi, kus presenteerib ka oma viimast albumit "Lifelines". 14. sept.tuleb drum'n'bassi spetsialist Fabio Tallinna üritusele Circulation

  16. Adhesive strength of hydroxyl apatite(HA coating and biomechanics behavior of HA-coated prosthesis:an experimental study

    Directory of Open Access Journals (Sweden)

    Tian-yang ZHANG

    2011-05-01

    Full Text Available Objective To explore the influence of adhesive strength of hydroxyapatite(HA coating on the post-implantation stability of HA-coated prosthesis.Methods The adhesive strength and biomechanics behavior of HA coating were studied by histopathological observation,material parameters and biomechanical testing,the titanium(Ti-coated prosthesis was employed as control.Results Scratch test showed that the adhesive strength of HA coating was significantly lower than that of Ti coating(P < 0.01.Histopathological examination and bone morphometry showed that,at the early stage of prosthesis implantation,the bony growth around HA-coated prosthesis was significantly higher than that around Ti-coated prosthesis(P < 0.01,but the ultimate shear strength of HA-coated prosthesis was much lower than that of Ti-coated prosthesis(P < 0.01.After the push-out test with prosthesis,histopathological observation showed that there were accumulations of clump-and strip-like granular residues on the surface of bones that newly grew around the HA-coated prosthesis,and surface energy-dispersive X-ray spectroscopy(EDX analysis also confirmed that the shear stress induced HA decohesion from the substrate of prosthesis.Conclusions Although HA coating showed a satisfactory effect on early bone formation and prosthetic stability,due to the deficiencies of adhesive strength,the early stability of prosthesis may be gradually destroyed by the shear loads of human body and coating degradation.

  17. Effect of n-HA with different surface-modified on the properties of n-HA/PLGA composite

    Science.gov (United States)

    Liuyun, Jiang; Chengdong, Xiong; Dongliang, Chen; Lixin, Jiang; xiubing, Pang

    2012-10-01

    Three different surface modification methods for nano-hydroxyapatite (n-HA) of stearic acid, grafted with L-lactide, combining stearic acid and surface-grafting L-lactic were adopted, respectively. The surface modification reaction and the effect of different methods were evaluated by Fourier transformation infrared (FTIR), X-ray photoelectron spectra (XPS), thermal gravimetric analysis (TGA), transmission electron microscopy (TEM). The results showed that n-HA surfaces were all successful modified, and the modification method of combining stearic acid and surface-grafting L-lactic had the greatest grafting amount and the best dispersion among the three modification methods. Then, the n-HA with three different surface modification and unmodified n-HA were introduced into PLGA, respectively, and a serials of n-HA/PLGA composites with 3% n-HA amount in weight were prepared by solution mixing, and the properties of n-HA/PLGA composites were also investigated by electromechanical universal tester and scanning electron microscope(SEM), comparing with PLGA. The results showed that the n-HA/PLGA composite with the n-HA surface modified by combining stearic acid and surface-grafting L-lactic had the highest bending strength and the best dispersion and interfacial adhesion among the three different modification methods, suggesting the surface modification of combining stearic acid and surface-grafting L-lactic was the most ideal method in this study, which has a great deal of enhancement of bending strength than PLGA, and it would be potential to be used in the field of bone fracture internal fixation in future.

  18. Effects of HA released calcium ion on osteoblast differentiation.

    Science.gov (United States)

    Jung, Gil-Yong; Park, Yoon-Jeong; Han, Jung-Suk

    2010-05-01

    Hydroxyapatite (HA) is a widely used calcium phosphate implant substitute and has dissolution property. Although HA has been shown a beneficial effect on osteoblast differentiation, the exact mechanism is still unclear. In the present study, we proposed that Ca(2+) released from HA activated the expression bone associated proteins, OPN and BSP, mediated by L-type calcium channel and calcium/calmodulin-dependent protein kinase (CaMK) 2 which resulted into improved osteoblast differentiation. Results showed that HA elevated ALP expression as well as OPN and BSP expression in MC3T3-E1 cells. The result from western blot of CaMK2alpha indicated that HA released Ca(2+) activated CaMK2 through L-type calcium channel. Furthermore, upregulation of OPN and BSP mRNA expression was significantly inhibited when blocking both the L-type calcium channel and CaMK2. These findings suggested that HA accelerated the osteoblast differentiation by releasing Ca(2+).

  19. CILogon-HA. Higher Assurance Federated Identities for DOE Science

    Energy Technology Data Exchange (ETDEWEB)

    Basney, James [Univ. of Illinois, Urbana-Champaign, IL (United States)

    2015-08-01

    The CILogon-HA project extended the existing open source CILogon service (initially developed with funding from the National Science Foundation) to provide credentials at multiple levels of assurance to users of DOE facilities for collaborative science. CILogon translates mechanism and policy across higher education and grid trust federations, bridging from the InCommon identity federation (which federates university and DOE lab identities) to the Interoperable Global Trust Federation (which defines standards across the Worldwide LHC Computing Grid, the Open Science Grid, and other cyberinfrastructure). The CILogon-HA project expanded the CILogon service to support over 160 identity providers (including 6 DOE facilities) and 3 internationally accredited certification authorities. To provide continuity of operations upon the end of the CILogon-HA project period, project staff transitioned the CILogon service to operation by XSEDE.

  20. Prospects of HA-Based Universal Influenza Vaccine

    Directory of Open Access Journals (Sweden)

    Anwar M. Hashem

    2015-01-01

    Full Text Available Current influenza vaccines afford substantial protection in humans by inducing strain-specific neutralizing antibodies (Abs. Most of these Abs target highly variable immunodominant epitopes in the globular domain of the viral hemagglutinin (HA. Therefore, current vaccines may not be able to induce heterosubtypic immunity against the divergent influenza subtypes. The identification of broadly neutralizing Abs (BnAbs against influenza HA using recent technological advancements in antibody libraries, hybridoma, and isolation of single Ab-secreting plasma cells has increased the interest in developing a universal influenza vaccine as it could provide life-long protection. While these BnAbs can serve as a source for passive immunotherapy, their identification represents an important step towards the design of such a universal vaccine. This review describes the recent advances and approaches used in the development of universal influenza vaccine based on highly conserved HA regions identified by BnAbs.

  1. Mao & Püha Eliisabet / Jüri Kuuskemaa

    Index Scriptorium Estoniae

    Kuuskemaa, Jüri, 1942-

    2000-01-01

    Kadrioru lossis Väliskunstimuuseumi ekspositsioonis olevast antikvaar August Käbi pärandist pärit maalist. Kunstiteadlase Mai Levini arvates võib maali autoriks olla Rooma kunstnik Tommaso Salini, hüüdnimega Mao. Maali süzee: "Püha Eliisabeti kuulutus". 1 ill

  2. Läkaköha - aktuaalne uurimisteema / Marje Oona

    Index Scriptorium Estoniae

    Oona, Marje, 1963-

    2012-01-01

    TÜ peremeditsiini õppetooli töötajate poolt algatatud uurimistööst, mille eesmärgiks on uurida Bordetella spp. infektsioonide epidemioloogiat, molekulaargeneetikat ja kliinilisi eripärasid ning selgitada läkaköha sagedasema diagnsimise põhjusi Eestis

  3. Challenges In the At Home Anywhere (@HA) Service Discovery Protocol

    NARCIS (Netherlands)

    Sundramoorthy, V.; Scholten, Johan; Finney, J.; Haahr, M.; Montresor, A.

    2002-01-01

    Since the idea of ubiquitous computing kicked off, service discovery has been found essential in implementing automatic discovery of networked devices, and remote control of one device from another. In the At Home Anywhere (@HA) project, service discovery ensures seamless communication between home

  4. Bilingual Creativity in Chinese English: Ha Jin's "In the Pond."

    Science.gov (United States)

    Zhang, Hang

    2002-01-01

    Addresses issues related to bilingual creativity in Chinese English and their implications for world Englishes in the Chinese context. The language examined is drawn from Ha Jin's novella, "In the Pond, in which the author's use of English is nativized in the Chinese context in order to recast the cultural meanings of the language.…

  5. Siempre ha habido infografía (3

    Directory of Open Access Journals (Sweden)

    Dr. José Manuel de Pablos

    1998-01-01

    Full Text Available El autor hace una reflexión bipolar: acerca de qué es la infografía que hoy con tanta frecuencia se encuentra en prensa y cómo esa misma figura comunicativa se ha encontrado en numerosas manifestaciones culturales de la humanidad, en tiempos históricos, muy anterior, naturalmente, a la presencia de la informática. Esto lo lleva a afirmar que siempre ha habido infografía, desde que el ser humano unió con sentido informativo un texto y una imagen, ambos estrechamente ligados, el texto apoyado en la imagen y la imagen subrayando al texto.Se trata de la tercera entrega del libro colectivo sobre infografía periodística, iniciado por Mario R. García, del Poynter Institute de Florida, y continuado por Elio Leturia, grafista del Detroit Free Press.

  6. El griot no ha muerto, viva el hip-hop

    Directory of Open Access Journals (Sweden)

    Fco. Javier González García-Mamely

    2015-11-01

    Full Text Available La oratura en África ha jugado un papel vital a lo largo de los milenios como un (único medio de preservar y transmitir la historia, la cultura y el imaginario de cada comunidad. El griot es un claro modelo de las artes orales, pero ha sufrido cambios drásticos en su modo de vida y en los recursos narrativos de los que dispone. Tras el mecenazgo de los grandes reyes y las sucesivas llegadas del islam, el colonialismo y los procesos de modernización y occidentalización, los griots se han tenido que adaptar a nuevos patrones, audiencias y medios de comunicación, convirtiéndose en políticos o en figuras del espectáculo. La aparición del rap y el hip-hop reclamando ser los “modernos griots” ha ocasionado una respuesta crítica y una atracción viral hacia el nuevo fenómeno, sea éste un nuevo género o una reinvención de la oratura del antiguo griot.

  7. Biopolymers for Medical Applications: Polyglycerol Sebacate (PGS) doped Hydroxyapatite (HA)

    Science.gov (United States)

    Teruel, Maria; Kuthirummal, Narayanan; Levi, Nicole; Wake College Team

    2011-04-01

    In the investigation to engineer the ideal scaffolding device for cleft palate repair, polyglycerol sebacate (PGS) doped with hydroxyapatite (HA) were chosen for their elastomeric and biodegradable properties, as well as their cost-effective synthesis. Hydroxyapatite was integrated into the PGS to form a composite with high porosity and improved mechanical properties yielding a good substrate for cell attachment during the repair process. FT-IR scans were performed to characterize the composite polymer. Differential Scanning Calorimetry (DSC) was utilized to identify an acceptable glass transition temperature (Tg), between -18 and - 21°C. At this Tg, it was determined that the material was sufficiently polymerized to a point where it was durable yet pliable enough to use for cleft palate devices. In the synthesis of PGS 3% and 5% HA, a Tg of - 20.10°C and - 21.72°C, respectively, was achieved and further analytical tests were then performed on the polymers. Methods of analysis included X-Ray Diffraction and Tensile Strength Testing. Acknowledgements to the Research Department of Plastic and Reconstructive Surgery, Wake Forest University and College of Charleston.

  8. L'oggetto del desiderio ha il colore del vuoto

    Directory of Open Access Journals (Sweden)

    Giovanni Bottiroli

    2011-07-01

    Full Text Available L’oggetto del desiderio non è semplicemente un oggetto empirico; su ciò, con qualche esitazione, potrebbe esistere un consenso generale. Resta la difficoltà di indicare le caratteristiche dell’oggetto del desiderio: che non sono banalmente delle proprietà, e neanche solo delle parti (in senso empirico, come si potrebbe nominarle da un punto di vista mereologico. L’oggetto del desiderio ha uno statuto modale: è un oggetto modalmente diviso, nei registri e nei regimi. Nella dimensione del desiderio, tanto il soggetto quanto l’oggetto sono abitati dal conflitto tra il diviso e l’indiviso. La spinta verso l’indiviso corrisponde a ciò che Freud ha introdotto con la nozione enigmatica di «pulsione di morte». In termini lacaniani, è l’attrazione verso la Cosa (das Ding. E la Cosa vuole coincidere con se stessa, abolendo ogni distinzione. L’oggetto del desiderio non è un dato o una forma empirica, per attraente che sia: l’attrazione che esercita proviene dal caos. Alla pericolosa coincidenza del «vuoto-pieno» (das Ding il desiderio oppone il vuoto logico della non-coincidenza. Una teoria del desiderio non può fare a meno di una riflessione sui differenti significati del vuoto.

  9. Effect of thickness of HA-coating on microporous silk scaffolds using alternate soaking technology.

    Science.gov (United States)

    Li, Hongguo; Zhu, Rui; Sun, Liguo; Xue, Yingsen; Hao, Zhangying; Xie, Zhenghong; Fan, Xiangli; Fan, Hongbin

    2014-01-01

    Hydroxyapatite (HA) can be coated on various materials surface and has the function of osteogenicity. Microporous silk scaffold has excellent biocompatibility. In this study, alternate soaking technology was used to coat HA on microporous silk scaffolds. However, the cell proliferation was found to decrease with the increasing thickness (cycles of soaking) of HA-coating. This study aims to determine the best thickness (cycles of soaking) of HA-coating on microporous silk scaffolds. The SEM observation showed that group with one cycle of alternate soaking (1C-HA) has the most optimal porosity like non-HA-modified microporous silk scaffolds. The proliferation of osteoblasts has no significant difference between noncoated HA (N-HA) and 1C-HA groups, which are both significantly higher than those in two cycles of soaking (2C-HA) and three cycles of soaking (3C-HA) groups. The transcription levels of specific genes (runx2 and osteonectin) in osteoblasts of 1C-HA group were significantly higher than those of N-HA group. Moreover, the levels showed no significant difference among 1C-HA, 2C-HA, and 3C-HA groups. In conclusion, microporous silk scaffold with 1 cycle of HA-coating can combine the biocompatibility of silk and osteogenicity of HA.

  10. Bør leger ha reservasjonsrett ved assistert befruktning?

    Directory of Open Access Journals (Sweden)

    Morten Magelssen

    2011-10-01

    Full Text Available Omfanget av helsepersonells reservasjonsrett har nylig vært gjenstand for debatt i Norge. Vi spør om leger bør ha reservasjonsrett ved utførelse og henvisning til assistert befruktning, og drøfter argumenter for og imot ved hjelp av et rammeverk med sju kriterier for vurdering av reservasjon. Reservasjonsrettens grunnleggende dilemma er hvordan to viktige hensyn, henholdsvis pasientens rett til behandling og hensynet til helsepersonellets moralske integritet, best kan ivaretas. Det argumenteres for at leger bør ha rett til å reservere seg mot å utføre, assistere ved og henvise til assistert befruktning generelt hvis begrunnelsen er hensynet til befruktede eggs moralske verdi. Videre finner vi at leger også kan ha en moralsk rett til reservasjon mot å utføre, assistere ved og henvise til assistert befruktning for likekjønnede, men da på nærmere spesifiserte vilkår.Nøkkelord: reservasjonsrett, assistert befruktning, samvittighet, moralsk integritetEnglish summary: Should physicians have the right to conscientiously object to assisted reproduction?The extent of the healthcare worker's right to conscientious objection has recently been debated in Norway. This article asks whether physicians should have a right to conscientious objection to the performance of, and referral for, assisted reproduction, and discusses arguments for and against the same, utilizing a framework of seven criteria for the evaluation of conscientious objection. The fundamental dilemma of conscientious objection is how two important considerations can be reconciled: the patient's right to treatment, and the protection of the healthcare worker's moral integrity. It is argued that physicians should have the right to object to performing, assisting with, and referring for assisted reproduction generally when the objection is grounded in the moral value of the embryo. Furthermore, physicians may also have a moral right to object to performing, assisting with, and

  11. Biomedical potential of chitosan/HA and chitosan/β-1,3-glucan/HA biomaterials as scaffolds for bone regeneration — A comparative study

    Energy Technology Data Exchange (ETDEWEB)

    Przekora, Agata, E-mail: agata.przekora@umlub.pl [Department of Biochemistry and Biotechnology, Medical University of Lublin, Chodzki 1, 20-093 Lublin (Poland); Palka, Krzysztof [Department of Materials Engineering, Lublin University of Technology, Nadbystrzycka 36, 20-618 Lublin (Poland); Ginalska, Grazyna [Department of Biochemistry and Biotechnology, Medical University of Lublin, Chodzki 1, 20-093 Lublin (Poland)

    2016-01-01

    The aim of this work was to compare biomedical potential of chitosan/hydroxyapatite (chit/HA) and novel chitosan/β-1,3-glucan/hydroxyapatite (chit/glu/HA) materials as scaffolds for bone regeneration via characterization of their biocompatibility, porosity, mechanical properties, and water uptake behaviour. Biocompatibility of the scaffolds was assessed in direct-contact with the materials using normal human foetal osteoblast cell line. Cytotoxicity and osteoblast proliferation rate were evaluated. Porosity was assessed using computed microtomography analysis and mechanical properties were determined by compression testing. Obtained results demonstrated that chit/HA scaffold possessed significantly better mechanical properties (compressive strength: 1.23 MPa, Young's modulus: 0.46 MPa) than chit/glu/HA material (compressive strength: 0.26 MPa, Young's modulus: 0.25 MPa). However, addition of bacterial β-1,3-glucan to the chit/HA scaffold improved its flexibility and porosity. Moreover, chit/glu/HA scaffold revealed significantly higher water uptake capability (52.6% after 24 h of soaking) compared to the chit/HA (30.7%) and thus can serve as a very good drug delivery carrier. Chit/glu/HA scaffold was also more favourable to osteoblast survival (near 100% viability after 24-h culture), proliferation, and spreading compared to the chit/HA (63% viability). The chit/glu/HA possesses better biomedical potential than chit/HA scaffold. Nevertheless, poor mechanical properties of the chit/glu/HA limit its application to non-load bearing implantation area. - Highlights: • Chitosan/HA and chit/β-1,3-glucan/HA scaffolds for bone regeneration were compared. • Chit/HA significantly reduced osteoblast viability to 63% compared to chit/glu/HA. • Unlike chit/HA, chit/glu/HA favoured cell adhesion, spreading, and proliferation. • Chit/HA had better compressive strength and Young's modulus than chit/glu/HA. • Chit/glu/HA revealed significantly higher

  12. Haïti-Quisqueya: une double insularité

    Directory of Open Access Journals (Sweden)

    Jean-Marie THÉODAT

    1998-09-01

    Full Text Available Deux pays se partagent une île coupée par une frontière méridienne de plus de 300 km: Haïti à l'ouest, Quisqueya à l'est. Cette coupure est l'héritage du partage colonial de l'île entre la France et l'Espagne, et le résultat de la dynamique spatiale contrastée des deux nations qui y sont nées et qui ont eu recours à des principes d'encadrement distincts.De là un sentiment de double insularité, chaque pays se comportant vis-à-vis de son voisin comme s'ils étaient situés sur deux îles séparées.

  13. Generation of recombinant pandemic H1N1 influenza virus with the HA cleavable by bromelain and identification of the residues influencing HA bromelain cleavage.

    Science.gov (United States)

    Wang, Weijia; Suguitan, Amorsolo L; Zengel, James; Chen, Zhongying; Jin, Hong

    2012-01-20

    The proteolytic enzyme bromelain has been traditionally used to cleave the hemagglutinin (HA) protein at the C-terminus of the HA2 region to release the HA proteins from influenza virions. The bromelain cleaved HA (BHA) has been routinely used as an antigen to generate antiserum that is essential for influenza vaccine product release. The HA of the 2009 pandemic H1N1 influenza A/California/7/2009 (CA09) virus could not be cleaved efficiently by bromelain. To ensure timely delivery of BHA for antiserum production, we generated a chimeric virus that contained the HA1 region from CA09 and the HA2 region from the seasonal H1N1 A/South Dakota/6/2007 (SD07) virus that is cleavable by bromelain. The BHA from this chimeric virus was antigenically identical to CA09 and induced high levels of HA-specific antibodies and protected ferrets from wild-type H1N1 CA09 virus challenge. To determine the molecular basis of inefficient cleavage of CA09 HA by bromelain, the amino acids that differed between the HA2 of CA09 and SD07 were introduced into recombinant CA09 virus to assess their effect on bromelain cleavage. The D373N or E374G substitution in the HA2 stalk region of CA09 HA enabled efficient cleavage of CA09 HA by bromelain. Sequence analysis of the pandemic H1N1-like viruses isolated from 2010 revealed emergence of the E374K change. We found that K374 enabled the HA to be cleaved by bromelain and confirmed that the 374 residue is critical for HA bromelain cleavage. Copyright © 2011 Elsevier Ltd. All rights reserved.

  14. Immunomodulatory Effects of Hemagglutinin- (HA- Modified A20 B-Cell Lymphoma Expanded as a Brain Tumor on Adoptively Transferred HA-Specific CD4+ T Cells

    Directory of Open Access Journals (Sweden)

    Valentin P. Shichkin

    2014-01-01

    Full Text Available Previously, the mouse A20 B-cell lymphoma engineered to express hemagglutinin (HA antigen (A20HA was used as a systemic tumor model. In this work, we used the A20HA cells as a brain tumor. HA-specific CD4+ T cells were transferred intravenously in a tail vein 5 days after A20HA intracranial inoculation and analyzed on days 2, 9, and 16 after the adoptive transfer by different methods. The transferred cells demonstrated state of activation as early as day 2 after the adoptive transfer and most the of viable HA-specific cells became anergic on day 16. Additionally, symptoms of systemic immunosuppression were observed in mice with massive brain tumors at a late stage of the brain tumor progression (days 20–24 after the A20HA inoculation. Despite that, a deal of HA-specific CD4+ T cells kept the functional activity even at the late stage of A20HA tumor growth. The activated HA-specific CD4+ T cells were found also in the brain of brain-tumor-bearing mice. These cells were still responding to reactivation with HA-peptide in vitro. Our data support an idea about sufficient role of both the tumor-specific and -nonspecific mechanisms inducing immunosuppression in cancer patients.

  15. Hypomethylating drugs convert HA-1-negative solid tumors into targets for stem cell-based immunotherapy.

    Science.gov (United States)

    Hambach, Lothar; Ling, Kam-Wing; Pool, Jos; Aghai, Zohara; Blokland, Els; Tanke, Hans J; Bruijn, Jan A; Halfwerk, Hans; van Boven, Hester; Wieles, Brigitte; Goulmy, Els

    2009-03-19

    Clinical responses of solid tumors after allogeneic human leukocyte antigen-matched stem cell transplantation (SCT) often coincide with severe graft-versus-host disease (GVHD). Targeting minor histocompatibility antigens (mHags) with hematopoiesis- and cancer-restricted expression, for example, HA-1, may allow boosting the antitumor effect of allogeneic SCT without risking severe GVHD. The mHag HA-1 is aberrantly expressed in cancers of most entities. However, an estimated 30% to 40% of solid tumors do not express HA-1 (ie, are HA-1(neg)) and cannot be targeted by HA-1-specific immunotherapy. Here, we investigated the transcriptional regulation of HA-1 gene expression in cancer. We found that DNA hypermethylation in the HA-1 promoter region is closely associated with the absence of HA-1 gene expression in solid tumor cell lines. Moreover, we detected HA-1 promoter hypermethylation in primary cancers. The hypomethylating agent 5-aza-2'-deoxycytidine induced HA-1 expression only in HA-1(neg) tumor cells and sensitized them for recognition by HA-1-specific cytotoxic T lymphocytes. Contrarily, the histone deacetylation inhibitor trichostatin A induced HA-1 expression both in some HA-1(neg) tumor cell lines and in normal nonhematopoietic cells. Our data suggest that promoter hypermethylation contributes to the HA-1 gene regulation in tumors. Hypomethylating drugs might extend the safe applicability of HA-1 as an immunotherapeutic target on solid tumors after allogeneic SCT.

  16. 24 CFR 964.18 - HA role in activities under subparts B & C.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false HA role in activities under... Provisions § 964.18 HA role in activities under subparts B & C. (a) HAs with 250 units or more. (1) A HA...) The HA, in collaboration with the resident councils, shall assume the lead role for assuring maximum...

  17. Haïti : entre urgence et reconstruction

    Directory of Open Access Journals (Sweden)

    Jean-Marc Biquet

    2014-01-01

    Full Text Available Note de l’éditeur : Cette contribution vient alimenter la section « Policy Debate » de la Revue de politique internationale de développement. Des universitaires, décideurs et praticiens y dialoguent autour d’enjeux globaux du développement. Le processus de publication des « Policy Debate » est différent de celle des autres sections. Les contributions sont éditées et corrigées, mais pas expertisés par des pairs. Une contribution thématique initiale lance le débat. Elle est suivie de commentaires critiques et de réactions de diverses parties. Jean-Marc Biquet, chargé de recherche à Médecin sans Frontière (MSF, livre une contribution sur la faillite du système d’aide en Haïti. Ce pays a été particulièrement touché par deux catastrophes coup sur coup : le séisme en janvier 2010 et une épidémie de choléra en octobre de la même année. Malgré des demandes répétées (et engagements reçus aux Nations unies (en particulier, à l’UNOCHA, nous n’avons malheureusement pas reçu de réaction écrite à l’article de Jean-Marc Biquet provenant de ces institutions. Cependant, nous avons reçu un commentaire critique de Andrea Binder, Directrice associée du Global Public Policy Institute (GPPi de Berlin ‘Is the Humanitarian Failure in Haiti a System Failure?’, que nous publions conjointement au texte de Jean-Marc Biquet. Dr Biner a notamment été étroitement impliquée dans le processus  d’évaluation inter-agences en temps réel de l’intervention humanitaire en Haïti suite au tremblement de terre. Téléchargez l’intégralité du débat en format .pdf sur http://poldev.revues.org/pdf/1600

  18. La Ha de la infancia en Italia. Problemas y perspectiva

    Directory of Open Access Journals (Sweden)

    Enzo CATARSI

    2010-03-01

    Full Text Available RESUMEN: La historiografía italiana de la infancia, como la de otros muchos países europeos, está hoy embarcada en una tarea de desarrollo y profundización que permitirá recuperar los retrasos que la han caracterizado. En efecto, también en Italia la historia de la infancia y su individuación como «objeto» historiografía constituyen una adquisición reciente, lograda con la ayuda de diversas influencias. La primera, estrechamente vinculada a la historia de las mentalidades, representada por la obra de Ph. Aries, «El niño y la vida familiar en el Antiguo Régimen», traducido al italiano en 1968. La segunda es la historia social, orientada al estudio de los diversos aspectos de la vida de una sociedad, y más atenta a sus acontecimientos. La tercera la representa el estructuralismo, especialmente el francés, y en concreto M. Foucault. La particular influencia que, también en el contexto italiano, han alcanzado los trabajos de Ph. Aries y L. DeMause, muy importantes por haber abierto una línea de investigación, aunque con las obligadas diferencias, ha conducido a privilegiar una perspectiva exclusiva de historia de las mentalidades que se muestra muy ambigua y claramente interpretativa en exceso.

  19. La planificación por competencias en la reforma de Bolonia de la educación superior: un análisis crítico/A planificação por competências a reforma de Bolonha da educação superior: uma análise crítica

    Directory of Open Access Journals (Sweden)

    Antonio Bolívar

    2007-01-01

    Full Text Available Este trabajo analiza la dimensión curricular y didáctica, más que la estructural, de la reforma de Bolonia. Se describen las principales líneas y orientaciones de la planificación del currículum y la enseñanza según el Proceso de Convergencia de Bolonia, pensando que puede ofrecer una oportunidad institucional para mejorar la docencia en la Universidad, a condición de no limitarse a cambios estructurales, para lo que debe incidir en mudar la propia mentalidad y cultura establecida. Más particularmente, se realiza un análisis crítico del papel que juegan las competencias en el proceso de planificación, tanto en el modelo adoptado (Proyecto Tuning, como por la subordinación al perfil profesional y su vinculación con el mercado laboral. Desde un abordaje crítico se defiende que, si bien la Universidad debe preparar para el ejercicio profesional, ello no puede suponer desdeñar otras dimensiones de la Educación Superior. Este trabalho analisa a dimensão curricular e didática, mais do que a estrutural, da reforma de Bolonha. Descrevem-se as principais linhas e orientações da planificação do currículo e do conhecimento segundo o Processo de Convergência de Bolonha, pensando que se pode oferecer uma oportunidade institucional para melhorar a docência da Universidade. Para que isto aconteça, a condição é de que o processo não se limite a câmbios estruturais, mas sim o que deve incidir em mudar a própria mentalidade e cultura estabelecida. Mais particularmente, se realiza uma analise critica do papel que se julgam as competências do processo de planificação, tanto no modelo adaptado (Prometo Tuning, como pela subordinação do perfil profissional, e sua vinculação com o Mercado de Trabalho. Desde uma abordagem critica se defende que a Universidade deve preparar para o exercício profissional, e isto não pode supor desdenhar outras dimensões da Educação Superior.

  20. Biomedical potential of chitosan/HA and chitosan/β-1,3-glucan/HA biomaterials as scaffolds for bone regeneration--A comparative study.

    Science.gov (United States)

    Przekora, Agata; Palka, Krzysztof; Ginalska, Grazyna

    2016-01-01

    The aim of this work was to compare biomedical potential of chitosan/hydroxyapatite (chit/HA) and novel chitosan/β-1,3-glucan/hydroxyapatite (chit/glu/HA) materials as scaffolds for bone regeneration via characterization of their biocompatibility, porosity, mechanical properties, and water uptake behaviour. Biocompatibility of the scaffolds was assessed in direct-contact with the materials using normal human foetal osteoblast cell line. Cytotoxicity and osteoblast proliferation rate were evaluated. Porosity was assessed using computed microtomography analysis and mechanical properties were determined by compression testing. Obtained results demonstrated that chit/HA scaffold possessed significantly better mechanical properties (compressive strength: 1.23 MPa, Young's modulus: 0.46 MPa) than chit/glu/HA material (compressive strength: 0.26 MPa, Young's modulus: 0.25 MPa). However, addition of bacterial β-1,3-glucan to the chit/HA scaffold improved its flexibility and porosity. Moreover, chit/glu/HA scaffold revealed significantly higher water uptake capability (52.6% after 24h of soaking) compared to the chit/HA (30.7%) and thus can serve as a very good drug delivery carrier. Chit/glu/HA scaffold was also more favourable to osteoblast survival (near 100% viability after 24-h culture), proliferation, and spreading compared to the chit/HA (63% viability). The chit/glu/HA possesses better biomedical potential than chit/HA scaffold. Nevertheless, poor mechanical properties of the chit/glu/HA limit its application to non-load bearing implantation area. Copyright © 2015 Elsevier B.V. All rights reserved.

  1. Prediction of IOI-HA Scores Using Speech Reception Thresholds and Speech Discrimination Scores in Quiet

    DEFF Research Database (Denmark)

    Brännström, K Jonas; Lantz, Johannes; Nielsen, Lars Holme

    2014-01-01

    ), and speech discrimination scores (SDSs) in quiet or in noise are common assessments made prior to hearing aid (HA) fittings. It is not known whether SRT and SDS in quiet relate to HA outcome measured with the International Outcome Inventory for Hearing Aids (IOI-HA). PURPOSE: The aim of the present study...... COLLECTION AND ANALYSIS: The psychometric properties were evaluated and compared to previous studies using the IOI-HA. The associations and differences between the outcome scores and a number of descriptive variables (age, gender, fitted monaurally/binaurally with HA, first-time/experienced HA users, years...

  2. Electrochemical Characteristics of HA Film on the Ti Alloy Using Pulsed Laser Deposition

    Energy Technology Data Exchange (ETDEWEB)

    Jeong, Yong-Hoon; Choe, Han-Cheol; Shin, Seung-Pyo; Chung, Chae-Heon [Chosun University, Gwangju (Korea, Republic of); Kim, Sang-Sub [Inha University, Incheon (Korea, Republic of)

    2012-05-15

    In this study, we have investigated the surface morphology of hydroxyapatite (HA) coated Ti alloy surface using pulsed laser plating. The HA (tooth ash) films were grown by pulsed KrF excimer laser, film surfaces were analyzed for topology, chemical composition, crystal structure and electrochemical behavior. The Ti-6Al-4V alloy showed α and β phase, Cp-Ti showed α phase and the HA coated surface showed HA and Ti alloy peaks. The HA coating layer was formed with 1-2um droplets and grain-like particles, particles which were smaller than the HA target particle, and the composition of the HA coatings were composed of Ca and P. From the electrochemical test, the pitting potential (1580 mV) of HA coated Ti-6Al-4V alloy was higher than those of Cp-Ti (1060 mV) and HA coated Cp-Ti (1350 mV). The HA coated samples showed a lower current density than non-HA coated samples, whereas, the polarization resistance of HA coated samples showed a high value compared to non-HA coated samples.

  3. Enantiomers of HA-966 (3-amino-1-hydroxypyrrolid-2-one) exhibit distinct central nervous system effects: (+)-HA-966 is a selective glycine/N-methyl-D-aspartate receptor antagonist, but (-)-HA-966 is a potent gamma-butyrolactone-like sedative

    Energy Technology Data Exchange (ETDEWEB)

    Singh, L.; Donald, A.E.; Foster, A.C.; Hutson, P.H.; Iversen, L.L.; Iversen, S.D.; Kemp, J.A.; Leeson, P.D.; Marshall, G.R.; Oles, R.J.; Priestley, T.; Thorn, L.; Tricklebank, M.D.; Vass, C.A.; Williams, B.J. (Merck Sharp and Dohme Research Labs., Essex (England))

    1990-01-01

    The antagonist effect of {+-}-3-amino-1-hydroxypyrrolid-2-one (HA-966) at the N-methyl-D-aspartate (NMDA) receptor occurs through a selective interaction with the glycine modulatory site within the receptor complex. When the enantiomers of {+-}-HA-966 were resolved, the (R)-(+)-enantiomer was found to be a selective glycine/NMDA receptor antagonist, a property that accounts for its anticonvulsant activity in vivo. In contrast, the (S)-(-)-enantiomer was only weakly active as an NMDA-receptor antagonist, but nevertheless it possessed a marked sedative and muscle relaxant action in vivo. In radioligand binding experiments, (+)-HA-966 inhibited strychnine-insensitive ({sup 3}H)glycine binding to rat cerebral cortex synaptic membranes with an IC{sub 50} of 12.5 {mu}M, whereas (-)-HA-966 had an IC{sub 50} value of 339 {mu}M. In mice, (+)-HA-966 antagonized sound and N-methyl-DL-aspartic acid (NMDLA)-induced seizures. The coadministration of D-serine dose-dependently antagonized the anticonvulsant effect of a submaximal dose of (+)-HA-966 against NMDLA-induced seizures. The sedative/ataxic effect of racemic HA-966 was mainly attributable to the (-)-enantiomer. It is suggested that, as in the case of the sedative {gamma}-butyrolactone, disruption of striatal dopaminergic mechanisms may be responsible for this action.

  4. Molecular aspects of zygotic embryogenesis in sunflower (Helianthus annuus L.): correlation of positive histone marks with HaWUS expression and putative link HaWUS/HaL1L.

    Science.gov (United States)

    Salvini, Mariangela; Fambrini, Marco; Giorgetti, Lucia; Pugliesi, Claudio

    2016-01-01

    The link HaWUS/ HaL1L , the opposite transcriptional behavior, and the decrease/increase in positive histone marks bond to both genes suggest an inhibitory effect of WUS on HaL1L in sunflower zygotic embryos. In Arabidopsis, a group of transcription factors implicated in the earliest events of embryogenesis is the WUSCHEL-RELATED HOMEOBOX (WOX) protein family including WUSCHEL (WUS) and other 14 WOX protein, some of which contain a conserved WUS-box domain in addition to the homeodomain. WUS transcripts appear very early in embryogenesis, at the 16-cell embryo stage, but gradually become restricted to the center of the developing shoot apical meristem (SAM) primordium and continues to be expressed in cells of the niche/organizing center of SAM and floral meristems to maintain stem cell population. Moreover, WUS has decisive roles in the embryonic program presumably promoting the vegetative-to-embryonic transition and/or maintaining the identity of the embryonic stem cells. However, data on the direct interaction between WUS and key genes for seed development (as LEC1 and L1L) are not collected. The novelty of this report consists in the characterization of Helianthus annuus WUS (HaWUS) gene and in its analysis regarding the pattern of the methylated lysine 4 (K4) of the Histone H3 and of the acetylated histone H3 during the zygotic embryo development. Also, a parallel investigation was performed for HaL1L gene since two copies of the WUS-binding site (WUSATA), previously identified on HaL1L nucleotide sequence, were able to be bound by the HaWUS recombinant protein suggesting a not described effect of HaWUS on HaL1L transcription.

  5. Corrosion behavior of HA-316L SS biocomposites in aqueous solutions

    OpenAIRE

    Robin, Alain; Silva,Gilbert; Rosa, Jorge Luiz

    2013-01-01

    316L stainless steel and Hydroxyapatite (5, 20 and 50 wt. (%) HA)-316L stainless steel composites were fabricated by mechanical alloying technique, pressing and sintering from 316L and HA powders. The corrosion behavior of both sintered 316L and HA-316L composites was evaluated by electrochemical techniques in simulated body fluid (Ringer's solution) and in 0.1M HCl solution which simulates occluded cell corrosion conditions. The results indicate that 316L stainless steel and HA-316L composit...

  6. Competencia en comunicación en el currículo del estudiante de Medicina de España (1990-2014: de la Atención Primaria al Plan Bolonia. Un estudio descriptivo

    Directory of Open Access Journals (Sweden)

    Guillermo Ferreira Padilla

    2015-08-01

    Conclusiones: La carga en créditos destinada a esta competencia ha aumentado considerablemente desde 1990 hasta 2014 (d = 1,43 >> 0,8. Sin embargo, aún no se han integrado plenamente las recomendaciones al respecto en la mayoría de FM españolas. Las universidades públicas parecen estar más concienciadas con este tipo de enseñanza. Asimismo, sería interesante reforzar esta competencia en el sexto curso.

  7. Stalking influenza by vaccination with pre-fusion headless HA mini-stem

    Science.gov (United States)

    Valkenburg, Sophie A.; Mallajosyula, V. Vamsee Aditya; Li, Olive T. W.; Chin, Alex W. H.; Carnell, George; Temperton, Nigel; Varadarajan, Raghavan; Poon, Leo L. M.

    2016-01-01

    Inaccuracies in prediction of circulating viral strain genotypes and the possibility of novel reassortants causing a pandemic outbreak necessitate the development of an anti-influenza vaccine with increased breadth of protection and potential for rapid production and deployment. The hemagglutinin (HA) stem is a promising target for universal influenza vaccine as stem-specific antibodies have the potential to be broadly cross-reactive towards different HA subtypes. Here, we report the design of a bacterially expressed polypeptide that mimics a H5 HA stem by protein minimization to focus the antibody response towards the HA stem. The HA mini-stem folds as a trimer mimicking the HA prefusion conformation. It is resistant to thermal/chemical stress, and it binds to conformation-specific, HA stem-directed broadly neutralizing antibodies with high affinity. Mice vaccinated with the group 1 HA mini-stems are protected from morbidity and mortality against lethal challenge by both group 1 (H5 and H1) and group 2 (H3) influenza viruses, the first report of cross-group protection. Passive transfer of immune serum demonstrates the protection is mediated by stem-specific antibodies. Furthermore, antibodies indudced by these HA stems have broad HA reactivity, yet they do not have antibody-dependent enhancement activity. PMID:26947245

  8. Transport features of nano-hydroxylapatite (n-HA) embedded silicone rubber (SR) systems: influence of SR/n-HA interaction, degree of reinforcement and morphology.

    Science.gov (United States)

    M, Bindu; G, Unnikrishnan

    2017-09-27

    We report the transport characteristics of silicone rubber/nano-hydroxylapatite (SR/n-HA) systems at room temperature with reference to the effects of n-HA loading, morphology and penetrant nature, using toluene, xylene, ethyl acetate and butyl acetate in the liquid phase and methanol, ethanol, 1-propanol, 2-propanol and butanol in the vapour phase as probe molecules. The interaction between the n-HA particles and SR matrix has been confirmed by FTIR analysis. As the n-HA content in the SR matrix increased, the penetrant uptake has been found to decrease. The observations have been correlated with the density and void content of the systems. Scanning electron microscopy images have been found to be complementary to the observed transport features. The reinforcement effect of n-HA particles on the SR matrix has been verified by Kraus equation. Molecular mass between the cross links has been observed to decrease with an increase in n-HA loading. The results have been compared with affine, phantom network, parallel, series and Maxwell models. The transport data have been complemented by observations on biological fluid uptake with urea, d-glucose, KI, saline water, phosphate buffer and artificial urine as the media.

  9. Preparation and characterization of bio-composite PEEK/nHA

    Science.gov (United States)

    Jin, Y. S.; Bian, C. C.; Zhang, Z. Q.; Zhao, Y.; Yang, L.

    2017-01-01

    PEEK/nHA composite material, with excellent mechanical property as polyetheretherketone (PEEK) and biological activity as hydroxyapatite (HA), has attracted wide attention of medical experts and materials science experts. The addition of hydroxyapatite was the decisive factor for biological activity in PEEK/nHA composite. In this paper, acicular nanohydroxyapatite was prepared by chemical precipitation method with Ca(NO3)2, (NH4)2HPO4 as raw material; PEEK/nHA composite was prepared by solution blending and vacuum sintering method. The composite was characterized with FT-IR, XRD, DSC, TG and mechanical property test. Results showed that the composite has good thermal stability and compressive property when the mass ratio of PEEK to nHA is 10:3; and high nHA content can improve the biological activity of the composite, which can meet the basic requirements for bone tissue engineering scaffold.

  10. Optimization of the HA-1-specific T-cell receptor for gene therapy of hematologic malignancies

    Science.gov (United States)

    van Loenen, Marleen M.; de Boer, Renate; Hagedoorn, Renate S.; van Egmond, Esther H.M.; Falkenburg, J.H. Frederik; Heemskerk, Mirjam H.M.

    2011-01-01

    To broaden the applicability of adoptive T-cell therapy for the treatment of hematologic malignancies, we aim to start a clinical trial using HA-1-TCR transferred virus-specific T cells. TCRs directed against the minor histocompatibility antigen (MiHA) HA-1 are good candidates for TCR gene transfer to treat hematologic malignancies because of the hematopoiesis-restricted expression and favorable frequency of HA-1. For optimal anti-leukemic reactivity, high cell-surface expression of the introduced TCR is important. Previously, however, we have demonstrated that gene transferred HA-1-TCRs are poorly expressed at the cell-surface. In this study several strategies were explored to improve expression of transferred HA-1-TCRs. PMID:21109688

  11. Data of evolutionary structure change: 1C7HA-1W01B [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1C7HA-1W01B 1C7H 1W01 A B NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGL---KVR...EHGRIQTMQAYWSEVNLSV- NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFFRQGLGGGKVR

  12. Data of evolutionary structure change: 1C7HA-1W01A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1C7HA-1W01A 1C7H 1W01 A A NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGL---KVR...DEHGRIQTMQAYWSEVNLSV -LPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFFRQGLGGGKVR

  13. Data of evolutionary structure change: 1C7HA-1W6YA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1C7HA-1W6YA 1C7H 1W6Y A A NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGL--KVRA...EHGRIQTMQAYWSEVNLSV- NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGGKVRA

  14. Data of evolutionary structure change: 1C7HA-1W00A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1C7HA-1W00A 1C7H 1W00 A A NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGL-KVRAC...EHGRIQTMQAYWSEVNLSV- NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGKVRAC

  15. Data of evolutionary structure change: 1C7HA-1CQSB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1C7HA-1CQSB 1C7H 1CQS A B NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGL-KVRAC...DEHGRIQTMQAYWSEVNLSV NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLGKVRAC

  16. The duration of hyaluronidase and optimal timing of hyaluronic acid (HA) filler reinjection after hyaluronidase injection.

    Science.gov (United States)

    Kim, H J; Kwon, S B; Whang, K U; Lee, J S; Park, Y L; Lee, S Y

    2018-02-01

    Hyaluronidase injection is a commonly performed treatment for overcorrection or misplacement of hyaluronic acid (HA) filler. Many patients often wants the HA filler reinjection after the use of hyaluronidase, though the optimal timing of reinjection of HA filler still remains unknown. To provide the optimal time interval between hyaluronidase injections and HA filler reinjections. 6 Sprague-Dawley rats were injected with single monophasic HA filler. 1 week after injection, the injected sites were treated with hyaluronidase. Then, HA fillers were reinjected sequentially with differing time intervals from 30 minutes to 14 days. 1 hour after the reinjection of the last HA filler, all injection sites were excised for histologic evaluation. 3 hours after reinjection of HA filler, the appearance of filler material became evident again, retaining its shape and volume. 6 hours after reinjection, the filler materials restored almost its original volume and there were no significant differences from the positive control. Our data suggest that the hyaluronidase loses its effect in dermis and subcutaneous tissue within 3-6 hours after the injection and successful engraftment of reinjected HA filler can be accomplished 6 hours after the injection.

  17. Study on the genotoxicity of HA/ZrO{sub 2} composite particles in vitro

    Energy Technology Data Exchange (ETDEWEB)

    Quan, Renfu, E-mail: quanrenfu8@yahoo.com [Xiaoshan Traditional Chinese Medical Hospital, ZhengJiang Province 311200 (China); Tang, Yanghua; Huang, Zhongming; Xu, Jinwei [Xiaoshan Traditional Chinese Medical Hospital, ZhengJiang Province 311200 (China); Wu, Xiaochen [School of Materials Science and Engineering, Shanghai University, Shanghai (China); Yang, Disheng [Department of Orthopedics, the second Affiliated Hospital, Medical College of Zhejiang University, Hangzhou 310009 (China)

    2013-04-01

    To evaluate the genotoxicity of the HA/ZrO{sub 2} composite particles by using the micronucleus test (MNT) in vitro. HA/ZrO{sub 2} composite particles prepared by sintering at high temperature and pressure, that used powder of HA and ZrO{sub 2} of different proportions, were compared with pure HA particles and pure ZrO{sub 2} particles. The effect of the composite particles on cell proliferation of rabbit mesenchymal stem cells, and its the genotoxicity to rabbit mesenchymal stem cells were detected by MNT method. The MTT test showed that both pure HA particles and composite particles which contained HA promoted cell proliferation of rabbit mesenchymal stem cells, while pure ZrO{sub 2} particles did not, and there was a significant difference (P < 0.05). The MNT test showed no significant difference between the HA group and the negative control group (P > 0.05), but a significant difference between the HA group and the positive control group (P < 0.05). The difference between the ZrO{sub 2} group and the negative control group was significant (P < 0.01), while the difference between the ZrO{sub 2} group and the positive control group was insignificant (P > 0.05). The genotoxicity of the HA/ZrO{sub 2} composite particle increased with a higher proportion of ZrO{sub 2} and an increase in the concentration of the composite, and the 30 wt.% HA/70% ZrO{sub 2} composite with 200 μg/mL concentration showed significant genotoxicity (P < 0.01). - Highlights: ► HA/ZrO{sub 2} composite particles were prepared by sintering used powder of HA and ZrO{sub 2} of different proportions. ► Evaluate the genotoxicity of the HA/ZrO{sub 2} composite particle in vitro micronucleus test (MNT). ► The genotoxicity of the HA/ZrO{sub 2} composite particle increased with an increase in the proportion of ZrO{sub 2}. ► The 30%wtHA/70% ZrO{sub 2} composite with 200 μg/mL concentration showed significant genotoxicity.

  18. Printsess ja pühak : Püha Elisabeth Tallinna altaritel / Kaie Hiiesalu

    Index Scriptorium Estoniae

    Hiiesalu, Kaie

    2006-01-01

    Artikkel keskendub naispühakule Tüüringi Pühale Elisabethile (1207-1231). Vaatluse all on Püha Elisabethi kujutised - nikerdatud ja maalitud üksikfiguurid ning maalitud stseenid. Pikemalt peatutakse Püha Vaimu kiriku peaaltaril, kus Elisabethi on kujutatud altari kõigis kolmes asendis

  19. A Modified Delphi Study to Define "Ah Ha" Moments in Education Settings

    Science.gov (United States)

    Pilcher, Jobeth

    2015-01-01

    Ah ha moments are often mentioned in education literature. These moments are suggested to be a powerful aspect of learning, yet limited research is present regarding this topic. Ah ha learning moments have also not been defined in the education literature, resulting in the likelihood that each educator and learner may have differing definitions.…

  20. The Mechanical Properties and Modeling of Creep Behavior of UHMWPE/Nano-HA Composites

    Science.gov (United States)

    Li, Fan; Gao, Lilan; Gao, Hong; Cui, Yun

    2017-09-01

    Composites with different levels of hydroxyapatite (HA) content and ultra-high molecular weight polyethylene (UHMWPE) were prepared in this work. Mechanical properties of the composites were examined here, and to evaluate the effect of HA particles on the time-dependent behavior of the pure matrix, the creep and recovery performance of composites at various stress levels were also researched. As expected, the addition of HA influenced the time-dependent response of the UHMWPE and the effect had a strong dependence on the HA content. The creep and recovery strain of the composites significantly decreased with increasing HA content, and tensile properties were also impaired, which was due to the concentration of HA fillers. The mechanism and effect of HA dispersed into the UHMWPE matrix were examined by scanning electron microscopy. Additionally, since variations in the adjusted parameters revealed the impact of HA on the creep behavior of the UHMWPE matrix, Findley's model was employed. The results indicated that the analytical model was accurate for the prediction of creep of the pure matrix and its composites.

  1. Registration of an oilseed sunflower germplasm HA-DM1 resistant to sunflower downy mildew

    Science.gov (United States)

    HA-DM1 (Reg. No.xxx, PI 674793) sunflower (Helianthus annuus L.) germplasm was developed and released cooperatively by the USDA-ARS, Sunflower and Plant Biology Research Unit and the North Dakota Agricultural Experiment Station in 2015. HA-DM1 is a BC2F4 derived oilseed maintainer line from the cros...

  2. A novel PHBV/HA microsphere releasing system loaded with alendronate

    Energy Technology Data Exchange (ETDEWEB)

    Huang Wei [School of Materials Science and Engineering, South China University of Technology, Guangzhou 510641 (China); Key Laboratory of Special Functional Materials, South China University of Technology, Ministry of Education, Guangzhou 510641 (China); Wang Yingjun, E-mail: imwangyj@scut.edu.cn [School of Materials Science and Engineering, South China University of Technology, Guangzhou 510641 (China); Key Laboratory of Special Functional Materials, South China University of Technology, Ministry of Education, Guangzhou 510641 (China); Ren Li; Du Chang; Shi Xuetao [School of Materials Science and Engineering, South China University of Technology, Guangzhou 510641 (China); Key Laboratory of Special Functional Materials, South China University of Technology, Ministry of Education, Guangzhou 510641 (China)

    2009-08-31

    Microspheres of poly({beta}-hydroxybutyrate-co-{beta}-hydroxyvalerate) (PHBV) incorporated with hydroxyapatite (HA) and loaded with alendronate (AL), an osteoporosis preventing drugs, were prepared by single emulsion technique. Several methods were used to evaluate this novel drug carrier microsphere system (referred as PHBV/HA-AL). Fourier transform infrared (FTIR) was used to evaluate the enwrapping of HA and the X-ray diffraction (XRD) analysis further confirmed the success. The morphology of PHBV/HA-AL microspheres was observed by scanning electron microscope (SEM), showing rough surface with HA particles enwrapped in the PHBV matrix. The in vitro drug releasing profile of PHBV/HA-AL system was investigated in a 26-day period. There is a sustained releasing pattern after a slight burst release during the first few days. Additionally, rabbit mesenchymal stem cells (MSCs) were used to evaluate the cytotoxicity of the PHBV/HA-AL composites. This controlled release system can well support the proliferation of MSCs. The novel PHBV/HA-AL controlled release system is promising for bone repair therapy.

  3. Production of polyhydroxybutyrate and hydroxyapatite (PHB/HA composites for use as biomaterial

    Directory of Open Access Journals (Sweden)

    G. A. dos Santos

    Full Text Available Abstract The composite materials using polyhydroxybutyrate as matrix and hydroxyapatite as reinforcement (PHB/HA were produced by molding, using pressing at 100 MPa and 165 °C for 30 min. The amount of filler was varied from 0 to 20 wt% to evaluate the effect of the HA particles on mechanical properties and the bioactivity of the composites. The increase of the HA amount reduced the compressive strength of the composites nearly 20% while bending strength reduced nearly 30%. However, the bioactivity after 14 days immersion in SBF was improved with the increase of HA amount, with formation of apatite layer on the surface of the PHB/HA composite.

  4. The fabrication and characterization of biodegradable HA/PHBV nanoparticle-polymer composite scaffolds.

    Science.gov (United States)

    Jack, Kevin S; Velayudhan, Shiny; Luckman, Paul; Trau, Matt; Grøndahl, Lisbeth; Cooper-White, Justin

    2009-09-01

    This study reports the fabrication and characterization of nano-sized hydroxyapatite (HA)/poly(hydroxyabutyrate-co-hydroxyvalerate) (PHBV) polymer composite scaffolds with high porosity and controlled pore architectures. These scaffolds were prepared using a modified thermally induced phase-separation technique. This investigation focuses on the effect of fabrication conditions on the overall pore architecture of the scaffolds and the dispersion of HA nanocrystals within the composite scaffolds. The morphologies, mechanical properties and in vitro bioactivity of the composite scaffolds were investigated. It was noted that the pore architectures could be manipulated by varying phase-separation parameters. The HA particles were dispersed in the pore walls of the scaffolds and were well bonded to the polymer. The introduction of HA greatly increased the stiffness and strength, and improved the in vitro bioactivity of the scaffolds. The results suggest these newly developed nano-HA/PHBV composite scaffolds may serve as an effective three-dimensional substrate in bone tissue engineering.

  5. Laser Annealing for Gas-Dynamical Spraying of HA Coating upon a Titanium Surface

    Directory of Open Access Journals (Sweden)

    Victor Saphronov

    2015-10-01

    Full Text Available Laser post-heating computer controlled detonation spraying (CCDS and cold spray (CS hybrid processes were proposed for fabrication of near sub micron structure coatings of hydroxyapatite (HA + Ti system. Optical and SEM with energy dispersive X-ray analysis and comparative XRD phase analysis were used to evaluate microstructure. After those hybrid processes, no substantial variation in HA composition was noted by structural and phase examination. Nano-sized HA powders can be recommended for laser annealing CS (LaCS process. Regimes of laser treatment optimal for increasing the adhesion between the HA and titanium coatings, providing more strength, ductility and decreasing of HA destruction in the coatings were determined.

  6. Influence of manganese doping into HA powders on the properties of its dense bodies.

    Science.gov (United States)

    Natasha, A N; Sopyan, I; Mel, M; Ramesh, S

    2008-07-01

    The effect of Manganese (Mn) addition on the Vickers hardness and relative density of nanocrystalline hydroxyapatite (HA) dense bodies were studied. The starting Mn doped HA powders was synthesized via sol-gel method with Mn concentration varies from 2 mol% up to 15 mol% Mn. The Mn doped HA disc samples were prepared by uniaxial pressing at 200MPa and subsequently sintered at 1300 degrees C. Characterization was carried out where appropriate to determine the phases present, bulk density, Vickers hardness of the various content of Mn doped HA dense bodies. The addition of Mn was observed to influence the color appearance of the powders and dense bodies as well. Higher Mn concentration resulted in dark grey powders. It was also found that the hardness and relative density of the material increased as the Mn content increased and influenced by the crystallinity of the prepared Mn doped HA powders.

  7. The relationship between humic acid (HA) adsorption on and stabilizing multiwalled carbon nanotubes (MWNTs) in water: effects of HA, MWNT and solution properties.

    Science.gov (United States)

    Lin, Daohui; Li, Tingting; Yang, Kun; Wu, Fengchang

    2012-11-30

    This study was aimed to explore the relationship between humic acid (HA, as a model NOM) adsorption on and stabilizing multiwalled carbon nanotubes (MWNTs) in water with a focus on the effects of HA, MWNT and solution properties. It was found that MWNT-surface area-normalized adsorption of HAs (Q(SA)) increased with increasing outer-diameter of the MWNTs and decreasing polarity of the HAs. However, at low pH values (ca. 1mmolL(-1) Ca(2+)), the HA adsorption decreased with decreasing polarity of the HAs. The MWNT stabilization increased with increasing Q(SA), but the increase leveled off when Q(SA) exceeded a threshold value markedly lower than the maximum Q(SA), especially for the MWNTs with relative large outer-diameters. On the whole, the Q(SA)-normalized MWNT stabilization, presenting the capability of the MWNT-adsorbed HAs for the MWNT stabilization, increased with increasing HA polarity and solution pH, but with decreasing Ca(2+) concentration. However, the stabilized MWNTs by the HAs with greater polarity could be more subject to destabilization by Ca(2+). The results of this study are believed to shed light on predictive understanding the interaction between MWNTs and NOM and the environmental behavior of MWNTs. Copyright © 2012 Elsevier B.V. All rights reserved.

  8. Development and characterization of poli composites (ether ether ketone)(PEEK)(Hydroxyapatite(HA); Desenvolvimento e caracterizacao de compositos poli (eter-eter-cetona)(PEEK)/Hidroxiapatita(HA)

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira, V.P.; Santos, F.S.F.; Sa, M.D. de; Fook, M.V.L., E-mail: valeriap.ferreira@hotmail.com [Universidade Federal de Campina Grande (UFCG), PB (Brazil). Centro de Ciencias e Tecnologia. Programa de Pos-Graduacao em Ciencia e Engenharia de Materiais

    2016-07-01

    The objective of this work was to develop PEEK / HA composites, combining the biological activity of the ceramic phase with the properties of the polymer phase, the materials used in this research were Poly (ether-ether-ketone) (PEEK) and Hydroxyapatite (HA) (50, 60, 70 and 80% m / v HA), this material was subjected to a load of two tons followed by a thermal treatment at 390 ° for a period of 30 minutes. Then they were characterized by FTIR, DRX and MO. In the physical-chemical characterization of FTIR and XRD, it was not possible to identify significant alterations. In the FTIR spectra of the composites, there is no formation of new identifiable chemical bonds. In the composites XRD diffractograms a profile similar to the ceramic phase was observed, with peaks increasing in intensity and narrowing proportional to the increase of the hydroxyapatite concentration in the composites. In optical microscopy it is possible to observe surfaces with heterogeneous morphology, with signs of roughness and in the cross section we observe a heterogeneous aspect, rich in regions with large agglomerates and lighter particles. Considering the processing aspects, the technique proved to be effective for the development of PEEK /HA composites. (author)

  9. Feasibility of using Littoral Combat Ship (LCS) for Humanitarian Assistance / Disaster Relief (HA/DR) operations

    OpenAIRE

    Ng, Fuquan

    2012-01-01

    This thesis addresses the feasibility of using Littoral Combat Ship (LCS) in conducting Humanitarian Assistance / Disaster Relief (HA/DR) operations and analyzes the suite of LCS mission packages in conducting HA/DR operations through a Systems Engineering study. The current preference for HA/DR operations is on using big decks, e.g., Amphibious Ship and Aircraft Carriers to maximize the lift capability of supplies, such as medical supplies, food, and water. The trade-off of using big decks i...

  10. Alternating current electrophoretic deposition of HA and hBN nanoparticles on Ti substrate

    OpenAIRE

    Geçgin, Merve; AY, Nuran; Göncü, Yapıncak

    2017-01-01

    Hydroxyapatite (HA) and hexagonal boron nitride(hBN) are biocompatible materials. In this study, nano HA and nano hBN were usedfor coatings of titanium (Ti) substrate. The nanoparticles were deposited on Ti substrates by alternating current electrophoretic deposition (AC-EPD). Suspensions were consist of nano HA and also comprised of the various amount of nano hBN (0.0-2.0-5.0-10.0 and 25.0 wt. % by the percentage of hydroxyapatite). The coated samples were heat treated at 800C in Aratmospher...

  11. Data of evolutionary structure change: 1YDVA-2V2HA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1YDVA-2V2HA 1YDV 2V2H A A --RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDV...------ADALASLKDFGVNWIVLGHSERRWYYGETNEIVADKVAAAVASGFMVIACIGETLQERESGRTAVVVLTQIAAIAKKLKKADWAKVVIAYEPVWAIGTGKVLTPQQAQEAHALIRSWVSSKIGADVA...nfEVID> 0 1YDV A 1YDVA A 1YDVA VDLID--NFDNV 1YDV A 1YDVA NLDFDPSKL

  12. Metallpitsid Tallinna Püha Johannese hospidali (Jaani seegi) kalmistu haualeidudes / Sari Marjut Rainne

    Index Scriptorium Estoniae

    Rainne, Sari Marjut

    2010-01-01

    Tallinna Püha Johannese hospidali (Jaani seegi) kalmistualal toimunud arheoloogilistelt kaevamistelt leitud metallpitsidest. Ülevaade põhiliselt 18. sajandist pärit peakatete külge kinnitatud pitside materjaliuuringu tulemustest ja konserveerimisest

  13. Neli + püha = kostüüm / Tambet Kaugema

    Index Scriptorium Estoniae

    Kaugema, Tambet

    1998-01-01

    Tallinnas Niguliste muuseum-kontserdisaalis kostüümidraama 'Neli + püha', mille korraldasid Jaanus Orgusaar, Ene Liis Semper, Aldo Järvsoo ja Tanel Veenre. Etendus toimus 'Barclay Atmosphere Art Is Everywhere' sarjas

  14. Single-dose monomeric HA subunit vaccine generates full protection from influenza challenge

    CSIR Research Space (South Africa)

    Mallajosyula, JK

    2014-03-01

    Full Text Available Recombinant subunit vaccines are an efficient strategy to meet the demands of a possible influenza pandemic, because of rapid and scalable production. However, vaccines made from recombinant hemagglutinin (HA) subunit protein are often of low...

  15. Immuniseerimiskava muudatus toob läkaköha revaktsineerimise noorukitele / Eli Lilles ; kommenteerinud Marje Oona

    Index Scriptorium Estoniae

    Lilles, Eli

    2011-01-01

    Vestlusest sotsiaalministeeriumi rahvatervise osakonna nõuniku Martin Kadaiga uuest immuniseerimiskavast, mille alusel on võimalik hakata kasutama noorukitele ja täiskasvanutele sobivat difteeria-teetanuse-läkaköha liitvaktsiini

  16. Evaluation of nanohydroxyapaptite (nano-HA) coated epigallocatechin-3-gallate (EGCG) cross-linked collagen membranes.

    Science.gov (United States)

    Chu, Chenyu; Deng, Jia; Man, Yi; Qu, Yili

    2017-09-01

    Collagen is the main component of extracellular matrix (ECM) with desirable biological activities and low antigenicity. Collagen materials have been widely utilized in guided bone regeneration (GBR) surgery due to its abilities to maintain space for hard tissue growth. However, pure collagen lacks optimal mechanical properties. In our previous study, epigallocatechin-3-gallate (EGCG) cross-linked collagen membranes, with better biological activities and enhanced mechanical properties, may promote osteoblast proliferation, but their effect on osteoblast differentiation is not very significant. Nanohydroxyapatite (nano-HA) is the main component of mineral bone, which possesses exceptional bioactivity properties including good biocompatibility, high osteoconductivity and osteoinductivity, non-immunogenicity and non-inflammatory behavior. Herein, by analyzing the physical and chemical properties as well as the effects on promoting bone regeneration, we have attempted to present a novel EGCG-modified collagen membrane with nano-HA coating, and have found evidence that the novel collagen membrane may promote bone regeneration with a better surface morphology, without destroying collagen backbone. To evaluate the surface morphologies, chemical and mechanical properties of pure collagen membranes, epigallocatechin-3-gallate (EGCG) cross-linked collagen membranes, nano-HA coated collagen membranes, nano-HA coated EGCG-collagen membranes, (ii) to evaluate the bone regeneration promoted by theses membranes. In the present study, collagen membranes were divided into 4 groups: (1) untreated collagen membranes (2) EGCG cross-linked collagen membranes (3) nano-HA modified collagen membranes (4) nano-HA modified EGCG-collagen membranes. Scanning electron microscope (SEM) and Fourier transform infrared spectroscopy (FTIR) were used to evaluate surface morphologies and chemical properties, respectively. Mechanical properties were determined by differential scanning calorimeter (DSC

  17. Does PEEK/HA Enhance Bone Formation Compared With PEEK in a Sheep Cervical Fusion Model?

    Science.gov (United States)

    Walsh, William R; Pelletier, Matthew H; Bertollo, Nicky; Christou, Chris; Tan, Chris

    2016-11-01

    Polyetheretherketone (PEEK) has a wide range of clinical applications but does not directly bond to bone. Bulk incorporation of osteoconductive materials including hydroxyapatite (HA) into the PEEK matrix is a potential solution to address the formation of a fibrous tissue layer between PEEK and bone and has not been tested. Using in vivo ovine animal models, we asked: (1) Does PEEK-HA improve cortical and cancellous bone ongrowth compared with PEEK? (2) Does PEEK-HA improve bone ongrowth and fusion outcome in a more challenging functional ovine cervical fusion model? The in vivo responses of PEEK-HA Enhanced and PEEK-OPTIMA(®) Natural were evaluated for bone ongrowth in the form of dowels implanted in the cancellous and cortical bone of adult sheep and examined at 4 and 12 weeks as well as interbody cervical fusion at 6, 12, and 26 weeks. The bone-implant interface was evaluated with radiographic and histologic endpoints for a qualitative assessment of direct bone contact of an intervening fibrous tissue later. Gamma-irradiated cortical allograft cages were evaluated as well. Incorporating HA into the PEEK matrix resulted in more direct bone apposition as opposed to the fibrous tissue interface with PEEK alone in the bone ongrowth as well as interbody cervical fusions. No adverse reactions were found at the implant-bone interface for either material. Radiography and histology revealed resorption and fracture of the allograft devices in vivo. Incorporating HA into PEEK provides a more favorable environment than PEEK alone for bone ongrowth. Cervical fusion was improved with PEEK-HA compared with PEEK alone as well as allograft bone interbody devices. Improving the bone-implant interface with a PEEK device by incorporating HA may improve interbody fusion results and requires further clinical studies.

  18. Endiguer la vague de criminalité en Haïti | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    17 avr. 2012 ... Pourtant, ce n'est qu'en se dotant d'un service de police national hautement qualifié qu'Haïti réussira à endiguer cette récente vague de criminalité. Le gouvernement haïtien doit absolument améliorer son processus de sélection et de recrutement et prendre les mesures nécessaires pour que le travail des ...

  19. Magneto-optical and catalytic properties of Fe3O4@HA@Ag magnetic nanocomposite

    Science.gov (United States)

    Amir, Md.; Güner, S.; Yıldız, A.; Baykal, A.

    2017-01-01

    Fe3O4@HA@Ag magnetic nanocomposites (MNCs) were successfully synthesized by the simple reflux method for the removal of azo dyes from the industrial aqueous media. Fe3O4@HA@AgMNCs exhibited high catalytic activity to reduce MB within 20 min from the waste water. The obtained materials were characterized by the means of different techniques. Powder X-ray diffraction (XRD) analysis confirmed the single-phase of Fe3O4 spinel structure. SEM and TEM analysis indicated that Fe3O4@HA@AgMNCs were nanoparticles like structure with small agglomeration. TG result showed that the products contained 9% of HA. The characteristic peaks of HA at 1601 cm-1 and 1703 cm-1 was observed by the means of FT-IR spectra of Fe3O4@HA@AgMNCs. The hysteresis (σ-H) curves revealed Fe3O4@HA@Ag MNCs exhibit a typical superparamagnetic characteristic with a saturation magnetization of 59.11 emu/g and measured magnetic moment is 2.45 μB. The average magnetic particle dimension (Dmag) is 13.25 nm. In accordance, the average crystallite and particle dimensions were obtained as 11.50 nm and 13.10 nm from XRD and TEM measurements, respectively. Magnetocrystalline anisotropy was offered as uniaxial and calculated effective anisotropy constant (Keff) is 2.96×105 Erg/g. The blocking temperature was estimated as 522 K. The size-dependent saturation magnetization suggests the existence of a magnetically dead layer as 0.793 nm for Fe3O4@HA@Ag MNCs. The UV-vis diffuse reflectance spectroscopy (DRS) and Kubelka-Munk theory were applied to determine the optical properties of powder samples. The direct optical energy band gap (Eg) values were estimated from Tauc plots between 1.62 eV and 2.12 eV.

  20. Polyethylene oxide (PEO)-hyaluronic acid (HA) nanofibers with kanamycin inhibits the growth of Listeria monocytogenes.

    Science.gov (United States)

    Ahire, J J; Robertson, D D; van Reenen, A J; Dicks, L M T

    2017-02-01

    Listeria monocytogenes is well known to cause prosthetic joint infections in immunocompromised patients. In this study, polyethylene oxide (PEO) nanofibers, containing kanamycin and hyaluronic acid (HA), were prepared by electrospinning at a constant electric field of 10kV. PEO nanofibers spun with 0.2% (w/v) HA and 1% (w/v) kanamycin had a smooth, bead-free structure at 30-35% relative humidity. The average diameter of the nanofibers was 83±20nm. Attenuated total reflectance (ATR)-Fourier transform infrared (FTIR) spectroscopy indicated that kanamycin was successfully incorporated into PEO/HA matrix. The presence of kanamycin affects the thermal properties of PEO/HA nanofibers, as shown by differential scanning calorimetry (DSC) and thermogravimetric analyses (TGA). The kanamycin-PEO-HA nanofibers (1mg; 47±3μg kanamycin) inhibited the growth of L. monocytogenes EDGe by 62%, as compared with PEO-HA nanofibers, suggesting that it may be used to coat prosthetic implants to prevent secondary infections. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  1. A Study of Hybrid Composite Hydroxyapatite (HA-Geopolymers as a Material for Biomedical Application

    Directory of Open Access Journals (Sweden)

    Saleha

    2017-01-01

    Full Text Available The main purpose of this research is to study the physical properties and microstructure characters of hybrid composites HA-geopolymers as a material for biomedical application. Hybrid composite HA–geopolymers were produced through alkaline activation method of metakaolin as a matrix and HA as the filler. HA was synthesized from eggshell particles by using a precipitation method. The addition of HA in metakaolin paste was varied from 0.5%, 1.0%, 1.5%, and 2.0% relative the weight of metakaolin. FTIR was used to examine the absorption bands the composites. X-ray diffraction (XRD was used to study the crystal structure of the starting and the resulting materials. Scanning Electron Microscopy-Energy Dispersive Spectroscopy (SEM-EDS was used to investigate the surface morphology of the composites. The thermal properties of the samples was examined by means of Differential Scanning Calorimetry (DSC. Capacitance measurement was conducted to investigate the bioactive properties of HA. The study results suggest that hybrid composite HA-geopolymers has a potential to be applied as a biomedical such as biosensor material.

  2. Preparation and characterization of NiW-nHA composite catalyst for hydrocracking

    Science.gov (United States)

    Zhou, Gang; Hou, Yongzhao; Liu, Lei; Liu, Hongru; Liu, Can; Liu, Jing; Qiao, Huiting; Liu, Wenyong; Fan, Yubo; Shen, Shituan; Rong, Long

    2012-11-01

    The synthesis, characterization and catalytic capability of the NiW-nano-hydroxyapatite (NiW-nHA) composite were investigated in this paper. The NiW-nHA catalyst was prepared by a co-precipitation method. Then Fourier transform infrared (FT-IR) spectroscopy, transmission electron microscopy (TEM), X-ray diffraction (XRD) and energy dispersive spectroscopy (EDX) were used to analyze this material. In addition, the catalytic capacity of the NiW-nHA composite was also examined by FT-IR and gas chromatography (GC). The results of FT-IR analysis indicated that Ni, W and nHA combined closely. TEM observation revealed that this catalyst was needle shaped and the crystal retained a nanometer size. XRD data also suggested that a new phase of CaWO4 appeared and the lattice parameters of nHA changed in this system. nHA was the carrier of metals. The rates of Ni/W-loading were 73.24% and 65.99% according to the EDX data, respectively. Furthermore, the conversion of 91.88% Jatropha oil was achieved at 360 °C and 3 MPa h-1 over NiW-nHA catalyst. The straight chain alkanes ranging from C15 to C18 were the main components in the production. The yield of C15-C18 alkanes was up to 83.56 wt%. The reaction pathway involved hydrocracking of the C&z.dbd;C bonds of these triglycerides from Jatropha oil. This paper developed a novel non-sulfided catalyst to obtain a ``green biofuel'' from vegetable oil.

  3. Sintering behavior and property of bioglass modified HA-Al2O3 composite

    Directory of Open Access Journals (Sweden)

    Wang Li-li

    2012-01-01

    Full Text Available The bioglass modified HA-Al2O3 composites were successfully fabricated by mixing HA, synthesized by wet chemical method between precursor materials H3PO4 and Ca(OH2, with 25wt% Al2O3 and different content of bioglass (5%, 25%, 45%, 65wt% respectively, with a mole fraction of 53.9%SiO2, 22.6%Na2O, 21.8%CaO, and 1.7wt%P2O5, sintered in air at various temperatures (750-950°C for 2h. when the content of bioglass is below 45wt% in the composite, HA decomposes completely and transforms to β-TCP. The main phase in this case are β-TCP, Al2O3 and Ca3(AlO32.When the content of bioglass is above 45wt% in the composite, the decomposition of HA to β-TCP is suppressed and the main phases in this case are Al2O3 and HA, DCP□CaHPO4□ and β-TCP, which almost have the same chemical composition, forming ternary-glass phase, and have better bioactive than pure HA. It can also be found that at the certain addition of bioglass, the higher sintered temperature, the bigger volume density and flexural strength of the composite are, but when the sintered temperature reaches 950°C, they decrease. This modified HA-Al2O3 composites by calcium silicate glass have a much lower sintering temperature and decrease the production cost much.

  4. Mechanical strength of [HA/Bioplastic/Sericin] composite part printed by bioprinter

    Energy Technology Data Exchange (ETDEWEB)

    Tontowi, Alva Edy, E-mail: alvaedytontowi@ugm.ac.id; Setiawan, Agris [Department of Mechanical and Industrial Engineering Faculty of Engineering Universitas Gadjah Mada (Indonesia)

    2016-06-17

    The aim of this research was to determine the effect of hydroxyapatite (HA) content in printed biocomposite to its mechanical strength. The biocomposite paste was prepared by composing HA, bioplastic and sericin with various ratios of [HA/Bioplastic]: 40/60, 50/50, 60,40 and 70/30. Sericin of 0.3% weight was added to the biocomposite. Mechanical test was conducted to observe tensile (ASTM D 638 type 4) and flexural strength (ASTM D 790). Both type of specimens were fabricated using 3D Printer. Printing process parameter (infill speed, print speed and layer height) were set up as 60 mm/s, 10 mm/s, 0.35 mm, respectively. Results showed that biocomposite with [HA/Biplastic]. weight ratio of 60/40(w/w) has an optimum tensile (3.89 ± 1.26 MPa) and flexural strength (2.51 ± 0.45 MPa). Scanning electron microscope observation indicated that microstructure of specimen was influenced by the percentage of the hydroxyapatite. There was no agglomeration of HA particle within the composite.

  5. New Coll–HA/BT composite materials for hard tissue engineering

    Energy Technology Data Exchange (ETDEWEB)

    Zanfir, Andrei Vlad [Department of Science and Engineering of Oxide Materials and Nanomaterials, Faculty of Applied Chemistry and Material Science, “Politehnica” University of Bucharest, 1-7 Gh. Polizu Street, RO-011061 Bucharest (Romania); Voicu, Georgeta, E-mail: getav2001@yahoo.co.uk [Department of Science and Engineering of Oxide Materials and Nanomaterials, Faculty of Applied Chemistry and Material Science, “Politehnica” University of Bucharest, 1-7 Gh. Polizu Street, RO-011061 Bucharest (Romania); Busuioc, Cristina; Jinga, Sorin Ion [Department of Science and Engineering of Oxide Materials and Nanomaterials, Faculty of Applied Chemistry and Material Science, “Politehnica” University of Bucharest, 1-7 Gh. Polizu Street, RO-011061 Bucharest (Romania); Albu, Madalina Georgiana [Department of Collagen, Branch of Leather and Footwear Research, National Institute of Research and Development for Textile and Leather, 93 I. Minulescu Street, RO-031215 Bucharest (Romania); Iordache, Florin [Department of Fetal and Adult Stem Cell Therapy, “Nicolae Simionescu” Institute of Cellular Biology and Pathology of Romanian Academy, 8 B.P. Hasdeu Street, RO-050568 Bucharest (Romania)

    2016-05-01

    The integration of ceramic powders in composite materials for bone scaffolds can improve the osseointegration process. This work was aimed to the synthesis and characterization of new collagen–hydroxyapatite/barium titanate (Coll–HA/BT) composite materials starting from barium titanate (BT) nanopowder, hydroxyapatite (HA) nanopowder and collagen (Coll) gel. BT nanopowder was produced by combining two wet-chemical approaches, sol–gel and hydrothermal methods. The resulting materials were characterized in terms of phase composition and microstructure by X-ray diffraction, Raman spectroscopy, scanning electron microscopy and transmission electron microscopy. Moreover, the biocompatibility and bioactivity of the composite materials were assessed by in vitro tests. The synthesized BT particles exhibit an average size of around 35 nm and a spherical morphology, with a pseudo-cubic or tetragonal symmetry. The diffraction spectra of Coll–HA and Coll–HA/BT composite materials indicate a pronounced interaction between Col and the mineral phases, meaning a good mineralization of Col fibres. As well, the in vitro tests highlight excellent osteoinductive properties for all biological samples, especially for Coll–HA/BT composite materials, fact that can be attributed to the ferromagnetic properties of BT. - Highlights: • Collagen–hydroxyapatite/barium titanate composite materials were synthesized. • Barium titanate was produced by combining the sol–gel and hydrothermal methods. • The in vitro tests highlight excellent osteoinductive properties for all samples.

  6. New Coll-HA/BT composite materials for hard tissue engineering.

    Science.gov (United States)

    Zanfir, Andrei Vlad; Voicu, Georgeta; Busuioc, Cristina; Jinga, Sorin Ion; Albu, Madalina Georgiana; Iordache, Florin

    2016-05-01

    The integration of ceramic powders in composite materials for bone scaffolds can improve the osseointegration process. This work was aimed to the synthesis and characterization of new collagen-hydroxyapatite/barium titanate (Coll-HA/BT) composite materials starting from barium titanate (BT) nanopowder, hydroxyapatite (HA) nanopowder and collagen (Coll) gel. BT nanopowder was produced by combining two wet-chemical approaches, sol-gel and hydrothermal methods. The resulting materials were characterized in terms of phase composition and microstructure by X-ray diffraction, Raman spectroscopy, scanning electron microscopy and transmission electron microscopy. Moreover, the biocompatibility and bioactivity of the composite materials were assessed by in vitro tests. The synthesized BT particles exhibit an average size of around 35 nm and a spherical morphology, with a pseudo-cubic or tetragonal symmetry. The diffraction spectra of Coll-HA and Coll-HA/BT composite materials indicate a pronounced interaction between Col and the mineral phases, meaning a good mineralization of Col fibres. As well, the in vitro tests highlight excellent osteoinductive properties for all biological samples, especially for Coll-HA/BT composite materials, fact that can be attributed to the ferromagnetic properties of BT. Copyright © 2016 Elsevier B.V. All rights reserved.

  7. Trehalose improves cell proliferation and dehydration tolerance of human HaCaT cells

    Directory of Open Access Journals (Sweden)

    Lee Kyung Eun

    2015-01-01

    Full Text Available Trehalose is a disaccharide molecule that serves as a natural osmotic regulator in halophilic microorganisms and plants but not in mammals. We observed that human HaCaT cells supplied with trehalose improved cell proliferation and extended viability under dehydration. In HaCaT cells, in response to increasing concentrations of exogenous trehalose, the levels of heat shock protein (HSP 70 increased and matrix metalloproteinase (MMP 1 decreased. Proteome analysis of trehalose-treated HaCaT cells revealed remarkable increases in the levels of proteins involved in cell signaling and the cell cycle, including p21 activated kinase I, Sec I family domain protein and elongation factor G. Moreover, the proteins for cell stress resistance, tryptophan hydroxylase, serine/cysteine proteinase inhibitors and vitamin D receptors were also increased. In addition, the proteins responsible for the maintenance of the cytoskeleton and cellular structures including procollagen-lysine dioxygenase, vinculin and ezrin were increased. Proteomic data revealed that trehalose affected HaCaT cells by inducing the proteins involved in cell proliferation. These results suggest that trehalose improves the proliferation and dehydration tolerance of HaCaT cells by inducing proteins involved in cell growth and dehydration protection.

  8. HaVec: An Efficient de Bruijn Graph Construction Algorithm for Genome Assembly

    Directory of Open Access Journals (Sweden)

    Md Mahfuzer Rahman

    2017-01-01

    Full Text Available Background. The rapid advancement of sequencing technologies has made it possible to regularly produce millions of high-quality reads from the DNA samples in the sequencing laboratories. To this end, the de Bruijn graph is a popular data structure in the genome assembly literature for efficient representation and processing of data. Due to the number of nodes in a de Bruijn graph, the main barrier here is the memory and runtime. Therefore, this area has received significant attention in contemporary literature. Results. In this paper, we present an approach called HaVec that attempts to achieve a balance between the memory consumption and the running time. HaVec uses a hash table along with an auxiliary vector data structure to store the de Bruijn graph thereby improving the total memory usage and the running time. A critical and noteworthy feature of HaVec is that it exhibits no false positive error. Conclusions. In general, the graph construction procedure takes the major share of the time involved in an assembly process. HaVec can be seen as a significant advancement in this aspect. We anticipate that HaVec will be extremely useful in the de Bruijn graph-based genome assembly.

  9. Cytotoxicity and scanning electron microscopy study of gentamycin-coated HA effect on biofilm.

    Science.gov (United States)

    Au, L F; Othman, F; Mustaffa, R; Vidyadaran, S; Rahmat, A; Besar, I; Akim, A Md; Khan, M A K Goriman; Saidi, M; Shamsudin, M Nor; Froemming, G A; Ishak, A K

    2008-07-01

    Biofilms are adherent, multi-layered colonies of bacteria that are typically more resistant to the host immune response and routine antibiotic therapy. HA biomaterial comprises of a single-phased hydroxyapatite scaffold with interconnected pore structure. The device is designed as osteoconductive space filler to be gently packed into bony voids or gaps following tooth extraction or any surgical procedure. Gentamycin-coated biomaterial (locally made hydroxyapatite) was evaluated to reduce or eradicate the biofilm on the implant materials. The results indicated that the HA coated with gentamycin was biocompatible to human osteoblast cell line and the biofilm has been reduced after being treated with different concentrations of gentamycin-coated hydroxyapatite (HA).

  10. Zanthoxylum bungeanum essential oil induces apoptosis of HaCaT human keratinocytes.

    Science.gov (United States)

    Li, Keyou; Zhou, Rui; Wang Jia, Wang; Li, Zhe; Li, Jiazhou; Zhang, Pengfei; Xiao, Tiancun

    2016-06-20

    Zanthoxylum bungeanum (ZB), a Chinese herb medicine, has been shown to possess a wide range of biological activities including anti-tumor, anti-inflammatory, and anti-microbial activity and has long been used to treat a variety of skin diseases including psoriasis. However, the underlying mechanism of action has not been systematically elucidated. to analyze the chemical composition of the hydro-distilled Zanthoxylum bungeanum essential oil (ZBEO), and to investigate its anti-proliferative activity on HaCaT cells as well as the underlying anti-psoriasis mechanisms. The chemical composition of ZBEO was analyzed with gas chromatography coupled to mass spectrometry (GC-MS). HaCaT cells was exposed to different dose of ZBEO added in medium prior to morphologic features analysis as well as cell cycle arrest examination with Flow cytometry. Western blot analysis was employed to estimate the expression level of proteins including caspase-8/9/3, PARP, Bax and Bcl-2. Thirty-nine compounds of the ZBEO were identified GC-MS. ZBEO-treated HaCaT cells showed typical apoptotic morphologic features by DAPI staining assay. The ZBEO significantly inhibited proliferation of HaCaT cells in a dose- and time-dependent manner and induced S phase arrest apoptosis in HaCaT cells. Furthermore, western blot analysis revealed that the ZBEO increased expression of cleaved caspase-8/9/3, PARP, and Bax, decreased Bcl-2 levels. ZBEO inhibits the proliferation of HaCaT cells, resulting from the induction of cellular apoptosis through both intrinsic and extrinsic pathways. ZBEO is a potential candidate that may be considered for development into an anti-psoriasis drug. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  11. Re-establishment of the IMS Hydroacoustic Station HA04, Crozet Islands, France.

    Science.gov (United States)

    Haralabus, Georgios; Stanley, Jerry; Zampolli, Mario; Grenard, Patrick; Nielsen, Peter; Le Bras, Ronan; Brown, David; Bittner, Paulina; Wang, Haijun; Gore, Jane; Amir, Menachem; Bereza, Slava

    2017-04-01

    The incorporation of the hydroacoustic station HA04, Crozet Islands, France, into the International Monitoring System (IMS) of the Comprehensive Nuclear-Test-Ban Treaty Organisation (CTBTO) is a 17 year saga that had a happy ending on 29 December 2016. On that day, following a major engineering and logistical undertaking, the station was successfully installed. While still in its initial testing phase, HA04 sends continuously quality data at the International Data Centre (IDC), pending official certification and promotion to mainstream operational status. Similarly to most other cabled hydroacoustic stations in the IMS, HA04 is comprised of two triplets of moored hydrophones deployed on both sides of Possession Island (Crozet Islands) sending uninterrupted data to a shore facility via submarine fiber optic cables. The designed frequency pass-band is 1 - 100 Hz. Data are relayed to Vienna via a shore based satellite link in real time. According to CTBTO's standard requirements, the design life of HA04 is at least 20 years, maintenance-free for the underwater system. An outline of the main phases of this project, highlights from the installation operations and examples of received hydroacoustic signals associated with recent underwater seismic activity in the Indian Ocean as well as vocalizations from marine mammals acquired by the new HA04 are presented here. HA04 is scheduled to be fully integrated into the operational platform of IDC in the next six months, which will enable registered researchers to access archived monitoring data and processing software, or via the National Data Centres (NDCs).

  12. Induction of SiHa cells apoptosis by nanometer realgar suspension and its mechanism.

    Science.gov (United States)

    Liu, Rong; Pu, Demin; Liu, Yan; Cheng, Yanxiang; Yin, Ling; Li, Tian; Zhao, Libo

    2008-06-01

    The effects of nanometer realgar suspension on proliferation and apoptosis of human uterine cervix cancer cell line SiHa cells and oncogenic genes HPV16E6/E7 were investigated. A "micro-jet efflux" strategy was used for the preparation of nanometer realgar suspension. SiHa cells were treated with nanometer Realgar suspension in various concentrations (6.25, 12.5, 25 and 50 mg/L) for different durations (12, 24, 48 and 72 h). The inhibitive effect of nanometer realgar suspension on growth of SiHa cells was detected by MTT method. Special morphological changes of apoptosis were observed by transmission electron microscopy (TEM) and DNA fragments electrophoresis. The apoptotic rate was quantified by flow cytometry (FCM). The expression of HPV16E6/E7 mRNA and protein was assayed by RT-PCR and Western blot respectively. The results showed after being treated with 25 50 mg/L nanometer realgar suspension for 48 h, the survival rate of SiHa cells was decreased, and apoptotic rate markedly increased in a time-and concentration-dependent manner. TEM and DNA electrophoresis revealed the special morphological changes of apoptosis. The apoptotic rate of SiHa cells treated with nanometer realgar suspension was significantly higher than in the control group (Prealgar suspension in 25 and 50 mg/L for 48 h. RT-PCR and Western blot assay indicated that nanometer realgar suspension reduced the HPV16E6/E7 gene expression. Nanometer realgar suspension could inhibit the proliferation and induce apoptosis of SiHa cells. The mechanism may be related to the down-regulation of the HPV16E6/E7 gene expression.

  13. Precision Extruding Deposition for Freeform Fabrication of PCL and PCL-HA Tissue Scaffolds

    Science.gov (United States)

    Shor, L.; Yildirim, E. D.; Güçeri, S.; Sun, W.

    Computer-aided tissue engineering approach was used to develop a novel Precision Extrusion Deposition (PED) process to directly fabricate Polycaprolactone (PCL) and composite PCL/Hydroxyapatite (PCL-HA) tissue scaffolds. The process optimization was carried out to fabricate both PCL and PCL-HA (25% concentration by weight of HA) with a controlled pore size and internal pore structure of the 0°/90° pattern. Two groups of scaffolds having 60 and 70% porosity and with pore sizes of 450 and 750 microns, respectively, were evaluated for their morphology and compressive properties using Scanning Electron Microscopy (SEM) and mechanical testing. The surface modification with plasma was conducted on PCL scaffold to increase the cellular attachment and proliferation. Our results suggested that inclusion of HA significantly increased the compressive modulus from 59 to 84 MPa for 60% porous scaffolds and from 30 to 76 MPa for 70% porous scaffolds. In vitro cell-scaffolds interaction study was carried out using primary fetal bovine osteoblasts to assess the feasibility of scaffolds for bone tissue engineering application. In addition, the results in surface hydrophilicity and roughness show that plasma surface modification can increase the hydrophilicity while introducing the nano-scale surface roughness on PCL surface. The cell proliferation and differentiation were calculated by Alamar Blue assay and by determining alkaline phosphatase activity. The osteoblasts were able to migrate and proliferate over the cultured time for both PCL as well as PCL-HA scaffolds. Our study demonstrated the viability of the PED process to the fabricate PCL and PCL-HA composite scaffolds having necessary mechanical property, structural integrity, controlled pore size and pore interconnectivity desired for bone tissue engineering.

  14. Strong Normalization for HA + EM1 by Non-Deterministic Choice

    Directory of Open Access Journals (Sweden)

    Federico Aschieri

    2013-09-01

    Full Text Available We study the strong normalization of a new Curry-Howard correspondence for HA + EM1, constructive Heyting Arithmetic with the excluded middle on Sigma01-formulas. The proof-term language of HA + EM1 consists in the lambda calculus plus an operator ||_a which represents, from the viewpoint of programming, an exception operator with a delimited scope, and from the viewpoint of logic, a restricted version of the excluded middle. We give a strong normalization proof for the system based on a technique of "non-deterministic immersion".

  15. IMPACT OF DYNAMICAL HYDRATION SHELL AROUND HA PROTEIN ON NONLINEAR CONCENTRATION DEPENDENT T-RAYS ABSORPTION

    Directory of Open Access Journals (Sweden)

    YIWEN SUN

    2013-10-01

    Full Text Available T-rays is sensitive to covalently cross-linked proteins and can be used to probe unique dynamic properties of water surrounding a protein. In this paper, we demonstrate the unique absorption properties of the dynamic hydration shells determined by hemagglutinin (HA protein in terahertz frequency. We study the changes arising from different concentrations in detail and show that nonlinear absorption coefficient is induced by the dynamic hydration water. The binary and ternary component model were used to interpret the nonlinearity absorption behaviors and predict the thickness of the hydration shells around the HA protein in aqueous phase.

  16. Consolidation de centres de recherche sur la reconstruction en Haïti ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Haïti doit encore relever des défis de taille en ce qui a trait à l'édification de l'État et à la démocratisation. Un groupe de pays latino-américains assume un rôle de premier plan au sein des forces de maintien de la paix coordonnées par la Mission des Nations Unies pour la stabilisation en Haïti (MINUSTAH). L'efficacité de ...

  17. Tensile properties of HA 230 and HA 188 after 400 and 2500 hour exposures to LiF-22CaF2 and vacuum at 1093 K

    Science.gov (United States)

    Whittenberger, J. Daniel

    1990-01-01

    The solid-to-liquid phase transformation of the nominal LiF-20CaF2 eutectic at 1043 K is considered to be an ideal candidate thermal energy storage mechanism for a space based low temperature Brayton cycle solar dynamic system. Although Co, Fe, and Ni superalloys are thought to be suitable containment materials for LiF based salts, long term containment is of concern because molten fluorides are usually corrosive and Cr can be lost into space through evaporation. Two examples of commercially available superalloys in sheet form, the Ni-base material HA 230 and the Co-base material Ha 88, have been exposed to molten LiF-22CaF2, its vapor, and vacuum, at 1093 K, for 400 and 2500 hr. Triplicate tensile testing of specimens subjected to all three environments have been undertaken between 77 to 1200 K. Comparison of the weight gain data, microstructure, and tensile properties indicate that little, if any, difference in behavior can be ascribed to the exposure environment.

  18. A homogenous CS/NaCMC/n-HA polyelectrolyte complex membrane prepared by gradual electrostatic assembling.

    Science.gov (United States)

    Jiang, Hong; Zuo, Yi; Cheng, Lin; Wang, Hongli; Gu, Aiqun; Li, Yubao

    2011-02-01

    A homogenous membrane composed of chitosan (CS), sodium carboxymethyl cellulose (NaCMC) and nano hydroxyapatite (n-HA) was prepared by a gradual electrostatic assembling (GEA) method. The physical and chemical properties of the membranes with different n-HA contents and CS/NaCMC ratios were characterized by Scanning electron microscopy, Fourier transform infrared spectroscopy, X-ray diffraction and mechanical test. The schematic formation mechanism of the membrane was discussed. The results show that GEA is an effective method to prepare the polyelectrolyte complex (PEC) membrane, in which oppositely charged CS-NaCMC polysaccharides can assemble mildly and gradually through electrostatic interaction to form the membrane framework, while the filled n-HA crystals can regulate the structure stability of the composite membrane. The optimum preparation condition for the PEC membrane can be fixed to a content of 60 wt% n-HA, an equivalent amount of CS to NaCMC and a drying temperature of 60°C. The PEC membrane may have good prospect for guided bone regeneration.

  19. β-TCP/HA with or without enamel matrix proteins for maxillary sinus floor augmentation

    DEFF Research Database (Denmark)

    Nery, James Carlos; Pereira, Luís Antônio Violin Dias; Guimarães, George Furtado

    2017-01-01

    BACKGROUND: It is still unclear whether enamel matrix proteins (EMD) as adjunct to bone grafting enhance bone healing. This study compared histomorphometrically maxillary sinus floor augmentation (MSFA) with β-TCP/HA in combination with or without EMD in humans. METHODS: In ten systemically healt...

  20. Gaming Sea-based Multinational HA/DR Operations at PACOM Amphibious Leaders Symposium 2016

    Science.gov (United States)

    2016-11-01

    communications among all involved parties and host-nation leadership of disaster relief operations. During future multinational HA/DR operations, PALS...Humanitarian Response Coordination Center (HRCC) in Changi, Singapore, would be one way to do this. Another option would be to incorporate the lessons ...26  Malaysia

  1. HaPI-the health and psychosocial instruments database available from Ovid.

    Science.gov (United States)

    Tomasulo, Patricia

    2006-01-01

    HaPI is the database of choice for locating information on all manner of measurement instruments, including questionnaires, interview schedules, rating scales, and much more. The database is easy to use, and offers unique fields to search, and a few choice limits.

  2. The performance of dental pulp stem cells on nanofibrous PCL/gelatin/nHA scaffolds.

    NARCIS (Netherlands)

    Yang, X.; Yang, F.; Walboomers, X.F.; Bian, Z.; Fan, M.; Jansen, J.A.

    2010-01-01

    The aim of current study is to investigate the in vitro and in vivo behavior of dental pulp stem cells (DPSCs) seeded on electrospun poly(epsilon-caprolactone) (PCL)/gelatin scaffolds with or without the addition of nano-hydroxyapatite (nHA). For the in vitro evaluation, DNA content, alkaline

  3. Euroveokid soosivad Venemaal käies üha enam Via Hanseaticat / Madis Aesma

    Index Scriptorium Estoniae

    Aesma, Madis

    2005-01-01

    Ajal. Postimees lüh. Pärast Balti riikide ühinemist Euroopa Liiduga kasutavad välismaa veoautojuhid üha enam Euroopast Venemaale sõitmiseks Valga-Tartu-Jõhvi-Narva maanteed, mis moodustab Via Hanseatica ehk Hansatee Eesti osa. Lisa: Via Hanseatica. Kaart: Visa Hanseatica

  4. Using accessibility indicators to investigate urban growth and motorcycles use in Ha Noi City, Vietnam

    NARCIS (Netherlands)

    Quang, N.N.; Quang, Ngoc Quang; Zuidgeest, M.H.P.; van den Bosch, F.H.M.; Sliuzas, R.V.; van Maarseveen, M.F.A.M.

    2013-01-01

    To investigate the impact of urban growth on motorcycles use in Ha Noi City, Vietnam, this paper maps and analysis three types of accessibility indicators. The results show that the levels of accessibility to jobs by public transport are very poor as compared to motorcycle and car, explaining the

  5. Abnormal MRI in a patient with 'headache with neurological deficits and CSF lymphocytosis (HaNDL)'.

    Science.gov (United States)

    Yilmaz, A; Kaleagasi, H; Dogu, O; Kara, E; Ozge, A

    2010-05-01

    A 27-year-old woman was admitted to the Emergency Department with right upper-extremity numbness and mild weakness followed by a bifrontal throbbing headache for 30 min, which was similar to a headache lasting for 12 h that had occurred 3 days ago. Laboratory tests were unremarkable except for cerebrospinal fluid (CSF) lymphocytic pleocytosis. On the following day, a headache episode with left hemiparesis and hemihypoaesthesia, left hemifield visio-spatial inattention, anosagnosia and confusion recurred. The headache was diagnosed as headache and neurological deficits with cerebrospinal fluid lymphocytosis (HaNDL) syndrome according to the criteria of the second edition of the International Classification of Headache Disorders. Simultaneously performed magnetic resonance imaging (MRI) revealed swelling of the grey matter, CSF enhancement in the sulci of the right temporal and occipital regions and hypoperfusion of the same brain regions. During the following 10 days two more similar episodes recurred and during the ensuing 12 months the patient remained headache free. Neuroimaging findings of the HaNDL syndrome are always thought as virtually normal. MRI abnormalities in our patient have not been reported in HaNDL syndrome previously, although they have been reported in hemiplegic migraine patients before. The findings in our case suggest that hemiplegic migraine and HaNDL syndrome may share a common pathophysiological pathway resulting in similar imaging findings and neurological symptoms.

  6. Sisekliima Tallinna Püha Vaimu kirikus / Targo Kalamees, Lennart Sasi

    Index Scriptorium Estoniae

    Kalamees, Targo, 1972-

    2007-01-01

    OÜ Rändmeister ja Tallinna Kultuuriväärtuste Ameti tellimusel Tallinna Tehnikaülikooli ehitusfüüsika ja arhitektuuri õppetooli poolt Tallinna Püha Vaimu kirikus ajavahemikul märts 2006 - november 2006 läbi viidud sisekliima uuringutest, mille alusel anti soovitused kirikus sisekliima renoveerimisprojekti koostamiseks

  7. International Outcome Inventory for Hearing Aids (IOI-HA): results from The Netherlands

    NARCIS (Netherlands)

    Kramer, Sophia E.; Goverts, S. Theo; Dreschler, Wouter A.; Boymans, Monique; Festen, Joost M.

    2002-01-01

    This paper presents data on the Dutch translation of the International Outcome Inventory for Hearing Aids (IOI-HA). The inventory was used as an additional postal tool in a nationwide study on the benefits of bilateral hearing aid fitting. Responses of 505 hearing aid users were analysed.

  8. Áreas metropolitanas:¿qué ha cambiado?: La experiencia de la Caracas Metropolitana

    Directory of Open Access Journals (Sweden)

    Sonia Barrios

    2001-05-01

    Full Text Available La nueva economía de la información y del conocimiento ha tenido tres decisivas implicaciones de orden territorial. Primero, ha acelerado el proceso de aglomeración urbana a escala planetaria. Segundo, ha provocado fuertes alteraciones en las redes urbanas de ámbito mundial, regional y nacional. Y tercero, ha impulsado la reestructuración interna de las áreas metropolitanas que se habían conformado durante la era industrial. Todo parece anticipar, por lo tanto, polarizaciones y fragmentaciones territoriales todavía más acentuadas que las conocidas en un pasado cercano. Tomando como referencia el caso de Caracas, se trata de averiguar en qué medida el desarrollo reciente de esta metrópoli sigue las grandes tendencias territoriales antes anotadas; y qué esfuerzos se están haciendo para ajustar sus instancias locales a las nuevas realidades urbanas. Como un recurso adicional, en distintos momentos se establecen comparaciones con Barcelona (España, considerada un ejemplo emblemático de las metrópolis de la era de la información

  9. Study of the gamma irradiation effects on the PMMA/HA and PMMA/SW

    Energy Technology Data Exchange (ETDEWEB)

    Silva, P., E-mail: silva@ivic.v [Instituto Venezolano de Investigaciones Cientificas, Centro de Fisica, Carretera Panamericana Km. 11, Caracas 1020-A (Venezuela, Bolivarian Republic of); Albano, C. [Universidad Central de Venezuela, Facultad de Ingenieria (Venezuela, Bolivarian Republic of); Instituto Venezolano de Investigaciones Cientificas, Centro de Quimica (Venezuela, Bolivarian Republic of); Perera, R. [Departamento de Mecanica, Universidad Simon Bolivar, Caracas 1080-A (Venezuela, Bolivarian Republic of); Dominguez, N. [Instituto Venezolano de Investigaciones Cientificas, Centro de Quimica (Venezuela, Bolivarian Republic of)

    2010-03-15

    The behavior of the poly(methyl methacrylate) (PMMA) under the action of gamma radiation has been sufficiently studied. In this work, we present results from melt flow index (MFI), thermogravimetric analysis (TGA), differential scanning calorimetry (DSC) and electron paramagnetic resonance (EPR) of PMMA composites with hydroxyapatite (HA) and seaweed residues (SW) irradiated with gamma rays at 1.08 kGy/h. Composites of PMMA/HA and PMMA/SW with 10%, 20% and 30% of the filler were prepared. The results show an increase in the MFI values with the integral dose of radiation, being consistent with chain-scission reactions. No EPR signal was observed in pure PMMA, while in the composites, the typical EPR signal of the PMMA radicals was observed, which increased with the amount of HA or SW. When comparing the relative intensities of the EPR signals for both types of composites, a slight increase in the concentration of free radicals generated in the sample with SW respect to that of PMMA/HA composite was obtained. A decay of the total free radical concentration was observed as time elapsed.

  10. Jom ha-Šo'a...počátky jednoho svátku

    Directory of Open Access Journals (Sweden)

    Zbyněk Tarant

    2011-12-01

    Full Text Available If one looks at the calendar, one will find there 'International Holocaust Rememberance Day' on 27th of January. This day was set by the UN General Assembly in 2005 and it refers to the anniversary of Auschwitz liberation. However, if one looks at the Israeli calendar, or any of the Jewish Luakh haShannah's, one will find there another day of mourning that is actually far older. The Yom HaShoah was set according to the Hebrew calendar and refers not to the liberation of Auschwitz, but to the Warsaw ghetto uprising. Today, this day of mourning is an interesting relict of the pioneer, upbuilding era that preferred the stories of heroes to those of victims. This article attempts to map the very beginning of the Yom HaShoah commemoration, by using Hebrew sources that were never published before in the Czech language. The story of Yom HaShoah in the context of the young state of Israel in the 1950s is an interesting case-study on the issue of how the contemporary political and public discourse affects the collective memory of  future generations.

  11. 24 CFR 964.135 - Resident involvement in HA management operations.

    Science.gov (United States)

    2010-04-01

    ... management operations. 964.135 Section 964.135 Housing and Urban Development Regulations Relating to Housing... Tenant Participation § 964.135 Resident involvement in HA management operations. Residents shall be... responsibility for management operations, it shall ensure strong resident participation in all issues and facets...

  12. 75 FR 55323 - Ha-Best, Inc.; Notice of Availability of Environmental Assessment

    Science.gov (United States)

    2010-09-10

    ... Energy Regulatory Commission Ha-Best, Inc.; Notice of Availability of Environmental Assessment August 31, 2010. In accordance with the National Environmental Policy Act of 1969 and the Federal Energy... lands. Staff prepared an environmental assessment (EA), which analyzes the potential environmental...

  13. Miks on tõde üha suhtelisem? / Marju Himma, Jaan-Juhan Oidermaa

    Index Scriptorium Estoniae

    Himma, Marju

    2016-01-01

    Arvamusfestivalil arutasid perearst ja TÜ peremeditsiini vanemteadur Marje Oona, jurist Maarja Pild ja teadusajakirjanik Arko Olesk teemal - miks teevad inimesed infoühiskonnas, kus tõenduspõhist teavet on üha rohkem ja vabamalt kätte saada, valikuid info kasuks, mis ei ole tõendatud

  14. Screening of the target genes trans-activated by HLA-HA8 in hepatocytes

    Directory of Open Access Journals (Sweden)

    Qi WANG

    2011-06-01

    Full Text Available Objective To clone and identify the target genes trans-activated by human minor histocompatibility antigen HLA-HA8 in hepatocytes with suppression subtractive hybridization(SSH and bioinfomatics technique.Methods mRNA was isolated from HepG2 cells transfected by pcDNA3.1(--HLA-HA8 and pcDNA3.1(- empty vector,and then used to synthesize the double-stranded cDNA(marked as Tester and Driver,respectively by reverse transcription.After being digested with restriction enzyme Rsa I,the tester cDNA was divided into two parts and ligated to the specific adaptor 1 and adaptor 2,respectively,and then hybridized with driver cDNA twice and underwent PCR twice.The production was subcloned into pEGM-Teasy plasmid vectors to set up the subtractive library.The library was then amplified by transfection into E.coli strain DH5α.The cDNA was sequenced and analyzed in GenBank with Blast search after PCR amplification.Results The subtractive library of genes trans-activated by HLA-HA8 was constructed successfully.The amplified library contained 101 positive clones.Colony PCR showed that all these clones contained 200-1000bp inserts.Twenty eight clones were selected randomly to analyze the sequences.The result of homologous analysis showed that altogether 16 coding sequences were gotten,of which 4 sequences were with unknown function.Conclusions The obtained sequences trans-activated by HLA-HA8 may code different proteins and play important roles in cell growth and metabolism,energy synthesis and metabolism,material transport and signal transduction.This finding will bring some new clues for the studies not only on the biological functions of HLA-HA8,but also on the HBV infection mechanism.

  15. ALP gene expression in cDNA samples from bone tissue engineering using a HA/TCP/Chitosan scaffold

    Science.gov (United States)

    Stephanie, N.; Katarina, H.; Amir, L. R.; Gunawan, H. A.

    2017-08-01

    This study examined the potential use of hydroxyapatite (HA)/tricalcium phosphate (TCP)/Chitosan as a bone tissue engineering scaffold. The potential for using HA/TCP/chitosan as a scaffold was analyzed by measuring expression of the ALP osteogenic gene in cDNA from bone biopsies from four Macaque nemestrina. Experimental conditions included control (untreated), treatment with HA/TCP 70:30, HA/TCP 50:50, and HA/TCP/chitosan. cDNA samples were measured quantitively with Real-Time PCR (qPCR) and semi-quantitively by gel electrophoresis. There were no significant differences in ALP gene expression between treatment subjects after two weeks, but the HA/TCP/chitosan treatment gave the highest level of expression after four weeks. The scaffold using the HA/TCP/chitosan combination induced a higher level of expression of the osteogenic gene ALP than did scaffold without chitosan.

  16. Elastin-like protein-hyaluronic acid (ELP-HA) hydrogels with decoupled mechanical and biochemical cues for cartilage regeneration.

    Science.gov (United States)

    Zhu, Danqing; Wang, Huiyuan; Trinh, Pavin; Heilshorn, Sarah C; Yang, Fan

    2017-05-01

    Hyaluronic acid (HA) is a major component of cartilage extracellular matrix and is an attractive material for use as 3D injectable matrices for cartilage regeneration. While previous studies have shown the promise of HA-based hydrogels to support cell-based cartilage formation, varying HA concentration generally led to simultaneous changes in both biochemical cues and stiffness. How cells respond to the change of biochemical content of HA remains largely unknown. Here we report an adaptable elastin-like protein-hyaluronic acid (ELP-HA) hydrogel platform using dynamic covalent chemistry, which allows variation of HA concentration without affecting matrix stiffness. ELP-HA hydrogels were created through dynamic hydrazone bonds via the reaction between hydrazine-modified ELP (ELP-HYD) and aldehyde-modified HA (HA-ALD). By tuning the stoichiometric ratio of aldehyde groups to hydrazine groups while maintaining ELP-HYD concentration constant, hydrogels with variable HA concentration (1.5%, 3%, or 5%) (w/v) were fabricated with comparable stiffness. To evaluate the effects of HA concentration on cell-based cartilage regeneration, chondrocytes were encapsulated within ELP-HA hydrogels with varying HA concentration. Increasing HA concentration led to a dose-dependent increase in cartilage-marker gene expression and enhanced sGAG deposition while minimizing undesirable fibrocartilage phenotype. The use of adaptable protein hydrogels formed via dynamic covalent chemistry may be broadly applicable as 3D scaffolds with decoupled niche properties to guide other desirable cell fates and tissue repair. Copyright © 2017 Elsevier Ltd. All rights reserved.

  17. ¿HEMOS TRAZADO EL CAMINO PARA BOLONIA?

    Directory of Open Access Journals (Sweden)

    Soledad Yelo Díaz

    2009-04-01

    Full Text Available The educational change, settled by the European Space of High Education for Spain in 2010, is based on the development of a competential work, a needed methodological change, a curricular and physical movement and, also, the conception of Education as a permanent process. It proposes teaching procedures that imply more dynamic, diverse and guided didactics. The latest legislative reformations for Primary and Secondary Education shows these aspects in a way which results will be the immediate future. Our secondary scholars are the reserve of students that will conclude the change that the Bologna Plan means. Will they be ready for it? A short debriefing about the key points of the University reformation that has begun are, as a reflection, the image to which the basic educational levels must respond.

  18. Iglesia de la Beata Vergine Inunacolata, en Bolonia (Italia

    Directory of Open Access Journals (Sweden)

    Gresleri, Glauco

    1965-10-01

    Full Text Available This church occupies a square of 35 m side, and there are two functional units, whose main axes are normal to each other: the church itself and a smaller chapel to hold the daily mass. Entry to the church can be made at various points, and this means that the faithful will converge towards the centre, and emphasize the spirit of unity and brotherhood of the building. A gallery round the top helps to increase the total capacity of the church, especially on important feast days. This church reflects a new concept of monumental architecture, of a highly expressive quality, and represents an outstanding design.En el interior de está iglesia, cuya planta adopta la forma de un cuadrado de 35 m de lado, podemos distinguir dos unidades funcionales dispuestas en ángulo recto: la nave central, y la capilla para la celebración de la misa diaria. El «ingreso» se puede realizar por diferentes accesos, lo que contribuye a conseguir la convergencia horizontal de los fieles, y la reunión «miembro a miembro» de la comunidad en la asamblea. Una galería superior permite disponer de un espacio de reserva, utilizado en las grandes solemnidades litúrgicas. Su nuevo concepto de monumentalidad y expresividad son las características más sobresalientes de esta obra.

  19. Mistisisme dalam Perspektif Filsafat Analitik: Antara Wittgenstein dan Mehdi Ha'iri Yazdi

    Directory of Open Access Journals (Sweden)

    M. Hidayatullah S.

    2007-12-01

    Full Text Available Language is a principal instrument for philosopher and as a medium for analysis and reflection. Wittgenstein said, that the order analytical philosophy is to clean away the epistemology from the "good" terms but unclear in it interpretation. Every thing that can be thinks must be able spoken. The limits of my language mean the limits of my world. From this perspective mysticism and mystics experience is nin-sense, because nothing factual reference. From this case, the goal of this study is to find out the epistemology in mysticism and mystic experience. In the study we include the knowledge by presence (ilm al-hudhuri Ha 'iri as an approach. Ha 'iri said that there is a other knowledge which that can be explanations in limits of language and picture theory. This is knowledge by peresence, which by Wittgenstein aware as some thing which having difference language games from knowledge by correspondece.

  20. CRYSTALLIZATION AND MECHANICAL PROPERTIES OF (45S5-HA BIOCOMPOSITE FOR BIOMEDICAL IMPLANTATION

    Directory of Open Access Journals (Sweden)

    Sunil Prasad

    2017-09-01

    Full Text Available Bioglass® (45S5 was prepared by conventional melting process and hydroxyapatite (HA was prepared by sol-gel method. The bioglass (45S5 and hydroxyapatite (Ca10(PO₄₆(OH₂ samples were mixed in a particular proportion to prepare composite by using hydraulic pressing. Based on thermogravimetric and differential thermal analysis, the composite were sintered with a suitable heat treatment process at 1000-1050 °C. The in-vitro bioactivity of samples was determined in simulated body fluid for 1, 3, 7, 14 and 21 days. The bioactivity was examined in vitro with respect to the ability of hydroxyapatite layer formation on the surface of samples when they were immersed in simulated body fluid (SBF. DTA/TGA, XRD, SEM and mechanical studies were conducted for different characteristic measurement of biocomposites. The result shows the enhancement in bioactivity and mechanical properties of (45S5-HA biocomposites for clinical implantation.

  1. SeeHaBITaT: A server on bioinformatics applications for Tospoviruses and other species

    Directory of Open Access Journals (Sweden)

    Seethalakshmi Sakthivel

    2016-06-01

    Full Text Available Plant viruses are important limiting factors in agricultural productivity. Tospovirus is one of the severe plant pathogens, causing damage to economically important food and ornamental crops worldwide through thrips as vectors. Database application resources exclusively on this virus would help to design better control measures, which aren't available. SeeHaBITaT is a unique and exclusive web based server providing work bench to perform computational research on tospoviruses and its species. SeeHaBITaT hosts Tospoviruses specific database Togribase, MOLBIT, SRMBIT and SS with PDB. These applications would be of immense help to the Tospovirus scientific community. The server could be accessed at http://bit.srmuniv.ac.in/.

  2. Green Chemistry; Sviluppo sostenibile. L'industria ha bisogno del contributo di tutti

    Energy Technology Data Exchange (ETDEWEB)

    Ingallina, P. [EniTecnologie SpA, San Donato Milanese, MI (Italy)

    2001-02-01

    Everyone acknowledges that chemistry is a key science in order to study and solve the problems of the environment: a successful arranging technological progress with environment protection is one of the main challenge of the next millennium. The Green Chemistry (or Sustainable Chemistry) represents the specific contribution that chemists can supply for an environmentally compatible development. [Italian] Fabrizio d'Adda, attualmente Presidente di EniChem e membro di Cefic (European Chemical Industry Council), ha aperto il seminario {sup T}he Greening of Chemistry{sup (}EniTecnologie - 31 Ottobre 2000) con un breve discorso. Ha espresso parole di fiducia riguardo al futuro dell'industria chimica, l'unica a suo giudizio, in grado di avviare un nuovo modello di sviluppo nel rispetto delle implicazioni ambientali, sociali ed economiche.

  3. Sääste hoitakse üha enam valuutas / Piret Reiljan

    Index Scriptorium Estoniae

    Reiljan, Piret, 1983-

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti 18. juuli lk. 3. Üha enam eraisikuid on oma tähtajalisi ja säästuhoiuseid paigutanud valuutasse, kuna välisraha puhul on valuutarisk väiksem. Kommenteerivad Mart Sõrg, Sven Meimer. Diagramm: Valuutahoiuste maht tõusuteel; Üle aasta kestvatest eraisikute hoiustest 75% valuutas. Tabel: Kroonihoius intressi poolest kuldne kesktee. Lisa: Number

  4. A complete analysis of HA and NA genes of influenza A viruses.

    LENUS (Irish Health Repository)

    Shi, Weifeng

    2010-12-01

    More and more nucleotide sequences of type A influenza virus are available in public databases. Although these sequences have been the focus of many molecular epidemiological and phylogenetic analyses, most studies only deal with a few representative sequences. In this paper, we present a complete analysis of all Haemagglutinin (HA) and Neuraminidase (NA) gene sequences available to allow large scale analyses of the evolution and epidemiology of type A influenza.

  5. Evaluation of Three Adolescent Sexual Health Programs in Ha Noi and Khanh Hoa Province, Vietnam

    OpenAIRE

    Pham, Van,; Hoang Nguyen; Le Huu Tho; Truong Tan Minh; Porntip Lerdboon; Rosemary Riel; Green, Mackenzie S.; Kaljee, Linda M.

    2012-01-01

    With an increase in sexual activity among young adults in Vietnam and associated risks, there is a need for evidence-based sexual health interventions. This evaluation of three sexual health programs based on the Protection Motivation Theory (PMT) was conducted in 12 communes in Ha Noi, Nha Trang City, and Ninh Hoa District. Inclusion criteria included unmarried youth 15–20 years residing in selected communes. Communes were randomly allocated to an intervention, and participants were randomly...

  6. HDPE/HA composites obtained in solution: Effect of the gamma radiation

    Science.gov (United States)

    Carmen, Albano; Arquímedes, Karam; Rosestela, Perera; Gema, González; Nohemy, Domínguez; Jeanette, González; Yanixia, Sánchez

    2006-06-01

    Radiation is employed to sterilize composite materials used in the biomedical field. Due to the changes induced by radiation onto polymeric materials, it is important to study variations in their melt flow index (MFI), as well as in their mechanical and thermal properties. In this work, those previous parameters were determined in composites obtained via solution of a high-density polyethylene (HDPE) in decalin, with different amounts of hydroxyapatite (HA), varying from 10 to 30 parts per hundred, after being exposed to gamma radiation at absorbed doses between 25 and 100 kGy. After the irradiation, the MFI of HDPE dissolved in decalin and precipitated afterwards and without filler increased from 6 to 24 g/10 min at the highest absorbed doses. This behavior was also observed in composites with 10 pph of HA, being the increase less pronounced, specifically in the range between 50 and 100 kGy. Composites with 20 and 30 pph of HA showed a maximum MFI value at 50 kGy, which decreased at higher doses. This implies that the filler begin to exert an influence because it does not melt at the test temperature and consequently, it does not flow. It was observed that Young's modulus increased with HA addition due to rigidity of the ceramic filler. Radiation did not significantly affect this tensile property. On the other hand, the tensile strength did not show significant variations at the different doses but the filler content did affect this property improving it. Finally, elongation at break showed a drastic decrease with filler addition. When the thermal behavior was studied it was noticed that crystallization and melting temperatures remained unchanged. Instead, crystallinity degree slightly increased in the composites, and a little decrease was obtained when they were irradiated.

  7. Technology transfer and scale-up of the Flublok recombinant hemagglutinin (HA) influenza vaccine manufacturing process.

    Science.gov (United States)

    Buckland, Barry; Boulanger, Robert; Fino, Mireli; Srivastava, Indresh; Holtz, Kathy; Khramtsov, Nikolai; McPherson, Clifton; Meghrous, Jamal; Kubera, Paul; Cox, Manon M J

    2014-09-22

    Multiple different hemagglutinin (HA) protein antigens have been reproducibly manufactured at the 650L scale by Protein Sciences Corporation (PSC) based on an insect cell culture with baculovirus infection. Significantly, these HA protein antigens were produced by the same Universal Manufacturing process as described in the biological license application (BLA) for the first recombinant influenza vaccine approved by the FDA (Flublok). The technology is uniquely designed so that a change in vaccine composition can be readily accommodated from one HA protein antigen to another one. Here we present a vaccine candidate to combat the recently emerged H7N9 virus as an example starting with the genetic sequence for the required HA, creation of the baculovirus and ending with purified protein antigen (or vaccine component) at the 10L scale accomplished within 38 days under GMP conditions. The same process performance is being achieved at the 2L, 10L, 100L, 650L and 2500L scale. An illustration is given of how the technology was transferred from the benchmark 650L scale facility to a retrofitted microbial facility at the 2500L scale within 100 days which includes the time for facility engineering changes. The successful development, technology transfer and scale-up of the Flublok process has major implications for being ready to make vaccine rapidly on a worldwide scale as a defense against pandemic influenza. The technology described does not have the same vulnerability to mutations in the egg adapted strain, and resulting loss in vaccine efficacy, faced by egg based manufacture. Copyright © 2014 Elsevier Ltd. All rights reserved.

  8. Endiguer la vague de criminalité en Haïti | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    17 avr. 2012 ... En Haïti, les signes de danger sautent littéralement aux yeux. Dans nombre des quartiers de Port‑au‑Prince dont les murs sont couverts de graffitis, on observe une grave escalade de la violence meurtrière. La montée en flèche du nombre de meurtres, de crimes contre les biens et de voies de fait, qui s'est ...

  9. Functionalized PCL/HA nanocomposites as microporous membranes for bone regeneration

    Energy Technology Data Exchange (ETDEWEB)

    Basile, Maria Assunta; Gomez d' Ayala, Giovanna; Malinconico, Mario [Institute for Polymers, Composites and Biomaterials, CNR, Via Campi Flegrei 34, Pozzuoli (Naples) (Italy); Laurienzo, Paola, E-mail: paola.laurienzo@ipcb.cnr.it [Institute for Polymers, Composites and Biomaterials, CNR, Via Campi Flegrei 34, Pozzuoli (Naples) (Italy); Coudane, Jean; Nottelet, Benjamin [Institut des Biomolécules Max Mousseron (IBMM), Artificial Biopolymers Group, CNRS UMR 5247, University of Montpellier 1, Faculty of Pharmacy, 15 Av. C. Flahault, Montpellier 34093 (France); Ragione, Fulvio Della [Department of Biochemistry and Biophysics, Second University of Naples, Via L. De Crecchio 7, Naples (Italy); Oliva, Adriana, E-mail: adriana.oliva@unina2.it [Department of Biochemistry and Biophysics, Second University of Naples, Via L. De Crecchio 7, Naples (Italy)

    2015-03-01

    In the present work, microporous membranes based on poly(ε-caprolactone) (PCL) and PCL functionalized with amine (PCL-DMAEA) or anhydride groups (PCL-MAGMA) were realized by solvent–non solvent phase inversion and proposed for use in Guided Tissue Regeneration (GTR). Nanowhiskers of hydroxyapatite (HA) were also incorporated in the polymer matrix to realize nanocomposite membranes. Scanning Electron Microscopy (SEM) showed improved interfacial adhesion with HA for functionalized polymers, and highlighted substantial differences in the porosity. A relationship between the developed porous structure of the membrane and the chemical nature of grafted groups was proposed. Compared to virgin PCL, hydrophilicity increases for functionalized PCL, while the addition of HA influences significantly the hydrophilic characteristics only in the case of virgin polymer. A significant increase of in vitro degradation rate was found for PCL-MAGMA based membranes, and at lower extent of PCL-DMAEA membranes. The novel materials were investigated regarding their potential as support for cell growth in bone repair using multipotent mesenchymal stromal cells (MSC) as a model. MSC plated onto the various membranes were analyzed in terms of adhesion, proliferation and osteogenic capacity that resulted to be related to chemical as well as porous structure. In particular, PCL-DMAEA and the relative nanocomposite membranes are the most promising in terms of cell-biomaterial interactions. - Graphical abstract: Functionalized PCL is used to realize nanocomposites with hydroxyapatite (HA) in the form of microporous membranes. The influence of different grafted groups on mechanical properties, in vitro degradation, porous membrane structure and interaction with mesenchymal stromal cells (MSC) is discussed. - Highlights: • Functionalized PCL shows faster in vitro degradation rate. • Functionalized PCL shows superior cell adhesion, proliferation and differentiation. • Nanocomposites based

  10. Effect of high pressure on growth and bacteriocin production of Pediococcus acidilactici HA-6111-2

    Science.gov (United States)

    Castro, S. M.; Kolomeytseva, M.; Casquete, R.; Silva, J.; Saraiva, J. A.; Teixeira, P.

    2015-10-01

    This study was aimed to investigate the effect of high pressure processing (HPP, 200-600 MPa) on the (i) survival of Listeria innocua and Pediococcus acidilactici HA-6111-2; (ii) production of bacteriocin bacHA-6111-2 and (iii) activity of bacteriocin against untreated and pressure-treated L. innocua cells. Inactivation of P. acidilactici was observed for pressures of >300 MPa. However, at this pressure level, L. innocua was more sensitive. Bacteriocin crude extract was pressure stable, with a decrease for pressures of ≥400 MPa. Pressures of ≤200 MPa did not affect bacteriocin production when compared with non-pressure-treated cells, whereas higher pressures caused a 2- to 4-fold decrease on the maximum level of bacteriocin production. Growth curves of P. acidilactici were fitted with the modified Gompertz model. The lag phase period depended on the magnitude of the pressure applied: there was a delay in the exponential phase as pressure increased and, as a consequence, in the beginning of bacteriocin production. Since P. acidilactici HA-6111-2 and its bacteriocin have shown resistance to pressures up to 300-400 MPa, they could be used in combination with HPP in order to improve food safety.

  11. Determination of Ca/P molar ratio in hydroxyapatite (HA) by X-ray fluorescence technique

    Energy Technology Data Exchange (ETDEWEB)

    Scapin, Marcos A.; Guilhen, Sabine N.; Cotrim, Marycel E.B.; Pires, Maria Ap. F., E-mail: mascapin@usp.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2015-07-01

    Hydroxyapatite (HA) is a mineral composed of calcium phosphate employed for endodontics, restorative dentistry and other applications in orthopedics and prosthesis. Additionally, this biomaterial is an inexpensive but efficient adsorbent for the removal of heavy metals and other unwanted species of contaminated liquid effluents. This is especially interesting when low-cost effective remediation is required. A Ca / P molar ratio of 1.667 is consistent with the theoretical Ca / P ratio for calcium hydroxyapatite with a compositional formula of Ca{sub 10}(PO{sub 4}){sub 6}(OH){sub 2}, which properties are well discussed in the literature. The aim of this work was to implement and validate a methodology for simultaneous determination of major and minor constituents in the hydroxyapatite (HA) as well as providing the Ca / P molar ratio. To accomplish these achievements, wavelength dispersive X-ray fluorescence spectroscopy (WDXRF) was applied. This is a non-destructive technique that requires no chemical treatment, enabling fast chemical analysis in a wide variety of samples, with no hazardous waste being generated as a result of the process of determination. A standard reference material from NIST (SRM 1400 – Bone Ash) was used to validate the methodology for the determination of magnesium, phosphorus, potassium, calcium, iron, zinc, strontium and the Ca / P ratio in HA samples by WDXRF. The Z-score test was applied as a statistical tool and showed that the calculated values were of less than 1.8 for all the measured analytes. (author)

  12. Effect of Annurca apple polyphenols on human HaCaT keratinocytes proliferation.

    Science.gov (United States)

    D'Angelo, Stefania; La Porta, Raffaele; Napolitano, Maria; Galletti, Patrizia; Quagliuolo, Lucio; Boccellino, Mariarosaria

    2012-11-01

    Polyphenols have been demonstrated to have clear antioxidant activities in vitro. However, in complex biological systems, they exhibit additional properties, which are yet poorly understood. The apple is among the most consumed fruits worldwide, and several studies suggest that apple polyphenols could play a role in the prevention of degenerative diseases. The present study aimed at evaluating the Annurca apple polyphenol extract (APE) effects both proliferation and apoptosis on HaCaT cells. The data indicate that apple polyphenolic compounds had significant antiproliferative action on HaCaT cells. The fluorescence-activated cell-sorting analysis showed that APE induced cell apoptosis in a dose-dependent manner. Moreover, apple polyphenols induced apoptosis in epithelial cells by triggering a death receptor-associated extrinsic pathway p53-independent. APE was also capable of inducing morphological changes as evidenced by nuclear condensation. The cellular, morphological, and molecular data unequivocally demonstrated that induction of cellular apoptosis was mainly responsible for the previously observed antiproliferation-induced APE on HaCaT keratinocytes. Our experimental results suggest that apple polyphenols are a promising source from which a natural-based topical agent could be developed for skin diseases treatment.

  13. Cobalt toxicity: Chemical and radiological combined effects on HaCaT keratinocyte cell line

    Energy Technology Data Exchange (ETDEWEB)

    Gault, N. [CEA Fontenay aux Roses, DSV/IRCM/SCSR/LRTS, 92265 Fontenay aux Rose (France); Sandre, C.; Moulin, B.; Bresson, C. [CEA, DEN, SECR, Laboratoire de Speciation des Radionucleides et des Molecules, F-91191 Gif-sur-Yvette (France); Poncy, J.L. [CEA Bruyeres Le Chatel, DSV/IRCM/SREIT/LRT, 91680 Bruyeres Le Chatel (France); Lefaix, J.L. [CEA Caen, DSV/IRCM/SRO/LARIA, 14070 Caen (France)

    2010-07-01

    Cobalt (Co) is an essential trace element well known as a constituent of vitamin B12, but different compounds of Co are also described as highly toxic and/or radio-toxic for individuals or the environment. In nuclear power plants, {sup 58}Co and {sup 60}Co are radioactive isotopes of cobalt present as activation products of stable Co and Ni used in alloys. Skin exposure is a current occupational risk in the hard metal and nuclear industries. As biochemical and molecular cobalt-induced toxicological mechanisms are not fully identified, we investigated cobalt toxicity in a model human keratinocyte cell line, HaCaT. In this study, we propose a model to determine the in vitro chemical impact on cell viability of a soluble form of cobalt (CoCl{sub 2}) with or without {gamma}-ray doses to mimic contamination by {sup 60}Co, to elucidate the mechanisms of cobalt intracellular chemical and radiological toxicity. Intracellular cobalt concentration was determined after HaCaT cell contamination and chemical toxicity was evaluated in terms of cellular viability and clonogenic survival. We investigated damage to DNA in HaCaT cells by combined treatment with chemical cobalt and a moderate {gamma}-ray dose. Additive effects of cobalt and irradiation were demonstrated. The underlying mechanism of cobalt toxicity is not clearly established, but our results seem to indicate that the toxicity of Co(II) and of irradiation arises from production of reactive oxygen species. (authors)

  14. Re-establishment of the IMS Hydroacoustic Station HA03, Robinson Crusoe Island, Chile

    Science.gov (United States)

    Haralabus, Georgios; Stanley, Jerry; Zampolli, Mario; Pautet, Lucie

    2015-04-01

    Water column hydrophone stations of the Comprehensive Nuclear-Test-Ban Treaty Organisation (CTBTO) International Monitoring System (IMS) comprise typically two triplets of moored hydrophones deployed on both sides of an island. Triplet distances vary approximately between 50 - 200 km from the island, with each triplet connected to the receiving shore equipment by fibre-optic submarine data cables. Once deployed, the systems relay underwater acoustic waveforms in the band 1 - 100 Hz in real time to Vienna via a shore based satellite link. The design life of hydroacoustic (HA) stations is at least 20 years, without need for any maintenance of the underwater system (UWS). The re-establishment of hydrophone station HA03 at Robinson Crusoe Island (670 km West of the Chilean mainland) is presented here. The station was destroyed in February 2010 by a Tsunami induced by an 8.8 magnitude earthquake. After a major engineering and logistical undertaking HA03 is now back in operation since April 2014. The main phases of the project are presented: (i) the installation of a shore facility for the reception of the hydrophone data from the UWS, which also relays the data back to the CTBTO International Data Center (IDC) in Vienna via a real-time satellite connection, (ii) the manufacturing and testing of the system to meet the stringent requirements of the Nuclear-Test-Ban Treaty, and (iii) the installation of the UWS with a state-of-the-art cable ship. Examples of data acquired by HA03 are also presented. These include hydroacoustic signals from the 1 April 2014 magnitude 8.2 earthquake in Northern Chile, bursting underwater bubbles from a submarine volcano near the Mariana Islands (15,000 Km away from the station), and vocalizations from the numerous marine mammals which transit in the vicinity of HA03. The use of CTBTO data for scientific purposes is possible via the virtual Data Exploitation Centre (vDEC), which is a platform that enables registered researchers to access

  15. Abordando la crisis de los Recursos Humanos para la Salud: ¿Hasta dónde hemos llegado? ¿Qué podemos esperar lograr al 2015? Addressing the Human Resources for Health crisis in countries: How far have we gone? What can we expect to achieve by 2015?

    Directory of Open Access Journals (Sweden)

    Manuel M. Dayrit

    2011-06-01

    Full Text Available El reporte mundial de la Salud del 2006 (World Health Report 2006 ha identificado 57 países en los que la densidad de trabajadores de salud con respecto a la población general se encuentra por debajo del umbral crítico de 2,3 por 1000 habitantes. Esto significa que por debajo de este umbral crítico, un país no sería capaz de brindar los servicios básicos para su población, definidos como el 80% de coberturas de inmunización y 80% de atención calificada del parto. De los 57 países, 36 pertenecen al África. Este artículo revisa el progreso realizado por los países para afrontar su crisis de recursos humanos en salud. Cita tres de los estudios mundiales más recientes y los indicadores utilizados para medir el progreso. Asimismo, se presenta la experiencia de ocho países: Malawi, Perú, Etiopía, Brasil, Tailandia, Zambia y Mali. Ello brinda un panorama diverso de esfuerzos, retos y éxitos en cada uno de estos países. El artículo lanza la interrogante sobre si la meta de una reducción del 25% en el número de países en crisis puede lograrse para el año 2015, objetivo definido por la Asamblea Mundial de la Salud en el 2008. El optimismo que los autores quisieran mantener sobre los esfuerzos orientados a esta meta, debe ir sin embargo a la par con un adecuado nivel de inversión de los países en recursos humanos en salud. Los siguientes cuatro años nos mostrarán cuánto en realidad puede ser logrado.The World Health Report 2006 identified 57 countries world-wide whose health worker to population density fell below a critical threshold of 2.3 per 1,000 population. This meant that below this critical threshold, a country could not provide the basic health services to its population, defined here as 80% immunization coverage and 80% skilled birth attendance at delivery. Of the 57 countries, 36 are located in Africa. This article reviews the progress countries have made in addressing their health workforce crisis. It cites 3 of

  16. A Pilot Investigation regarding Speech-Recognition Performance in Noise for Adults with Hearing Loss in the FM+HA Listening Condition

    Science.gov (United States)

    Lewis, M. Samantha; Gallun, Frederick J.; Gordon, Jane; Lilly, David J.; Crandell, Carl

    2010-01-01

    While the concurrent use of the hearing aid (HA) microphone with frequency modulation (FM) technology can decrease speech-recognition performance, the FM+HA condition is still an important setting for users of both HA and FM technology. The primary goal of this investigation was to evaluate the effect of attenuating HA gain in the FM+HA listening…

  17. Augmenter le taux de vaccination et réduire la mortalité infantile à Haïti

    International Development Research Centre (IDRC) Digital Library (Canada)

    2 mai 2016 ... Résultats de l'Initiative canadienne d'immunisation internationale pour Haïti À Haïti, un enfant sur quatorze ne survit pas assez longtemps pour fêter son premier anniversaire. Parmi les facteurs contributifs, citons les taux extrêmement faibles de vaccination à Haïti, qui sont parmi les plus bas au monde.

  18. The use of acetone to enhance the infiltration of HA nanoparticles into a demineralized dentin collagen matrix.

    Science.gov (United States)

    Besinis, Alexandros; van Noort, Richard; Martin, Nicolas

    2016-03-01

    This study investigates the role of acetone, as a carrier for nano-hydroxyapatite (nano-HA) in solution, to enhance the infiltration of fully demineralized dentin with HA nanoparticles (NPs). Dentin specimens were fully demineralized and subsequently infiltrated with two types of water-based nano-HA solutions (one containing acetone and one without). Characterization of the dentin surfaces and nano-HA particles was performed using scanning electron microscopy (SEM) and transmission electron microscopy (TEM). The surface wettability and infiltration capacity of the nano-HA solutions were quantified by means of contact angle measurements and energy dispersive X-ray spectroscopy (EDS), respectively. Contact angle measurements were taken at baseline and repeated at regular intervals to assess the effect of acetone. The P and Ca levels of infiltrated dentin specimens were measured and compared to sound dentin and non-infiltrated controls. The presence of acetone resulted in an eight-fold decrease in the contact angles of the nano-HA solutions recorded on the surface of demineralized dentin compared to nano-HA solutions without acetone (one-way ANOVA, pacetone. Infiltration of demineralized dentin with the nano-HA solution containing acetone restored the lost mineral content by 50%, whereas the mean mineralization values for P and Ca in dentin treated with the acetone-free nano-HA solution were less than 6%. Acetone was shown to act as a vehicle to enhance the capacity to infiltrate demineralized dentin with HA NPs. The successful infiltration of dentin collagen with HA NPs provides a suitable scaffold, whereby the infiltrated HA NPs have the potential to act as seeds that may initiate heterogenous mineral growth when exposed to an appropriate mineral-rich environment. Copyright © 2015 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.

  19. Neural stem cell proliferation and differentiation in the conductive PEDOT-HA/Cs/Gel scaffold for neural tissue engineering.

    Science.gov (United States)

    Wang, Shuping; Guan, Shui; Xu, Jianqiang; Li, Wenfang; Ge, Dan; Sun, Changkai; Liu, Tianqing; Ma, Xuehu

    2017-09-26

    Engineering scaffolds with excellent electro-activity is increasingly important in tissue engineering and regenerative medicine. Herein, conductive poly(3,4-ethylenedioxythiophene) doped with hyaluronic acid (PEDOT-HA) nanoparticles were firstly synthesized via chemical oxidant polymerization. A three-dimensional (3D) PEDOT-HA/Cs/Gel scaffold was then developed by introducing PEDOT-HA nanoparticles into a chitosan/gelatin (Cs/Gel) matrix. HA, as a bridge, not only was used as a dopant, but also combined PEDOT into the Cs/Gel via chemical crosslinking. The PEDOT-HA/Cs/Gel scaffold was used as a conductive substrate for neural stem cell (NSC) culture in vitro. The results demonstrated that the PEDOT-HA/Cs/Gel scaffold had excellent biocompatibility for NSC proliferation and differentiation. 3D confocal fluorescence images showed cells attached on the channel surface of Cs/Gel and PEDOT-HA/Cs/Gel scaffolds with a normal neuronal morphology. Compared to the Cs/Gel scaffold, the PEDOT-HA/Cs/Gel scaffold not only promoted NSC proliferation with up-regulated expression of Ki67, but also enhanced NSC differentiation into neurons and astrocytes with up-regulated expression of β tubulin-III and GFAP, respectively. It is expected that this electro-active and bio-active PEDOT-HA/Cs/Gel scaffold will be used as a conductive platform to regulate NSC behavior for neural tissue engineering.

  20. Characterization of Three Novel Fatty Acid- and Retinoid-Binding Protein Genes (Ha-far-1, Ha-far-2 and Hf-far-1 from the Cereal Cyst Nematodes Heterodera avenae and H. filipjevi.

    Directory of Open Access Journals (Sweden)

    Fen Qiao

    Full Text Available Heterodera avenae and H. filipjevi are major parasites of wheat, reducing production worldwide. Both are sedentary endoparasitic nematodes, and their development and parasitism depend strongly on nutrients obtained from hosts. Secreted fatty acid- and retinol-binding (FAR proteins are nematode-specific lipid carrier proteins used for nutrient acquisition as well as suppression of plant defenses. In this study, we obtained three novel FAR genes Ha-far-1 (KU877266, Ha-far-2 (KU877267, Hf-far-1 (KU877268. Ha-far-1 and Ha-far-2 were cloned from H. avenae, encoding proteins of 191 and 280 amino acids with molecular masses about 17 and 30 kDa, respectively and sequence identity of 28%. Protein Blast in NCBI revealed that Ha-FAR-1 sequence is 78% similar to the Gp-FAR-1 protein from Globodera pallida, while Ha-FAR-2 is 30% similar to Rs-FAR-1 from Radopholus similis. Only one FAR protein Hf-FAR-1was identified in H. filipjevi; it had 96% sequence identity to Ha-FAR-1. The three proteins are alpha-helix-rich and contain the conserved domain of Gp-FAR-1, but Ha-FAR-2 had a remarkable peptide at the C-terminus which was random-coil-rich. Both Ha-FAR-1 and Hf-FAR-1 had casein kinase II phosphorylation sites, while Ha-FAR-2 had predicted N-glycosylation sites. Phylogenetic analysis showed that the three proteins clustered together, though Ha-FAR-1 and Hf-FAR-1 adjoined each other in a plant-parasitic nematode branch, but Ha-FAR-2 was distinct from the other proteins in the group. Fluorescence-based ligand binding analysis showed the three FAR proteins bound to a fluorescent fatty acid derivative and retinol and with dissociation constants similar to FARs from other species, though Ha-FAR-2 binding ability was weaker than that of the two others. In situ hybridization detected mRNAs of Ha-far-1 and Ha-far-2 in the hypodermis. The qRT-PCR results showed that the Ha-far-1and Ha-far-2 were expressed in all developmental stages; Ha-far-1 expressed 70 times more

  1. Mapping HA-tagged protein at the surface of living cells by atomic force microscopy.

    Science.gov (United States)

    Formosa, C; Lachaize, V; Galés, C; Rols, M P; Martin-Yken, H; François, J M; Duval, R E; Dague, E

    2015-01-01

    Single-molecule force spectroscopy using atomic force microscopy (AFM) is more and more used to detect and map receptors, enzymes, adhesins, or any other molecules at the surface of living cells. To be specific, this technique requires antibodies or ligands covalently attached to the AFM tip that can specifically interact with the protein of interest. Unfortunately, specific antibodies are usually lacking (low affinity and specificity) or are expensive to produce (monoclonal antibodies). An alternative strategy is to tag the protein of interest with a peptide that can be recognized with high specificity and affinity with commercially available antibodies. In this context, we chose to work with the human influenza hemagglutinin (HA) tag (YPYDVPDYA) and labeled two proteins: covalently linked cell wall protein 12 (Ccw12) involved in cell wall remodeling in the yeast Saccharomyces cerevisiae and the β2-adrenergic receptor (β2-AR), a G protein-coupled receptor (GPCR) in higher eukaryotes. We first described the interaction between HA antibodies, immobilized on AFM tips, and HA epitopes, immobilized on epoxy glass slides. Using our system, we then investigated the distribution of Ccw12 proteins over the cell surface of the yeast S. cerevisiae. We were able to find the tagged protein on the surface of mating yeasts, at the tip of the mating projections. Finally, we could unfold multimers of β2-AR from the membrane of living transfected chinese hamster ovary cells. This result is in agreement with GPCR oligomerization in living cell membranes and opens the door to the study of the influence of GPCR ligands on the oligomerization process. Copyright © 2014 John Wiley & Sons, Ltd.

  2. Resveratrol Couples Apoptosis with Autophagy in UVB-Irradiated HaCaT Cells

    Science.gov (United States)

    Vitale, Nicoletta; Kisslinger, Annamaria; Paladino, Simona; Procaccini, Claudio; Matarese, Giuseppe; Pierantoni, Giovanna Maria; Mancini, Francesco Paolo; Tramontano, Donatella

    2013-01-01

    UVB radiation causes about 90% of non-melanoma skin cancers by damaging DNA either directly or indirectly by increasing levels of reactive oxygen species (ROS). Skin, chronically exposed to both endogenous and environmental pro-oxidant agents, contains a well-organised system of chemical and enzymatic antioxidants. However, increased or prolonged free radical action can overwhelm ROS defence mechanisms, contributing to the development of cutaneous diseases. Thus, new strategies for skin protection comprise the use of food antioxidants to counteract oxidative stress. Resveratrol, a phytoalexin from grape, has gained a great interest for its ability to influence several biological mechanisms like redox balance, cell proliferation, signal transduction pathways, immune and inflammatory response. Therefore, the potential of resveratrol to modify skin cell response to UVB exposure could turn out to be a useful option to protect skin from sunlight-induced degenerative diseases. To investigate into this matter, HaCaT cells, a largely used model for human skin keratinocytes, were treated with 25 or 100 µM resveratrol for 2 and 24 hours prior to UVB irradiation (10 to 100 mJ/cm2). Cell viability and molecular markers of proliferation, oxidative stress, apoptosis, and autophagy were analyzed. In HaCaT cells resveratrol pretreatment: reduces UVB-induced ROS formation, enhances the detrimental effect of UVB on HaCaT cell vitality, increases UVB-induced caspase 8, PARP cleavage, and induces autophagy. These findings suggest that resveratrol could exert photochemopreventive effects by enhancing UVB-induced apoptosis and by inducing autophagy, thus reducing the odds that damaged cells could escape programmed cell death and initiate malignant transformation. PMID:24260465

  3. Titanium Dioxide Nanoparticle Penetration into the Skin and Effects on HaCaT Cells

    Directory of Open Access Journals (Sweden)

    Matteo Crosera

    2015-08-01

    Full Text Available Titanium dioxide nanoparticles (TiO2NPs suspensions (concentration 1.0 g/L in synthetic sweat solution were applied on Franz cells for 24 h using intact and needle-abraded human skin. Titanium content into skin and receiving phases was determined. Cytotoxicity (MTT, AlamarBlue® and propidium iodide, PI, uptake assays was evaluated on HaCat keratinocytes after 24 h, 48 h, and seven days of exposure. After 24 h of exposure, no titanium was detectable in receiving solutions for both intact and damaged skin. Titanium was found in the epidermal layer after 24 h of exposure (0.47 ± 0.33 μg/cm2 while in the dermal layer, the concentration was below the limit of detection. Damaged skin, in its whole, has shown a similar concentration (0.53 ± 0.26 μg/cm2. Cytotoxicity studies on HaCaT cells demonstrated that TiO2NPs induced cytotoxic effects only at very high concentrations, reducing cell viability after seven days of exposure with EC50s of 8.8 × 10−4 M (MTT assay, 3.8 × 10−5 M (AlamarBlue® assay, and 7.6 × 10−4 M (PI uptake, index of a necrotic cell death. Our study demonstrated that TiO2NPs cannot permeate intact and damaged skin and can be found only in the stratum corneum and epidermis. Moreover, the low cytotoxic effect observed on human HaCaT keratinocytes suggests that these nano-compounds have a potential toxic effect at the skin level only after long-term exposure.

  4. Áreas metropolitanas:¿qué ha cambiado?: La experiencia de la Caracas Metropolitana

    Directory of Open Access Journals (Sweden)

    Sonia Barrios

    2001-05-01

    Full Text Available La nueva economía de la información y del conocimiento ha tenido tres decisivas implicaciones de orden territorial. Primero, ha acelerado el proceso de aglomeración urbana a escala planetaria. Segundo, ha provocado fuertes alteraciones en las redes urbanas de ámbito mundial, regional y nacional. Y tercero, ha impulsado la reestructuración interna de las áreas metropolitanas que se habían conformado durante la era industrial. Todo parece anticipar, por lo tanto, polarizaciones y fragmentaciones territoriales todavía más acentuadas que las conocidas en un pasado cercano. Tomando como referencia el caso de Caracas, se trata de averiguar en qué medida el desarrollo reciente de esta metrópoli sigue las grandes tendencias territoriales antes anotadas; y qué esfuerzos se están haciendo para ajustar sus instancias locales a las nuevas realidades urbanas. Como un recurso adicional, en distintos momentos se establecen comparaciones con Barcelona (España, considerada un ejemplo emblemático de las metrópolis de la era de la informaciónThe developments of new informational and knowledge-based economies have had three decisive implications at the territorial level. First, it has accelerated the urban agglomeration processes worldwide. Second, it has brought about substantial alterations in the existing global, regional and national urban networks. Finally, it has triggered the internal restructuring of former industrial-based metropolitan areas. All this seems to anticipate that territorial polarization and fragmentation will reach higher levels than those we have observed in the recent past. Taking the case of Caracas as a reference point, the intention is to find out to what extent the recent development of this metropolis follows the main territorial trends mentioned above. Interest is also placed in finding what steps are being taken in order to adjust its local levels of government to the new urban realities. In addition, comparisons are

  5. Patienters upplevelser kring deras sexualitet efter att ha fått en stomi : En litteraturstudie

    OpenAIRE

    Oskarsson, Ellinor; Isa, Göransson

    2014-01-01

    Bakgrund: Att få en stomi kan innebära flera olika förändringar i en människas liv. Individens självbild kan förändras efter operationen, till följd av det nya kroppsliga utseendet och dess funktioner. Ett tillfredsställande sexliv är starkt korrelerat till psykosocialt- och fysiskt välbefinnande. Syfte: Syftet med detta arbete var att beskriva patienters upplevelser samt eventuella förändringar som kan uppstå kring deras sexualitet efter att ha erhållit en stomi. Metod: Litte...

  6. Access to microcredit for women living with, or vulnerable to, HIV in Haïti

    OpenAIRE

    C. Longuet; J. L. Machuron; M. M. Deschamps; R. Sinior; J. W. Pape; E. Brignoli; B. Miribel

    2010-01-01

    Haïti is the poorest country on the American continent. It is also the Caribbean nation where HIV prevalence is the highest: 2.2% of the adults carry the virus. In 2005, GHESKIO, a centre for the care of people living with HIV/AIDS; ACME, Association for Cooperation with Micro Enterprise; and Fondation Mérieux launched a microcredit programme to help women living with HIV/AIDS. The programme was subsequently extended to vulnerable women who had consulted at GHESKIO. In 2006, an impact assessm...

  7. Functional study of the novel multidrug resistance gene HA117 and its comparison to multidrug resistance gene 1

    Directory of Open Access Journals (Sweden)

    Chen Tingfu

    2010-07-01

    Full Text Available Abstract Background The novel gene HA117 is a multidrug resistance (MDR gene expressed by all-trans retinoic acid-resistant HL-60 cells. In the present study, we compared the multidrug resistance of the HA117 with that of the classical multidrug resistance gene 1 (MDR1 in breast cancer cell line 4T1. Methods Transduction of the breast cancer cell line 4T1 with adenoviral vectors encoding the HA117 gene and the green fluorescence protein gene (GFP (Ad-GFP-HA117, the MDR1 and GFP (Ad-GFP-MDR1 or GFP (Ad-GFP was respectively carried out. The transduction efficiency and the multiplicity of infection (MOI were detected by fluorescence microscope and flow cytometry. The transcription of HA117 gene and MDR1 gene were detected by reverse transcription polymerase chain reaction (RT-PCR. Western blotting analysis was used to detect the expression of P-glycoprotein (P-gp but the expression of HA117 could not be analyzed as it is a novel gene and its antibody has not yet been synthesized. The drug-excretion activity of HA117 and MDR1 were determined by daunorubicin (DNR efflux assay. The drug sensitivities of 4T1/HA117 and 4T1/MDR1 to chemotherapeutic agents were detected by Methyl-Thiazolyl-Tetrazolium (MTT assay. Results The transducted efficiency of Ad-GFP-HA117 and Ad-GFP-MDR1 were 75%-80% when MOI was equal to 50. The transduction of Ad-GFP-HA117 and Ad-GFP-MDR1 could increase the expression of HA117 and MDR1. The drug resistance index to Adriamycin (ADM, vincristine (VCR, paclitaxel (Taxol and bleomycin (BLM increased to19.8050, 9.0663, 9.7245, 3.5650 respectively for 4T1/HA117 and 24.2236, 11.0480, 11.3741, 0.9630 respectively for 4T1/MDR1 as compared to the control cells. There were no significant differences in drug sensitivity between 4T1/HA117 and 4T1/MDR1 for the P-gp substrates (ADM, VCR and Taxol (P Conclusions These results confirm that HA117 is a strong MDR gene in both HL-60 and 4T1 cells. Furthermore, our results indicate that the MDR

  8. Fabrication and in vitro biocompatibility of biomorphic PLGA/nHA composite scaffolds for bone tissue engineering

    Energy Technology Data Exchange (ETDEWEB)

    Qian, Junmin, E-mail: jmqian@mail.xjtu.edu.cn; Xu, Weijun; Yong, Xueqing; Jin, Xinxia; Zhang, Wei

    2014-03-01

    In this study, biomorphic poly(DL-lactic-co-glycolic acid)/nano-hydroxyapatite (PLGA/nHA) composite scaffolds were successfully prepared using cane as a template. The porous morphology, phase, compression characteristics and in vitro biocompatibility of the PLGA/nHA composite scaffolds and biomorphic PLGA scaffolds as control were investigated. The results showed that the biomorphic scaffolds preserved the original honeycomb-like architecture of cane and exhibited a bimodal porous structure. The average channel diameter and micropore size of the PLGA/nHA composite scaffolds were 164 ± 52 μm and 13 ± 8 μm, respectively, with a porosity of 89.3 ± 1.4%. The incorporation of nHA into PLGA decreased the degree of crystallinity of PLGA, and significantly improved the compressive modulus of biomorphic scaffolds. The in vitro biocompatibility evaluation with MC3T3-E1 cells demonstrated that the biomorphic PLGA/nHA composite scaffolds could better support cell attachment, proliferation and differentiation than the biomorphic PLGA scaffolds. The localization depth of MC3T3-E1 cells within the channels of the biomorphic PLGA/nHA composite scaffolds could reach approximately 400 μm. The results suggested that the biomorphic PLGA/nHA composite scaffolds were promising candidates for bone tissue engineering. - Highlights: • Novel biomimetic PLGA/nHA composite scaffolds were successfully prepared. • nHA addition improved elastic modulus of PLGA scaffold and decreased its crystallinity. • PLGA/nHA composite scaffolds had better biocompatibility than PLGA scaffolds. • Biomorphic PLGA/nHA composite scaffold had great potential in bone tissue engineering.

  9. Role of induced glutathione-S-transferase from Helicoverpa armigera (Lepidoptera: Noctuidae) HaGST-8 in detoxification of pesticides.

    Science.gov (United States)

    Labade, Chaitali P; Jadhav, Abhilash R; Ahire, Mehul; Zinjarde, Smita S; Tamhane, Vaijayanti A

    2018-01-01

    The present study deals with glutathione-S-transferase (GST) based detoxification of pesticides in Helicoverpa armigera and its potential application in eliminating pesticides from the environment. Dietary exposure of a pesticide mixture (organophosphates - chlorpyrifos and dichlorvos, pyrethroid - cypermethrin; 2-15ppm each) to H. armigera larvae resulted in a dose dependant up-regulation of GST activity and gene expression. A variant GST from H. armigera (HaGST-8) was isolated from larvae fed with 10ppm pesticide mixture and it was recombinantly expressed in yeast (Pichia pastoris HaGST-8). HaGST-8 had a molecular mass of 29kDa and was most active at pH 9 at 30°C. GC-MS and LC-HRMS analysis validated that HaGST-8 was effective in eliminating organophosphate type of pesticides and partially reduced the cypermethrin content (53%) from aqueous solutions. Unlike the untransformed yeast, P. pastoris HaGST-8 grew efficiently in media supplemented with pesticide mixtures (200 and 400ppm each pesticide) signifying the detoxification ability of HaGST-8. The amino acid sequence of HaGST-8 and the already reported sequence of HaGST-7 had just 2 mismatches. The studies on molecular interaction strengths revealed that HaGST-8 had stronger binding affinities with organophosphate, pyrethroid, organochloride, carbamate and neonicotinoid type of pesticides. The abilities of recombinant HaGST-8 to eliminate pesticides and P. pastoris HaGST-8 to grow profusely in the presence of high level of pesticide content can be applied for removal of such residues from food, water resources and bioremediation. Copyright © 2017 Elsevier Inc. All rights reserved.

  10. Polycystic Ovarian Syndrome: Is It Time to Rename PCOS to HA-PODS?

    Science.gov (United States)

    Khadilkar, Suvarna Satish

    2016-04-01

    The term polycystic ovarian syndrome (PCOS) came into existence 80 years ago. Pathophysiology of PCOS remains ill understood despite extensive research in this field. It is now accepted that the manifestations of PCOS are not confined to the reproductive dysfunction, and there are endocrine-metabolic implications to PCOS with several consequences to female health. PCOS is a misnomer as ovaries do not contain epithelial cysts, but they are actually antral follicles. Moreover, the name PCOS neither reflects the hyperandrogenism which is essential for diagnosis nor the metabolic derangements. While various authors have expressed the need for change of the name, a suitable new option has not yet been established. This review aims to analyse the current understanding of pathophysiology of PCOS and addresses to the controversies associated with its diagnosis and nomenclature. The name "Hyperandrogenic Persistent Ovulatory Dysfunction Syndrome or HA-PODS" is proposed here to overcome diagnostic pitfalls of previous nomenclature. This new name will help formulate appropriate treatment and promote consistency in research as well. Further categorizations of HA-PODS are also discussed in the article.

  11. Trichomonas vaginalis metalloproteinase induces mTOR cleavage of SiHa cells.

    Science.gov (United States)

    Quan, Juan-Hua; Choi, In-Wook; Yang, Jung-Bo; Zhou, Wei; Cha, Guang-Ho; Zhou, Yu; Ryu, Jae-Sook; Lee, Young-Ha

    2014-12-01

    Trichomonas vaginalis secretes a number of proteases which are suspected to be the cause of pathogenesis; however, little is understood how they manipulate host cells. The mammalian target of rapamycin (mTOR) regulates cell growth, cell proliferation, cell motility, cell survival, protein synthesis, and transcription. We detected various types of metalloproteinases including GP63 protein from T. vaginalis trophozoites, and T. vaginalis GP63 metalloproteinase was confirmed by sequencing and western blot. When SiHa cells were stimulated with live T. vaginalis, T. vaginalis excretory-secretory products (ESP) or T. vaginalis lysate, live T. vaginalis and T. vaginalis ESP induced the mTOR cleavage in both time- and parasite load-dependent manner, but T. vaginalis lysate did not. Pretreatment of T. vaginalis with a metalloproteinase inhibitor, 1,10-phenanthroline, completely disappeared the mTOR cleavage in SiHa cells. Collectively, T. vaginalis metallopeptidase induces host cell mTOR cleavage, which may be related to survival of the parasite.

  12. Dose Dependent Effect of Iso-Octane on HaCaT: A Model Study.

    Science.gov (United States)

    Das, Lopamudra; Das, Soumen; Chatterjee, Jyotirmoy

    2015-01-01

    Improved understanding of cytotoxicity under chemical assaults may be achieved by multimodal analysis of cellular morphology, viability, molecular expressions, and biophysical properties. In this study dose-dependent effects of an organic solvent (OS), iso-octane (IO), known to cause skin irritation, has been explored multimodally for understanding its effect on structural and functional profile of normal epithelial cell population in vitro. Under IO exposures, after 5 h there was a sharp decrease in viability of HaCaT with increasing doses which may be due to disruption in cellular association noted via immunocytochemical study and was further supported by the decreased expression of E-cadherin at transcriptomic level. Dislocation of E-cadherin from membrane to the cytoplasm occurred with increasing doses. The dose-dependent changes in varied aspects of bioelectrical properties, having plausible correlation with cellular viability, association, and adherence were noteworthy at 5 h of IO exposure. Evaluation of biomechanical properties by micropipette aspiration showed a distinct change in cellular stiffness in terms of increase in suction force and post-suction alteration in cellular shape. The cells became stiffer and fragile with increasing IO doses. Present study explicated dose-dependent cytotoxicity of IO on HaCaT and explored the usefulness of this approach to develop in vitro model system to evaluate epithelial toxicity with level-free markers.

  13. DEMENCIA FRONTOTEMPORAL, CÓMO HA RESURGIDO SU DIAGNÓSTICO

    Directory of Open Access Journals (Sweden)

    Patricia Lillo Z, MD, PhD

    2016-05-01

    Full Text Available Desde la descripción inicial efectuada por Pick hace más de un siglo atrás, el interés por las demencias frontotemporales ha tenido un gran crecimiento. Gracias a los avances de las neuroimágenes y el desarrollo de biomarcadores, el progreso en este campo ha generado nuevos conocimientos en torno a la categorización clínica, correlatos neuronales de las funciones cerebrales superiores y mecanismos de neurodegeneración. Paradójicamente, estos avances han traído consigo cierta controversia y desafíos, los cuales han motivado la creación de nuevos criterios diagnósticos. Esta breve revisión muestra la evolución histórica de estas condiciones y describe los criterios diagnósticos actuales para la variante conductual y las afasias progresivas primarias, que son las dos formas clínicas de las demencias frontotemporales.

  14. Astilbin decreases proliferation and improves differentiation in HaCaT keratinocytes.

    Science.gov (United States)

    Zhang, Chunhong; Xu, Qingqing; Tan, Xi; Meng, Liya; Wei, Guo; Liu, Ying; Zhang, Chunmin

    2017-09-01

    Psoriasis is a common chronic dermatosis characterized by keratinocyte hyperproliferation accompanied by inflammatory reactions. Pathological changes upset the balance between keratinocyte proliferation, differentiation, and death in psoriatic lesions, suggesting that molecules with topical anti-inflammatory, anti-proliferation and anti-angiogenesis abilities may be useful for its treatment. The flavonoid astilbin is the major active component extracted from the rhizome of Smilax glabra, which has been widely used in China to treat inflammatory and autoimmune diseases. Here, we investigate the potential of astilbin as a treatment for psoriasis. We reveal that astilbin inhibits the growth of HaCaT keratinocytes. Detailed study shows that astilbin leads to S phase arrest of the cell cycle by induction of p53 and p21 and activated-AMPK. Additionally, astilbin induced keratinocyte differentiation correlated with suppression of keratin 5 (KRT5) and KRT14 proteins (the markers of epidermal basal layer) and induction KRT1 and KRT10 proteins (occurring in the upper layers). Moreover, astilbin regulates the expression of VEGF in human HaCaT keratinocytes. These results suggest that astilbin may be a promising agent for psoriasis treatment. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  15. The early reception of Aristotle through Averroes in medieval Jewish philosophy: the case of the Midrash ha-Hokhmah

    NARCIS (Netherlands)

    Fontaine, R.

    2012-01-01

    The Midrash ha-hokhmah ('The exposition of science') is a thirteenth-century Hebrew encyclopedic text that aims to divu lge contemporary science and philosophy among Jews. Its author is the rather unknown Judah ben Solomon ha-Kohen of Toledo. Originally drafted in Arabic in Toledo, the Hebrew

  16. Tallinna Püha hõimkonna altariretaabel / Merike Koppel ; tõlk. Tiina Randviir, toim. Richard Adang

    Index Scriptorium Estoniae

    Koppel, Merike

    2006-01-01

    Tallinna Niguliste kirikus asuva 17. sajandi keskpaigas ümber tehtud hiliskeskaegse Püha hõimkonna altariretaabli algne pildiprogramm. Altariretaabli korpuse rekonstruktsioon. Kappaltari algse asukoha ja võimalike tellijate väljaselgitamisest. Püha hõimkond Flandria hiliskeskaegsetel nikerdaltaritel

  17. Fabrication and characterization of Ti-Nb-HA alloy by mechanical alloying and spark plasma sintering for hard tissue replacements

    Science.gov (United States)

    Singh, Ramandeep; Pal Singh, Bhupinder; Gupta, Anjali; Prakash, Chander

    2017-08-01

    In the present research work, a β-type Ti-35Nb-10HA alloy was successfully fabricated by mechanical alloying of titanium (Ti), niobium (Nb), and hydroxyaptite (HA) powders followed by consolidation using Spark Plasma Sintering technique. The effect of HA on the microstructure and mechanical properties were studied. The microstructure, surface topography, and element composition of the Ti-Nb-HA alloy was investigated using optical microscope, field-emission scanning electron microscopy, and energy-dispersive X-ray spectroscopy. The micro-hardness of the specimens was measured on a Vickers hardness tester. The microstructure examination of the compact revealed that the alloy distinctly shows the primary grain boundaries along with secondary grain boundary. It was observed that complex reactions between HA and alloy elements occurred during the sintering process of Ti-35Nb-10HA alloy and biocompatible phases [Ca3(PO4)2, CaTiO3, Nb8P5, CaO, TiP, Nb4O5, and TiO2] were generated in the compact, which is beneficial to form apatite and improved the bioactivity of the alloy for osseiointegartion. The fabricated Ti-35Nb-15HA alloy exhibits maximum micro-hardness (∼786 HV), which is very high value as compared to the alloys reported in literature. Based on these above observations, it is expected that the as-fabricated Ti-35Nb-10HA alloy is suggested for dental and orthopaedic applications.

  18. Effect of calcinations temperature on the luminescence intensity and fluorescent lifetime of Tb3+-doped hydroxyapatite (Tb-HA) nanocrystallines

    National Research Council Canada - National Science Library

    Hairong Yin; Yanxiao Li; Jianguang Bai; Mingxin Ma; Jing Liu

    2017-01-01

    ...+ ions were observed in emission spectra of 6 mol.% Tb-HA under 378 nm excitation. The luminescent intensity of Tb-HA, which showed the fluorescence quenching, firstly enhanced and then decreased at 700 °C...

  19. Los estudiantes universitarios y la sociedad de la informacion: una combinacion que ha facilitado el plagio academico en las aulas Colombianas

    National Research Council Canada - National Science Library

    Jaramillo Valbuena, Sonia; Rincon Belalcazar, Nestor Fabian

    2014-01-01

    ...; Consejo Pontificio para las Comunicaciones Sociales, 2002). El impacto de esta revolucion ha permeado diversos ambitos, entre ellos el educativo y ha traido consecuencias tanto positivas como negativas...

  20. Inhibitory effect of PTD-OD-HA fusion protein on Bcr-Abl in K562 cells

    Directory of Open Access Journals (Sweden)

    Miao GAO

    2012-10-01

    Full Text Available Objective To study the transduction dynamics, location of PTD-OD-HA fusion protein and its interaction with Bcr-Abl oncoprotein in K562 cell lines, and explore the influence of PTD-OD-HA fusion protein on oligomerization and tyrosine kinase activity of Bcr-Abl. Methods PTD-OD-HA fusion protein was labeled with FITC and co-cultured with K562 cells. The transduction efficiency of labeled PTD-OD-HA at different doses and time intervals was observed under fluorescence microscope. The location of labeled PTD-OD-HA fusion protein in K562 cells was detected by confocal microscopy. The interaction of PTD-OD-HA fusion protein with Bcr-Abl oncoprotein was confirmed by coimmunoprecipitation. The phosphorylation of Bcr-Abl oncoprotein was detected by Western blotting. Results PTD-OD-HA fusion protein labeled with FITC was transduced into K562 cells in a dose- and time-dependent manner. PTD-OD-HA fusion protein was located in the cytoplasm of K562 cells and was consistent with the location of Bcr-Abl oncoprotein. The interaction of PTD-OD-HA fusion protein with Bcr-Abl oncoprotein was proved in K562 cells. This interaction could interrupt the homologous oligomerization of Bcr-Abl oncoprotein and reduce the phosphorylation of Bcr-Abl oncoprotein. Conclusion PTD-OD-HA fusion protein could be transduced into K562 cells efficiently, inhibit the oligomerization and reduce the phosphorylation of Bcr-Abl oncoprotein.

  1. « Peintures haïtiennes d’inspiration vaudou »

    Directory of Open Access Journals (Sweden)

    Nelly Mok

    2008-05-01

    Full Text Available En hommage aux relations historiques étroites qui unissent l’île de Saint-Domingue et Bordeaux depuis le XVIIIe siècle essentiellement par le biais du commerce colonial, le Musée d’Aquitaine s’est intéressé à l’île et, plus particulièrement, au rôle que le vaudou, reconnu comme religion officielle en Haïti depuis 1987, a joué dans l’histoire politique du pays, dans sa construction d’une identité nationale et sa lutte pour l’indépendance, mais aussi, et surtout, dans l’évolution de son art pic...

  2. HA/Bioglass composite films deposited by pulsed laser with different substrate temperature

    Science.gov (United States)

    Wang, D. G.; Chen, C. Z.; Jin, Q. P.; Li, H. C.; Pan, Y. K.

    2014-03-01

    In this experiment, the HA/Bioglass composite films on Ti-6Al-4V were deposited by a pulsed laser at Ar atmosphere, and the influence of substrate temperature on the morphology, phase constitutions, bonding configurations and adhesive strength of the films was studied. The obtained films were characterized by an electron probe microanalyzer (EPMA), scanning electron microscope (SEM), X-ray diffractometer (XRD), Fourier transform infrared spectrometer (FTIR), scratch apparatus, and so on. The results show that the amount of the droplets, the crystallinity, and the critical load of the deposited films all increase with the increase of the substrate temperature; however, the substrate temperature has little influence on the functional groups of the films.

  3. Qimḥi’s Sefer ha-Shorashim: A Didactic Tool

    Directory of Open Access Journals (Sweden)

    Judith Kogel

    2017-01-01

    Full Text Available Less than forty years after Judah ibn Tibbon translated Ibn Janāḥ’s Kitāb al-Uṣūl into Hebrew, David Qimḥi availed himself to write a new dictionary of Hebrew roots, known as Sefer ha-Shorashim. This book achieved great success and consequently overshadowed the work of his predecessor which nevertheless served as a model to Qimḥi. A preliminary research based on the roots starting by the letter ṭet and sameḵ seems to constitute a representative sample for the history of the text. First of all, it allows to better grasp Qimḥi’s motivation for writing a new dictionary. Further, the analysis of this relatively small corpus gives us clues to understand Qimḥi’s lexicological approach to the Hebrew root and his strategy in the organization of each entry.

  4. Haïti : l’oraison démocratique

    OpenAIRE

    Reno, Fred

    2011-01-01

    Après le départ de Jean-Claude Duvalier, on a cru que le duvaliérisme était mort ou agoniserait assez rapidement pour débarrasser Haïti de la dictature. On a postulé l’horizon démocratique. Plusieurs faits plaidaient dans ce sens. A commencer par l’avènement du Conseil national de gouvernement installé en février 1986, dirigé certes par un général qui acceptait d’assurer la transition vers la démocratie. D’ailleurs, le fait que cette structure fut présidé par un militaire témoignait aux yeux ...

  5. Satellite observations of a surtseyan eruption: Hunga Ha'apai, Tonga

    Science.gov (United States)

    Vaughan, R.G.; Webley, P.W.

    2010-01-01

    On March 17, 2009, a surtseyan eruption occurred around Hunga Ha'apai Island, Tonga. A series of observations from the high-spatial resolution Advanced Spaceborne Thermal Emission and Reflection Radiometer (ASTER), and the high-temporal resolution Moderate Resolution Imaging Spectroradiometer (MODIS), was used to estimate the magnitude, location, start time, and duration of the eruption, and measure the evolving characteristics of the new Hunga Ha'apai Island. The eruption start time was estimated to be between 01:50 and 11:10 local time, on March 17, 2009 (i.e., between 12:50 and 22:10UTC, March 16). The initial explosive phase lasted 3-5days and consisted of multiple steam and tephra explosions from two distinct vent sources, one on the northwest side, and another about 100m off the south shore of the pre-existing island. The eruption plume reached 4.0 to 7.6km altitude above sea level, and tephra added new land around each of the vents, initially tripling the area of the pre-existing island. The next phase of steaming from newly formed crater lakes around the vents lasted a few days. Three warm crater lakes formed initially, but disappeared with time as the shoreline eroded. After ~2months, vegetation that was initially buried by tephra was recovering; after ~10months, the size of the island had eroded down to ~twice that of the pre-existing island, and the one remaining crater lake had a temperature of ~68??17??C. The volume of erupted material was estimated to be ~0.0176km3 and the volcanic explosivity index (VEI) was estimated to be VEI=2. ?? 2010.

  6. Hydrophone localization for the newly installed CTBTO station HA04 using noise from the installation vessel

    Science.gov (United States)

    Nielsen, Peter; Haralabus, Georgios; Stanley, Jerry; Zampolli, Mario; Grenard, Patrick; Brown, David; Le Bras, Ronan; Amir, Menachem; Slava, Bereza; Bittner, Paulina; Gore, Jane; Wang, Haijun

    2017-04-01

    During December 2016, the cabled hydroacoustic station HA04 was installed close to the Crozet Islands, France, in the southern Indian Ocean as part of the Comprehensive Nuclear-Test-Ban Treaty Organization's (CTBTO) International Monitoring System (IMS) designed to detect nuclear explosions worldwide. The HA04 station consists of two triplets of cabled to shore hydrophones deployed north and south of Crozet. Each triplet forms a two kilometre triangular configuration positioned in the Sound Fixing and Ranging channel for optimum performance. The water depth is approximately 1200 m with the hydrophones connected to a riser cable of approximately 700 m in length. The deployment was conducted from a cable vessel utilising high precision global and dynamic positioning system to position the sensors as close as possible to the planned locations. Although high confidence in the sensor locations was achieved during the vessel operation, the locations were verified by independent means in order to refine sensor locations, optimize station performance, and to ensure that the deployment was within the tolerance of the terms of reference for the deployment. The alternative estimate of the individual sensor locations was formulated as a global optimization problem with 10 unknown parameters, i.e., latitude, longitude and depth for each sensor within a station and an effective sound speed value in water. The objective function was defined as a least-mean-square type error function between modelled and measured arrival times between pairs of hydrophones. The arrival times were obtained by cross-correlating radiated noise from the surface vessel deploying the sensors while performing a dedicated known track for the purpose of the hydrophone localization. Results from the hydrophone localization estimation are presented and compared to the planned positions together with uncertainty estimates caused by independent modelling and measurement errors.

  7. CoralWatch Data Analysis at Hoi Ha Wan Marine Park, Hong Kong

    Science.gov (United States)

    Lau, A.; Hodgson, P.

    2015-12-01

    CoralWatch is a conservation organization that is based at the University of Queensland in Australia. Their development of the "Coral Health Chart" standardized the colour of corals for the further investigation of coral health and bleaching. The location of this project is in the NE part of Hong Kong in New Territories. The location faces ShenZhen, a heavily industrialized city, which is known for its pollution of the Pearl River. This area is protected by the Hong Kong Government and the WWF since 1996.Human activities have caused large amounts of greenhouse gasses to be released into the atmosphere. Carbon dioxide has caused the global temperature to rise and made ocean waters more acidic due to ocean respiration. The ocean is a carbon sink for mankind and the effect of severe acidification is negatively affecting marine life. The increase of temperature diminishes the amount of diversity of marine life; the decreasing acidity of the water has eliminated many species of shellfish and sea anemone; the increase of marine exploitation has decreased the diversity of marine life. The release of toxic waste, mainly mercury, waste and plastic products has also polluted the oceans which negatively impact coral reefs and endanger marine life.The data has been collected by observing the colours and discolouration (bleaching) of the corals of approximately 40 colonies per month. The species of coral in Hoi Ha Wan include, Favites flexuosa, Goniopora columna,Leptastrea purpurea, Lithophyllon undulatum, Pavona decussata. and Platygyra acuta (AFCD,1). The evaluation of four years of coralwatch data has shown the bleaching of hard boulder corals in Hoi Ha Wan, Hong Kong, has halted and the reefs are being to show signs of regeneration. Local marine biologists credited the improved situation of the corals to protected status of the area.

  8. Effect of a high molecular weight hyaluronic acid (HA) preparation on the stimulation of polymorphonulcear leukocytes (PMNL)

    Energy Technology Data Exchange (ETDEWEB)

    McNeil, J.; Chow, D.C.; Skosey, J.L.

    1986-03-01

    During the process of joint inflammation PMNL are attracted into the joint space by chemotactic agents and are stimulated by immune complexes, particular matter (eg, crystals, cartilage debris) and other phlogistic agents. This process occurs in an environment rich in HA. The authors have examined the effect of high molecular weight HA. They have examined the effect of high molecular weight HA upon PMNL stimulation. PMNL were isolated from human blood and stimulated with either opsonized zymosan or formyl-methionyl-leucyl-phenylalanine (fmlp). The authors assessed stimulation by measuring the ability of cell supernatants to promote the release of /sup 35/S from chips of rabbit articular cartilage labeled in vivo, and the enhancement of oxidation of (1-/sup 14/C)glucose to /sup 14/CO/sub 2/. Stimulation of cells with zym in the presence of HA, 0.125-2.5 mg/ml, resulted in enhanced /sup 35/S release (33-59% over zym alone) and /sup 14/CO/sub 2/ production (0.5-64%). However, HA failed to enhance responses when fmlp (+cytochalasin B) was used as the stimulus. It has been demonstrated that high molecular weight HA inhibits phagocytosis of both latex and aggregated IgG. In our studies, it is likely that HA interference with ingestion of zym leads to frustrated phagocytosis and enhancement of PMNL responses. Similar modification of responses of inflammatory mediator cells could occur in inflamed joints.

  9. [Effect of terpene penetration enhancer and its mechanisms on membrane fluidity and potential of HaCaT keratinocytes].

    Science.gov (United States)

    Lan, Yi; Wang, Jing-yan; Liu, Yan; Ru, Qing-guo; Wang, Yi-fei; Yu, Jing-xin; Wu, Qing

    2015-02-01

    The aim of this paper was to investigate the effect of terpene penetration enhancers on membrane fluidity and membrane potential using HaCaT keratinocytes, and study the potential mechanisms of these terpene compounds using as natural transdermal penetration enhancer. Six terpene compounds, namely menthol, limonene, 1,8-cineole, menthone, terpinen-4-ol and pulegone, were chosen in this study on account of their good penetration-enhancement activities. The cytotoxicity of these terpene compounds was measured using an MTT assay. The fluorescence recovery after photobleaching (FRAP) technique was employed to measure the change of membrane fluidity of HaCaT cells. The flow cytometer was used to study the alteration of membrane fluidity of HaCaT cells, and investigate the effect of terpene compounds on intracellular Ca2+. It was found that 6 terpene compounds possessed low cytotoxicity in comparison to the well-established and standard penetration enhancer azone. Those terpene compounds could significantly enhance HaCaT cells membrane fluidity and decrease HaCaT cells membrane potentials. Meanwhile, after treated with various terpene compounds, the Ca2(+)-ATPase activity and intracellular Ca2+ of HaCaT cells was decreased significantly. Terpene penetration enhancers perhaps changed the membrane fluidity and potentials of HaCaT cells by altering the Ca2+ balance of the cell inside and outside, resulting in the low skin permeability to increase the drug transdermal absorption.

  10. Fabrication of Biodegradable Low Elastic Porous Mg-Zn-Mn-HA Alloy by Spark Plasma Sintering for Orthopaedic Applications

    Science.gov (United States)

    Pal Singh, Bhupinder; Singh, Ramandeep; Mehta, J. S.; Prakash, Chander

    2017-08-01

    In the present research work, porous Mg-Zn-Mn-HA alloy was successfully fabricated by mechanical alloying of magnesium (Mg), manganese (Mn), zinc (Zn), and hydroxyapatite (HA) powders followed by consolidation using Spark Plasma Sintering technique. The microstructure, surface topography, and element composition of the Mg-Zn-Mn-HA alloy was investigated using optical microscope, field-emission scanning electron microscopy, and energy-dispersive X-ray spectroscopy. The micro-hardness of the specimens was measured on a Vickers hardness tester. The microstructure and FESEM examination of the compact revealed that the alloy distinctly shows the porosities in the microstructure. It was observed that complex reactions between HA and alloy elements occurred during the sintering process of Mg-Zn-Mn-HA alloy and biocompatible phases such as Manganese Oxide ((MnO)0.441 (CaO)0.559), Mg0.97 Zn0.03, Manganese Phosphide (Mn1.9 P), Calcium Manganese Oxide (Ca2 Mn8 O16), and Zincite (ZnO2) were generated in the compact, which is beneficial to form apatite and improved the bioactivity of the alloy for osseiointegartion. The fabricated Mg-Zn-Mn-HA alloy exhibits maximum micro-hardness (∼97 HV), which is very high value as compared to the alloys reported in literature. Based on these above observations, it is expected that the as-fabricated Mg-Zn-Mn-HA alloy is suggested for orthopaedic applications.

  11. Synthesis of nano-hydroxyapatite (nHA) from waste mussel shells using a rapid microwave method

    Energy Technology Data Exchange (ETDEWEB)

    Shavandi, Amin, E-mail: amin.shavandi@postgrad.otago.ac.nz [Department of Food Sciences, University of Otago, Dunedin (New Zealand); Bekhit, Alaa El-Din A. [Department of Food Sciences, University of Otago, Dunedin (New Zealand); Ali, Azam [Department of Applied Sciences, University of Otago, Dunedin (New Zealand); Sun, Zhifa [Department of Physics, University of Otago, Dunedin (New Zealand)

    2015-01-15

    Nano-crystalline hydroxyapatite (HA, Ca{sub 10}(PO{sub 4}){sub 6}(OH){sub 2}) was produced from waste mussel shells using a rapid microwave irradiation method. Mussel shells were converted to rod like nano-crystalline HA particles of 30–70 nm long using 0.1 M EDTA as a chelating agent for 30 min after an appropriate pre-treatment and an irradiation step in a microwave with a power of 1.1 kW. The produced HA was characterised using X-ray diffraction (XRD), scanning electron microscopy (SEM) coupled with energy-dispersive X-ray spectroscopy (EDS), transmission electron microscopy (TEM), thermo gravimetric analysis (TGA), Fourier transform infrared spectroscopy (FT-IR) and inductively coupled plasma mass spectrometry (ICP-MS) to determine the morphology, particle size, crystal phases, elemental composition and thermal behaviour. Furthermore, to benchmark the synthesized HA obtained from mussel shells, it was compared with a commercially pure HA (Sigma–Aldrich). The thermal analysis showed that the synthesized HA has remarkable heat stability at 1000 °C, and the XRD and FTIR results showed a high purity of the synthesized HA powders. Compared to the conventional hydrothermal treatment, microwave-assisted method has the advantages of an increased rate of HA formation. The obtained HA have potential engineering applications as materials for bone-tissues. - Highlights: • Waste mussel shells were successfully converted to nano sized hydroxyapatite. • Microwave-assisted technique accelerated the conversion process. • The physicochemical properties of the produced hydroxyapatite are reported. • The prepared hydroxyapatite has nano sized particles of less than 100 nm.

  12. Understanding the undelaying mechanism of HA-subtyping in the level of physic-chemical characteristics of protein.

    Directory of Open Access Journals (Sweden)

    Mansour Ebrahimi

    Full Text Available The evolution of the influenza A virus to increase its host range is a major concern worldwide. Molecular mechanisms of increasing host range are largely unknown. Influenza surface proteins play determining roles in reorganization of host-sialic acid receptors and host range. In an attempt to uncover the physic-chemical attributes which govern HA subtyping, we performed a large scale functional analysis of over 7000 sequences of 16 different HA subtypes. Large number (896 of physic-chemical protein characteristics were calculated for each HA sequence. Then, 10 different attribute weighting algorithms were used to find the key characteristics distinguishing HA subtypes. Furthermore, to discover machine leaning models which can predict HA subtypes, various Decision Tree, Support Vector Machine, Naïve Bayes, and Neural Network models were trained on calculated protein characteristics dataset as well as 10 trimmed datasets generated by attribute weighting algorithms. The prediction accuracies of the machine learning methods were evaluated by 10-fold cross validation. The results highlighted the frequency of Gln (selected by 80% of attribute weighting algorithms, percentage/frequency of Tyr, percentage of Cys, and frequencies of Try and Glu (selected by 70% of attribute weighting algorithms as the key features that are associated with HA subtyping. Random Forest tree induction algorithm and RBF kernel function of SVM (scaled by grid search showed high accuracy of 98% in clustering and predicting HA subtypes based on protein attributes. Decision tree models were successful in monitoring the short mutation/reassortment paths by which influenza virus can gain the key protein structure of another HA subtype and increase its host range in a short period of time with less energy consumption. Extracting and mining a large number of amino acid attributes of HA subtypes of influenza A virus through supervised algorithms represent a new avenue for

  13. The highly conserved HA2 protein of the influenza A virus induces a cross protective immune response.

    Science.gov (United States)

    Lee, Jong-Soo; Chowdhury, Mohammed Y E; Moon, Ho-Jin; Choi, Young-Ki; Talactac, Melbourne R; Kim, Jae-Hoon; Park, Min-Eun; Son, Hwa-Young; Shin, Kwang-Soon; Kim, Chul-Joong

    2013-12-01

    Existing influenza vaccines protect mostly homologous subtypes and acted most effectively only when well matched to the circulating strain. Immunization with an updated vaccine is therefore necessary to maintain long-term protection and the development of a broadly protective influenza vaccine against the threat of pandemic outbreak. The highly conserved HA2 glyco-polypeptide (HA2 gp) is a promising new candidate for such an influenza vaccine. Helical domain and the fusion peptide (residues 15-137) of surface antigen from influenza A subtype A/EM/Korea/W149/06 (H5N1) was used to assess the potentiality of HA2 vaccination against multiple subtypes of the influenza viruses. The construct, named H5HA2 was expressed in Escherichia coli and allowed to refold from inclusion bodies. Purified proteins were used to investigate the immunogenicity of H5HA2 and its potential for cross protection. The immunization of mice with H5HA2 induced HA2 antibodies, HA2 specific T-cell responses, and protection against homologous A/EM/Korea/W149/06 (H5N1) influenza. Immunized mice were also protected from two distinct heterosubtypes of influenza: A/Puerto Rico/1/34(H1N1) and bird/Korea/w81/2005(H5N2). Results suggest that recombinant proteins based on the highly conserved residues within HA2 are candidates for the development of vaccines against pandemic outbreaks of emergent influenza variants. Copyright © 2013 Elsevier B.V. All rights reserved.

  14. Understanding the undelaying mechanism of HA-subtyping in the level of physic-chemical characteristics of protein.

    Science.gov (United States)

    Ebrahimi, Mansour; Aghagolzadeh, Parisa; Shamabadi, Narges; Tahmasebi, Ahmad; Alsharifi, Mohammed; Adelson, David L; Hemmatzadeh, Farhid; Ebrahimie, Esmaeil

    2014-01-01

    The evolution of the influenza A virus to increase its host range is a major concern worldwide. Molecular mechanisms of increasing host range are largely unknown. Influenza surface proteins play determining roles in reorganization of host-sialic acid receptors and host range. In an attempt to uncover the physic-chemical attributes which govern HA subtyping, we performed a large scale functional analysis of over 7000 sequences of 16 different HA subtypes. Large number (896) of physic-chemical protein characteristics were calculated for each HA sequence. Then, 10 different attribute weighting algorithms were used to find the key characteristics distinguishing HA subtypes. Furthermore, to discover machine leaning models which can predict HA subtypes, various Decision Tree, Support Vector Machine, Naïve Bayes, and Neural Network models were trained on calculated protein characteristics dataset as well as 10 trimmed datasets generated by attribute weighting algorithms. The prediction accuracies of the machine learning methods were evaluated by 10-fold cross validation. The results highlighted the frequency of Gln (selected by 80% of attribute weighting algorithms), percentage/frequency of Tyr, percentage of Cys, and frequencies of Try and Glu (selected by 70% of attribute weighting algorithms) as the key features that are associated with HA subtyping. Random Forest tree induction algorithm and RBF kernel function of SVM (scaled by grid search) showed high accuracy of 98% in clustering and predicting HA subtypes based on protein attributes. Decision tree models were successful in monitoring the short mutation/reassortment paths by which influenza virus can gain the key protein structure of another HA subtype and increase its host range in a short period of time with less energy consumption. Extracting and mining a large number of amino acid attributes of HA subtypes of influenza A virus through supervised algorithms represent a new avenue for understanding and

  15. Understanding the Underlying Mechanism of HA-Subtyping in the Level of Physic-Chemical Characteristics of Protein

    Science.gov (United States)

    Ebrahimi, Mansour; Aghagolzadeh, Parisa; Shamabadi, Narges; Tahmasebi, Ahmad; Alsharifi, Mohammed; Adelson, David L.

    2014-01-01

    The evolution of the influenza A virus to increase its host range is a major concern worldwide. Molecular mechanisms of increasing host range are largely unknown. Influenza surface proteins play determining roles in reorganization of host-sialic acid receptors and host range. In an attempt to uncover the physic-chemical attributes which govern HA subtyping, we performed a large scale functional analysis of over 7000 sequences of 16 different HA subtypes. Large number (896) of physic-chemical protein characteristics were calculated for each HA sequence. Then, 10 different attribute weighting algorithms were used to find the key characteristics distinguishing HA subtypes. Furthermore, to discover machine leaning models which can predict HA subtypes, various Decision Tree, Support Vector Machine, Naïve Bayes, and Neural Network models were trained on calculated protein characteristics dataset as well as 10 trimmed datasets generated by attribute weighting algorithms. The prediction accuracies of the machine learning methods were evaluated by 10-fold cross validation. The results highlighted the frequency of Gln (selected by 80% of attribute weighting algorithms), percentage/frequency of Tyr, percentage of Cys, and frequencies of Try and Glu (selected by 70% of attribute weighting algorithms) as the key features that are associated with HA subtyping. Random Forest tree induction algorithm and RBF kernel function of SVM (scaled by grid search) showed high accuracy of 98% in clustering and predicting HA subtypes based on protein attributes. Decision tree models were successful in monitoring the short mutation/reassortment paths by which influenza virus can gain the key protein structure of another HA subtype and increase its host range in a short period of time with less energy consumption. Extracting and mining a large number of amino acid attributes of HA subtypes of influenza A virus through supervised algorithms represent a new avenue for understanding and

  16. Les stratégies spatiales de la population haïtienne à Miami

    Directory of Open Access Journals (Sweden)

    Cédric Audebert

    2008-02-01

    Full Text Available Le schéma migratoire haïtien s’est traduit par la genèse d’un champ migratoire international entre le pays d’origine et Miami, où la population d’origine haïtienne a enregistré une croissance rapide. Dans une métropole floridienne marquée par une forte ségrégation « ethno-raciale » et socio-économique, les nouveaux venus se sont installés à l’origine dans les quartiers noirs centraux paupérisés. Les incidences de la politique migratoire fédérale sont apparues contrastées, occasionnant le repli sur soi des immigrants à Little Haiti lorsqu’elle était défavorable ou rendant possible la mobilité résidentielle dans une conjoncture d’assouplissement de la législation. Ultérieurement, la complexité croissante de l’espace de l’immigration haïtienne, caractérisé par une évolution rapide de son étendue et de ses formes, s’est manifestée par une dichotomie marquée entre l’« enclave » traditionnelle et les nouveaux espaces d’installation en banlieue. Résultat d’une dynamique d’agrégation autant choisie que contrainte, la concentration spatiale des Haïtiens à Miami s’est traduite par la genèse de secteurs d’implantation privilégiée, terrains favorables à la mise en place de processus de territorialisation complexes. L’apprentissage mental et fonctionnel de l’espace vise à faire sienne la terre d’immigration et à la doter de sens, et apparaît comme le préalable à la mise en place de stratégies collectives de territorialisation. La « prise de possession » d’une portion de l’aire métropolitaine et son affectation à des activités sociales, commerciales et de représentation politique visent à assurer la pérennité du lien communautaire haïtien en créant de la cohésion, de la solidarité et de la socialité.Haitian emigration has evolved within the growing dependency of Haiti from the United States throughout the XXth century. The Haitian migratory pattern

  17. Eesti filmikunstitööstus elab üha enam välisriikidest tuleva raha toel / Erik Aru

    Index Scriptorium Estoniae

    Aru, Erik

    2007-01-01

    Eesti filmikunsti tootmise üha paranevast olukorrast. Riiklikule toetusele lisanduvad kaastootmisfondide, EL-i programmi Media ja Eurimage'i, kaastootmisturul Baltic Event sõlmitud lepingute kaudu laekuvad summad

  18. Effects of bound versus soluble pentosan polysulphate in PEG/HA-based hydrogels tailored for intervertebral disc regeneration.

    Science.gov (United States)

    Frith, Jessica E; Menzies, Donna J; Cameron, Andrew R; Ghosh, P; Whitehead, Darryl L; Gronthos, S; Zannettino, Andrew C W; Cooper-White, Justin J

    2014-01-01

    Previous reports in the literature investigating chondrogenesis in mesenchymal progenitor cell (MPC) cultures have confirmed the chondro-inductive potential of pentosan polysulphate (PPS), a highly sulphated semi-synthetic polysaccharide, when added as a soluble component to culture media under standard aggregate-assay conditions or to poly(ethylene glycol)/hyaluronic acid (PEG/HA)-based hydrogels, even in the absence of inductive factors (e.g. TGFβ). In this present study, we aimed to assess whether a 'bound' PPS would have greater activity and availability over a soluble PPS, as a media additive or when incorporated into PEG/HA-based hydrogels. We achieved this by covalently pre-binding the PPS to the HA component of the gel (forming a new molecule, HA-PPS). We firstly investigated the activity of HA-PPS compared to free PPS, when added as a soluble factor to culture media. Cell proliferation, as determined by CCK8 and EdU assay, was decreased in the presence of either bound or free PPS whilst chondrogenic differentiation, as determined by DMMB assay and histology, was enhanced. In all cases, the effect of the bound PPS (HA-PPS) was more potent than that of the unbound form. These results alone suggest wider applications for this new molecule, either as a culture supplement or as a coating for scaffolds targeted at chondrogenic differentiation or maturation. We then investigated the incorporation of HA-PPS into a PEG/HA-based hydrogel system, by simply substituting some of the HA for HA-PPS. Rheological testing confirmed that incorporation of either HA-PPS or PPS did not significantly affect gelation kinetics, final hydrogel modulus or degradation rate but had a small, but significant, effect on swelling. When encapsulated in the hydrogels, MPCs retained good viability and rapidly adopted a rounded morphology. Histological analysis of both GAG and collagen deposition after 21 days showed that the incorporation of the bound-PPS into the hydrogel resulted in

  19. Debris flows from small catchments of the Ma Ha Tuak Range, metropolitan Phoenix, Arizona

    Science.gov (United States)

    Dorn, Ronald I.

    2010-08-01

    Debris flows debauch from tiny but steep mountain catchments throughout metropolitan Phoenix, Arizona, USA. Urban growth in the past half-decade has led to home construction directly underneath hundreds of debris-flow channels, but debris flows are not recognized as a potential hazard at present. One of the first steps in a hazard assessment is to determine occurrence rates. The north flank of the Ma Ha Tuak Range, just 10 km from downtown Phoenix, was selected to determine the feasibility of using the varnish microlaminations (VML) method to date every debris-flow levee from 127 catchment areas. Only 152 of the 780 debris-flow levees yielded VML ages in a first round of sampling; this high failure rate is due to erosion of VML by microcolonial fungi. The temporal pattern of preserved debris-flow levees indicates anomalously high production of debris flows at about 8.1 ka and about 2.8 ka, corresponding to Northern Hemisphere climatic anomalies. Because many prior debris flows are obliterated by newer events, the minimum overall occurrence rates of 1.3 debris flows per century for the last 60 ka, 2.2 flows/century for the latest Pleistocene, and 5 flows/century for the last 8.1 ka has little meaning in assessment of a contemporary hazard. This is because newer debris flows have obliterated an unknown number of past deposits. More meaningful to a hazards analysis is the estimate that 56 flows have occurred in the last 100 years on the north side of the range, an estimate that is consistent with direct observations of three small debris flows resulting events from a January 18-22, 2010 storm producing 70 mm of precipitation in the Ma Ha Tuak Range, and a 500 m long debris flow in a northern metropolitan Phoenix location that received over 150 mm of precipitation in this same storm. These findings support the need for a more extensive hazard assessment of debris flows in metropolitan Phoenix.

  20. Les Pénicillates de Haïti décrits par H.F. Loomis

    NARCIS (Netherlands)

    Condé, B.; Terver, D.

    1965-01-01

    Les deux seules especes de Pénicillates connues de Haïti (Hispaniola) ont été décrites par H. F. LOOMIS (1934b, 1936): Lophoproctus niveus, de l’île Beata près de la cote méridionale de Haïti, auquel furent attribués aussi des specimens récoltés plus tard à Kenscoff, et Lophoproctus aequatus, de

  1. Understanding the roles of nanoparticle dispersion and polymer crystallinity in controlling the mechanical properties of HA/PHBV nanocomposites.

    Science.gov (United States)

    Noohom, Wadcharawadee; Jack, Kevin S; Martin, Darren; Trau, Matt

    2009-02-01

    Nano-sized hydroxyapatite (HA) particles stabilized using poly(acrylic acid) (PAA) as a dispersing agent, and sonic energy to further increase dispersion, were blended with poly(hydroxybutyrate-co-hydroxyvalerate) (PHBV) using a precipitation/gelation method to produce HA/PHBV nanocomposites with up to 16% by weight of HA content. The level of HA nanoparticle dispersion was monitored in the precursor dispersions prior to composite production and in the nanocomposites by a range of techniques including visual observation, turbidity measurements and electron microscopy, and the roles of the dispersing agent and the sonic energy in controlling the dispersion of HA particles in both the precursor dispersions and the final composites as well as their effects on the compressive strength and Young's modulus were investigated. It was found that HA suspensions treated with both PAA and sonic energy possessed significantly better colloidal stability compared to untreated suspensions or suspensions treated with either PAA or sonic energy. This, in turn, resulted in better dispersion of HA nanoparticles in the composites and higher compressive moduli as a function of the particle loading. This enhancement in stiffness of the composites was attributed primarily to the increased surface area of the HA filler in the more highly dispersed samples, but also to an observed increase in the crystalline content achievable after annealing of the samples. It is proposed that this increase in crystallinity is due to the more highly dispersed particles acting as nucleation sites for the crystallization of the PHBV at the particle interface, which, in turn, leads to enhancement of the bonding between the matrix and filler.

  2. Understanding the roles of nanoparticle dispersion and polymer crystallinity in controlling the mechanical properties of HA/PHBV nanocomposites

    Energy Technology Data Exchange (ETDEWEB)

    Noohom, Wadcharawadee; Jack, Kevin S; Martin, Darren; Trau, Matt, E-mail: k.jack@uq.edu.a [Australian Institute for Bioengineering and Nanotechnology, University of Queensland, Queensland 4072 (Australia)

    2009-02-15

    Nano-sized hydroxyapatite (HA) particles stabilized using poly(acrylic acid) (PAA) as a dispersing agent, and sonic energy to further increase dispersion, were blended with poly(hydroxybutyrate-co-hydroxyvalerate) (PHBV) using a precipitation/gelation method to produce HA/PHBV nanocomposites with up to 16% by weight of HA content. The level of HA nanoparticle dispersion was monitored in the precursor dispersions prior to composite production and in the nanocomposites by a range of techniques including visual observation, turbidity measurements and electron microscopy, and the roles of the dispersing agent and the sonic energy in controlling the dispersion of HA particles in both the precursor dispersions and the final composites as well as their effects on the compressive strength and Young's modulus were investigated. It was found that HA suspensions treated with both PAA and sonic energy possessed significantly better colloidal stability compared to untreated suspensions or suspensions treated with either PAA or sonic energy. This, in turn, resulted in better dispersion of HA nanoparticles in the composites and higher compressive moduli as a function of the particle loading. This enhancement in stiffness of the composites was attributed primarily to the increased surface area of the HA filler in the more highly dispersed samples, but also to an observed increase in the crystalline content achievable after annealing of the samples. It is proposed that this increase in crystallinity is due to the more highly dispersed particles acting as nucleation sites for the crystallization of the PHBV at the particle interface, which, in turn, leads to enhancement of the bonding between the matrix and filler.

  3. Does hyaluronic acid-carboxymethylcellulose (HA-CMC) membrane interfere with the healing of intestinal suture lines and abdominal incisions?

    Science.gov (United States)

    Yamaner, Sümer; Kalayci, Murat; Barbaros, Umut; Balik, Emre; Bulut, Türker

    2005-03-01

    Although hyaluronic acid-carboxymethylcellulose (HA-CMC) membrane has the advantage of preventing intraabdominal adhesions, it has theoretical risk of negative effects on the healing of intestinal suture lines by forming a barrier between the suture lines and neighboring serosal surfaces. This study evaluated the effect of HA-CMC on bowel anastomoses, scar healing, and intraabdominal adhesion formation. Two groups of 10 male Sprague-Dawley rats were examined. In the first group, laparotomy was performed with a median incision. Colotomy on the cecum and a single-layer repair of the bowel wall was performed. HA-CMC membrane was placed on the cecal suture line and under the laparotomy incision before abdominal closure. The second group had the same procedure but no HA-CMC membrane was placed. The animals were killed on postoperative day 14. Intraabdominal adhesions, laparotomy suture line endurance, bursting pressure of the repaired cecal wall, and tissue hydroxyproline levels were determined. The repaired cecal wall was also examined histopathologically. The statistical analyses revealed that HA-CMC prevented intraabdominal adhesions significantly. No negative effects of this material on the healing of the bowel and laparotomy suture lines were observed. HA-CMC appears to be a safe material to prevent intraabdominal adhesions, without negative effects on the healing of abdominal incisions and bowel suture lines.

  4. Mechanical properties of titanium-hydroxyapatite (Ti-HA) composite coating on stainless steel prepared by thermal spraying

    Science.gov (United States)

    Rosmamuhamadani, R.; Azhar, N. H.; Talari, M. K.; Yahaya, Sabrina M.; Sulaiman, S.; Ismail, M. I. S.

    2017-09-01

    Addition of hydroxyapatite (HA) can enhance the bioactivity of the common metallic implant due to its similarity with natural bones and teeth. In this investigation, high velocity oxy-fuel (HVOFT) technique was used to deposit titanium-hydroxyapatite (Ti-HA) composite on stainless steel substrate plate with different percentage of HA for biomedical applications. The aim of this research is to investigate the mechanical properties of Ti-HA coating such as hardness, adhesion strength and wear behaviour. The hardness and strength was determined by using SHIMADZU-microhardness Vickers tester and PosiTest AT portable adhesion tester respectively. The wear test was performed by using pin-on-disk equipment and field emission scanning electron microscope (FESEM) used to determine the extent of surface damage. From the results obtained, mechanical properties such as hardness and adhesion strength of titanium (Ti) coating decreased with the increased of HA contents. Meanwhile, the coefficient of friction of Ti-10% HA coating shows the highest value compare to others as three-body abrasion had occurred during the test.

  5. Structure, mechanical property and corrosion behaviors of (HA+β-TCP)/Mg-5Sn composite with interpenetrating networks.

    Science.gov (United States)

    Wang, X; Li, J T; Xie, M Y; Qu, L J; Zhang, P; Li, X L

    2015-11-01

    In this paper, a novel (Hydroxyapatite+β-tricalcium phosphate)/Mg-5Sn ((HA+β-TCP)/Mg-5Sn) composite with interpenetrating networks was fabricated by infiltrating Mg-5Sn alloy into porous HA+β-TCP using suction casting technique. The structure, mechanical property and corrosion behaviors of the composite have been evaluated by means of scanning electron microscopy (SEM), X-ray diffraction (XRD), mechanical testing, electrochemical and immersion test. It is shown that the molten Mg-5Sn alloy has infiltrated not only into the pores but also into the struts of the HA+β-TCP scaffold to forming a compact composite. The microstructure observation also shows that the Mg alloy contacts to the HA+β-TCP closely, and no reaction layer can be found between Mg-5Sn alloy and scaffold. The ultimate compressive strength of the composite is as high as 176MPa, which is about four fifths of the strength of the Mg-5Sn bulk alloy. The electrochemical and immersion tests indicate that the corrosion resistance of the composite is better than that of the Mg-5Sn bulk alloy. The corrosion products on the composite surface are mainly Mg(OH)2, Ca3(PO4)2 and HA. Appropriate mechanical and corrosion properties of the (HA+β-TCP)/Mg-5Sn composite indicate its possibility for new bone tissue implant materials. Copyright © 2015 Elsevier B.V. All rights reserved.

  6. Transgenic Cotton Plants Expressing the HaHR3 Gene Conferred Enhanced Resistance to Helicoverpa armigera and Improved Cotton Yield.

    Science.gov (United States)

    Han, Qiang; Wang, Zhenzhen; He, Yunxin; Xiong, Yehui; Lv, Shun; Li, Shupeng; Zhang, Zhigang; Qiu, Dewen; Zeng, Hongmei

    2017-08-30

    RNA interference (RNAi) has been developed as an efficient technology. RNAi insect-resistant transgenic plants expressing double-stranded RNA (dsRNA) that is ingested into insects to silence target genes can affect the viability of these pests or even lead to their death. HaHR3 , a molt-regulating transcription factor gene, was previously selected as a target expressed in bacteria and tobacco plants to control Helicoverpa armigera by RNAi technology. In this work, we selected the dsRNA- HaHR3 fragment to silence HaHR3 in cotton bollworm for plant mediated-RNAi research. A total of 19 transgenic cotton lines expressing HaHR3 were successfully cultivated, and seven generated lines were used to perform feeding bioassays. Transgenic cotton plants expressing ds HaHR3 were shown to induce high larval mortality and deformities of pupation and adult eclosion when used to feed the newly hatched larvae, and 3rd and 5th instar larvae of H. armigera . Moreover, HaHR3 transgenic cotton also demonstrated an improved cotton yield when compared with controls.

  7. Supervisors and accomplices: extra-marital sex among migrant construction workers in Ha Noi, Viet Nam.

    Science.gov (United States)

    Thuy, Bui Thi Thanh; Kretchmar, Joshua

    2008-06-01

    This study examines the influence of social networks on the sexual relations of migrant construction workers in Ha Noi, Viet Nam. Research included observation and interviews with members of two different groups of workers. The first group, together with their employer (cai), came from the same village; the second group came from different villages. Of interest in the present study was how social relationships among workers and their employers influence extra-marital sexual activity. In the group where workers and their cai came from the same village of origin, fear of acquiring a bad reputation made these workers reluctant to seek sex services, since accounts of their behaviour were transmitted quickly home. In contrast, workers from the group who came from different villages often went out together to purchase sex. The absence of direct links to their villages of origin made it easier for these latter workers to conceal their activity. The implication of these findings for sexual safety and risk are discussed.

  8. Impact of Different Spa Waters on Inflammation Parameters in Human Keratinocyte HaCaT Cells.

    Science.gov (United States)

    Zöller, Nadja; Valesky, Eva; Hofmann, Matthias; Bereiter-Hahn, Jürgen; Bernd, August; Kaufmann, Roland; Meissner, Markus; Kippenberger, Stefan

    2015-12-01

    The treatment of different skin conditions with spa waters is a long tradition dating back to at least late Hellenism. Interestingly, independent scientific examinations studying the effect of spa waters are scarce. In the present in vitro study, we compared the effect of culture media supplemented with (a) thermal spa waters (La Roche-Posay, Avène) and (b) two natural mineral drinking waters (Heppinger, Adelholzener) on physiological parameters in HaCaT keratinocytes. The different medium preparations were investigated with regard to cell proliferation and cell damage. Moreover, the impact on inflammation parameters with and without ultraviolet B (UVB) irradiation was examined. Two popular thermal spring waters were found to suppress cell proliferation and cell damage. Moreover, these waters reversed the induction of interleukin-6, as measured using enzyme-linked immunosorbent assay and promoter transactivation, and the formation of reactive oxygen species after UVB stimulation. Of note, the two natural mineral waters, which are distributed as drinking waters, had some effect on the above-mentioned parameters but to a lesser extent. In summary, our results show that spa waters, and particularly those derived from thermal springs, reduce parameters associated with inflammation. It seems likely that trace elements such as selenium and zinc are critical for the observed effects.

  9. Development of HA/Ag-NPs Composite Coating from Green Process for Hip Applications.

    Science.gov (United States)

    Lozoya-Rodríguez, Denisse A; de Lima, Renata; Fraceto, Leonardo F; Ledezma Pérez, Antonio; Bazaldua Domínguez, Mercedes; Gómez Batres, Roberto; Reyes Rojas, Armando; Orozco Carmona, Víctor

    2017-08-08

    In the present study, biological hydroxyapatite (HA) was obtained from bovine bones through a thermal process. A total of 0% and 1% of silver nanoparticles (Ag-NPs) synthesized from Opuntia ficus (nopal) were added to the biological hydroxyapatite coatings using an atmospheric plasma spray (APS) on a Ti6Al4V substrate. Following this, its antimicrobial efficiency was evaluated against the following bacterial strains: Escherichia coli, Staphylococcus aureus, and Pseudomonas aeruginosa. This was conducted according to the Japanese Industrial Standard (JIS) Z2801:2000 "Antimicrobial Product-Test for Antimicrobial Activity and Efficacy". Scanning electron microscopy (SEM) showed that the silver nanoparticles (Ag-NPs) were evenly distributed on the coating surface. Energy dispersive X-ray spectroscopy (EDX) shows that apatite deposition occurs on a daily basis, maintaining a Ca/P rate between 2.12 and 1.45. Biocompatibility properties were evaluated with osteoblast-like cells (MC3T3-E1) by single-cell gel electrophoresis assay and Tali image cytometry.

  10. Antidiabetics and diuretics show phototoxicity in HaCaT cells

    Science.gov (United States)

    Selvaag, Edgar; Petersen, Anita B.; Gniadecki, Robert; Thorn, Tine; Wulf, Hans Christian

    2001-10-01

    The antidiabetics tolbutamide, glibenclamide, and glipizide, and the diuretics bendroflumethiazide, butizide, furosemide, hydrochlorothiazide, and trichlormethiazide were investigated for potential phototoxicity in the HaCaT cell line. The cells were incubated with the drugs and then exposed to UVA1 irradiation. The effects of the antioxidants L-ascorbic acid, and (alpha) -tocopherol on oxidative DNA damage were assessed. Bendroflumethiazide, furosemide, hydrochlorothiazide, trichlormethiazide, or tolbutamide induced dose-dependent phototoxicity. Cells incubated with bendroflumethiazide, tolbutamide, and glibenclamide, and irradiated with UVA1 demonstrated an increased oxidative DNA damage. Pre-treatment with L-ascorbic acid, or (alpha) -tocopherol, suppressed the UVA-induced DNA damage in cells incubated with 1 mM of bendroflumethiazide, furosemide, glibenclamide, glipizide, tolbutamide, and trichloromethiazide, further implying the involvement of reactive oxygen species in the phototoxic DNA damage. These results may indicate a link between phototoxic and photocancerogenic potential of the sulfonamide-derived oral antidiabetic and diuretic drugs, as it has previously been recognized for psoralen, chlorpromazine, and fluoroquinolones. Excessive exposure to UV light may be deleterious for patients treated with these drugs.

  11. Hyaluronic Acid (HA)-Polyethylene glycol (PEG) as injectable hydrogel for intervertebral disc degeneration patients therapy

    Science.gov (United States)

    Putri Kwarta, Cityta; Widiyanti, Prihartini; Siswanto

    2017-05-01

    Chronic Low Back Pain (CLBP) is one health problem that is often encountered in a community. Inject-able hydrogels are the newest way to restore the disc thickness and hydration caused by disc degeneration by means of minimally invasive surgery. Thus, polymers can be combined to improve the characteristic properties of inject-able hydrogels, leading to use of Hyaluronic Acid (a natural polymer) and Polyethylene glycol (PEG) with Horse Radish Peroxide (HRP) cross linker enzymes. The swelling test results, which approaches were the ideal disc values, were sampled with variation of enzyme concentrations of 0.25 µmol/min/mL. The enzyme concentrations were 33.95%. The degradation test proved that the sample degradation increased along with the decrease of the HRP enzyme concentration. The results of the cytotoxicity assay with MTT assay method showed that all samples resulted in the 90% of living cells are not toxic. In vitro injection, models demonstrated that higher concentration of the enzymes was less state of gel which would rupture when released from the agarose gel. The functional group characterization shows the cross linking bonding in sample with enzyme adding. The conclusion of this study is PEG-HA-HRP enzyme are safe polymer composites which have a potential to be applied as an injectable hydrogel for intervertebral disc degeneration.

  12. Fisica e filosofia come la scienza contemporanea ha modificato il pensiero dell'uomo

    CERN Document Server

    Heisenberg, Werner

    2003-01-01

    Nel corso del Novecento le scoperte della fisica – dalla meccanica quantistica alla teoria della relatività, dalle ricerche sul cosmo all’energia nucleare – hanno travolto le precedenti nozioni di spazio e tempo e rivoluzionato la percezione che l’uomo aveva di sé, investendolo inoltre della responsabilità di una possibile autodistruzione. Figura geniale e controversa, Werner Heisenberg è stato un protagonista assoluto dell’epopea scientifica del secolo scorso, insieme a Bohr e Fermi, Einstein e Planck. Fisica e filosofia esplora la complessità di quello snodo offrendo risposte chiare a domande che non hanno mai perso la loro centralità. Cosa affermano le teorie della fisica contemporanea? In che modo investono la concezione che l’uomo ha di sé? Quali sono i limiti etici delle loro applicazioni tecnologiche? E quale sarà l’influenza politica della scienza su scala planetaria? Affrontando quesiti di portata universale, Heisenberg si dimostra consapevole della necessità di ristabilire la ...

  13. Evaluation of Three Adolescent Sexual Health Programs in Ha Noi and Khanh Hoa Province, Vietnam

    Directory of Open Access Journals (Sweden)

    Van Pham

    2012-01-01

    Full Text Available With an increase in sexual activity among young adults in Vietnam and associated risks, there is a need for evidence-based sexual health interventions. This evaluation of three sexual health programs based on the Protection Motivation Theory (PMT was conducted in 12 communes in Ha Noi, Nha Trang City, and Ninh Hoa District. Inclusion criteria included unmarried youth 15–20 years residing in selected communes. Communes were randomly allocated to an intervention, and participants were randomly selected within each commune. The intervention programs included Vietnamese Focus on Kids (VFOK, the gender-based program Exploring the World of Adolescents (EWA, and EWA plus parental and health provider education (EWA+. Programs were delivered over a ten-week period in the communities by locally trained facilitators. The gender-based EWA program with parental involvement (EWA+ compared to VFOK showed significantly greater increase in knowledge. EWA+ in comparison to VFOK also showed significant decrease at immediate postintervention for intention to have sex. Sustained changes are observed in all three interventions for self-efficacy condom use, self-efficacy abstinence, response efficacy for condoms, extrinsic rewards, and perceived vulnerability for HIV. These findings suggest that theory-based community programs contribute to sustained changes in knowledge and attitudes regarding sexual risk among Vietnamese adolescents.

  14. CoReHA 2.0: A Software Package for In Vivo MREIT Experiments

    Science.gov (United States)

    Jeon, Kiwan

    2013-01-01

    Magnetic resonance electrical impedance tomography (MREIT) is a new medical imaging modality visualizing static conductivity images of electrically conducting subjects. Recently, MREIT has rapidly progressed in its theory, algorithm, and experiment technique and now reached to the stage of in vivo animal experiments. In this paper, we present a software, named CoReHA 2.0 standing for the second version of conductivity reconstructor using harmonic algorithms, to facilitate in vivo MREIT reconstruction of conductivity image. This software offers various computational tools including preprocessing of MREIT data, identification of 2D geometry of the imaging domain and electrode positions, and reconstruction of cross-sectional scaled conductivity images from MREIT data. In particular, in the new version, we added several tools including ramp-preserving denoising, harmonic inpainting, and local harmonic B z algorithm to deal with data from in vivo experiments. The presented software will be useful to researchers in the field of MREIT for simulation, validation, and further technical development. PMID:23509604

  15. The use of sodium hyaluronate-carboxymethylcellulose (HA-CMC) barrier in gynecologic malignancies: a retrospective review of outcomes.

    Science.gov (United States)

    Tan, Annie; Argenta, Peter; Ramirez, Rose; Bliss, Robin; Geller, Melissa

    2009-02-01

    Concerns exist regarding the safety of sodium hyaluronate-carboxymethylcellulose (HA-CMC, Seprafilm) adhesion barrier in regard to cancer survival as a result of in vitro data demonstrating that hyaluronan, a component of HA-CMC, may promote tumor growth. We sought to determine whether use of HA-CMC is associated with duration of disease-free or overall survival and rates of immediate complication in patients with gynecologic malignancies. We identified 202 consecutive patients with epithelial ovarian, fallopian tube, and primary peritoneal cancer who underwent initial surgical staging or interval debulking at the University of Minnesota between January 2001 and December 2004. Information on patients' demographics, medical history, surgical procedures, postoperative complications, disease stage, histology, adjuvant therapy, and disease-free and overall survival was collected from medical records. Survival curves were compared between patients receiving or not receiving HA-CMC by stratified Cox regression models, log rank, and Wilcoxon tests. The level of significance was set to alpha = .05 for each test. Eighty patients received intraoperative placement of HA-CMC and 122 did not. Immediate postoperative complication rates were equivalent in both groups. Median follow-up was 2.1 years. There was no difference in disease-free survival (5-year estimate 23.6% vs. 33.3%, P = .80) or overall survival (5-year estimate 29.7% vs. 40.3%, P = .75) between those who received HA-CMC and those who did not. Our retrospective analysis suggests that HA-CMC adhesion barrier does not affect disease-free survival or overall survival; nor does it increase the immediate postoperative complication rates in patients undergoing abdominal surgery for ovarian, fallopian tube, and primary peritoneal carcinomas.

  16. Adhesion strength characterization of PVDF/HA coating on cp Ti surface modified by laser beam irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Ribeiro, A.A., E-mail: aantunesr@yahoo.com.br [Department of Polymer Technology, School of Chemical Engineering, State University of Campinas, UNICAMP, P.O. Box 6066, Campinas, SP 13083-970 (Brazil); Vaz, L.G. [Department of Dental Materials and Prosthodontics, Araraquara Dental School, UNESP, P.O. Box 331, Araraquara, SP 14801-903 (Brazil); Guastaldi, A.C. [Department of Physical Chemistry, Institute of Chemistry, UNESP, P.O. Box 331, Araraquara, SP 14801-970 (Brazil); Campos, J.S.C. [Department of Polymer Technology, School of Chemical Engineering, State University of Campinas, UNICAMP, P.O. Box 6066, Campinas, SP 13083-970 (Brazil)

    2012-10-01

    Highlights: Black-Right-Pointing-Pointer Titanium substrates are superficially treated by laser beam irradiation. Black-Right-Pointing-Pointer Treated titanium substrates are coated with {alpha}-PVDF and {alpha}-PVDF/HA films. Black-Right-Pointing-Pointer Three-point bending test is used to assess the adhesion strength of coatings. Black-Right-Pointing-Pointer The coatings show good physical adhesion on treated titanium substrates. Black-Right-Pointing-Pointer Three-point bending test appears as an alternative for measuring adhesion strength. - Abstract: Up to the moment, there is no standardized test for measuring the adhesion strength of polymeric coatings on titanium substrate modified by laser beam irradiation. The present work aimed to assess the adhesion strength of polyvinylidene fluoride ({alpha}-PVDF)/hydroxyapatite (HA) composite coating on commercially pure titanium ({alpha}-cp Ti) substrate surface modified by laser beam irradiation, using the three-point bending test. The preparation of coating was carried out by mixing {alpha}-PVDF pellets dissolved in dimethylacetamide (DMA) with HA/DMA emulsion. The mixture was poured onto the {alpha}-cp Ti sample and left to dry in an oven. Commercially pure titanium plates were coated with {alpha}-PVDF/HA composite film, in proportions of 100/00 (PVDF) and 60/40 (PVDF/HA) in weight. The Ti-PVDF/HA samples were subjected to the three-point bending test and analyzed by scanning electron microscopy. According to the results, PVDF and PVDF/HA coatings showed a good adhesion strength on {alpha}-cp Ti surface, since no detachment was observed.

  17. Crystal Structure of the Receptor-Binding Domain of Botulinum Neurotoxin Type HA, Also Known as Type FA or H

    Directory of Open Access Journals (Sweden)

    Guorui Yao

    2017-03-01

    Full Text Available Botulinum neurotoxins (BoNTs, which have been exploited as cosmetics and muscle-disorder treatment medicines for decades, are well known for their extreme neurotoxicity to humans. They pose a potential bioterrorism threat because they cause botulism, a flaccid muscular paralysis-associated disease that requires immediate antitoxin treatment and intensive care over a long period of time. In addition to the existing seven established BoNT serotypes (BoNT/A–G, a new mosaic toxin type termed BoNT/HA (aka type FA or H was reported recently. Sequence analyses indicate that the receptor-binding domain (HC of BoNT/HA is ~84% identical to that of BoNT/A1. However, BoNT/HA responds differently to some potent BoNT/A-neutralizing antibodies (e.g., CR2 that target the HC. Therefore, it raises a serious concern as to whether BoNT/HA poses a new threat to our biosecurity. In this study, we report the first high-resolution crystal structure of BoNT/HA-HC at 1.8 Å. Sequence and structure analyses reveal that BoNT/HA and BoNT/A1 are different regarding their binding to cell-surface receptors including both polysialoganglioside (PSG and synaptic vesicle glycoprotein 2 (SV2. Furthermore, the new structure also provides explanations for the ~540-fold decreased affinity of antibody CR2 towards BoNT/HA compared to BoNT/A1. Taken together, these new findings advance our understanding of the structure and function of this newly identified toxin at the molecular level, and pave the way for the future development of more effective countermeasures.

  18. Crystal Structure of the Receptor-Binding Domain of Botulinum Neurotoxin Type HA, Also Known as Type FA or H

    Energy Technology Data Exchange (ETDEWEB)

    Yao, Guorui; Lam, Kwok-ho; Perry, Kay; Weisemann, Jasmin; Rummel, Andreas; Jin, Rongsheng (Cornell); (Dusseldorf); (UCI)

    2017-03-01

    Botulinum neurotoxins (BoNTs), which have been exploited as cosmetics and muscle-disorder treatment medicines for decades, are well known for their extreme neurotoxicity to humans. They pose a potential bioterrorism threat because they cause botulism, a flaccid muscular paralysis-associated disease that requires immediate antitoxin treatment and intensive care over a long period of time. In addition to the existing seven established BoNT serotypes (BoNT/A–G), a new mosaic toxin type termed BoNT/HA (aka type FA or H) was reported recently. Sequence analyses indicate that the receptor-binding domain (HC) of BoNT/HA is ~84% identical to that of BoNT/A1. However, BoNT/HA responds differently to some potent BoNT/A-neutralizing antibodies (e.g., CR2) that target the HC. Therefore, it raises a serious concern as to whether BoNT/HA poses a new threat to our biosecurity. In this study, we report the first high-resolution crystal structure of BoNT/HA-HC at 1.8 Å. Sequence and structure analyses reveal that BoNT/HA and BoNT/A1 are different regarding their binding to cell-surface receptors including both polysialoganglioside (PSG) and synaptic vesicle glycoprotein 2 (SV2). Furthermore, the new structure also provides explanations for the ~540-fold decreased affinity of antibody CR2 towards BoNT/HA compared to BoNT/A1. Taken together, these new findings advance our understanding of the structure and function of this newly identified toxin at the molecular level, and pave the way for the future development of more effective countermeasures

  19. Stable isotope distribution in continental Maastrichtian vertebrates from the Haţeg Basin, South Carpathians

    Science.gov (United States)

    Bojar, Ana-Voica; Csiki, Zoltan; Grigorescu, Dan

    2010-05-01

    The oxygen isotopic compositions of biogenic apatite from crocodiles, turtles and dinosaurs, and their relationship to climate and physiology have been evidenced by several studies (Barrick and Showers, 1995; Kolodny et al., 1996; Barrick et al., 1999; Fricke and Rogers, 2000; Stoskopf et al., 2001; Straight et al., 2004; Amiot et al., 2007). To date, few attempts have been made to correlate the enamel d13C to dietary resources of dinosaurs (Bocherens et al., 1988; Stanton Thomas and Carlson, 2004; Fricke and Pearson, 2008; Fricke, et al., 2008). One additional complication is that for dinosaurs, the d18O of enamel phosphate depends on both body water and variations in body temperature. Several studies addressed the issue of endothermy vs. ectothermy of fossil vertebrates by studying inter- and intra-bone and enamel isotopic variability (Barrick and Showers, 1994, 1995; Barrick et al., 1996; 1998; Fricke and Rogers, 2000). More recent investigations provided evidence for inter-tooth temporal variations and related them to seasonality and/or changes in physiology (Straight et al., 2004; Stanton Thomas and Carlson, 2004). The main objectives of this study are to extract palaeoclimatic information considering, beside lithofacial characteristics and the isotopic distribution of carbonates formed in paleosols, the stable isotope composition of vertebrate remains from the Haţeg Basin. We also sampled several teeth along their growth axis in order to get further information about growth rates and the amplitude of isotopic variation. Located in the South Carpathians in Romania, the Haţeg Basin contains a thick sequence of Maastrichtian continental deposits yielding a rich dinosaur and mammalian fauna. Stable isotope analyses of both calcretes and dinosaur, crocodilian and turtle remains from two localities (Tuştea and Sibişel) were integrated in order to reconstruct environmental conditions during the Maastrichtian time and to gain further insights into the metabolism

  20. Chronic kidney disease in older people with intellectual disability: results of the HA-ID study.

    Science.gov (United States)

    de Winter, C F; Echteld, M A; Evenhuis, H M

    2014-03-01

    With increasing longevity and cardiovascular events, chronic kidney disease may also become a significant problem in older people with intellectual disability (ID). We studied prevalence and associations of chronic kidney disease as part of the Healthy Ageing and Intellectual Disability (HA-ID) study, a large Dutch cross-sectional study among people with ID aged 50 years and over, using creatinine and cystatin-C measurement in plasma. Glomerular filtration rate (GFR) was calculated using the Modification of Diet in Renal Disease (MDRD) and Chronic Kidney Disease Epidemiology Collaboration (CKD-EPI) equations. Equations based on creatinine (as the MDRD equation) may underestimate kidney dysfunction in people with sarcopenia, because low muscle mass leads to a low creatinine production. Therefore, also prevalence of chronic kidney disease was studied in the sarcopenic group, using different GFR equations. Prevalence of chronic kidney disease, among 635 participants, was 15.3%, which equals prevalence in the general Dutch population. In the group of participants with sarcopenia (n=82), the CKD-EPI equation based on creatinine and cystatin-C gave a higher prevalence of chronic kidney disease than did the MDRD equation, but confidence intervals were very wide. Chronic kidney disease was associated with higher age, Down syndrome, obesity, hypercholesterolemia and hypothyroid disease. GFR should be measured in all older people with ID and polypharmacy, and in older people with ID and Down syndrome as part of the regular health checks. Moreover, if sarcopenia is present and information on GFR is required, this should not be measured based on creatinine only, but additional measures, such as cystatin-C, should be taken into account. Copyright © 2013 Elsevier Ltd. All rights reserved.

  1. 5-fluorouracil Toxicity Mechanism Determination in Human Keratinocytes: in vitro Study on HaCaT

    Directory of Open Access Journals (Sweden)

    Jan Hartinger

    2018-01-01

    Full Text Available 5-fluorouracil (5-FU and capecitabine therapy is often accompanied by palmar-plantar erythrodysesthesia (PPE which is manifestation of 5-FU toxicity in keratinocytes. The main mechanisms of 5-FU action are thymidylate synthase (TS inhibition which can be abrogated by thymidine and strengthened by calciumfolinate (CF and incorporation of fluorouridinetriphosphate into RNA which can be abrogated by uridine. For proper PPE treatment 5-FU mechanism of action in keratinocytes needs to be elucidated. We used the 5-FU toxicity modulators uridine, thymidine and CF to discover the mechanism of 5-FU action in human keratinocyte cell line HaCaT. To measure the cellular viability, we used MTT test and RTCA test. CF did not augment 5-FU toxicity and 5-FU toxicity was weakened by uridine. Therefore, the primary mechanism of 5-FU toxicity in keratinocytes is 5-FU incorporation into RNA. The uridine protective effect cannot fully develop in the presence of CF. Thymidine addition to 5-FU and uridine treated cells not only prevents the toxicity-augmenting CF effect but it also prolongs the 5-FU treated cells survival in comparison to uridine only. Therefore, it can be assumed that in the presence of uridine the 5-FU toxicity mechanism is switched from RNA incorporation to TS inhibition. Although particular 5-FU toxicity mechanisms were previously described in various cell types, this is the first time when various combinations of pyrimidine nucleosides and CF were used for 5-FU toxicity mechanism elucidation in human keratinocytes. We suggest that for PPE treatment ointment containing uridine and thymidine should be further clinically tested.

  2. Insights into a 20-ha multi-contaminated brownfield megasite: An environmental forensics approach

    Energy Technology Data Exchange (ETDEWEB)

    Gallego, J.R., E-mail: jgallego@uniovi.es; Rodríguez-Valdés, E.; Esquinas, N.; Fernández-Braña, A.; Afif, E.

    2016-09-01

    Here we addressed the contamination of soils in an abandoned brownfield located in an industrial area. Detailed soil and waste characterisation guided by historical information about the site revealed pyrite ashes (a residue derived from the roasting of pyrite ores) as the main environmental risk. In fact, the disposal of pyrite ashes and the mixing of these ashes with soils have affected a large area of the site, thereby causing heavy metal(loid) pollution (As and Pb levels reaching several thousands of ppm). A full characterisation of the pyrite ashes was thus performed. In this regard, we determined the bioavailable metal species present and their implications, grain-size distribution, mineralogy, and Pb isotopic signature in order to obtain an accurate conceptual model of the site. We also detected significant concentrations of pyrogenic benzo(a)pyrene and other PAHs, and studied the relation of these compounds with the pyrite ashes. In addition, we examined other waste and spills of minor importance within the study site. The information gathered offered an insight into pollution sources, unravelled evidence from the industrial processes that took place decades ago, and identified the co-occurrence of contaminants by means of multivariate statistics. The environmental forensics study carried out provided greater information than conventional analyses for risk assessment purposes and for the selection of clean-up strategies adapted to future land use. - Highlights: • Complex legacy of contamination afflicts 20-ha brownfield • As and Pb highest soil pollutants • Forensic study reveals main waste and spills. • Comprehensive study of pyrite ashes (multi-point source of pollution) • Co-occurrence of PAH also linked to pyrite ashes.

  3. Magneto-optical and catalytic properties of Fe{sub 3}O{sub 4}@HA@Ag magnetic nanocomposite

    Energy Technology Data Exchange (ETDEWEB)

    Amir, Md., E-mail: mdamir01031001@gmail.com [Department of Chemistry, Fatih University, 34500 B.Çekmece-İstanbul, Turkey (Turkey); Bio & Nanotechnology Engineering, Faculty of Engineering, Istanbul University, 34452 Beyazıt/Fatih-İstanbul (Turkey); Güner, S. [Department of Physics, Fatih University, 34500 B.Çekmece-İstanbul, Turkey (Turkey); Yıldız, A. [Department of Textile Engineering, Namık Kemal University, 59860 Çorlu-Tekirdağ, Turkey (Turkey); Baykal, A. [Department of Chemistry, Fatih University, 34500 B.Çekmece-İstanbul, Turkey (Turkey)

    2017-01-01

    Fe{sub 3}O{sub 4}@HA@Ag magnetic nanocomposites (MNCs) were successfully synthesized by the simple reflux method for the removal of azo dyes from the industrial aqueous media. Fe{sub 3}O{sub 4}@HA@AgMNCs exhibited high catalytic activity to reduce MB within 20 min from the waste water. The obtained materials were characterized by the means of different techniques. Powder X-ray diffraction (XRD) analysis confirmed the single-phase of Fe{sub 3}O{sub 4} spinel structure. SEM and TEM analysis indicated that Fe{sub 3}O{sub 4}@HA@AgMNCs were nanoparticles like structure with small agglomeration. TG result showed that the products contained 9% of HA. The characteristic peaks of HA at 1601 cm{sup −1} and 1703 cm{sup −1} was observed by the means of FT-IR spectra of Fe{sub 3}O{sub 4}@HA@AgMNCs. The hysteresis (σ–H) curves revealed Fe{sub 3}O{sub 4}@HA@Ag MNCs exhibit a typical superparamagnetic characteristic with a saturation magnetization of 59.11 emu/g and measured magnetic moment is 2.45 µ{sub B}. The average magnetic particle dimension (D{sub mag}) is 13.25 nm. In accordance, the average crystallite and particle dimensions were obtained as 11.50 nm and 13.10 nm from XRD and TEM measurements, respectively. Magnetocrystalline anisotropy was offered as uniaxial and calculated effective anisotropy constant (K{sub eff}) is 2.96×10{sup 5} Erg/g. The blocking temperature was estimated as 522 K. The size-dependent saturation magnetization suggests the existence of a magnetically dead layer as 0.793 nm for Fe{sub 3}O{sub 4}@HA@Ag MNCs. The UV–vis diffuse reflectance spectroscopy (DRS) and Kubelka–Munk theory were applied to determine the optical properties of powder samples. The direct optical energy band gap (E{sub g}) values were estimated from Tauc plots between 1.62 eV and 2.12 eV. - Graphical abstract: An illustration for the fabrication of Fe{sub 3}O{sub 4}@HA@Ag MNCs. - Highlights: • The reduction of azo dye such Methylene Blue was instantly completed with

  4. Employing the cyclophosphate to accelerate the degradation of nano-hydroxyapatite/poly(amino acid) (n-HA/PAA) composite materials.

    Science.gov (United States)

    Jing, Linjing; Chen, Li; Peng, Haitao; Ji, Mizhi; Xiong, Yi; Lv, Guoyu

    2017-12-01

    Owing to the good degradability and biocompatibility of polyphosphoesters (PPEs), the aim of the current study was to investigate a novel degradable composite of nano-hydroxyapatite/poly(amino acid) (n-HA/PAA) with cyclophosphate (CPE) via in situ melting polymerization to improve the degradation of n-HA/PAA. The structure of each composite was characterized via Fourier transform infrared spectroscopy, X-ray diffraction, and X-ray photoelectron spectroscopy. The degradation properties were studied in terms of the weight loss and pH in a phosphate-buffered saline (PBS) solution, while the surface morphology was examined using a scanning electron microscope-energy dispersive spectrometer (SEM-EDS) after soaking the surface in simulated body fluid (SBF). The cell proliferation, cell adhesion, and alkaline phosphatase (ALP) activity were used for the analysis of cytocompatibility. The weight loss results showed that the n-HA/PAA composite was 9.98 wt%, weighed after soaking in the PBS solution for 12 weeks, whereas the nano-hydroxyapatite/polyphosphoester-amino acid (n-HA/PPE-AA) composite was 46.94 wt%. The pH of the composites was in a suitable range between 6.64 to 7.06 and finally stabilized at 7.39. The SEM and EDS results revealed the formation of an apatite-like layer on the surface of the n-HA/PPE-AA composites after soaking in SBF for one week. The cell counting Kit 8 (CCK-8) assay of the cell culture in the leaching liquid of the n-HA/PPE-AA composites exhibited non-cytotoxicity and high-proliferation, and the cell adhesion showed the well spreading and normal phenotype extension of the cells on the n-HA/PPE-AA composites surface. Concurrently, the co-culture results of the composites and cells confirmed that the n-HA/PPE-AA composites exhibited a higher ALP activity. In summary, the results demonstrated that the n-HA/PPE-AA composites had a controllable degradation property, good bioactivity, and cytocompatibility.

  5. In Vitro and In Vivo Evaluation of a nHA/PA66 Composite Membrane for Guided Bone Regeneration.

    Science.gov (United States)

    Li, Jidong; Man, Yi; Zuo, Yi; Zhang, Li; Huang, Cui; Liu, Man; Li, Yubao

    2011-01-01

    A nano-hydroxyapatite/polyamide 66 (nHA/PA66) composite with good bioactivity and osteoconductivity is employed to develop a novel porous membrane with an asymmetric structure. In order to investigate the biocompatibility and the effect on guided bone regeneration (GBR) of nHA/PA66 porous membrane, the proliferation, viability, morphology and alkaline phosphatase activity (ALP) of the osteoblast-like cell line (MG63) cultured on the membrane were studied in vitro. In vivo biocompatibility and osteogenesis of the fabricated membrane were assessed by comparing guiding rats calvarial bone defects regeneration with "gold standard" GBR material, expanded polytetrafluoroethylene (e-PTFE) membrane. In vitro experiments showed that the nHA/PA66 composite membrane had good cell affinity and cytocompatibility, in favor of cell proliferation. The in vivo study showed that the nHA/PA66 asymmetric porous membrane had a good GBR effect. All the results indicate that the asymmetric porous nHA/PA66 composite GBR membrane with good biocompatibility, high bioactivity and osteoconductivity exhibits good GBR effect and has a potential to be applied in GBR fields, especially in dental tissue regeneration.

  6. In vitro study of RRS HA injectable mesotherapy/biorevitalization product on human skin fibroblasts and its clinical utilization.

    Science.gov (United States)

    Deglesne, Pierre-Antoine; Arroyo, Rodrigo; Ranneva, Evgeniya; Deprez, Philippe

    2016-01-01

    Mesotherapy/biorevitalization with hyaluronic acid (HA) is a treatment approach currently used for skin rejuvenation. Various products with a wide range of polycomponent formulations are available on the market. Most of these formulations contain noncross-linked HA in combination with a biorevitalization cocktail, formed by various amounts of vitamins, minerals, amino acids, nucleotides, coenzymes, and antioxidants. Although ingredients are very similar among the different products, in vitro and clinical effects may vary substantially. There is a real need for better characterization of these products in terms of their action on human skin or in vitro skin models. In this study, we analyzed the effect of the RRS(®) (Repairs, Refills, Stimulates) HA injectable medical device on human skin fibroblasts in vitro. Skin fibroblast viability and its capacity to induce the production of key extracellular matrix were evaluated in the presence of different concentrations of RRS HA injectable. Viability was evaluated through colorimetric MTT (3-[4,5-dimethylthiazol-2-yl]-2,5 diphenyl tetrazolium bromide) assay, and key extracellular matrix genes, type I collagen and elastin, were quantified by quantitative polymerase chain reaction. Results demonstrated that RRS HA injectable could promote human skin fibroblast viability (+15%) and increase fibroblast gene expression of type I collagen and elastin by 9.7-fold and 14-fold in vitro, respectively. These results demonstrate that mesotherapy/biorevitalization products can, at least in vitro, effectively modulate human skin fibroblasts.

  7. Laser fabrication of Ag-HA nanocomposites on Ti6Al4V implant for enhancing bioactivity and antibacterial capability.

    Science.gov (United States)

    Liu, Xiangmei; Man, H C

    2017-01-01

    For titanium alloy implants, both surface bioactivity and antibacterial infection are the two critical factors in determining the success of clinical implantation of these metallic implants. In the present work, a novel nanocomposite layer of nano-silver-containing hydroxyapatite (Ag-HA) was prepared on the surface of biomedical Ti6Al4V by laser processing. Analysis using SEM, EDS and XRD shows the formation of an Ag-HA layer of about 200μm fusion bonded to the substrate. Mineralization tests in simulated body fluid (SBF) showed that laser fabricated Ag-HA nanocomposite layer favors the deposition of apatite on the surface of the implants. Antibacterial tests confirmed that all Ag-HA nanocomposite layers can kill bacteria while a higher Ag content would lower the cytocompatibility of these coatings. Cell viability decreases when the Ag content reaches 5% in these coatings, due to the larger amount of Ag leached out, as confirmed by ion release evaluation. Our results reveal that laser fabricated Ag-HA nanocomposite coatings containing 2% Ag show both excellent cytocompatibility and antibacterial capability. Copyright © 2016 Elsevier B.V. All rights reserved.

  8. In Vitro Degradation of PHBV Scaffolds and nHA/PHBV Composite Scaffolds Containing Hydroxyapatite Nanoparticles for Bone Tissue Engineering

    Directory of Open Access Journals (Sweden)

    Naznin Sultana

    2012-01-01

    Full Text Available This paper investigated the long-term in vitro degradation properties of scaffolds based on biodegradable polymers and osteoconductive bioceramic/polymer composite materials for the application of bone tissue engineering. The three-dimensional porous scaffolds were fabricated using emulsion-freezing/freeze-drying technique using poly(hydroxybutyrate-co-hydroxyvalerate (PHBV which is a natural biodegradable and biocompatible polymer. Nanosized hydroxyapatite (nHA particles were successfully incorporated into the PHBV scaffolds to render the scaffolds osteoconductive. The PHBV and nHA/PHBV scaffolds were systematically evaluated using various techniques in terms of mechanical strength, porosity, porous morphology, and in vitro degradation. PHBV and nHA/PHBV scaffolds degraded over time in phosphate-buffered saline at 37°C. PHBV polymer scaffolds exhibited slow molecular weight loss and weight loss in the in vitro physiological environment. Accelerated weight loss was observed in nHA incorporated PHBV composite scaffolds. An increasing trend of crystallinity was observed during the initial period of degradation time. The compressive properties decreased more than 40% after 5-month in vitro degradation. Together with interconnected pores, high porosity, suitable mechanical properties, and slow degradation profile obtained from long-term degradation studies, the PHBV scaffolds and osteoconductive nHA/PHBV composite scaffolds showed promises for bone tissue engineering application.

  9. Access to microcredit for women living with, or vulnerable to, HIV in Haïti

    Directory of Open Access Journals (Sweden)

    C. Longuet

    2010-09-01

    Full Text Available Haïti is the poorest country on the American continent. It is also the Caribbean nation where HIV prevalence is the highest: 2.2% of the adults carry the virus.In 2005, GHESKIO, a centre for the care of people living with HIV/AIDS; ACME, Association for Cooperation with Micro Enterprise; and Fondation Mérieux launched a microcredit programme to help women living with HIV/AIDS. The programme was subsequently extended to vulnerable women who had consulted at GHESKIO.In 2006, an impact assessment of the programme among the first 66 women benefiting from a loan showed better living conditions compared to a control group of 30 women with similar initial medical and socioeconomic status but no loan. By mid-2008, 1061 women were the beneficiaries of 1538 loans totalling 11 373 000 gourdes, i.e. approximately 216 000€. Of these, 247 received several loans (up to seven loans to date.Although the women are very poorly educated and live in arduous economic circumstances, the loan repayment records are excellent – around 94% as of mid 2008. There is no difference between HIV-negative women and those living with HIV. Combined with antiretroviral treatment, micro-financing is certainly one of the major instruments for reducing the impact of HIV on the infected populations in countries with limited resources. This programme in Haiti is a demonstration of the feasibility of microcredit in a difficult environment. The great professionalism of the institutions implementing the programme is a key factor in its success.Haïti est le pays le plus pauvre du continent américain. C’est également la région des Caraïbes qui affiche la plus forte prévalence de VIH : 2,2 % des adultes sont porteurs du virus.En 2005, GHESKIO, un centre de soins pour les personnes atteintes du VIH/SIDA, ACME (Association for Cooperation with Micro Enterprise et la Fondation Mérieux ont lancé un programme de microcrédit pour aider les femmes atteintes du VIH/SIDA. Le

  10. [Study on evolutionary origin of influenza A virus (H1N1) based on HA gene].

    Science.gov (United States)

    Lu, Yi-Han; Ju, Li-Wen; Jiang, Lu-Fang; Yang, Ji-Xing; Shi, Qiang; Jiang, Qing-Wu

    2009-07-01

    To determine the evolutionary rate and divergence time of influenza A virus HA gene isolated recently worldwide pandemic and explore the origin and its transmission. A total of 344 H1 sequences available in the GenBank (including 248 isolated from human, 84 from swine, 11 from avian, and 1 from ferret) and 7 isolated in Shanghai were collected. The nucleotide substitution rate and time to most recent common ancestor (tMRCA) was calculated using molecular clock theory and Bayesian Skyline Plot (BSP) based on Markov chain Monte Carlo. Then genetic phylogeny was constructed referring to posterior distribution. It was found that H1 sequences in the US from human, swine and avian were clustered significantly with swine H1 ones from Asia phylogenetically (Cluster US). The second cluster (Cluster Eurasian Human) nearly consisted of human H1 sequences isolated in other regions. The third cluster (Cluster Eurasian Animal) consisted of swine and avian H1 sequences from China and Italy respectively. As for all the H1 sequences, the evolutionary rate was of 2.57 x 10(-3) substitutions/site per year averagely (95% Highest Posterior Density: 1.96 x 10(-3) - 3.03 x 10(-3)/site per year). The estimated dates for tMRCA of human H1 in Europe and swine H1 in the mainland of China were the earliest, with the corresponding rates of 6.46 x 10(-3)/site per year and 0.97 x 10(-3)/site per year respectively. The tMRCAs of human and swine H1 sequences from the US were similar, with the rates of 5.86 x 10(-3)/site per year and 5.02 x 10(-3)/site per year. The present flu outbreak was possibly induced by long-term circulation of influenza A virus (H1N1) in human population and swine herds in America. There was no evidence proving that influenza virus in China involved in the present outbreak.

  11. Hospital-associated methicillin-resistant Staphylococcus aureus (HA-MRSA in Italy

    Directory of Open Access Journals (Sweden)

    Borbone Sonia

    2009-06-01

    Full Text Available Abstract The aim of our study was to trace the dynamic changes of hospital-associated methicillin-resistant Staphylococcus aureus (HA-MRSA lineages in Italy, comparing the genotypic backgrounds of contemporary isolates over a period of 17 years, with those of a sample of early MRSA strains from 1980. In total, 301 non-repetitive MRSA clinical isolates, recovered from 19 Italian hospitals between 1990 and 2007 were selected and analyzed for their antibiotic resistance, typed by PFGE and SCCmec, grouped into clonal-types and further characterized using Multi Locus Sequence Typing (MLST. A sample of fifteen early MRSA strains from 1980 was also used for comparison. The most interesting feature was the recent increase of ST228-MRSA-I (formerly the Italian clone; PFGE E over the period 2000–2007 (57%, when compared to the period 1990–1999 (29%, and its stability to date, associated with a decrease of the highly epidemic ST247-MRSA-IA (formerly the Iberian clone; PFGE A, (23% from 1990 to 1999, 6% from 2000 to 2007. ST1-MRSA-I (1 out of 2 strains carrying ccrA2B2, ST8-MRSA-I (4 strains, ST15-MRSA-I (1 out of 4 carrying ccrA2B2 and ST30-MRSA-I (2 out of 5 carrying no ccrAB-types and ccrC were the predominant earliest STs among the MRSA strains in 1980. A temporal shift in the susceptibility levels to glycopeptides was observed: strains with vancomycin MIC of ≥ 2 mg/L increased from 19.4% to 35.5%. In conclusion, we describe the alternation of MRSA clones that occurred in hospitals from 1990 to 2007 and the increase of the glycopeptide MIC levels, reflecting a worldwide trend. We document the detection of ST1, ST8, ST15 and ST30 in the 1980 isolates; we hypothesize their possible latency and their appearance as the current CA-MRSA clones.

  12. Syndrome of transient headache and neurologic deficits with cerebrospinal fluid lymphocytosis (HaNDL): a pediatric case report.

    Science.gov (United States)

    Gonçalves, Daniel; Meireles, Joana; Rocha, Ruben; Sampaio, Mafalda; Leão, Miguel

    2013-12-01

    The syndrome of transient headache and neurologic deficits associated with cerebrospinal fluid lymphocytosis (HaNDL) is characterized by 1 or more episodes of severe headache, transient neurologic deficits, and lymphocytic pleocytosis in the cerebrospinal fluid. It is a benign and self limited disorder seldom reported in pediatric age. We report the case of a 14-year-old girl who suffered from 2 episodes of headache with transient focal neurologic deficits and pleocytosis consistent with the syndrome of HaNDL. This entity should be taken into account as a differential diagnosis in otherwise healthy children presenting with recurrent headache and acute neurologic deficits. Repeated use of invasive and expensive laboratory and imaging investigations can be avoided when the diagnosis of the syndrome of HaNDL is correctly established.

  13. TGF-α/HA complex promotes tympanic membrane keratinocyte migration and proliferation via ErbB1 receptor

    Energy Technology Data Exchange (ETDEWEB)

    Mei Teh, Bing, E-mail: bing.teh@earscience.org.au [Ear Sciences Centre, School of Surgery, The University of Western Australia, Nedlands, WA (Australia); Ear Science Institute Australia, Subiaco, WA (Australia); Department of Otolaryngology, Head, Neck and Skull Base Surgery, Sir Charles Gairdner Hospital, Nedlands, WA (Australia); Redmond, Sharon L. [Ear Sciences Centre, School of Surgery, The University of Western Australia, Nedlands, WA (Australia); Ear Science Institute Australia, Subiaco, WA (Australia); Shen, Yi [Ear Sciences Centre, School of Surgery, The University of Western Australia, Nedlands, WA (Australia); Ear Science Institute Australia, Subiaco, WA (Australia); Department of Otolaryngology, Head and Neck, Ningbo Lihuili Hospital (Ningbo Medical Centre), Ningbo, Zhejiang (China); Atlas, Marcus D. [Ear Sciences Centre, School of Surgery, The University of Western Australia, Nedlands, WA (Australia); Ear Science Institute Australia, Subiaco, WA (Australia); Department of Otolaryngology, Head, Neck and Skull Base Surgery, Sir Charles Gairdner Hospital, Nedlands, WA (Australia); Marano, Robert J.; Dilley, Rodney J. [Ear Sciences Centre, School of Surgery, The University of Western Australia, Nedlands, WA (Australia); Ear Science Institute Australia, Subiaco, WA (Australia)

    2013-04-01

    Tympanic membrane perforations are common and represent a management challenge to clinicians. Current treatments for chronic perforations involve a graft surgery and require general anaesthesia, including associated costs and morbidities. Bioactive molecules (e.g. growth factors, cytokines) play an important role in promoting TM wound healing following perforation and the use of growth factors as a topical treatment for tympanic membrane perforations has been suggested as an alternative to surgery. However, the choice of bioactive molecules best suited to promote wound healing has yet to be identified. We investigated the effects of hyaluronic acid, vitronectin, TGF-α, IL-24 and their combinations on migration, proliferation and adhesion of cultured human tympanic membrane-derived keratinocytes (hTM), in addition to their possible mechanisms of action. We found that TGF-α, TGF-α/HA and TGF-α/IL-24 promoted wound healing by significantly increasing both migration and proliferation. TGF-α and/or HA treated cells showed comparable cell–cell adhesion whilst maintaining an epithelial cell phenotype. With the use of receptor binding inhibitors for ErbB1 (AG1478) and CD44 (BRIC235), we revealed that the activation of ErbB1 is required for TGF-α/HA-mediated migration and proliferation. These results suggest factors that may be incorporated into a tissue-engineered membrane or directly as topical treatment for tympanic membrane perforations and hence reduce the need for a surgery. - Highlights: ► TGF-α, TGF-α/HA and TGF-α/IL-24 improved hTM keratinocyte migration and proliferation. ► TGF-α and/or HA maintained epithelial cell phenotype. ► TGF-α/HA-mediated migration and proliferation requires activation of ErbB1 receptor.

  14. Antigenicity of the 2015-2016 seasonal H1N1 human influenza virus HA and NA proteins.

    Directory of Open Access Journals (Sweden)

    Amelia M Clark

    Full Text Available Antigenic drift of the hemagglutinin (HA and neuraminidase (NA influenza virus proteins contributes to reduced vaccine efficacy. To analyze antigenic drift in human seasonal H1N1 viruses derived from the 2009 pandemic H1N1 virus (pH1N1-like viruses accounts for the limited effectiveness (around 40% of vaccination against pH1N1-like viruses during the 2015-2016 season, nasal washes/swabs collected from adult subjects in the Rochester, NY area, were used to sequence and isolate the circulating viruses. The HA and NA proteins from viruses circulating during the 2015-2016 season encoded eighteen and fourteen amino acid differences, respectively, when compared to A/California/04/2009, a strain circulating at the origin of the 2009 pandemic. The circulating strains belonged to subclade 6B.1, defined by HA amino acid substitutions S101N, S179N, and I233T. Hemagglutination-inhibiting (HAI and HA-specific neutralizing serum antibody (Ab titers from around 50% of pH1N1-like virus-infected subjects and immune ferrets were 2-4 fold lower for the 2015-2016 circulating strains compared to the vaccine strain. In addition, using a luminex-based mPlex HA assay, the binding of human sera from subjects infected with pH1N1-like viruses to the HA proteins from circulating and vaccine strains was not identical, strongly suggesting antigenic differences in the HA protein. Additionally, NA inhibition (NAI Ab titers in human sera from pH1N1-like virus-infected subjects increased after the infection and there were measurable antigenic differences between the NA protein of circulating strains and the vaccine strain using both ferret and human antisera. Despite having been vaccinated, infected subjects exhibited low HAI Ab titers against the vaccine and circulating strains. This suggests that poor responses to the H1N1 component of the vaccine as well as antigenic differences in the HA and NA proteins of currently circulating pH1N1-like viruses could be contributing to

  15. Transgenic Cotton Plants Expressing the HaHR3 Gene Conferred Enhanced Resistance to Helicoverpa armigera and Improved Cotton Yield

    OpenAIRE

    Han, Qiang; Wang, Zhenzhen; He, Yunxin; Xiong, Yehui; Lv, Shun; Li, Shupeng; Zhang, Zhigang; Qiu, Dewen; Zeng, Hongmei

    2017-01-01

    RNA interference (RNAi) has been developed as an efficient technology. RNAi insect-resistant transgenic plants expressing double-stranded RNA (dsRNA) that is ingested into insects to silence target genes can affect the viability of these pests or even lead to their death. HaHR3, a molt-regulating transcription factor gene, was previously selected as a target expressed in bacteria and tobacco plants to control Helicoverpa armigera by RNAi technology. In this work, we selected the dsRNA-HaHR3 f...

  16. Kontsert põhiseaduse auks. Riccardo ja Pupo varsti Eestis. Laulud Püha Katarina kirikule. Saadikud Itaaliast

    Index Scriptorium Estoniae

    2007-01-01

    Vabaõhukontserdist Eesti Vabariigi põhiseaduse 15. aastapäeva tähistamise auks 7. sept. Tartus Toomemäe pargis. Itaalia estraadilauljate Riccardo Fogli ja Pupo kontserdist 20. sept. Tallinna Linnahallis. Heategevuskontserdist 13. sept. Tallinnas Püha Katariina kirikus. Sümfooniaorkestri Europa Galante kontserdist 13. sept. Estonia kontserdisaalis

  17. A Novel HA/β-TCP-Collagen Composite Enhanced New Bone Formation for Dental Extraction Socket Preservation in Beagle Dogs

    Directory of Open Access Journals (Sweden)

    Ko-Ning Ho

    2016-03-01

    Full Text Available Past studies in humans have demonstrated horizontal and vertical bone loss after six months following tooth extraction. Many biomaterials have been developed to preserve bone volume after tooth extraction. Type I collagen serves as an excellent delivery system for growth factors and promotes angiogenesis. Calcium phosphate ceramics have also been investigated because their mineral chemistry resembles human bone. The aim of this study was to compare the performance of a novel bioresorbable purified fibrillar collagen and hydroxyapatite/β-tricalcium phosphate (HA/β-TCP ceramic composite versus collagen alone and a bovine xenograft-collagen composite in beagles. Collagen plugs, bovine graft-collagen composite and HA/β-TCP-collagen composite were implanted into the left and right first, second and third mandibular premolars, and the fourth molar was left empty for natural healing. In total, 20 male beagle dogs were used, and quantitative and histological analyses of the extraction ridge was done. The smallest width reduction was 19.09% ± 8.81% with the HA/β-TCP-collagen composite at Week 8, accompanied by new bone formation at Weeks 4 and 8. The HA/β-TCP-collagen composite performed well, as a new osteoconductive and biomimetic composite biomaterial, for socket bone preservation after tooth extraction.

  18. A novel porous aspirin-loaded (GO/CTS-HA)n nanocomposite films: Synthesis and multifunction for bone tissue engineering.

    Science.gov (United States)

    Ji, Mingxiang; Li, Han; Guo, Hailin; Xie, Anjian; Wang, Shaohua; Huang, Fangzhi; Li, Shikuo; Shen, Yuhua; He, Jiacai

    2016-11-20

    A novel porous graphene oxide (GO)/chitosan (CTS)-hydroxyapatite (HA) nanocomposite film was successfully prepared for the first time by combining layer-by-layer (LBL) assembly technology with biomimetic mineralization method. The LBL technology was used to control the thickness of film as well as induce the biomimetic mineralization of biocompatible HA. The obtained (GO/CTS-HA)n film provided ideal platform for the proliferation of mouse mesenchymal stem cells (mMSCs). The pore size in the film is about 300nm, and the porous architecture made the film have high aspirin loading efficiency. Also the accumulated loading dosage could be adjusted by the film thickness, and the sustained release of aspirin could ensure well anti-inflammatory effect. The above advantages may alleviate the pain of patients and give the better environment for bone regeneration. This multifunctional aspirin-loaded (GO/CTS-HA)n film provided an inspiration for the synthesis of novel porous inorganic/biomacromolecule nanocomposite films as the biocoatings applied in bone tissue engineering. Copyright © 2016 Elsevier Ltd. All rights reserved.

  19. Chromium III histidinate exposure modulates antioxidant gene expression in HaCaT human keratinocytes exposed to oxidative stress

    Science.gov (United States)

    While the toxicity of hexavalent chromium is well established, trivalent Cr (Cr(III)) is an essential nutrient involved in insulin and glucose homeostasis. Recently, antioxidant effects of chromium (III) histidinate (Cr(III)His) were reported in HaCaT human keratinocytes exposed to oxidative stress...

  20. Silencing the HaAK gene by transgenic plant-mediated RNAi impairs larval growth of Helicoverpa armigera.

    Science.gov (United States)

    Liu, Feng; Wang, Xiao-Dong; Zhao, Yi-Ying; Li, Yan-Jun; Liu, Yong-Chang; Sun, Jie

    2015-01-01

    Insect pests have caused noticeable economic losses in agriculture, and the heavy use of insecticide to control pests not only brings the threats of insecticide resistance but also causes the great pollution to foods and the environment. Transgenic plants producing double-stranded RNA (dsRNA) directed against insect genes have been is currently developed for protection against insect pests. In this study, we used this technology to silence the arginine kinase (AK) gene of Helicoverpa armigera (HaAK), encoding a phosphotransferase that plays a critical role in cellular energy metabolism in invertebrate. Transgenic Arabidopsis plants producing HaAK dsRNA were generated by Agrobacterium-mediated transformation. The maximal mortality rate of 55% was reached when H. armigera first-instar larvae were fed with transgenic plant leaves for 3 days, which was dramatically higher than the 18% mortality recorded in the control group. Moreover, the ingestion of transgenic plants significantly retarded larval growth, and the transcript levels of HaAK were also knocked down by up to 52%. The feeding bioassays further indicated that the inhibition efficiency was correlated with the integrity and concentration of the produced HaAK dsRNA in transgenic plants. These results strongly show that the resistance to H. armigera was improved in transgenic Arabidopsis plants, suggesting that the RNAi targeting of AK has the potential for the control of insect pests.

  1. Pop nädal : Popuudised. Uus plaat. Deutsche Alternative Charts albumid Top 10. A-Ha video / Aivar Meos

    Index Scriptorium Estoniae

    Meos, Aivar

    2002-01-01

    Kurt Cobaini raamatust"Kurt Cobain: The Journals". 2. juulil müügile tulevast ansambli The White Stripes' albumist "Dead Leaves and the Dirty Ground". Ansambli R.E.M. uuest albumist. Ansambli ZLO plaadist "Machopask". Ansambli A-Ha videost, mis põhineb 1991. a. vändatud lühifilmil "A Year along the Abonded Road"

  2. Application of a heterogeneous adsorbent (HA for the removal of hexavalent chromium from aqueous solutions: Kinetic and equilibrium modeling

    Directory of Open Access Journals (Sweden)

    Varsha Srivastava

    2017-05-01

    Full Text Available In the present study, a heterogeneous adsorbent material (HA was used as an adsorbent for the removal of Cr(VI from aqueous solutions at laboratory scale. Cr(VI containing water was treated with heterogeneous adsorbent(HA.Chromium solutions of various initial concentrations were treated with adsorbent in batch mode experiments to investigate the adsorption characteristics of heterogeneous adsorbent (HA. Kinetics of adsorption of Cr(VI ions on adsorbent was investigated by using pseudo first order and second order kinetic models. Removal processes were found to be governed by pseudo second order model. Intraparticle diffusion model was also analyzed for this system. Removal was found to be increased by increasing the temperature from 298 to 318 K which indicates the endothermic nature of the process. Various two parameter isotherm models viz. Langmuir, Freundlich, Elovich, Tempkin, Dubnin–Raduskevich (D–R, Harkin–Jura and BET isotherm were applied on resultant data for equilibrium modeling. It was observed that heterogeneous adsorbent (HA particles were highly efficient for the removal of Cr(VI.

  3. Response of human bone marrow-derived MSCs on triphasic Ca-P substrate with various HA/TCP ratio.

    Science.gov (United States)

    Bajpai, Indu; Kim, Duk Yeon; Kyong-Jin, Jung; Song, In-Hwan; Kim, Sukyoung

    2017-01-01

    Calcium phosphates (Ca-P) are used commonly as artificial bone substitutes to control the biodegradation rate of an implant in the body fluid. This study examined the in vitro proliferation of human bone marrow-derived mesenchymal stem cells (hBMSCs) on triphasic Ca-P samples. For this aspect, hydroxyapatite (HA), dicalcium phosphate dehydrate (DCPD), and calcium hydroxide (Ca(OH)2 ) were mixed at various ratios, cold compacted, and sintered at 1250°C in air. X-ray diffraction showed that the β-tricalcium phosphate (TCP) to α-TCP phase transformation increased with increasing DCPD/HA ratio. The micro-hardness deceased with increasing TCP content, whereas the mean grain size and porosity increased with increasing TCP concentration. To evaluate the in vitro degree of adhesion and proliferation on the HA/TCP samples, human BMSCs were incubated on the HA/TCP samples and analyzed by a cells proliferation assay, expression of the extracellular matrix (ECM) genes, such as α-smooth muscle actin (α-SMA) and fibronectin (FN), and FITC-phalloidin fluorescent staining. In terms of the interactions of human BMSCs with the triphasic Ca-P samples, H50T50 (Ca/P = 1.59) markedly enhanced cell spreading, proliferation, FN, and α-SMA compared with H100T0 (Ca/P = 1.67). Interestingly, these results show that among the five HA/TCP samples, H50T50 is the optimal Ca-P composition for in vitro cell proliferation. © 2015 Wiley Periodicals, Inc. J Biomed Mater Res Part B: Appl Biomater, 105B: 72-80, 2017. © 2015 Wiley Periodicals, Inc.

  4. In vitro study of RRS HA injectable mesotherapy/biorevitalization product on human skin fibroblasts and its clinical utilization

    Directory of Open Access Journals (Sweden)

    Deglesne PA

    2016-02-01

    Full Text Available Pierre-Antoine Deglesne,* Rodrigo Arroyo,* Evgeniya Ranneva, Philippe Deprez Research and Development, SKIN TECH PHARMA GROUP, Castelló d'Empúries, Spain  *These authors contributed equally to this work Abstract: Mesotherapy/biorevitalization with hyaluronic acid (HA is a treatment approach currently used for skin rejuvenation. Various products with a wide range of polycomponent formulations are available on the market. Most of these formulations contain noncross-linked HA in combination with a biorevitalization cocktail, formed by various amounts of vitamins, minerals, amino acids, nucleotides, coenzymes, and antioxidants. Although ingredients are very similar among the different products, in vitro and clinical effects may vary substantially. There is a real need for better characterization of these products in terms of their action on human skin or in vitro skin models. In this study, we analyzed the effect of the RRS® (Repairs, Refills, Stimulates HA injectable medical device on human skin fibroblasts in vitro. Skin fibroblast viability and its capacity to induce the production of key extracellular matrix were evaluated in the presence of different concentrations of RRS HA injectable. Viability was evaluated through colorimetric MTT (3-[4,5-dimethylthiazol-2-yl]-2,5 diphenyl tetrazolium bromide assay, and key extracellular matrix genes, type I collagen and elastin, were quantified by quantitative polymerase chain reaction. Results demonstrated that RRS HA injectable could promote human skin fibroblast viability (+15% and increase fibroblast gene expression of type I collagen and elastin by 9.7-fold and 14-fold in vitro, respectively. These results demonstrate that mesotherapy/biorevitalization products can, at least in vitro, effectively modulate human skin fibroblasts.Keywords: mesotherapy, medical device, RRS, collagen, elastin, extracellular matrix

  5. The sunflower transcription factor HaWRKY76 confers drought and flood tolerance to Arabidopsis thaliana plants without yield penalty.

    Science.gov (United States)

    Raineri, Jesica; Ribichich, Karina F; Chan, Raquel L

    2015-12-01

    Arabidopsis transgenic plants expressing the sunflower transcription factor HaWRKY76 exhibit increased yield and tolerance to drought and flood stresses. The genetic construct containing HaWRKY76 is proposed as a potential biotechnological tool to improve crops. Water deficit and water excess are abiotic stress factors that seriously affect crops worldwide. To increase the tolerance to such stresses without causing yield penalty constitutes a major goal for biotechnologists. In this survey, we report that HaWRKY76, a divergent sunflower WRKY transcription factor, is able to confer both dehydration and submergence tolerance to Arabidopsis transgenic plants without yield penalty. The expression pattern of HaWRKY76 was analyzed in plants grown in standard conditions and under different watering regimes indicating a regulation by water availability. The corresponding cDNA was isolated and cloned under the control of a constitutive promoter and Arabidopsis plants were transformed with this construct. These transgenic plants presented higher biomass, seed production and sucrose content than controls in standard growth conditions. Moreover, they exhibited tolerance to mild drought or flood (complete submergence/waterlogging) stresses as well as the same or increased yield, depending on the stress severity and plant developmental stage, compared with controls. Drought tolerance occurred via an ABA-independent mechanism and induction of stomatal closure. Submergence tolerance can be explained by the carbohydrate (sucrose and starch) preservation achieved through the repression of fermentation pathways. Higher cell membrane stability and chlorenchyma maintenance could be the nexus between tolerance responses in front of both stresses. Altogether, the obtained results indicated that HaWRKY76 can be a potential biotechnological tool to improve crops yield as well as drought and flood tolerances.

  6. Synthesis and characterization of a nanoestructered hydroxyapatite: elaboration of nanocomposites HA/SiO{sub 2}n; Sintese e caracterizacao de uma hidroxiapatita nanoestruturada: elaboracao de nanocompositos HA/Si{sub 2}n

    Energy Technology Data Exchange (ETDEWEB)

    Passoni, L.S.; Camargo, N.H.A.; Gemelli, E.; Dalmonico, G.M.L.; Prandi, R.G., E-mail: laispassoni@gmail.com [Universidade do Estado de Santa Catarina (UESC), SC (Brazil)

    2011-07-01

    Hydroxyapatite is a synthetic bone matrix, known as a promising biomaterial in bone reconstruction. The development of nanostructured biomaterials based on hydroxyapatite has been showing as a technological innovation conducive to reconstruction of bone tissue. The biphasic compositions HA/SiO2, have led to obtaining nanocomposites biomaterials with new microestructural and nanostructured characteristics. This study aimed to characterize the raw materials for subsequent synthesis of hydroxyapatite phase and nanocomposite HA/SiO2n. Were prepared four compositions of Nanocomposites as follows: 0.5% 1% 2%, 3% in volume of SiO{sub 2}n. The synthesis method used was wet through the dissolution-precipitation reaction involving solid phase / liquid CaO and phosphoric acid required for the formation of compositions in the Ca / P ratio = 1.67 molar. The results presented refer to the characterization by the technique of x-ray diffraction, infrared spectrometry by Fourier Transforms and scanning electron microscopy. (author)

  7. Genetic mapping of rust resistance genes in confection sunflower line HA-R6 and oilseed line RHA 397.

    Science.gov (United States)

    Gong, L; Gulya, T J; Markell, S G; Hulke, B S; Qi, L L

    2013-08-01

    Few widely effective resistance sources to sunflower rust, incited by Puccinia helianthi Schwein., have been identified in confection sunflower (Helianthus annuus L.). The USDA inbred line HA-R6 is one of the few confection sunflower lines resistant to rust. A previous allelism test indicated that rust resistance genes in HA-R6 and RHA 397, an oilseed-type restorer line, are either allelic or closely linked; however, neither have been characterized nor molecularly mapped. The objectives of this study are (1) to locate the rust resistance genes in HA-R6 and RHA 397 on a molecular map, (2) to develop closely linked molecular markers for rust resistance diagnostics, and (3) to determine the resistance spectrum of two lines when compared with other rust-resistant lines. Two populations of 140 F2:3 families each from the crosses of HA 89, as susceptible parent, with HA-R6 and RHA 397 were inoculated with race 336 of P. helianthi in the greenhouse. The resistance genes (R-genes) in HA-R6 and RHA 397 were molecularly mapped to the lower end of linkage group 13, which encompasses a large R-gene cluster, and were designated as R 13a and R 13b, respectively. In the initial maps, SSR (simple sequence repeat) and InDel (insertion and deletion) markers revealed 2.8 and 8.2 cM flanking regions for R 13a and R 13b, respectively, linked with a common marker set of four co-segregating markers, ORS191, ORS316, ORS581, and ZVG61, in the distal side and one marker ORS464 in the proximal side. To identify new markers closer to the genes, sunflower RGC (resistance gene candidate) markers linked to the downy mildew R-gene Pl 8 and located at the same region as R 13a and R 13b were selected to screen the two F2 populations. The RGC markers RGC15/16 and a newly developed marker SUN14 designed from a BAC contig anchored by RGC251 further narrowed down the region flanking R 13a and R 13b to 1.1 and 0.1 cM, respectively. Both R 13a and R 13b are highly effective against all rust races

  8. The novel kinetics expression of Cadmium (II) removal using green adsorbent horse dung humic acid (Hd-Ha)

    Science.gov (United States)

    Basuki, Rahmat; Santosa, Sri Juari; Rusdiarso, Bambang

    2017-03-01

    Humic acid from dry horse dung powder has been prepared and this horse dung humic acid (HD-HA) was then applied as a sorbent to adsorb Cadmium(II) from a solution. Characterization of HD-HA was conducted by detection of its functional group, UV-Vis spectra, ash level, and total acidity. Result of the work showed that HD-HA had similar character compared with peat soil humic acid (PS-HA) and previous researchers. The adsorption study of this work was investigated by batch experiment in pH 5. The thermodynamics parameters in this work were determined by the Langmuir isotherm model for monolayer sorption and Freundlich isotherm model multilayer sorption. Monolayer sorption capacity (b) for HD-HA was 1.329 × 10-3 mol g-1, equilibrium constant (K) was 5.651 (mol/L)-1, and multilayer sorption capacity was 2.646 × 10-2 mol g-1. The kinetics parameters investigated in this work were determined by the novel kinetics expression resulted from the mathematical derivation the availability of binding sites of sorbent. Adsorption rate constant (ka) from this novel expression was 43.178 min-1 (mol/L)-1 and desorption rate constant (kd) was 1.250 × 10-2 min-1. Application of the kinetics model on sorption Cd(II) onto HD-HA showed the nearly all of models gave a good linearity. However, only this proposed kinetics expression has good relation with Langmuir model. The novel kinetics expression proposed in this paper seems to be more realistic and reasonable and close to the experimental real condition because the value of ka/kd (3452 (mol/L)-1) was fairly close with K from Langmuir isotherm model (5651 (mol/L)-1). Comparison of this novel kinetics expression with well-known Lagergren pseudo-first order kinetics and Ho pseudo-second order kinetics was also critically discussed in this paper.

  9. Ahmet Haşim’in Poetikasına Göre “Vuzuh”Un Mahiyeti Ve Değeri Nature And Value Of Clearness (Vuzuh In According To Ahmet Haşim’s Poetics

    Directory of Open Access Journals (Sweden)

    Özden APAYDIN

    2013-03-01

    Full Text Available In this study, “vuzuh” (clearness, which Ahmet Haşim, one of the most important names in Turkish poetry, wrote as a response to the critics, who criticised his poem named “Desire at the End of a Day” and he often mentioned in his article named Some Thoughts on Poetry expressing his own poetics, will be dealt. The poet set the basis of Some Thoughts on Poetry ontwo important concepts; Meaning and clearness. Although these aresupplementary concept to each other, a separate analysis should be done inorder to see what “clearness” means for Haşim and to understand whatimportance it has in his poetry. However, in this analysis his opinions on“meaning” will be benefited for the necessary points. Hence, Haşim’sapproach on the matter will be tried to be presented by interpreting someattention-grabbing concepts of the parts of the poetics relating to theclearness as it is the primary subject of this work. These attention-grabbingconcepts will be dealt with one by one under different subheadings in thisstudy. The matter will be examined with the questions such as “What isclearness in Haşim’s opinion? What is the place of clearness in poetry;should there or should there not be? Is there any point that Haşim is in adilemma? What answers does he give to the critics, who accuse him ofwriting inexplicit poems? Does he think his poems are ambiguous or not?”.Hence how the concept of clearness in poetry is evaluated and expressed byHaşim will be explored. Bu çalışmada, modern Türk şiirinin en önemlisi isimlerinden biri olan Ahmet Haşim’in “Bir Günün Sonunda Arzu” adlı şiiri sebebiyle kendisini eleştirenlere cevaben kaleme aldığı ve genel itibariyle poetikasını anlattığı Şiir Hakkında Bazı Mülahazalar adlı yazısında sıklıkla bahsettiği “vuzuh” konusu ele alınmaktadır. Şair, Şiir Hakkında Bazı Mülahazalar’ın temelini iki önemli kavram üzerine kurar: Mana ve vuzuh. Bunlar, her ne kadar

  10. Une description philologique de quelques mots du français régional haïtien

    Directory of Open Access Journals (Sweden)

    Roberson Pierre

    2012-11-01

    Full Text Available Cet article décrit quelques exemples de mots relevant du français régional haïtien, autrement dit du français contemporain tel qu'il est représenté en Haïti. Dans une approche philologique, les auteurs sollicitent la méthodologie de la lexicographie différentielle francophone de manière à soulever, plus indirectement, quelques unes des questions d'ordre sociolinguistique qui ont toujours préoccupé Pierre Vernet. Sont traités à titre d'illustration les mots bérégène, bouillon, calalou*, camionette, carnet, chadèque, pistache, rigoise et suret(te.

  11. Radiation induced depolymerization of hyaluronic acid (HA) in aqueous solutions at pH 7. 4. [Gamma radiation

    Energy Technology Data Exchange (ETDEWEB)

    Lal, M.

    1985-10-01

    Radiolytic depolymerization of hyaluronic acid (HA, a heteropolysaccharide) in aqueous solutions under a variety of conditions demonstrates that the damaging effect of radiolytic radical species is in the following order: OH > esub(aq)sup(-) > Osub(2). Cysteine, penicillamine and dithiothreitol were found to protect against primary radiolytic species. The results point out that the enzyme superoxide dismutase (SOD) and the above three thiols do not protect against the radiolytic species generated by the Mg-irradiation of aerated sodium formate solutions. The results also indicate that the reaction between COsub(2) anion and hyaluronic acid is faster than that between Osub(2) and hyaluronic acid and that COsub(2) anions are not scavenged by superoxide dismutase. The results further suggest that t-buthanol radicals interact with hyaluronic acid and reduce the viscosity of HA solutions. Preliminary pulse radiolysis experiments do demonstrate a reaction between COsub(2) radical and hyaluronic acid.

  12. Large-scale FMO-MP3 calculations on the surface proteins of influenza virus, hemagglutinin (HA) and neuraminidase (NA)

    Science.gov (United States)

    Mochizuki, Yuji; Yamashita, Katsumi; Fukuzawa, Kaori; Takematsu, Kazutomo; Watanabe, Hirofumi; Taguchi, Naoki; Okiyama, Yoshio; Tsuboi, Misako; Nakano, Tatsuya; Tanaka, Shigenori

    2010-06-01

    Two proteins on the influenza virus surface have been well known. One is hemagglutinin (HA) associated with the infection to cells. The fragment molecular orbital (FMO) calculations were performed on a complex consisting of HA trimer and two Fab-fragments at the third-order Møller-Plesset perturbation (MP3) level. The numbers of residues and 6-31G basis functions were 2351 and 201276, and thus a massively parallel-vector computer was utilized to accelerate the processing. This FMO-MP3 job was completed in 5.8 h with 1024 processors. Another protein is neuraminidase (NA) involved in the escape from infected cells. The FMO-MP3 calculation was also applied to analyze the interactions between oseltamivir and surrounding residues in pharmacophore.

  13. Démocratisation, identité culturelle et identité nationale en Haïti

    OpenAIRE

    Hurbon, Laënnec

    2011-01-01

    Ni le religieux ni le politique ne semblent offrir la base d’un nouveau lien social en Haïti après l’effondrement du régime dictatorial de Duvalier en 1986. L’expérience démocratique conduit à une crise de l’église catholique qui, jusqu’ici jouissait d’une position privilégiée dans la société haïtienne, alors que les signes de l’instauration d’un Etat démocratique de droit sont encore loin d’être repérables. Des mouvements culturels identitaires et nationalistes sont alors des tentations indu...

  14. Behaviour of human mesenchymal stem cells on chemically synthesized HA-PCL scaffolds for hard tissue regeneration.

    Science.gov (United States)

    D'Antò, Vincenzo; Raucci, Maria Grazia; Guarino, Vincenzo; Martina, Stefano; Valletta, Rosa; Ambrosio, Luigi

    2016-02-01

    Our goal was to characterize the response of human mesenchymal stem cells (hMSCs) to a novel composite scaffold for bone tissue engineering. The hydroxyapatite-polycaprolactone (HA-PCL) composite scaffolds were prepared by a sol-gel method at room temperature and the scaffold morphology was investigated by scanning electron microscopy (SEM)/energy-dispersive spectroscopy (EDS) to validate the synthesis process. The response of two different lines of hMSCs, bone-marrow-derived human mesenchymal stem cells (BMSCs) and dental pulp stem cells (DPSCs) in terms of cell proliferation and differentiation into the osteoblastic phenotype, was evaluated using Alamar blue assay, SEM, histology and alkaline phosphatase activity. Our results indicate that tissue engineering by means of composite HA-PCL scaffolds may represent a new therapeutic strategy to repair craniofacial bone defects. Copyright © 2013 John Wiley & Sons, Ltd.

  15. Però hi ha una antinòmia entre ètica i religió?

    OpenAIRE

    Norbert Bilbeny

    1994-01-01

    Tant l'ètica com la religió formen part d'un llarg aprenentatge de la humanitat. Aquesta ha d'aprendre també a sobreposar-se de les seves grans contradiccions, no solament a adaptar-se al medi i transformar-lo d'acord amb els seus interessos i necessitats. Vull recordar aquestes contradiccions que encara avui ens fan sentir molt avall en l'escala ideal del progrés.

  16. In Vitro Degradation of PHBV Scaffolds and nHA/PHBV Composite Scaffolds Containing Hydroxyapatite Nanoparticles for Bone Tissue Engineering

    OpenAIRE

    Naznin Sultana; Tareef Hayat Khan

    2012-01-01

    This paper investigated the long-term in vitro degradation properties of scaffolds based on biodegradable polymers and osteoconductive bioceramic/polymer composite materials for the application of bone tissue engineering. The three-dimensional porous scaffolds were fabricated using emulsion-freezing/freeze-drying technique using poly(hydroxybutyrate-co-hydroxyvalerate) (PHBV) which is a natural biodegradable and biocompatible polymer. Nanosized hydroxyapatite (nHA) particles were successfully...

  17. The miR-124-prolyl hydroxylase P4HA1-MMP1 axis plays a critical role in prostate cancer progression.

    Science.gov (United States)

    Chakravarthi, Balabhadrapatruni V S K; Pathi, Satya Sreehari; Goswami, Moloy T; Cieślik, Marcin; Zheng, Heng; Nallasivam, Sivakumar; Arekapudi, Subramanyeswara R; Jing, Xiaojun; Siddiqui, Javed; Athanikar, Jyoti; Carskadon, Shannon L; Lonigro, Robert J; Kunju, Lakshmi P; Chinnaiyan, Arul M; Palanisamy, Nallasivam; Varambally, Sooryanarayana

    2014-08-30

    Collagen prolyl hydroxylases (C-P4HAs) are a family of enzymes involved in collagen biogenesis. One of the isoforms of P4HA, Prolyl 4-hydroxylase, alpha polypeptide I (P4HA1), catalyzes the formation of 4-hydroxyproline that is essential for the proper three-dimensional folding of newly synthesized procollagen chains. Here, we show the overexpression of P4HA1 in aggressive prostate cancer. Immunohistochemical analysis using tissue microarray demonstrated that P4HA1 expression was correlated with prostate cancer progression. Using in vitro studies, we showed that P4HA1 plays a critical role in prostate cancer cell growth and tumor progression. Expression profiling studies using P4HA1 modulated prostate cells suggested regulation of Matrix metalloproteases 1. The invasive properties of P4HA1 overexpressing cells were reversed by blocking MMP1. Our studies indicate P4HA1 copy number gain in a subset of metastatic prostate tumors and its expression is also regulated by microRNA-124. MiR-124 in turn is negatively regulated by transcriptional repressors EZH2 and CtBP1, both of which are overexpressed in aggressive prostate cancer. Chick chorioallantoic membrane (CAM) assay and mice xenograft investigations show that P4HA1 is required for tumor growth and metastasis in vivo. Our observations suggest that P4HA1 plays a critical role in prostate cancer progression and could serve as a viable therapeutic target.

  18. Effects of Wannachawee Recipe with Antipsoriatic Activity on Suppressing Inflammatory Cytokine Production in HaCaT Human Keratinocytes

    Directory of Open Access Journals (Sweden)

    Mingkwan Na Takuathung

    2017-01-01

    Full Text Available Psoriasis is a chronic inflammatory and immune-mediated skin disease. The pathogenesis involves T cells activation via the IL-23/Th17 axis. Conventional treatments of psoriasis have adverse events influencing patients’ adherence. Wannachawee Recipe (WCR has been effectively used as Thai folk remedy for psoriasis patients; however, preclinical evidence defining how WCR works is still lacking. This study defined mechanisms for its antiproliferation and anti-inflammatory effects in HaCaT cells. The cytotoxicity and antiproliferation results from SRB and CCK-8 assays showed that WCR inhibited the growth and viability of HaCaT cells in a concentration-dependent manner. The distribution of cell cycle phases determined by flow cytometry showed that WCR did not interrupt cell cycle progression. Interestingly, RT-qPCR revealed that WCR significantly decreased the mRNA expression of IL-1β, IL-6, IL-8, IL-17A, IL-22, IL-23, and TNF-α but induced IL-10 expression in TNF-α- and IFN-γ-induced HaCaT cells. At the protein level determined by ELISA, WCR significantly reduced the secretion of IL-17A, IL-22, and IL-23. The WCR at low concentrations was proved to possess anti-inflammatory effect without cytotoxicity and it did not interfere with cell cycle of keratinocytes. This is the first study to provide convincing evidence that WCR is a potential candidate for development of effective psoriasis therapies.

  19. An in vitro study on the cytotoxicity of bismuth oxychloride nanosheets in human HaCaT keratinocytes.

    Science.gov (United States)

    Gao, Xiaoya; Zhang, Xiaochao; Wang, Yawen; Wang, Yunfang; Peng, Shiqi; Fan, Caimei

    2015-06-01

    As an emerging nanomaterial, bismuth oxychloride (BiOCl) has attracted explosive interests in diverse areas. However, how it interfaces with biological systems, particularly its interaction with human cells and the resulting effects are completely unknown. In this paper, the cytotoxicity of BiOCl nanosheets (NSs) was investigated toward a human skin derived cell line (HaCaT). It was found that BiOCl-NSs had no cytotoxicity at low concentrations (<0.5 µg/mL), whereas higher concentrations (5-100 µg/mL) of BiOCl-NSs could trigger toxic effects on HaCaT cells, with changes in cell morphology and impairment of intracellular structures (mitochondria and cytoskeleton). BiOCl-NSs also led to cell apoptosis and cells cycle arrest in G0/G1 phase. Flow cytometric data showed that BiOCl-NSs were effectively incorporated into HaCaT cells. Transmission electron microscope (TEM) images further revealed that BiOCl-NSs sequestered in the lysosomes, mitochondria, nuclei, and vesicles. Results of DCFH-DA assay and nutritional antioxidant N-acetylcysteine (NAC) experiments suggested that an oxidative stress mechanism was involved in the cytotoxic effects of BiOCl-NSs. Taken together, this work represents the first study on the behavior of BiOCl-NSs on human cells, and constitutes the first and essential step for the risk assessment of BiOCl nanomaterials. Copyright © 2015 Elsevier Ltd. All rights reserved.

  20. Enhancing glass ionomer cement features by using the HA/YSZ nanocomposite: a feed forward neural network modelling.

    Science.gov (United States)

    Rajabzadeh, Ghadir; Salehi, Sahar; Nemati, Ali; Tavakoli, Razeih; Solati Hashjin, Mehran

    2014-01-01

    Despite brilliant properties of glass ionomer cement (GIC), its weak mechanical property poses an obstacle for its use in medical applications. The present research aims to formulate hydroxyapatite/yttria-stabilized zirconia (HA/YSZ) in the composition of GIC to enhance mechanical properties and to improve fluoride release of GIC. HA/YSZ was synthesized via a sol-gel method and characterized by applying X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FT-IR), X-ray photo-emission spectroscopy (XPS) and simultaneous thermal analysis (STA) along with transmission electron microscopy (TEM) methods. The synthesized nanocomposite was mixed with GIC at a fixed composition of 5wt%. The effect of different weight percentages of YSZ:HA on GIC was investigated by measuring the compressive strength, diametral tensile strength, microhardness and fluoride release. The results showed that, after 1 and 7 days of setting, the 20wt% nanohydroxyapatite/80wt% stabilized zirconia cement exhibited higher compressive strength (1857-245MPa), higher diametral tensile strength (11-14MPa) and greater microhardness (104-106MPa) as compared with the pure GIC (65-88MPa in compressive strength, 5-9.5MPa in diametral tensile strength and 70-89MPa in microhardness). The reinforced cement, also, exhibited higher fluoride release compared with pure GIC. The artificial neural network (ANN) was trained for modeling the system. Results obtained by ANN have proved to be completely in accordance with expectations. © 2013 Elsevier Ltd. All rights reserved.

  1. Cross-platform metabolomics investigating the intracellular metabolic alterations of HaCaT cells exposed to phenanthrene.

    Science.gov (United States)

    Jiang, Guoting; Kang, Hongyan; Yu, Yunqiu

    2017-08-15

    Phenanthrene (Phe) is one of the most abundant Polycyclic aromatic hydrocarbons (PAHs) contamination from various ambient sources, which has a tremendous impact on public health. However, our knowledge regarding its effects on skin remains limited. In this study, we investigated the metabolite profiling of the human keratinocytes HaCaT cells after Phe exposure to understand the toxic effects of Phe exposure on skin. To obtain a broad picture of metabolome with various hydrophilicity, a cross-platform approach with GC-MS and UHPLC-QTOF-MS has been employed. Data were analyzed by multivariate statistical analysis and samples were separated successfully using supervised PLS-DA models. It was shown that the impacts of Phe exposure on HaCaT cells were both dose-related and time-related. A total of 48 Phe-regulated metabolites were identified and among which 19 were confirmed by reference standards. By pathway analysis, amino acid metabolism, glutathione metabolism and glycerophospholipid metabolism were highlighted as the major metabolic pathways disturbed by Phe. Furthermore, it was found that the mechanisms included a reduced amino pool and a reduced antioxidant status. Overall, these results aid in improving understanding of the dermal toxicology related to Phe, and demonstrate this cross-platform approach is suitable for metabolomics researches on HaCaT cells. Copyright © 2017 Elsevier B.V. All rights reserved.

  2. Structural analysis of the α-glucosidase HaG provides new insights into substrate specificity and catalytic mechanism.

    Science.gov (United States)

    Shen, Xing; Saburi, Wataru; Gai, Zuoqi; Kato, Koji; Ojima-Kato, Teruyo; Yu, Jian; Komoda, Keisuke; Kido, Yusuke; Matsui, Hirokazu; Mori, Haruhide; Yao, Min

    2015-06-01

    α-Glucosidases, which catalyze the hydrolysis of the α-glucosidic linkage at the nonreducing end of the substrate, are important for the metabolism of α-glucosides. Halomonas sp. H11 α-glucosidase (HaG), belonging to glycoside hydrolase family 13 (GH13), only has high hydrolytic activity towards the α-(1 → 4)-linked disaccharide maltose among naturally occurring substrates. Although several three-dimensional structures of GH13 members have been solved, the disaccharide specificity and α-(1 → 4) recognition mechanism of α-glucosidase are unclear owing to a lack of corresponding substrate-bound structures. In this study, four crystal structures of HaG were solved: the apo form, the glucosyl-enzyme intermediate complex, the E271Q mutant in complex with its natural substrate maltose and a complex of the D202N mutant with D-glucose and glycerol. These structures explicitly provide insights into the substrate specificity and catalytic mechanism of HaG. A peculiar long β → α loop 4 which exists in α-glucosidase is responsible for the strict recognition of disaccharides owing to steric hindrance. Two residues, Thr203 and Phe297, assisted with Gly228, were found to determine the glycosidic linkage specificity of the substrate at subsite +1. Furthermore, an explanation of the α-glucosidase reaction mechanism is proposed based on the glucosyl-enzyme intermediate structure.

  3. Electrophoretic deposition and characterization of HA/chitosan nanocomposite coatings on Ti6Al7Nb alloy

    Science.gov (United States)

    Moskalewicz, Tomasz; Kot, Marcin; Seuss, Sigrid; Kędzierska, Aleksandra; Czyrska-Filemonowicz, Aleksandra; Boccaccini, Aldo R.

    2015-01-01

    Nano-hydroxyapatite/chitosan (nc-HA/chitosan) composite coatings were produced on two phase (α+β) Ti6Al7Nb titanium alloy substrates by electrophoretic deposition (EPD). The microstructure of the coatings was examined by scanning- and transmission electron microscopy methods as well as by X-ray diffractometry. The coatings, 770 nm-800 nm thick, were uniform, without any cracks or presence of large voids and they exhibited good adhesion to the titanium alloy substrate. The microstructure of the coatings consisted of nc-HA needle-like particles homogeneously embedded in a chitosan matrix. The deposited coatings exhibited good adhesion to the substrate. The best adhesion to the titanium alloy was determined for the coating deposited from suspensions containing 4 g/L of HA at 10 V during 240 s. The results confirm EPD as a convenient method to develop uniform and crack-free nanoscale organic-inorganic composite coatings on two phase titanium alloy substrates with potential application in orthopedic and dental implants.

  4. Bioresorbable Fe-Mn and Fe-Mn-HA Materials for Orthopedic Implantation: Enhancing Degradation through Porosity Control.

    Science.gov (United States)

    Heiden, Michael; Nauman, Eric; Stanciu, Lia

    2017-07-01

    Resorbable, porous iron-manganese-hydroxyapatite biocomposites with suitable degradation rates for orthopedic applications are prepared using salt-leaching for the first time. These transient biomaterials have the potential to replace inert, permanent implants that can suffer from long-term complications, or have to be surgically removed, leaving an unfavorable void. Fe30Mn-10HA materials are newly developed to address inadequate resorption rates of degradable materials proposed for orthopedic environments in the past. In this study, controllable porosities with 300 µm diameter pores are introduced into Fe30Mn alloys and Fe30Mn-10HA composites, which enhance tissue ingrowth. For the composites, a Ca2 Mn7 O14 phase generated within the Fe30Mn matrix during the sintering process greatly increases degradability. The combination of this second phase and added porosity is found to contribute to increased bone-like apatite layer formation, mouse bone marrow mesenchymal stem cell attachment, and reduction of detrimental oxide layer flaking. Remarkably, after thirty days in vitro, there is a significant increase in degradation up to 0.82 ± 0.04 mm per year for 30 wt% porous Fe30Mn-10HA biocomposites, compared to 0.02 ± 0.00 mm per year for traditional nonporous Fe30Mn, thereby increasing the viability of these materials for future clinical studies. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  5. Realgar-mediated growth inhibition on HaCaT human keratinocytes is associated with induction of apoptosis.

    Science.gov (United States)

    Tse, Wai-Pui; Cheng, Christopher H K; Che, Chun-Tao; Zhao, Ming; Fan, Rui-Qiang; Lin, Zhi-Xiu

    2009-08-01

    Traditional Chinese medicine has long been used to treat a variety of ailments including skin diseases. Our previous study has revealed the ethanolic extract of realgar, a common ingredient used in psoriasis treatment in Chinese medicine, to possess potent anti-proliferative action on cultured HaCaT cells of human keratinocyte origin. In the present study, the mechanisms of action of the observed growth inhibitory action of realgar were investigated. Several bioassay methods were employed to elucidate whether cellular apoptosis is involved in the realgar-induced growth inhibition of the skin cells. Morphologically, nuclear condensation and DNA fragmentation were observed when HaCaT cells were exposed to the realgar extract. DNA fragmentation induced by the treatment of realgar was also evident as detected by gel electrophoresis and the TUNEL method. Cell cycle analysis by propidium iodide (PI) staining demonstrated the appearance of sub-G1 peak and cell cycle arrest at the G1 phase upon realgar treatment. Quantitative analysis by annexin V-PI staining revealed that the realgar-induced apoptotic event was dose-dependent. Furthermore, realgar was able to activate caspase-3 expression when examined by Western blot analysis. Our experimental data unambiguously confirm that induction of cellular apoptosis is mainly responsible for the observed growth inhibition brought about by realgar on the HaCaT keratinocytes, and this finding helps place the traditional use of this mineral for psoriasis treatment on a scientific footing.

  6. Production of polyclonal antibody against Tehran strain influenza virus (A/H1N1/2009 hemagglutinin conserved domain (HA2: brief report

    Directory of Open Access Journals (Sweden)

    Somayeh Zamani

    2015-10-01

    Full Text Available Background: The influenza virus is one of the most important factors for higher morbidity and mortality in the world. Recently, researchers have been focused on influenza conserved antigenic proteins such as hemagglutinin stalk domain (HA2 for vaccine production and serological studies. The HA2 plays a major role in the fusion of the virus with host cells membrane. The immunity system enables to produce antibody against HA2. The aim of this study is polyclonal antibody production against influenza HA2. Methods: This study was done in the Influenza Research Lab, Pasteur Institute of Iran, Tehran for one year from September 2013 to October 2014. In the present study, recombinant HA2 protein was produced in prokaryotic system and purified using Nickel affinity chromatography. The purified HA2 was mixed with Freund’s adjuvant (complete and incomplete and injected into two New Zealand white rabbits by intramuscularly and subcutaneously routes. Immunization was continued for several months with two weeks interval. Before each immunization, blood was drawn by venous puncture from the rabbit ear. Function of rabbit's sera was evaluated using radial immunodiffusion (RID in both forms, Single RID (SRID and Double RID (DRID. Finally, antiserum activity against HA2 was evaluated using western blotting as serological assay. Results: Sedimentary line and zone was observed in RID assays (SRID and DRID represent interaction between HA2 protein and anti- HA2 antibody. As well as, western blotting results was positive for HA2 protein. Therefore, these results showed that polyclonal antibody produced against HA2 protein can identify HA2 protein antigenic sites. Conclusion: These findings show that humoral immune responses have properly been stimulated in rabbits and these antibodies can identify HA2 protein and may be suitable for other serological methods.

  7. (+)-Nootkatone inhibits tumor necrosis factor α/interferon γ-induced production of chemokines in HaCaT cells

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Hyeon-Jae; Lee, Jin-Hwee [College of Pharmacy, Ajou University, Suwon 443-749 (Korea, Republic of); Jung, Yi-Sook, E-mail: yisjung@ajou.ac.kr [College of Pharmacy, Ajou University, Suwon 443-749 (Korea, Republic of); Research Institute of Pharmaceutical Sciences and Technology, Ajou University, Suwon 443-749 (Korea, Republic of)

    2014-05-02

    Highlights: • (+)-Nootkatone inhibits TNF-α/IFN-γ-induced TARC and MDC expression in HaCaT cells. • PKCζ, p38 MAPK, or NF-κB mediate TNF-α/IFN-γ-induced TARC and MDC expression. • (+)-Nootkatone inhibits TNF-α/IFN-γ-induced activation of PKCζ, p38 MAPK, or NF-κB. • (+)-Nootkatone suppresses chemokine expression by inhibiting of PKCζ and p38 pathways. - Abstract: Chemokines are important mediators of cell migration, and thymus and activation-regulated chemokine (TARC/CCL17) and macrophage-derived chemokine (MDC/CCL22) are well-known typical inflammatory chemokines involved in atopic dermatitis (AD). (+)-Nootkatone is the major component of Cyperus rotundus. (+)-Nootkatone has antiallergic, anti-inflammatory, and antiplatelet activities. The purpose of this study was to investigate the effect of (+)-nootkatone on tumor necrosis factor α (TNF-α)/interferon γ (IFN-γ)-induced expression of Th2 chemokines in HaCaT cells. We found that (+)-nootkatone inhibited the TNF-α/IFN-γ-induced expression of TARC/CCL17 and MDC/CCL22 mRNA in HaCaT cells. It also significantly inhibited TNF-α/IFN-γ-induced activation of nuclear factor kappa B (NF-κB), p38 mitogen-activated protein kinase (MAPK), and protein kinase Cζ (PKCζ). Furthermore, we showed that PKCζ and p38 MAPK contributed to the inhibition of TNF-α/IFN-γ-induced TARC/CCL17 and MDC/CCL22 expression by blocking IκBα degradation in HaCaT cells. Taken together, these results suggest that (+)-nootkatone may suppress TNF-α/IFN-γ-induced TARC/CCL17 and MDC/CCL22 expression in HaCaT cells by inhibiting of PKCζ and p38 MAPK signaling pathways that lead to activation of NF-κB. We propose that (+)-nootkatone may be a useful therapeutic candidate for inflammatory skin diseases such as AD.

  8. MC1R expression in HaCaT keratinocytes inhibits UVA-induced ROS production via NADPH oxidase- and cAMP-dependent mechanisms.

    Science.gov (United States)

    Henri, Pauline; Beaumel, Sylvain; Guezennec, Anne; Poumès, Carine; Stoebner, Pierre-Emmanuel; Stasia, Marie-José; Guesnet, Joëlle; Martinez, Jean; Meunier, Laurent

    2012-06-01

    Ultraviolet A (UVA) radiations are responsible for deleterious effects, mainly due to reactive oxygen species (ROS) production. Alpha-melanocyte stimulating hormone (α-MSH) binds to melanocortin-1 receptor (MC1R) in melanocytes to stimulate pigmentation and modulate cutaneous inflammatory responses. MC1R may be induced in keratinocytes after UV exposure. To investigate the effect of MC1R signaling on UVA-induced ROS (UVA-ROS) production, we generated HaCaT cells that stably express human MC1R (HaCaT-MC1R) or the Arg151Cys (R(151)C) non-functional variant (HaCaT-R(151)C). We then assessed ROS production immediately after UVA exposure and found that: (1) UVA-ROS production was strongly reduced in HaCaT-MC1R but not in HaCaT-R(151)C cells compared to parental HaCaT cells; (2) this inhibitory effect was further amplified by incubation of HaCaT-MC1R cells with α-MSH before UVA exposure; (3) protein kinase A (PKA)-dependent NoxA1 phosphorylation was increased in HaCaT-MC1R compared to HaCaT and HaCaT-R(151)C cells. Inhibition of PKA in HaCaT-MC1R cells resulted in a marked increase of ROS production after UVA irradiation; (4) the ability of HaCaT-MC1R cells to produce UVA-ROS was restored by inhibiting epidermal growth factor receptor (EGFR) or extracellular signal-regulated kinases (ERK) activity before UVA exposure. Our findings suggest that constitutive activity of MC1R in keratinocytes may reduce UVA-induced oxidative stress via EGFR and cAMP-dependent mechanisms. Copyright © 2011 Wiley Periodicals, Inc.

  9. AFLP and AMP Fingerprints as Markers to Evaluate Genetic Differences between Medicago truncatula Line Jemalong and 2HA, a New Line Produced by in vitro Culture Selection

    Directory of Open Access Journals (Sweden)

    R.R. Irwanto

    2008-09-01

    Full Text Available A new line, Medicago truncatula cv. Jemalong 2HA (herein known as 2HA has been developed via repetitive regeneration and selection of M. truncatula cv. Jemalong. During somatic embryogenesis, 2HA produces 500 times more embryos than its progenitor, Jemalong. It is interesting to study if those two lines are isogenic or has genetic differences. The main objectives of the study was to evaluate the genotypic differences between Jemalong and 2HA also to evaluate the methylation event in 2HA utilized two DNA fingerprinting techniques, i.e AFLP fingerprints (Amplified Length of Polymorphism and AMP (Amplified Methylation Polymorphism. The results showed that AFLP analysis using eight primers combinations could not detect any differences between Jemalong and 2HA. However, using AMP methylation sensitive primers it could detect 15 polymorphisms out of 840 markers. These results lead to a conclusion that Jemalong and 2HA are isogenic lines. 2HA may have higher regeneration capacities due to methylation process which occurs during the production of 2HA through repetitive regeneration cycles.

  10. The Structure of the Neurotoxin- Associated Protein HA33/A from Clostridium botulinum Suggests a Reoccurring Beta-Trefoil Fold in the Progenitor Toxin Complex

    National Research Council Canada - National Science Library

    Arndt, Joseph W; Gu, Jenny; Jaroszewski, Lukasz; Schwarzenbacher, Robert; Hanson, Michael A; Lebeda, Frank L; Stevens, Raymond C

    2004-01-01

    The hemagglutinating protein HA33 from Clostridium botulinum is associated with the large botulinum neurotoxin secreted complexes and is critical in toxin protection, internalization, and possibly activation...

  11. Biomaterials recycling: bioglasses obtained from reuse of hydroxyapatite (HA) bovine bone with term exceeded validity; Reciclagem de biomateriais: biovidros obtidos a partir do reaproveitamento de hidroxiapatita (HA) ossea bovina com prazo de validade excedido

    Energy Technology Data Exchange (ETDEWEB)

    Silva, A.C.; Santos, S.C.; Braga, F.J.C., E-mail: dasilva.ac@uol.com.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Aparecida, A.H. [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Araraquara, SP (Brazil). Inst. de Quimica

    2012-07-01

    The hydroxyapatite (HA) is a reference bioceramic for bone replacement and regeneration medical practice, becoming one of the most produced and researched bone graft material. Since it is a material for biomedical application, the manufacture and storage of this bioceramic must comply with severe conservation criteria, and its validity date is the lawful major factor for disposal. Materials with the exceeded expiration date are usually discarded and incinerated, resulting in ash, environmental contamination and energy expenditure. This study evaluates the possibility of reuse of bovine HA collected after its validity date as raw material to obtain bioglass, aiming to natural resources saving and environmental emissions mitigation. 45S5 similar compositions were obtained by melting the materials at 1500 ° C, followed by rapid cooling and annealing thermal treatment (500 ° C for 2h), analytical grade chemical reagents were used to set the final composition. The obtained materials were characterized by X-ray diffraction, infrared spectroscopy (FT-IR), and hydrolysis resistance techniques. The results of comparative chemical resistance (Hydrolytic) tests indicate the potential use of the materials developed for bone replacement applications. (author)

  12. Multivalent HA DNA vaccination protects against highly pathogenic H5N1 avian influenza infection in chickens and mice.

    Directory of Open Access Journals (Sweden)

    Srinivas Rao

    Full Text Available Sustained outbreaks of highly pathogenic avian influenza (HPAI H5N1 in avian species increase the risk of reassortment and adaptation to humans. The ability to contain its spread in chickens would reduce this threat and help maintain the capacity for egg-based vaccine production. While vaccines offer the potential to control avian disease, a major concern of current vaccines is their potency and inability to protect against evolving avian influenza viruses.The ability of DNA vaccines encoding hemagglutinin (HA proteins from different HPAI H5N1 serotypes was evaluated for its ability to elicit neutralizing antibodies and to protect against homologous and heterologous HPAI H5N1 strain challenge in mice and chickens after DNA immunization by needle and syringe or with a pressure injection device. These vaccines elicited antibodies that neutralized multiple strains of HPAI H5N1 when given in combinations containing up to 10 HAs. The response was dose-dependent, and breadth was determined by the choice of the influenza virus HA in the vaccine. Monovalent and trivalent HA vaccines were tested first in mice and conferred protection against lethal H5N1 A/Vietnam/1203/2004 challenge 68 weeks after vaccination. In chickens, protection was observed against heterologous strains of HPAI H5N1 after vaccination with a trivalent H5 serotype DNA vaccine with doses as low as 5 microg DNA given twice either by intramuscular needle injection or with a needle-free device.DNA vaccines offer a generic approach to influenza virus immunization applicable to multiple animal species. In addition, the ability to substitute plasmids encoding different strains enables rapid adaptation of the vaccine to newly evolving field isolates.

  13. COMPARISON OF METHICILLIN RESISTANT STAPHYLOCOCCUS AUREUS IN HEALTHY COMMUNITY HOSPITAL VISITORS[CA-MRSA] AND HOSPITAL STAFF [HA-MRSA

    Directory of Open Access Journals (Sweden)

    Nirmal A Pathare

    2015-10-01

    Full Text Available Background: The prevalence of community associated methicillin resistant Staphylococcus aureus [CA-MRSA] in unknown in Oman. Methods: Nasal and cell phones swabs were collected from hospital visitors and health-care workers on sterile polyester swabs and directly inoculated onto a mannitol salt agar containing oxacillin, allowing growth of methicillin-resistant microorganisms. Antibiotic susceptibility tests were performed using Kirby Bauer’s disc diffusion method on the isolates. A brief survey questionnaire was requested be filled to ascertain the exposure to known risk factors for CA-MRSA carriage. Results: Overall, nasal colonization with CA-MRSA was seen in 34 individuals (18%, 95% confidence interval [CI] =12.5%-23.5%, whereas, CA-MRSA was additionally isolated from the cell phone surface in 12 participants (6.3%, 95% CI =5.6%-6.98%. Nasal colonization prevalence with HA-MRSA was seen in 16 individuals (13.8%, 95% confidence interval [CI] =7.5%-20.06%, whereas, HA-MRSA was additionally isolated from the cell phone surface in 3 participants (2.6%, 95% CI =1.7-4.54.  Antibiotic sensitivity was 100% to linezolid and rifampicin in the CA-MRSA isolates. Antibiotic resistance to vancomycin and clindamycin varied between 9-11 % in the CA-MRSA isolates.  There was no statistically significant correlation between CA-MRSA nasal carriage and the risk factors (P>0.05, Chi-square test. Conclusions: The prevalence of CA-MRSA in the healthy community hospital visitors was 18 % (95% CI, 12.5% to 23.5% as compared to 13.8% [HA-MRSA] in the hospital health-care staff. In spite of a significant prevalence of CA-MRSA, these strains were mostly sensitive. Recommendation the universal techniques of hand washing, personal hygiene and sanitation are thus warranted.

  14. Le processus de tertiarisation de l’économie haïtienne The Tertiarization of the Haitian Economy

    Directory of Open Access Journals (Sweden)

    Bénédique Paul

    2012-05-01

    Full Text Available Dans les années 1800, l’agriculture représentait près de 95% du Produit Intérieur Brut (PIB d’Haïti. En 2009, le secteur primaire entier ne représentait plus que 23% du PIB. Ce déclin s’est fait au profit du développement du secteur tertiaire, lui-même dominé par des petits commerces. Le secteur tertiaire est passé de moins de 5% à 60% du PIB sur la même période. La mise en évidence de ce processus irréversible est l’objectif poursuivi dans cet article. Il s’agit de faire la lumière sur ce changement de tendance sectorielle dans l’activité économique en Haïti. L’observation des données macroéconomiques dans le temps nous amène à la conclusion que l’économie haïtienne n’est plus essentiellement agricole. Elle est tertiarisée de façon informelle.In the 1800’s, agriculture represented almost 95% of the Haitian Gross Domestic Product (GDP. In 2009, the whole primary sector does not contribute more than 23% in the GDP. This decline profited the service sector which is dominated by little trade. The service sector moved from less than 5% to 60% of the GDP in the same period. In the present article we intend to underline this irreversible process.   We aim to shed light on the current sectoral tendency change in Haiti’s economic activity. Evidence from macroeconomic data through time allows us to conclude that the Haitian economy is no more dominated by agriculture. It is dominated by the service sector, greatly informal.

  15. "Eg vil ha graut og sjokomelk" : foreldre sine erfaringar med opplæring og bruk av PECS heime

    OpenAIRE

    Sande, Anita

    2006-01-01

    SAMANDRAG Menneske som av ulike årsaker ikkje kan formidle seg via talespråk kan ha nytte av alternativ eller supplerande kommunikasjon (ASK). The Picture Exchange Communication System (PECS) er eit kommunikasjonssystem basert på grafiske symbol, som ei aukande gruppe barn og unge utan talespråk tek i bruk. Det spesialpedagogiske hjelpeapparatet i Norge er i stor grad retta inn mot å rettleie det pedagogiske personalet, i barnehage og skule, som arbeider med barn med særskilde vanska...

  16. Comparison of Methicillin Resistant Staphylococcus Aureus in Healthy Community Hospital Visitors [CA-MRSA] and Hospital Staff [HA-MRSA].

    Science.gov (United States)

    Pathare, Nirmal A; Tejani, Sara; Asogan, Harshini; Al Mahruqi, Gaitha; Al Fakhri, Salma; Zafarulla, Roshna; Pathare, Anil V

    2015-01-01

    The prevalence of community-associated methicillin-resistant Staphylococcus aureus [CA-MRSA] is unknown in Oman. Nasal and cell phones swabs were collected from hospital visitors and health-care workers on sterile polyester swabs and directly inoculated onto a mannitol salt agar containing oxacillin, allowing growth of methicillin-resistant microorganisms. Antibiotic susceptibility tests were performed using Kirby Bauer's disc diffusion method on the isolates. Minimum inhibitory concentration (MIC) was determined for vancomycin and teicoplanin against the resistant isolates of MRSA by the Epsilometer [E] test. A brief survey questionnaire was requested be filled to ascertain the exposure to known risk factors for CA-MRSA carriage. Overall, nasal colonization with CA-MRSA was seen in 34 individuals (18%, 95% confidence interval [CI] =12.5%-23.5%), whereas, CA-MRSA was additionally isolated from the cell phone surface in 12 participants (6.3%, 95% CI =5.6%-6.98%). Nasal colonization prevalence with hospital-acquired [HA] MRSA was seen in 16 individuals (13.8%, 95% confidence interval [CI] =7.5%-20.06%), whereas, HA-MRSA was additionally isolated from the cell phone surface in 3 participants (2.6%, 95% CI =1.7-4.54). Antibiotic sensitivity was 100% to linezolid and rifampicin in the CA-MRSA isolates. Antibiotic resistance to vancomycin and clindamycin varied between 9-11 % in the CA-MRSA isolates. Mean MIC for vancomycin amongst CA- and HA-MRSA were 6.3 and 9.3 μg/ml, whereas for teicoplanin they were 13 and 14 μg/ml respectively by the E-test. There was no statistically significant correlation between CA-MRSA nasal carriage and the risk factors (P>0.05, Chi-square test). The prevalence of CA-MRSA in the healthy community hospital visitors was 18 % (95% CI, 12.5% to 23.5%) as compared to 13.8% HA-MRSA in the hospital health-care staff. Despite a significant prevalence of CA-MRSA, these strains were mostly sensitive. The universal techniques of hand washing, personal

  17. Efecto de la melatonina y de HA/β-TCP/C sobre la pulpa dental de molares de rata

    OpenAIRE

    Guerrero Gironés, Julia

    2014-01-01

    OBJETIVOS La melatonina juega un papel esencial en la regulación del crecimiento óseo. El efecto de la melatonina sobre los odontoblastos podría ser similar a su acción sobre los osteoblastos. La hidroxiapatita (HA) y el fosfato beta-tricálcico (β-TCP) son biocerámicas usadas como sustitutos óseos que, unidas a colágeno (C) como soporte, tienen unas cualidades osteoconductoras satisfactorias. El objetivo de nuestro estudio es evaluar la respuesta de la pulpa de molares de rata a la melaton...

  18. Incoming human papillomavirus 16 genome is lost in PML protein-deficient HaCaT keratinocytes.

    Science.gov (United States)

    Bienkowska-Haba, Malgorzata; Luszczek, Wioleta; Keiffer, Timothy R; Guion, Lucile G M; DiGiuseppe, Stephen; Scott, Rona S; Sapp, Martin

    2017-05-01

    Human papillomaviruses (HPVs) target promyelocytic leukemia (PML) nuclear bodies (NBs) during infectious entry and PML protein is important for efficient transcription of incoming viral genome. However, the transcriptional down regulation was shown to be promoter-independent in that heterologous promoters delivered by papillomavirus particles were also affected. To further investigate the role of PML protein in HPV entry, we used small hairpin RNA to knockdown PML protein in HaCaT keratinocytes. Confirming previous findings, PML knockdown in HaCaT cells reduced HPV16 transcript levels significantly following infectious entry without impairing binding and trafficking. However, when we quantified steady-state levels of pseudogenomes in interphase cells, we found strongly reduced genome levels compared with parental HaCaT cells. Because nuclear delivery was comparable in both cell lines, we conclude that viral pseudogenome must be removed after successful nuclear delivery. Transcriptome analysis by gene array revealed that PML knockdown in clonal HaCaT cells was associated with a constitutive interferon response. Abrogation of JAK1/2 signaling prevented genome loss, however, did not restore viral transcription. In contrast, knockdown of PML protein in HeLa cells did not affect HPV genome delivery and transcription. HeLa cells are transformed by HPV18 oncogenes E6 and E7, which have been shown to interfere with the JAK/Stat signaling pathway. Our data imply that PML NBs protect incoming HPV genomes. Furthermore, they provide evidence that PML NBs are key regulators of the innate immune response in keratinocytes. Promyelocytic leukemia nuclear bodies (PML NBs) are important for antiviral defense. Many DNA viruses target these subnuclear structures and reorganize them. Reorganization of PML NBs by viral proteins is important for establishment of infection. In contrast, HPVs require the presence of PML protein for efficient transcription of incoming viral genome. Our

  19. T24 human bladder carcinoma cells with activated Ha-ras protooncogene: nontumorigenic cells susceptible to malignant transformation with carcinogen.

    OpenAIRE

    Senger, D. R.; Perruzzi, C A; Ali, I U

    1988-01-01

    A comparative analysis of T24 human bladder carcinoma cells and N-methyl-N'-nitro-N-nitrosoguanidine (MeNNG)-transformed derivatives (MeNNG-T24 cells) revealed the following: (i) The presence of an activated c-Ha-ras gene (in the absence of the normal allele) is insufficient to confer upon T24 cells a tumor-associated phenotype. (ii) MeNNG-transformed T24 cells not only acquire tumor-associated (in vitro) traits (growth in soft agar and rhodamine retention) but, are highly tumorigenic in nude...

  20. ARHGAP1 overexpression inhibits proliferation, migration and invasion of C-33A and SiHa cell lines

    Directory of Open Access Journals (Sweden)

    Li JP

    2017-02-01

    Full Text Available Jun-ping Li,1 Yang Liu,2 Yi-hua Yin3 1Department of Gynecology and Obstetrics, Huashan Hospital North, 2Institute of Antibiotics, Huashan Hospital, Fudan University, 3Department of Gynecology, Shanghai First Maternity and Infant Hospital, Tongji University School of Medicine, Shanghai, People’s Republic of China Abstract: ARHGAP1, also known as RhoGAP, RhoGAP1, CDC42GAP and p50rhoGAP, is officially named Ras homology (Rho GTPase-activating protein 1, which is one of the key members of RhoGAPs. Growing evidences demonstrate that several RhoGAPs are suppressed or downregulated in cancers. Thus, the aim of this study was to explore the effects of ARHGAP1 on cervical carcinoma cells. The human cervical carcinoma cells C-33A and SiHa were transduced with lentivirus targeting ARHGAP1 (lenti-ARHGAP1. Cellular proliferation, migration and invasion assays, as well as quantitative real-time polymerase chain reaction and Western blot assays, were performed in the control, negative control (infected with lentivirus and ARHGAP1+-infected groups. Results showed that overexpression of ARHGAP1 markedly inhibited the proliferation of both C-33A and SiHa cells at 24 h, 48 h and 72 h in a time-dependent manner (n=3, P<0.01. Migration and invasion of C-33A and SiHa cells were suppressed after the transduction with lenti-ARHGAP1 compared with the controls (n=3, P<0.01. In addition, several tumor cellular process-related proteins, such as matrix metallopeptidase 2, zinc finger E-box binding homeobox 1, Cyclin B1, twist family bHLH transcription factor 1 and proliferating cell nuclear antigen, were all downregulated in ARHGAP1-overexpressed C-33A and SiHa cells and proved to be targets of ARHGAP1. This study indicated that ARHGAP1 may have a positive function on antitumor activity in the treatment of cervical cancer. Keywords: cervical carcinoma, ARHGAP1, tumor cellular process-related protein

  1. HA-Coated Implant

    DEFF Research Database (Denmark)

    Daugaard, Henrik; Søballe, Kjeld; Bechtold, Joan E

    2014-01-01

    The goal of osseointegration of orthopedic and dental implants is the rapid achievement of a mechanically stable and long lasting fixation between living bone and the implant surface. In total joint replacements of cementless designs, coatings of calcium phosphates were introduced as a means...

  2. Ha-Mah-Tsa

    Science.gov (United States)

    Johnston, Basil

    1978-01-01

    Describing the values and moral orientations associated with the Cannibal Dance Ceremony, this article emphasizes the Kwahiutl's belief in the free will to choose between good or selflessness and evil or selfishness. (JC)

  3. Characterization of Palytoxin Binding to HaCaT Cells Using a Monoclonal Anti-Palytoxin Antibody

    Directory of Open Access Journals (Sweden)

    Chiara Florio

    2013-02-01

    Full Text Available Palytoxin (PLTX is the reference compound for a group of potent marine biotoxins, for which the molecular target is Na+/K+-ATPase. Indeed, ouabain (OUA, a potent blocker of the pump, is used to inhibit some PLTX effects in vitro. However, in an effort to explain incomplete inhibition of PLTX cytotoxicity, some studies suggest the possibility of two different binding sites on Na+/K+-ATPase. Hence, this study was performed to characterize PLTX binding to intact HaCaT keratinocytes and to investigate the ability of OUA to compete for this binding. PLTX binding to HaCaT cells was demonstrated by immunocytochemical analysis after 10 min exposure. An anti-PLTX monoclonal antibody-based ELISA showed that the binding was saturable and reversible, with a Kd of 3 × 10−10 M. However, kinetic experiments revealed that PLTX binding dissociation was incomplete, suggesting an additional, OUA-insensitive, PLTX binding site. Competitive experiments suggested that OUA acts as a negative allosteric modulator against high PLTX concentrations (0.3–1.0 × 10−7 M and possibly as a non-competitive antagonist against low PLTX concentrations (0.1–3.0 × 10−9 M. Antagonism was supported by PLTX cytotoxicity inhibition at OUA concentrations that displaced PLTX binding (1 × 10−5 M. However, this inhibition was incomplete, supporting the existence of both OUA-sensitive and -insensitive PLTX binding sites.

  4. Genetic drift of HA and NA in Danish swine influenza virus from the period 2003-2012

    DEFF Research Database (Denmark)

    Fobian, Kristina; Breum, Solvej Østergaard; Hjulsager, Charlotte Kristiane

    2012-01-01

    The aim of this study is to analyze; the genetic drift in hemagglutinin (HA) and neuraminidase (NA) genes from influenza viruses isolated from Danish swine over the past decade; the antigenic evolution and relatedness between swine influenza virus strains of the H1 subtype by antigenic cartograph...... and along with the monitoring of antigenic changes in hemagglutinin subtypes it will be possible to ensure a continuous efficacy of influenza virus vaccines.......The aim of this study is to analyze; the genetic drift in hemagglutinin (HA) and neuraminidase (NA) genes from influenza viruses isolated from Danish swine over the past decade; the antigenic evolution and relatedness between swine influenza virus strains of the H1 subtype by antigenic cartography....... Currently at least three influenza A subtypes (H1N1, H1N2 and H3N2) are endemic in the Danish swine population, and since 2010 the pandemic virus (H1N1pdm09) have also frequently been detected. The focus in this study will be on H1N1 and H1N2, since the prevalence of H3N2 have declined over the past years...

  5. Expression of the hemagglutinin HA1 subunit of the equine influenza virus using a baculovirus expression system.

    Science.gov (United States)

    Sguazza, Guillermo H; Fuentealba, Nadia A; Tizzano, Marco A; Galosi, Cecilia M; Pecoraro, Marcelo R

    2013-01-01

    Equine influenza virus is a leading cause of respiratory disease in horses worldwide. Disease prevention is by vaccination with inactivated whole virus vaccines. Most current influenza vaccines are generated in embryonated hens' eggs. Virions are harvested from allantoic fluid and chemically inactivated. Although this system has served well over the years, the use of eggs as the substrate for vaccine production has several well-recognized disadvantages (cost, egg supply, waste disposal and yield in eggs). The aim of this study was to evaluate a baculovirus system as a potential method for producing recombinant equine influenza hemagglutinin to be used as a vaccine. The hemagglutinin ectodomain (HA1 subunit) was cloned and expressed using a baculovirus expression vector. The expression was determined by SDS-PAGE and immunoblotting. A high yield, 20μg/ml of viral protein, was obtained from recombinant baculovirus-infected cells. The immune response in BALB/c mice was examined following rHA1 inoculation. Preliminary results show that recombinant hemagglutinin expressed from baculovirus elicits a strong antibody response in mice; therefore it could be used as an antigen for subunit vaccines and diagnostic tests. Copyright © 2013 Asociación Argentina de Microbiología. Publicado por Elsevier España. All rights reserved.

  6. Binding of the Antagonist Caffeine to the Human Adenosine Receptor hA2AR in Nearly Physiological Conditions.

    Directory of Open Access Journals (Sweden)

    Ruyin Cao

    Full Text Available Lipid composition may significantly affect membrane proteins function, yet its impact on the protein structural determinants is not well understood. Here we present a comparative molecular dynamics (MD study of the human adenosine receptor type 2A (hA(2AR in complex with caffeine--a system of high neuro-pharmacological relevance--within different membrane types. These are POPC, mixed POPC/POPE and cholesterol-rich membranes. 0.8-μs MD simulations unambiguously show that the helical folding of the amphipathic helix 8 depends on membrane contents. Most importantly, the distinct cholesterol binding into the cleft between helix 1 and 2 stabilizes a specific caffeine-binding pose against others visited during the simulation. Hence, cholesterol presence (~33%-50% in synaptic membrane in central nervous system, often neglected in X-ray determination of membrane proteins, affects the population of the ligand binding poses. We conclude that including a correct description of neuronal membranes may be very important for computer-aided design of ligands targeting hA(2AR and possibly other GPCRs.

  7. Antitumour activity of AMG 900 alone or in combination with histone deacetylase inhibitor SaHa on medulloblastoma cell lines.

    Science.gov (United States)

    Geron, Lenisa; Borges, Kleiton Silva; Andrade, Augusto Faria; Suazo, Veridiana Kill; Scrideli, Carlos Alberto; Tone, Luiz Gonzaga

    2015-08-01

    Medulloblastoma (MB) is the most common malignant childhood brain tumour. Aurora kinases are essential for cell division and are primarily active during mitosis. Recently, the combination of aurora kinases inhibitors (iAURK) and histone deacetylase inhibitors (iHDAC) has shown potential antitumour effects and had significant biological effects in preclinical cancer models. In this study, we analysed the effects of the pan-aurora kinases inhibitor AMG 900 alone or in combination with the iHDAC SaHa (Vorinostat) on paediatric MB cell lines (UW402, UW473 and ONS-76). Cell proliferation was measured by XTT assay, apoptosis was determined by flow cytometry and clonogenic capacity was studied. qRT-PCR assays were used to determine the mRNA expression in MB cell lines after treatment. Drug combination analyses were made based on Chou-Talalay method. AMG 900 caused the inhibition of cell proliferation, diminution of clonogenic capacity and increased the apoptosis rate in cell lines (P AMG900-SaHa combination was evidenced on the inhibition of cell proliferation in all cell lines, especially in sequential drug treatment. Moreover, the combination of these drugs reached 100% of the inhibition in colony formation (synergistic effect). The treatment with AMG 900 increased the p21 and GDF15 expression, but did not alter the TP53 in one of the cell lines. These results indicate that AMG 900 may be a promising drug for the adjuvant treatment of MB, mainly when combined with iHDAC.

  8. Production of poly(β-l-malic acid) by Aureobasidium pullulans HA-4D under solid-state fermentation.

    Science.gov (United States)

    Xia, Jun; Li, Rongqing; He, Aiyong; Xu, Jiaxing; Liu, Xiaoyan; Li, Xiangqian; Xu, Jiming

    2017-11-01

    Poly(β-l-malic acid) (PMA) production by Aureobasidium pullulans HA-4D was carried out through solid-state fermentation (SSF) using agro-industrial residues. Maximum PMA production (75.4mg/g substrate) was obtained from a mixed substrate of sweet potato residue and wheat bran (1:1, w/w) supplemented with NaNO3 (0.8%, w/w) and CaCO3 (2%, w/w), with an initial moisture content of 70% and inoculum size of 13% (v/w) for 8days. Repeated-batch SSF was successfully conducted for 5 cycles with a high productivity. The scanning electron microscopy showed that the yeast-like cells of A. pullulans HA-4D could grow well on the solid substrate surface. Moreover, the cost analysis showed that the unit price of PMA in SSF was much lower than that of SmF. This is the first report on PMA production via SSF, and this study provided a new method to produce PMA from inexpensive agro-industrial residues. Copyright © 2017 Elsevier Ltd. All rights reserved.

  9. Design, construction and mechanical testing of digital 3D anatomical data-based PCL-HA bone tissue engineering scaffold.

    Science.gov (United States)

    Yao, Qingqiang; Wei, Bo; Guo, Yang; Jin, Chengzhe; Du, Xiaotao; Yan, Chao; Yan, Junwei; Hu, Wenhao; Xu, Yan; Zhou, Zhi; Wang, Yijin; Wang, Liming

    2015-01-01

    The study aims to investigate the techniques of design and construction of CT 3D reconstructional data-based polycaprolactone (PCL)-hydroxyapatite (HA) scaffold. Femoral and lumbar spinal specimens of eight male New Zealand white rabbits were performed CT and laser scanning data-based 3D printing scaffold processing using PCL-HA powder. Each group was performed eight scaffolds. The CAD-based 3D printed porous cylindrical stents were 16 piece × 3 groups, including the orthogonal scaffold, the Pozi-hole scaffold and the triangular hole scaffold. The gross forms, fiber scaffold diameters and porosities of the scaffolds were measured, and the mechanical testing was performed towards eight pieces of the three kinds of cylindrical scaffolds, respectively. The loading force, deformation, maximum-affordable pressure and deformation value were recorded. The pore-connection rate of each scaffold was 100 % within each group, there was no significant difference in the gross parameters and micro-structural parameters of each scaffold when compared with the design values (P > 0.05). There was no significant difference in the loading force, deformation and deformation value under the maximum-affordable pressure of the three different cylinder scaffolds when the load was above 320 N. The combination of CT and CAD reverse technology could accomplish the design and manufacturing of complex bone tissue engineering scaffolds, with no significant difference in the impacts of the microstructures towards the physical properties of different porous scaffolds under large load.

  10. Education par le numérique en Haïti : Enjeux, défis et perspectives

    Directory of Open Access Journals (Sweden)

    Nirvah Jean-Jacques

    2015-12-01

    Full Text Available Ces présentes réflexions portent sur les initiatives partant de l’idée d’éduquer par le numérique les jeunes haïtiens, notamment ceux dont les parents n’ont pas de moyens financiers leur permettant de payer scolarité. Notre objectif est d’indiquer ici quelques enjeux et défis que ces initiatives prises peut-être sous émotions face aux progrès des Technologies de l’Information et de la Communication (TIC semblent ne pas prendre en compte. À partir des enjeux et défis indiqués, nous essayerons de dégager des perspectives que nous souhaitons être une contribution aux réflexions portant sur le système éducatif haïtien à l’heure actuelle en vue d’une éducation de qualité à l’échelle nationale.

  11. 7 CFR 1940.335 - Environmental review of FmHA or its successor agency under Public Law 103-354 proposals for...

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 13 2010-01-01 2009-01-01 true Environmental review of FmHA or its successor agency under Public Law 103-354 proposals for legislation. 1940.335 Section 1940.335 Agriculture Regulations of... REGULATIONS (CONTINUED) GENERAL Environmental Program § 1940.335 Environmental review of FmHA or its successor...

  12. 7 CFR 1901.506 - Book-entry procedure for FmHA or its successor agency under Public Law 103-354 securities...

    Science.gov (United States)

    2010-01-01

    ... under Public Law 103-354 securities-issuance and redemption of certificate by Reserve bank. 1901.506...) Issue book-entry FmHA or its successor agency under Public Law 103-354 securities by means of entries on... Law 103-354 securities and definitive FmHA or its successor agency under Public Law 103-354 securities...

  13. Different activities of the adenovirus types 5 and 12 E1A regions in transformation with the EJ Ha-ras oncogene

    NARCIS (Netherlands)

    Jochemsen, A.G.; Bernards, R.A.; Kranen, H.J. van; Houweling, A.; Bos, J.L.; Eb, A.J. van der

    1986-01-01

    We have compared the capacities of the E1A regions of nononcogenic adenovirus type 5 (Ad5) and highly oncogenic Ad12 to cooperate with the EJ bladder carcinoma Ha-ras-1 oncogene in the transformation of primary baby rat kidney cells. Both E1A regions, when cotransfected with the Ha-ras oncogene,

  14. Historical Background to Nahmanides’ Acre Sermon for Rosh ha-Shanah: The Strengthening of the Catalonian Center

    Directory of Open Access Journals (Sweden)

    Yahalom, Shalem

    2008-12-01

    Full Text Available This study identifies literary testimony of the conflict over the nature of the Rosh ha-Shanah prayer in Nahmanides’ Sermon. Acre was in the 13th century home to rival Talmudic academies. In his Sermon for Rosh ha-Shanah, Ramban confronts the founding figures of the Tosafist community in the city. His ongoing controversy with contemporary sages can be read between the lines. Aside from brief segments, the majority of its Halakhic section is specifically aimed at opposing the Tosafists’ rulings, and the way in which material was chosen also highlights its polemical aim. In Ramban’s Novellae, he does not hesitate to argue with Tosafist and Andalusian-Geonic Halakhic rulings. Yet in the Sermon, he prefers citing reservations he had about the former. In the 13th century the intellectual momentum of the Tosafists came to a halt, simultaneous to the flourishing of Ramban’s study hall, and many Talmudic innovations were collected in the Novellae written by Ramban and his disciples. This transition forms an intellectual turning point in Talmud study. The confrontation among the academies in Acre may be viewed as a microcosm of this process.Este estudio analiza el conflicto en torno al carácter de la oración de Roš ha-Šaná en el Sermón de Na?mánides (Rambán. Acre albergaba en el siglo XIII academias talmúdicas rivales, y en su Sermón de Roš ha-Šaná, Rambán confronta a las figuras fundacionales de la congregación tosafista de esa ciudad. Su controversia con sabios coetáneos puede leerse entre líneas y, a excepción de alguna otra referencia a otros asuntos, la mayor parte de su exposición halájica, junto a la manera en la que el material expuesto ha sido elegido, se dedica a combatir las decisiones de aquéllos. En sus Novellae, Rambán no había dudado en discutir tanto las decisiones halájicas tosafistas como las gueónico-andalusíes, pero en el sermón prefiere subrayar sus reservas acerca de aquéllas. De manera simult

  15. Thermal Characteristic Of Waste-Derived Hydroxyapatite (HA) Reinforced Ultra High Molecular Weight Polyethylene (UHMWPE) Composites For Fused Deposition Modeling (FDM) Process

    Science.gov (United States)

    Ansari, Mohamad Helmi Bin Md; Ibrahim, Mohd Halim Irwan Bin

    2017-01-01

    The present study provides a hydrothermal synthesis to obtain Hydroxyapatite (HA) powder from waste eggshells. This waste-derived HA has been characterized by X-ray diffraction, scanning electron microscopy and energy dispersive spectroscopy analysis. Waste-derived HA will be reinforced the Ultra-High Molecular Weight Polyethylene (UHMWPE) to develop a material composite for biomedical applications because of impressive mechanical properties owned by UHMWPE. Main challenger is UHMWPE has an ultra-high viscosity that renders continuous melt- state processes including one of the additive manufacturing processes which is Fused Deposition Modeling (FDM). To develop this material as feedstock in FDM process, it has been overcome by blending UHMWPE with waste-derived HA as filler. It exhibit the inclusion of 50wt% HA has reduced the degradation temperature in TGA and DSC thus enhances the processability in FDM process.

  16. Immunopotentiation of Different Adjuvants on Humoral and Cellular Immune Responses Induced by HA1-2 Subunit Vaccines of H7N9 Influenza in Mice.

    Directory of Open Access Journals (Sweden)

    Li Song

    Full Text Available In spring 2013, human infections with a novel avian influenza A (H7N9 virus were reported in China. The number of cases has increased with over 200 mortalities reported to date. However, there is currently no vaccine available for the H7 subtype of influenza A virus. Virus-specific cellular immune responses play a critical role in virus clearance during influenza infection. In this study, we undertook a side-by-side evaluation of two different adjuvants, Salmonella typhimurium flagellin (fliC and polyethyleneimine (PEI, through intraperitoneal administration to assess their effects on the immunogenicity of the recombinant HA1-2 subunit vaccine of H7N9 influenza. The fusion protein HA1-2-fliC and HA1-2 combined with PEI could induce significantly higher HA1-2-specific IgG and hemagglutination inhibition titers than HA1-2 alone at 12 days post-boost, with superior HA1-2 specific IgG titers in the HA1-2-fliC group compared with the PEI adjuvanted group. The PEI adjuvanted vaccine induced higher IgG1/IgG2a ratio and significantly increased numbers of IFN-γ- and IL-4-producing cells than HA1-2 alone, suggesting a mixed Th1/Th2-type cellular immune response with a Th2 bias. Meanwhile, the HA1-2-fliC induced higher IgG2a and IgG1 levels, which is indicative of a mixed Th1/Th2-type profile. Consistent with this, significant levels, and equal numbers, of IFN-γ- and IL-4-producing cells were detected after HA1-2-fliC vaccination. Moreover, the marked increase in CD69 expression and the proliferative index with the HA1-2-fliC and PEI adjuvanted vaccines indicated that both adjuvanted vaccine candidates effectively induced antigen-specific cellular immune responses. Taken together, our findings indicate that the two adjuvanted vaccine candidates elicit effective and HA1-2-specific humoral and cellular immune responses, offering significant promise for the development of a successful recombinant HA1-2 subunit vaccine for H7N9 influenza.

  17. Centella asiatica protects against UVB-induced HaCaT keratinocyte damage through microRNA expression changes.

    Science.gov (United States)

    An, In-Sook; An, Sungkwan; Choe, Tae-Βoo; Kang, Sang-Μo; Lee, Jae Ho; Park, In-Chul; Jin, Young-Woo; Lee, Su-Jae; Bae, Seunghee

    2012-12-01

    This study aimed to evaluate the protective effects of Centella asiatica (C. asiatica) against ultraviolet B (UVB) damage in human keratinocytes using microRNA (miRNA) expression profiling analysis. Titrated extract of C. asiatica (TECA) demonstrated low cytotoxicity in normal human HaCaT keratinocytes only at low doses (<5 µg/ml). UVB (50 mJ/cm2) irradiation significantly decreased cell viability, and TECA treatment decreased the UVB toxicity. By using miRNA microarrays, we determined that 72 miRNAs had an altered expression following TECA treatment in UVB-irradiated keratinocytes (46 upregulated and 26 downregulated). Using an miRNA target gene prediction tool and Gene Ontology (GO) analysis, we determined that miRNAs with altered expression were functionally related with the inhibition of apoptosis and cell proliferation. Overall, these results provide meaningful information to facilitate the understanding of TECA-mediated UVB protection in human keratinocytes.

  18. Sodium pyruvate modulates cell death pathways in HaCaT keratinocytes exposed to half-mustard gas.

    Science.gov (United States)

    Paromov, Victor; Brannon, Marianne; Kumari, Sudha; Samala, Mallikarjun; Qui, Min; Smith, Milton; Stone, William L

    2011-03-01

    2-Chloroethyl ethyl sulfide (CEES) or half-mustard gas, a sulfur mustard (HD) analog, is a genotoxic agent that causes oxidative stress and induces both apoptotic and necrotic cell death. Sodium pyruvate induced a necrosis-to-apoptosis shift in HaCaT cells exposed to CEES levels ≤ 1.5 mmol/L and lowered markers of DNA damage, oxidative stress, and inflammation. This study provides a rationale for the future development of multicomponent therapies for HD toxicity in the skin. We hypothesize that a combination of pyruvates with scavengers/antioxidants encapsulated in liposomes for optimal local delivery should be therapeutically beneficial against HD-induced skin injury. However, the latter suggestion should be verified in animal models exposed to HD.

  19. HPV16E6-Dependent c-Fos Expression Contributes to AP-1 Complex Formation in SiHa Cells

    Directory of Open Access Journals (Sweden)

    Feixin Liang

    2011-01-01

    Full Text Available To date, the major role of HPV16E6 in cancer has been considered to be its ability to inhibit the p53 tumor-suppressor protein, thereby thwarting p53-mediated cytotoxic responses to cellular stress signals. Here, we show that HPV16E6-dependent c-fos oncogenic protein expression contributes to AP-1 complex formation under oxidative stress in SiHa cells (HPV16-positive squamous cell carcinoma of the cervix. In addition, we examined the role of HPV16E6 in TGF-α-induced c-fos expression and found that the c-fos protein expression induced by TGF-α is HPV16E6 dependent. Thus, our results provide the first evidence that HPV16E6 contributes to AP-1 complex formation after both ligand-dependent and independent EGFR activation, suggesting a new therapeutic approach to the treatment of HPV-associated tumors.

  20. El estado mexicano de Chiapas: ¿Qué ha cambiado en veinte años?

    Directory of Open Access Journals (Sweden)

    Agustín Ávila Romero

    2014-12-01

    Full Text Available En el presente texto se hace un recorrido sobre las causas económicas y sociales que posibilitaron la rebelión zapatista hace veinte años, para mostrar que este hecho ocasionó la llegada creciente de recursos económicos al estado de Chiapas y exponer, a su vez, como se utilizaron los dineros por parte de los municipios oficiales y el Gobierno del estado. Se concluye que las finanzas públicas de Chiapas son sumamente débiles y que pese a la creciente inyección de capital que ha recibido, el estado se encuentra sobre endeudado y en condiciones de marginación y pobreza similares a las de hace dos décadas.

  1. ARKRAY ADAMS A1c HA-8180T Analyzer for Diagnosis of Thalassemia and Hemoglobinopathies Common in Southeast Asia.

    Science.gov (United States)

    Kunwandee, Jatuphol; Srivorakun, Hataichanok; Fucharoen, Goonnapa; Sanchaisuriya, Kanokwan; Fucharoen, Supan

    2014-01-01

    To evaluate the ARKRAY ADAMS A1c HA-8180T analyzer for diagnosis of thalassemias and hemoglobinopathies commonly found in the Southeast Asian population. Our cohort consisted of 557 specimens from adults referred for thalassemia diagnosis. From these, we selected 457 specimens and subjected them to DNA analysis to determine various thalassemia genotypes. Also, to confirm the reference range for HbA2, we obtained an additional 48 specimens from healthy individuals. We estimated the diagnostic range for Hb E from specimens from another 52 subject individuals previously diagnosed with heterozygous HbE. All of these individuals had negative results in DNA testing for all common α-thalassemia alleles found in Thailand. We performed hemoglobin (Hb) analysis and compared the results with those we derived from testing the CAPILLARYS 2 Flex Piercing device. We defined genotypes via by DNA analysis. Performance evaluation revealed the within- and between-run precision for analysis of HbA2 and HbE, with coefficients of variation (CVs) ranging from 0.6% to 2.5%. We determined the reference ranges of HbA2 and HbE in the HbE heterozygote to be 2.2% to 3.4 % and 25.7% to 31.0%, respectively. We were able to identify all cases of β-thalassemia and HbE disorders. We coeluted HbH and Hb Bart and interfered with acetylated HbF. The ARKRAY ADAMS A1c HA-8180T analyzer could accurately identify which individuals had β-thalassemia and HbE disorders. However, compared with other high-performance liquid chromatography instruments in diagnosing α-thalassemia disease with HbH and Hb Bart, this analyzer is relatively difficult to use. Copyright© by the American Society for Clinical Pathology (ASCP).

  2. Polypeptides from the Skin of Rana chensinensis Exert the Antioxidant and Antiapoptotic Activities on HaCaT Cells.

    Science.gov (United States)

    Zhang, Xin; Cheng, Yunyun; Yang, Yang; Liu, Songcai; Shi, Hui; Lu, Chao; Li, Siming; Nie, Linyan; Su, Dan; Deng, Xuming; Ding, Kexiang; Hao, Linlin

    2017-01-02

    Studies have shown that frog skin secretes many types of peptides that are good for human skin. In this study, acid and enzymatic extracts of Rana skin peptides (acid/enzymatic Rana skin peptides, ARPs/ERPs) were obtained. The chemical and physical properties of the ARPs and ERPs were identified through UV scanning, HGLC, FRIT, and MS. MTS and flow cytometry were used to test the proproliferative and antiapoptotic effects of the ARPs and ERPs on human immortalized keratinocytes (HaCaT cells). To elucidate the antiapoptotic mechanisms, the mRNA and protein levels of EGF (epidermal growth factor, which enhances stimulation of cellular proliferation in both cells and epithelial tissues) and caspase-3 were evaluated using quantitative RT-PCR. The results indicated that the ARPs and ERPs were extracted from the Rana skin with yields of 0.65% and 0.52%, respectively. Treatment with ARPs (1.6 g/L) and ERPs (0.8 g/L) showed a 1.66-fold (p < 0.001) and 2.1-fold (p < 0.001) enhancement in the proliferation rates of HaCaT cells. The rate of apoptosis decreased by 2.6 fold (p < 0.01) and 3.4 fold (p < 0.01) under the UVB stimulation, respectively, at the same time, the up-regulation of EGF and down-regulation of caspase-3 were found. These results suggested that we can dig into the potential value of ARPs/ERPs in a new field.

  3. Effects of lunar and mars dust simulants on HaCaT keratinocytes and CHO-K1 fibroblasts

    Science.gov (United States)

    Rehders, Maren; Grosshäuser, Bianka B.; Smarandache, Anita; Sadhukhan, Annapurna; Mirastschijski, Ursula; Kempf, Jürgen; Dünne, Matthias; Slenzka, Klaus; Brix, Klaudia

    2011-04-01

    Exposure to lunar dust during Apollo missions resulted in occasional reports of ocular, respiratory and dermal irritations which showed that lunar dust has a risk potential for human health. This is caused by its high reactivity as well as its small size, leading to a wide distribution also inside habitats. Hence, detailed information regarding effects of extraterrestrial lunar dusts on human health is required to best support future missions to moon, mars or other destinations. In this study, we used several methods to assess the specific effects of extraterrestrial dusts onto mammalian skin by exposing HaCaT keratinocytes and CHO-K1 fibroblasts to dusts simulating lunar or mars soils. These particular cell types were chosen because the skin protects the human body from potentially harmful substances and because a well orchestrated program ensures proper wound healing. Keratinocytes and fibroblasts were exposed to the dusts for different durations of time and their effects on morphology and viability of the cells were determined. Cytotoxicity was measured using the MTT assay and by monitoring culture impedance, while phalloidin staining of the actin cytoskeleton was performed to address structural integrity of the cells which was also investigated by propidium iodide intake. It was found that the effects of the two types of dust simulants on the different features of both cell lines varied to a considerable extent. Moreover, proliferation of HaCaT keratinocytes, as analyzed by Ki67 labeling, was suppressed in sub-confluent cultures exposed to lunar dust simulant. Furthermore, experimental evidence is provided for a delay in regeneration of keratinocyte monolayers from scratch-wounding when exposed to lunar dust simulant. The obtained results will facilitate further investigations of dust exposure during wound healing and will ease risk assessment studies e.g., for lunar lander approaches. The investigations will help to determine safety measures to be taken during

  4. Engineered HA hydrogel for stem cell transplantation in the brain: Biocompatibility data using a design of experiment approach.

    Science.gov (United States)

    Nih, Lina R; Moshayedi, Pouria; Llorente, Irene L; Berg, Andrew R; Cinkornpumin, Jessica; Lowry, William E; Segura, Tatiana; Carmichael, S Thomas

    2017-02-01

    This article presents data related to the research article "Systematic optimization of an engineered hydrogel allows for selective control of human neural stem cell survival and differentiation after transplantation in the stroke brain" (P. Moshayedi, L.R. Nih, I.L. Llorente, A.R. Berg, J. Cinkornpumin, W.E. Lowry et al., 2016) [1] and focuses on the biocompatibility aspects of the hydrogel, including its stiffness and the inflammatory response of the transplanted organ. We have developed an injectable hyaluronic acid (HA)-based hydrogel for stem cell culture and transplantation, to promote brain tissue repair after stroke. This 3D biomaterial was engineered to bind bioactive signals such as adhesive motifs, as well as releasing growth factors while supporting cell growth and tissue infiltration. We used a Design of Experiment approach to create a complex matrix environment in vitro by keeping the hydrogel platform and cell type constant across conditions while systematically varying peptide motifs and growth factors. The optimized HA hydrogel promoted survival of encapsulated human induced pluripotent stem cell derived-neural progenitor cells (iPS-NPCs) after transplantation into the stroke cavity and differentially tuned transplanted cell fate through the promotion of glial, neuronal or immature/progenitor states. The highlights of this article include: (1) Data of cell and bioactive signals addition on the hydrogel mechanical properties and growth factor diffusion, (2) the use of a design of Experiment (DOE) approach (M.W. 2 Weible and T. Chan-Ling, 2007) [2] to select multi-factorial experimental conditions, and (3) Inflammatory response and cell survival after transplantation.

  5. Engineered HA hydrogel for stem cell transplantation in the brain: Biocompatibility data using a design of experiment approach

    Directory of Open Access Journals (Sweden)

    Lina R. Nih

    2017-02-01

    Full Text Available This article presents data related to the research article “Systematic optimization of an engineered hydrogel allows for selective control of human neural stem cell survival and differentiation after transplantation in the stroke brain” (P. Moshayedi, L.R. Nih, I.L. Llorente, A.R. Berg, J. Cinkornpumin, W.E. Lowry et al., 2016 [1] and focuses on the biocompatibility aspects of the hydrogel, including its stiffness and the inflammatory response of the transplanted organ. We have developed an injectable hyaluronic acid (HA-based hydrogel for stem cell culture and transplantation, to promote brain tissue repair after stroke. This 3D biomaterial was engineered to bind bioactive signals such as adhesive motifs, as well as releasing growth factors while supporting cell growth and tissue infiltration. We used a Design of Experiment approach to create a complex matrix environment in vitro by keeping the hydrogel platform and cell type constant across conditions while systematically varying peptide motifs and growth factors. The optimized HA hydrogel promoted survival of encapsulated human induced pluripotent stem cell derived-neural progenitor cells (iPS-NPCs after transplantation into the stroke cavity and differentially tuned transplanted cell fate through the promotion of glial, neuronal or immature/progenitor states. The highlights of this article include: (1 Data of cell and bioactive signals addition on the hydrogel mechanical properties and growth factor diffusion, (2 the use of a design of Experiment (DOE approach (M.W. 2 Weible and T. Chan-Ling, 2007 [2] to select multi-factorial experimental conditions, and (3 Inflammatory response and cell survival after transplantation.

  6. Chitosan/hydroxyapatite (HA)/hydroxypropylmethyl cellulose (HPMC) spongy scaffolds-synthesis and evaluation as potential alveolar bone substitutes.

    Science.gov (United States)

    Iqbal, Haffsah; Ali, Moazzam; Zeeshan, Rabia; Mutahir, Zeeshan; Iqbal, Farasat; Nawaz, Muhammad Azhar Hayat; Shahzadi, Lubna; Chaudhry, Aqif Anwar; Yar, Muhammad; Luan, Shifang; Khan, Ather Farooq; Rehman, Ihtesham-Ur

    2017-12-01

    Alveolar bone loss is associated with infections and its augmentation is a pre-requisite for the success of dental implants. In present study, we aim to develop and evaluate novel freeze dried doxycycline loaded chitosan (CS)/hydroxyapatite (HA) spongy scaffolds where hydroxypropylmethyl cellulose (HPMC) was added as a crosslinker. Scaffolds displayed compressive strength of 14MPa/cm3 and 0.34 as elastic response. The interconnected pore diameter was 41-273μm, favorably provided the template supporting cells and transport. An overall 10% degradation was seen after 14day's studies at pH 7.4 in PBS. Doxycycline hyclate, a frequently used drug to counter oral infections, demonstrated an initial burst release (6-8h), followed by a sustain release profile for the remaining 64h. CS/HA/HPMC scaffolds were nontoxic and promoted pre-osteoblast cell viability as seen with live/dead calcein staining after 24h where scaffolds with 10% and 25% HPMC by weight of scaffold had more viable cells. Scaffolds with 10%, 20% and 25% HPMC by weight of scaffold showed efficient cellular adhesion as seen in scanning electron microscopy images (day 8) indicating that pre-osteoblast cells were able to adhere well on the surface and into the porous structure via cytoplasmic extensions. Hoechst 33258 nuclear staining at day 2 and 8 indicated cell proliferation which was further supported byMTT assay at day 2, 4 and 8. Although all scaffolds supported pre-osteoblast cell viability, alkaline phosphatase (ALP) staining demonstrated that upon induction, differentiation was pronounced in case of scaffolds with 10% HMPC scaffolds. Conclusively, these materials having all the required mechanical and biological properties are potential candidates for alveolar bone regeneration. Copyright © 2017 Elsevier B.V. All rights reserved.

  7. In Vitro and In Vivo Dentinogenic Efficacy of Human Dental Pulp-Derived Cells Induced by Demineralized Dentin Matrix and HA-TCP

    Science.gov (United States)

    Kang, Kyung-Jung; Lee, Min Suk; Moon, Chan-Woong; Lee, Jae-Hoon

    2017-01-01

    Human dental pulp cells have been known to have the stem cell features such as self-renewal and multipotency. These cells are differentiated into hard tissue by addition of proper cytokines and biomaterials. Hydroxyapatite-tricalcium phosphates (HA-TCPs) are essential components of hard tissue and generally used as a biocompatible material in tissue engineering of bone. Demineralized dentin matrix (DDM) has been reported to increase efficiency of bone induction. We compared the efficiencies of osteogenic differentiation and in vivo bone formation of HA-TCP and DDM on human dental pulp stem cells (hDPSCs). DDM contains inorganic components as with HA-TCP, and organic components such as collagen type-1. Due to these components, osteoinduction potential of DDM on hDPSCs was remarkably higher than that of HA-TCP. However, the efficiencies of in vivo bone formation are similar in HA-TCP and DDM. Although osteogenic gene expression and bone formation in immunocompromised nude mice were similar levels in both cases, dentinogenic gene expression level was slightly higher in DDM transplantation than in HA-TCP. All these results suggested that in vivo osteogenic potentials in hDPSCs are induced with both HA-TCP and DDM by osteoconduction and osteoinduction, respectively. In addition, transplantation of hDPSCs/DDM might be more effective for differentiation into dentin. PMID:28761445

  8. In Vitro and In Vivo Dentinogenic Efficacy of Human Dental Pulp-Derived Cells Induced by Demineralized Dentin Matrix and HA-TCP

    Directory of Open Access Journals (Sweden)

    Kyung-Jung Kang

    2017-01-01

    Full Text Available Human dental pulp cells have been known to have the stem cell features such as self-renewal and multipotency. These cells are differentiated into hard tissue by addition of proper cytokines and biomaterials. Hydroxyapatite-tricalcium phosphates (HA-TCPs are essential components of hard tissue and generally used as a biocompatible material in tissue engineering of bone. Demineralized dentin matrix (DDM has been reported to increase efficiency of bone induction. We compared the efficiencies of osteogenic differentiation and in vivo bone formation of HA-TCP and DDM on human dental pulp stem cells (hDPSCs. DDM contains inorganic components as with HA-TCP, and organic components such as collagen type-1. Due to these components, osteoinduction potential of DDM on hDPSCs was remarkably higher than that of HA-TCP. However, the efficiencies of in vivo bone formation are similar in HA-TCP and DDM. Although osteogenic gene expression and bone formation in immunocompromised nude mice were similar levels in both cases, dentinogenic gene expression level was slightly higher in DDM transplantation than in HA-TCP. All these results suggested that in vivo osteogenic potentials in hDPSCs are induced with both HA-TCP and DDM by osteoconduction and osteoinduction, respectively. In addition, transplantation of hDPSCs/DDM might be more effective for differentiation into dentin.

  9. Small secreted proteins from the necrotrophic conifer pathogen Heterobasidion annosum s.l. (HaSSPs) induce cell death in Nicotiana benthamiana.

    Science.gov (United States)

    Raffaello, Tommaso; Asiegbu, Fred O

    2017-08-11

    The basidiomycete Heterobasidion annosum sensu lato (s.l.) is considered to be one of the most destructive conifer pathogens in the temperate forests of the northern hemisphere. H. annosum is characterized by a dual fungal lifestyle. The fungus grows necrotrophically on living plant cells and saprotrophically on dead wood material. In this study, we screened the H. annosum genome for small secreted proteins (HaSSPs) that could potentially be involved in promoting necrotrophic growth during the fungal infection process. The final list included 58 HaSSPs that lacked predictable protein domains. The transient expression of HaSSP encoding genes revealed the ability of 8 HaSSPs to induce cell chlorosis and cell death in Nicotiana benthamiana. In particular, one protein (HaSSP30) could induce a rapid, strong, and consistent cell death within 2 days post-infiltration. HaSSP30 also increased the transcription of host-defence-related genes in N. benthamiana, which suggested a necrotrophic-specific immune response. This is the first line of evidence demonstrating that the H. annosum genome encodes HaSSPs with the capability to induce plant cell death in a non-host plant.

  10. Surface phenomena of HA/TiN coatings on the nanotubular-structured beta Ti-29Nb-5Zr alloy for biomaterials

    Science.gov (United States)

    Kim, Eun-Ju; Jeong, Yong-Hoon; Choe, Han-Cheol; Brantley, William A.

    2012-01-01

    Surface phenomena of HA/TiN coatings on the nanotubular-structured beta Ti-29Nb-5Zr alloy for biomaterials have been investigated by several experimental methods. The nanotubular structure was formed by anodizing the Ti-29Nb-5Zr alloy in 1 M H3PO4 electrolytes with 1.0 wt.% NaF at room temperature. Hydroxyapatite (HA)/titanium nitride (TiN) films were deposited on Ti-29Nb-5Zr alloy specimens using a magnetron sputtering system. The HA target was made of human tooth-ash by sintering at 1300 °C for 1 h, and the HA target had an average Ca/P ratio of 1.9. The HA/TiN depositions were performed, using the pure HA target, on Ti-29Nb-5Zr alloy following the initial deposition of a TiN buffer layer coating. Microstructures and nanotubular morphology of the coated alloy specimens were examined by FE-SEM, EDX, XRD, and XPS. The Ti-29Nb-5Zr alloy substrate had small grain size and preferred orientation along the drawing direction. The HA/TiN coating was stable with a uniform morphology at the tips of the nanotubes.

  11. In Vitro and In Vivo Dentinogenic Efficacy of Human Dental Pulp-Derived Cells Induced by Demineralized Dentin Matrix and HA-TCP.

    Science.gov (United States)

    Kang, Kyung-Jung; Lee, Min Suk; Moon, Chan-Woong; Lee, Jae-Hoon; Yang, Hee Seok; Jang, Young-Joo

    2017-01-01

    Human dental pulp cells have been known to have the stem cell features such as self-renewal and multipotency. These cells are differentiated into hard tissue by addition of proper cytokines and biomaterials. Hydroxyapatite-tricalcium phosphates (HA-TCPs) are essential components of hard tissue and generally used as a biocompatible material in tissue engineering of bone. Demineralized dentin matrix (DDM) has been reported to increase efficiency of bone induction. We compared the efficiencies of osteogenic differentiation and in vivo bone formation of HA-TCP and DDM on human dental pulp stem cells (hDPSCs). DDM contains inorganic components as with HA-TCP, and organic components such as collagen type-1. Due to these components, osteoinduction potential of DDM on hDPSCs was remarkably higher than that of HA-TCP. However, the efficiencies of in vivo bone formation are similar in HA-TCP and DDM. Although osteogenic gene expression and bone formation in immunocompromised nude mice were similar levels in both cases, dentinogenic gene expression level was slightly higher in DDM transplantation than in HA-TCP. All these results suggested that in vivo osteogenic potentials in hDPSCs are induced with both HA-TCP and DDM by osteoconduction and osteoinduction, respectively. In addition, transplantation of hDPSCs/DDM might be more effective for differentiation into dentin.

  12. Solid State Reaction Synthesis of Si-HA as Potential Biomedical Material: An Endeavor to Enhance the Added Value of Indonesian Mineral Resources

    Science.gov (United States)

    Hartatiek; Yudyanto; Ratnasari, S. D.; Windari, R. Y.; Hidayat, N.

    2017-05-01

    In recent years, one of the most prominently investigated materials is hydroxyapatite (HA). It is because of its excellent properties for medical applications, essentially related to orthopedic. Also, the introduction of other materials to HA becomes another research focus of many leading scientists. In this present study, silicon with various concentrations was introduced, by means of solid state reaction route, to HA forming Si-HA. The crystal structure properties of the as-prepared samples were evaluated by X-ray diffractometer (XRD). Fourier Transform Infra Red (FTIR) spectroscopy data collection and analysis were done to investigate the functional groups within the samples. The microstructural characteristics as well as elemental mapping of the samples were captured by scanning electron microscopy and energy dispersive x-ray spectroscopy (SEM-EDX). Vickers hardness test was also conducted to investigate the hardness properties of the samples. Furthermore, in vitro characterization-based bio resorbability of the samples in a simulated body fluid were also described. This study revealed that Indonesian limestone can be utilized as the raw material for synthesizing HA. The silicon has been successfully incorporated into phosphate site of the HA crystal. Conclusively, the Si-HA reported in this study shows good bioresorbability characteristic.

  13. Induction of HIV neutralizing antibodies against the MPER of the HIV envelope protein by HA/gp41 chimeric protein-based DNA and VLP vaccines.

    Science.gov (United States)

    Ye, Ling; Wen, Zhiyuan; Dong, Ke; Wang, Xi; Bu, Zhigao; Zhang, Huizhong; Compans, Richard W; Yang, Chinglai

    2011-01-01

    Several conserved neutralizing epitopes have been identified in the HIV Env protein and among these, the MPER of gp41 has received great attention and is widely recognized as a promising target. However, little success has been achieved in eliciting MPER-specific HIV neutralizing antibodies by a number of different vaccine strategies. We investigated the ability of HA/gp41 chimeric protein-based vaccines, which were designed to enhance the exposure of the MPER in its native conformation, to induce MPER-specific HIV neutralizing antibodies. In characterization of the HA/gp41 chimeric protein, we found that by mutating an unpaired Cys residue (Cys-14) in its HA1 subunit to a Ser residue, the modified chimeric protein HA-C14S/gp41 showed increased reactivity to a conformation-sensitive monoclonal antibody against HA and formed more stable trimers in VLPs. On the other hand, HA-C14S/gp41 and HA/gp41 chimeric proteins expressed on the cell surfaces exhibited similar reactivity to monoclonal antibodies 2F5 and 4E10. Immunization of guinea pigs using the HA-C14S/gp41 DNA or VLP vaccines induced antibodies against the HIV gp41 as well as to a peptide corresponding to a segment of MPER at higher levels than immunization by standard HIV VLPs. Further, sera from vaccinated guinea pigs were found to exhibit HIV neutralizing activities. Moreover, sera from guinea pigs vaccinated by HA-C14S/gp41 DNA and VLP vaccines but not the standard HIV VLPs, were found to neutralize HIV pseudovirions containing a SIV-4E10 chimeric Env protein. The virus neutralization could be blocked by a MPER-specific peptide, thus demonstrating induction of MPER-specific HIV neutralizing antibodies by this novel vaccine strategy. These results show that induction of MPER-specific HIV neutralizing antibodies can be achieved through a rationally designed vaccine strategy.

  14. An Influenza HA and M2e Based Vaccine Delivered by a Novel Attenuated Salmonella Mutant Protects Mice against Homologous H1N1 Infection

    Directory of Open Access Journals (Sweden)

    Irshad A. Hajam

    2017-05-01

    Full Text Available Attenuated Salmonella strains constitute a promising technology for the development of a more efficient multivalent protein based vaccines. In this study, we constructed a novel attenuated strain of Salmonella for the delivery and expression of the H1N1 hemagglutinin (HA and the conserved extracellular domain of the matrix protein 2 (M2e. We demonstrated that the constructed Salmonella strain exhibited efficient HA and M2e protein expressions and little cytotoxicity and pathogenicity in mice. Using BALB/c mice as the model, we showed that the mice vaccinated with a Salmonella strain expressing HA and M2e protein antigens, respectively, induced significant production of HA and M2e-specific serum IgG1 and IgG2a responses, and of anti-HA interferon-γ producing T cells. Furthermore, immunization with Salmonella-HA-M2e-based vaccine via different routes provided protection in 66.66% orally, 100% intramuscularly, and 100% intraperitoneally immunized mice against the homologous H1N1 virus while none of the animals survived treated with either the PBS or the Salmonella carrying empty expression vector. Ex vivo stimulated dendritic cells (DCs with heat killed Salmonella expressing HA demonstrated that DCs play an important role in the elicitation of HA-specific humoral immune responses in mice. In summary, Salmonella-HA-M2e-based vaccine elicits efficient antigen-specific humoral and cellular immune responses, and provides significant immune protection against a highly pathogenic H1N1 influenza virus.

  15. A phase IIa study of HA-irinotecan, formulation of hyaluronic acid and irinotecan targeting CD44 in extensive-stage small cell lung cancer.

    Science.gov (United States)

    Alamgeer, Muhammad; Neil Watkins, D; Banakh, Ilia; Kumar, Beena; Gough, Daniel J; Markman, Ben; Ganju, Vinod

    2017-12-26

    Preclinical studies in small cell lung cancer (SCLC) have shown that hyaluronic acid (HA) can be effectively used to deliver chemotherapy and selectively decrease CD44 expressing (stem cell-like) tumour cells. The current study aimed to replicate these findings and obtain data on safety and activity of HA-irinotecan (HA-IR). Eligible patients with extensive stage SCLC were consented. A safety cohort (n = 5) was treated with HA-IR and Carboplatin (C). Subsequently, the patients were randomised 1:1 to receive experimental (HA-IR + C) or standard (IR + C) treatment, to a maximum of 6 cycles. The second line patients were added to the study and treated with open label HA-IR + C. Tumour response was measured after every 2 cycles. Baseline tumour specimens were stained for CD44s and CD44v6 expression. Circulating tumour cells (CTCs) were enumerated before each treatment cycle. Out of 39 patients screened, 34 were evaluable for the study. The median age was 66 (range 39-83). The overall response rates were 69% and 75% for experimental and standard arms respectively. Median progression free survival was 42 and 28 weeks, respectively (p = 0.892). The treatments were well tolerated. The incidence of grade III/IV diarrhea was more common in the standard arm, while anaemia was more common in the experimental arm. IHC analysis suggested that the patients with CD44s positive tumours may gain survival benefit from HA-IR. HA-IR is well tolerated and active in ES-SCLC. The effect of HA-IR on CD44s + cancer stem-like cells provide an early hint towards a potential novel target.

  16. Evaluation of rhBMP-2/collagen/TCP-HA bone graft with and without bone marrow cells in the canine femoral multi defect model.

    Science.gov (United States)

    Luangphakdy, V; Shinohara, K; Pan, H; Boehm, C; Samaranska, A; Muschler, G F

    2015-01-12

    Recombinant human bone morphogenetic protein-2, when applied to an absorbable type 1 bovine collagen sponge (rhBMP-2/ACS) is an effective therapy in many bone grafting settings. Bone marrow aspirate (BMA) has also been used as a source of transplantable osteogenic connective tissue progenitors. This study was designed to characterize the performance of a scaffold comprising rhBMP-2/ACS in which the sponge wraps around tri-calcium phosphate hydroxyapatite granules (rhBMP-2/ACS/TCP-HA) and to test the hypothesis that addition of BMA will improve the performance of this construct in the Canine Femoral Multi Defect Model. In each subject, two sites were grafted with rhBMP-2/ACS/TCP-HA scaffold loaded with BMA clot and two other sites with rhBMP-2/ACS/TCP-HA scaffold loaded with wound blood (WB). After correction for unresorbed TCP-HA granules, sites grafted with rhBMP-2/ACS/TCP-HA+BMA and rhBMP-2/ACS/TCP-HA+WB were similar, with mean percent bone volumes of 10.9 %±1.2 and 11.2 %±1.2, respectively. No differences were seen in quantitative histomorphometry. While bone formation using both constructs was robust, this study did not support the hypothesis that the addition of unprocessed bone marrow aspirate clot improved bone regeneration in a site engrafted with rhBMP-2/ACS/TCP-HA+BMA. In contrast to prior studies using this model, new bone formation was greater at the center of the defect where TCP-HA was distributed. This finding suggests a potential synergy between rhBMP-2 and the centrally placed ceramic and cellular components of the graft construct. Further optimization may also require more uniform distribution of TCP-HA, alternative cell delivery strategies, and a more rigorous large animal segmental defect model.

  17. In vitro and in vivo performance of bioactive Ti6Al4V/TiC/HA implants fabricated by a rapid microwave sintering technique

    Energy Technology Data Exchange (ETDEWEB)

    Choy, Man Tik; Tang, Chak Yin, E-mail: mfcytang@polyu.edu.hk; Chen, Ling; Wong, Chi Tak; Tsui, Chi Pong

    2014-09-01

    Failure of the bone–implant interface in a joint prosthesis is a main cause of implant loosening. The introduction of a bioactive substance, hydroxyapatite (HA), to a metallic bone–implant may enhance its fixation on human bone by encouraging direct bone bonding. Ti6Al4V/TiC/HA composites with a reproducible porous structure (porosity of 27% and pore size of 6–89 μm) were successfully fabricated by a rapid microwave sintering technique. This method allows the biocomposites to be fabricated in a short period of time under ambient conditions. Ti6Al4V/TiC/HA composites exhibited a compressive strength of 93 MPa, compressive modulus of 2.9 GPa and microhardness of 556 HV which are close to those of the human cortical bone. The in vitro preosteoblast MC3T3-E1 cells cultured on the Ti6Al4V/TiC/HA composite showed that the composite surface could provide a biocompatible environment for cell adhesion, proliferation and differentiation without any cytotoxic effects. This is among the first attempts to study the in vivo performance of load-bearing Ti6Al4V/TiC and Ti6Al4V/TiC/HA composites in a live rabbit. The results indicated that the Ti6Al4V/TiC/HA composite had a better bone–implant interface compared with the Ti6Al4V/TiC implant. Based on the microstructural features, the mechanical properties, and the in vitro and in vivo test results from this study, the Ti6Al4V/TiC/HA composites have the potential to be employed in load-bearing orthopedic applications. - Highlights: • Ti6Al4V/TiC and Ti6Al4V/TiC/HA composites were fabricated by microwave sintering. • Ti6Al4V/TiC/HA exhibited mechanical properties close to human cortical bone. • Ti6Al4V/TiC/HA could provide a biocompatible environment for bone cell growth. • Ti6Al4V/TiC/HA showed a better bone–implant interface than Ti6Al4V/TiC. • Ti6Al4V/TiC/HA could be used for bone replacement under load-bearing conditions.

  18. Amino Acid Substitutions Improve the Immunogenicity of H7N7HA Protein and Protect Mice against Lethal H7N7 Viral Challenge.

    Directory of Open Access Journals (Sweden)

    Subaschandrabose Rajesh Kumar

    Full Text Available Avian influenza A H7N7/NL/219/03 virus creates a serious pandemic threat to human health because it can transmit directly from domestic poultry to humans and from human to human. Our previous vaccine study reported that mice when immunized intranasally (i.n with live Bac-HA were protected from lethal H7N7/NL/219/03 challenge, whereas incomplete protection was obtained when administered subcutaneously (s.c due to the fact that H7N7 is a poor inducer of neutralizing antibodies. Interestingly, our recent vaccine studies reported that mice when vaccinated subcutaneously with Bac-HA (H7N9 was protected against both H7N9 (A/Sh2/2013 and H7N7 virus challenge. HA1 region of both H7N7 and H7N9 viruses are differ at 15 amino acid positions. Among those, we selected three amino acid positions (T143, T198 and I211 in HA1 region of H7N7. These amino acids are located within or near the receptor binding site. Following the selection, we substituted the amino acid at these three positions with amino acids found on H7N9HA wild-type. In this study, we evaluate the impact of amino acid substitutions in the H7N7 HA-protein on the immunogenicity. We generated six mutant constructs from wild-type influenza H7N7HA cDNA by site directed mutagenesis, and individually expressed mutant HA protein on the surface of baculovirus (Bac-HAm and compared their protective efficacy of the vaccines with Bac-H7N7HA wild-type (Bac-HA by lethal H7N7 viral challenge in a mouse model. We found that mice immunized subcutaneously with Bac-HAm constructs T143A or T198A-I211V or I211V-T143A serum showed significantly higher hemagglutination inhibition and neutralization titer against H7N7 and H7N9 viruses when compared to Bac-HA vaccinated mice groups. We also observed low level of lung viral titer, negligible weight loss and complete protection against lethal H7N7 viral challenge. Our results indicated that amino acid substitution at position 143 or 211 improve immunogenicity of H7N7HA

  19. [Establishment of MDCK-pHaMDR cell model and standard operation procedure for assessing blood-brain barrier permeability of chemical components of traditional Chinese medicine].

    Science.gov (United States)

    Yang, Yan-Fang; Wu, Ni; Yang, Xiu-Wei

    2016-07-01

    To establish MDCK-pHaMDR cell model and standard operation procedure for assessing the blood-brain barrier permeability of chemical components of traditional Chinese medicine. MDCK-pHaMDR cell model was evaluated by determining the morphology features, transepithelial electrical resistance, bidirectional transport and intracellular accumulation of Rhodamine 123 and the apparent permeability of positive control drugs caffeine and atenolol. The MDCK-pHaMDR cell model had satisfactory integrity and tightness, and stable expression of P-gp. In addition, the transport results of the positive control drugs were consistent with the reported values in literature. All the parameters tested of the MDCK-pHaMDR cell model were consistent with the requirements, so the model can be used to study the blood-brain barrier permeability of chemical components of traditional Chinese medicine. Copyright© by the Chinese Pharmaceutical Association.

  20. 7 CFR 1951.9 - Distribution of payments when a borrower owes more than one type of FmHA or its successor agency...

    Science.gov (United States)

    2010-01-01

    ... marginal land converted to the production of softwood timber must be applied on the ST loan(s). (b) Distribution of extra payments. Extra payments will be distributed first to the FmHA or its successor agency...

  1. Induction of HIV neutralizing antibodies against the MPER of the HIV envelope protein by HA/gp41 chimeric protein-based DNA and VLP vaccines

    National Research Council Canada - National Science Library

    Ye, Ling; Wen, Zhiyuan; Dong, Ke; Wang, Xi; Bu, Zhigao; Zhang, Huizhong; Compans, Richard W; Yang, Chinglai

    2011-01-01

    .... We investigated the ability of HA/gp41 chimeric protein-based vaccines, which were designed to enhance the exposure of the MPER in its native conformation, to induce MPER-specific HIV neutralizing antibodies...

  2. School Absenteeism due to Toothache among Secondary School Students Aged 16-18 Years in the Ha'il Region of Saudi Arabia

    National Research Council Canada - National Science Library

    Shaikh, Sameer; Siddiqui, Ammar Ahmed; Aljanakh, Mohammad

    2016-01-01

    .... Consequently, the prevalence of absenteeism due to toothache in this study was of 18%. Conclusion. The prevalence of school absenteeism due to toothache among students in the Ha'il Region was low...

  3. Live-attenuated auxotrophic mutant of Salmonella Typhimurium expressing immunogenic HA1 protein enhances immunity and protective efficacy against H1N1 influenza virus infection.

    Science.gov (United States)

    Kamble, Nitin Machindra; Hyoung, Kim Je; Lee, John Hwa

    2017-07-01

    To evaluate the efficacy of attenuated Salmonella Typhimurium (JOL912) as a live bacterial vaccine vector. The JOL912 engineered to deliver HA1 protein from influenza A/Puerto Rico/8/1934 (H1N1; PR8) virus was coined as JOL1635 and further evaluated for immunogenicity and protective efficacy. The JOL1635 stably harbored the HA1 gene within pMMP65 plasmid with periplasmic expression and effective delivery of HA1 protein to RAW264.7 cells. The JOL1635 immunized chickens showed the significant increase in HA1-specific IgG, sIgA antibody, IFN-γ, IL-6 cytokine and cellular immune responses. The postoral challenge, the JOL1635-immunized chickens showed a faster clearance of PR8 virus cloacal shedding than the control group. Generated JOL1635 can establish specific immunogenicity and protection against the PR8 virus in chickens.

  4. MiR-30e suppresses proliferation of hepatoma cells via targeting prolyl 4-hydroxylase subunit alpha-1 (P4HA1) mRNA

    Energy Technology Data Exchange (ETDEWEB)

    Feng, Guoxing [State Key Laboratory of Medicinal Chemical Biology, Department of Cancer Research, College of Life Sciences, Nankai University, Tianjin (China); Shi, Hui [State Key Laboratory of Medicinal Chemical Biology, Department of Biochemistry, College of Life Sciences, Nankai University, Tianjin (China); Li, Jiong; Yang, Zhe [State Key Laboratory of Medicinal Chemical Biology, Department of Cancer Research, College of Life Sciences, Nankai University, Tianjin (China); Fang, Runping; Ye, Lihong [State Key Laboratory of Medicinal Chemical Biology, Department of Biochemistry, College of Life Sciences, Nankai University, Tianjin (China); Zhang, Weiying, E-mail: zhwybao@nankai.edu.cn [State Key Laboratory of Medicinal Chemical Biology, Department of Cancer Research, College of Life Sciences, Nankai University, Tianjin (China); Zhang, Xiaodong, E-mail: zhangxd@nankai.edu.cn [State Key Laboratory of Medicinal Chemical Biology, Department of Cancer Research, College of Life Sciences, Nankai University, Tianjin (China)

    2016-04-08

    Aberrant microRNA expression has been shown to be characteristic of many cancers. It has been reported that the expression levels of miR-30e are decreased in liver cancer tissues. However, the role of miR-30e in hepatocellular carcinoma remains poorly understood. In the present study, we investigated the significance of miR-30e in hepatocarcinogenesis. Bioinformatics analysis reveals a putative target site of miR-30e in the 3′-untranslated region (3′UTR) of prolyl 4-hydroxylase subunit alpha-1 (P4HA1) mRNA. Moreover, luciferase reporter gene assays verified that miR-30e directly targeted 3′UTR of P4HA1 mRNA. Then, we demonstrated that miR-30e was able to reduce the expression of P4HA1 at the levels of mRNA and protein using reverse transcription-polymerase chain reaction and Western blot analysis. Enforced expression of miR-30e suppressed proliferation of HepG2 cells by 5-ethynyl-2-deoxyuridine (EdU) assay and reduced colony formation of these cells by colony formation analysis. Conversely, anti-miR-30e enhanced the proliferation of hepatoma cells in vitro. Interestingly, the ectopic expression of P4HA1 could efficiently rescue the inhibition of cell proliferation mediated by miR-30e in HepG2 cells. Meanwhile, silencing of P4HA1 abolished the anti-miR-30e-induced proliferation of cells. Clinically, quantitative real-time PCR showed that miR-30e was down-regulated in liver tumor tissues relative to their peritumor tissues. The expression levels of miR-30e were negatively correlated to those of P4HA1 mRNA in clinical liver tumor tissues. Thus, we conclude that miR-30e suppresses proliferation of hepatoma cells through targeting P4HA1 mRNA. Our finding provides new insights into the mechanism of hepatocarcinogenesis. - Highlights: • P4HA1 is a novel target gene of miR-30e. • P4HA1 is increased in clinical HCC tissues. • MiR-30e is negatively correlated with P4HA1 in clinical HCC tissues. • MiR-30e suppresses the proliferation of HCC cells through

  5. Optical and near-IR observations of the faint and fast 2008ha-like supernova 2010ae

    Science.gov (United States)

    Stritzinger, M. D.; Hsiao, E.; Valenti, S.; Taddia, F.; Rivera-Thorsen, T. J.; Leloudas, G.; Maeda, K.; Pastorello, A.; Phillips, M. M.; Pignata, G.; Baron, E.; Burns, C. R.; Contreras, C.; Folatelli, G.; Hamuy, M.; Höflich, P.; Morrell, N.; Prieto, J. L.; Benetti, S.; Campillay, A.; Haislip, J. B.; LaClutze, A. P.; Moore, J. P.; Reichart, D. E.

    2014-01-01

    A comprehensive set of optical and near-infrared (NIR) photometry and spectroscopy is presented for the faint and fast 2008ha-like supernova (SN) 2010ae. Contingent on the adopted value of host extinction, SN 2010ae reached a peak brightness of -13.8 > MV > -15.3 mag, while modeling of the UVOIR light curve suggests it produced 0.003-0.007 M⊙ of 56Ni, ejected 0.30-0.60 M⊙ of material, and had an explosion energy of 0.04-0.30 × 1051 erg. The values of these explosion parameters are similar to the peculiar SN 2008ha -for which we also present previously unpublished early phase optical and NIR light curves - and places these two transients at the faint end of the 2002cx-like SN population. Detailed inspection of the post-maximum NIR spectroscopic sequence indicates the presence of a multitude of spectral features, which are identified through SYNAPPS modeling to be mainly attributed to Co ii. Comparison with a collection of published and unpublished NIR spectra of other 2002cx-like SNe, reveals that a Co ii footprint is ubiquitous to this subclass of transients, providing a link to Type Ia SNe. A visual-wavelength spectrum of SN 2010ae obtained at +252 days past maximum shows a striking resemblance to a similar epoch spectrum of SN 2002cx. However, subtle differences in the strength and ratio of calcium emission features, as well as diversity among similar epoch spectra of other 2002cx-like SNe indicates a range of physical conditions of the ejecta, highlighting the heterogeneous nature of thispeculiar class of transients. Based on observations collected at the European Organization for Astronomical Research in the Southern Hemisphere, Chile (ESO Programs 082.A-0526, 084.D-0719, 088.D-0222, 184.D-1140, and 386.D-0966); the Gemini Observatory, Cerro Pachon, Chile (Gemini Programs GS-2010A-Q-14 and GS-2010A-Q-38); the Magellan 6.5 m telescopes at Las Campanas Observatory; and the SOAR telescope.Tables 1-5 and Appendix A are available in electronic form at http

  6. An efficient Volumetric Arc Therapy treatment planning approach for hippocampal-avoidance whole-brain radiation therapy (HA-WBRT)

    Energy Technology Data Exchange (ETDEWEB)

    Shen, Jin [Department of Radiation Oncology, Montefiore Medical Center and Albert Einstein College of Medicine, Bronx, NY (United States); Bender, Edward [Department of Medical Physics, University of Wisconsin, Madison, WI (United States); Yaparpalvi, Ravindra; Kuo, Hsiang-Chi; Basavatia, Amar; Hong, Linda; Bodner, William; Garg, Madhur K.; Kalnicki, Shalom [Department of Radiation Oncology, Montefiore Medical Center and Albert Einstein College of Medicine, Bronx, NY (United States); Tomé, Wolfgang A., E-mail: wtome@montefiore.org [Department of Radiation Oncology, Montefiore Medical Center and Albert Einstein College of Medicine, Bronx, NY (United States); Department of Medical Physics, University of Wisconsin, Madison, WI (United States)

    2015-10-01

    An efficient and simple class solution is proposed for hippocampal-avoidance whole-brain radiation therapy (HA-WBRT) planning using the Volumetric Arc Therapy (VMAT) delivery technique following the NRG Oncology protocol NRG-CC001 treatment planning guidelines. The whole-brain planning target volume (PTV) was subdivided into subplanning volumes that lie in plane and out of plane with the hippocampal-avoidance volume. To further improve VMAT treatment plans, a partial-field dual-arc technique was developed. Both the arcs were allowed to overlap on the in-plane subtarget volume, and in addition, one arc covered the superior out-of-plane sub-PTV, while the other covered the inferior out-of-plane subtarget volume. For all plans (n = 20), the NRG-CC001 protocol dose-volume criteria were met. Mean values of volumes for the hippocampus and the hippocampal-avoidance volume were 4.1 cm{sup 3} ± 1.0 cm{sup 3} and 28.52 cm{sup 3} ± 3.22 cm{sup 3}, respectively. For the PTV, the average values of D{sub 2%} and D{sub 98%} were 36.1 Gy ± 0.8 Gy and 26.2 Gy ± 0.6 Gy, respectively. The hippocampus D{sub 100%} mean value was 8.5 Gy ± 0.2 Gy and the maximum dose was 15.7 Gy ± 0.3 Gy. The corresponding plan quality indices were 0.30 ± 0.01 (homogeneity index), 0.94 ± 0.01 (target conformality), and 0.75 ± 0.02 (confirmation number). The median total monitor unit (MU) per fraction was 806 MU (interquartile range [IQR]: 792 to 818 MU) and the average beam total delivery time was 121.2 seconds (IQR: 120.6 to 121.35 seconds). All plans passed the gamma evaluation using the 5-mm, 4% criteria, with γ > 1 of not more than 9.1% data points for all fields. An efficient and simple planning class solution for HA-WBRT using VMAT has been developed that allows all protocol constraints of NRG-CC001 to be met.

  7. Effectiveness of Losartan-Loaded Hyaluronic Acid (HA) Micelles for the Reduction of Advanced Hepatic Fibrosis in C3H/HeN Mice Model.

    Science.gov (United States)

    Thomas, Reju George; Moon, Myeong Ju; Kim, Jo Heon; Lee, Jae Hyuk; Jeong, Yong Yeon

    2015-01-01

    Advanced hepatic fibrosis therapy using drug-delivering nanoparticles is a relatively unexplored area. Angiotensin type 1 (AT1) receptor blockers such as losartan can be delivered to hepatic stellate cells (HSC), blocking their activation and thereby reducing fibrosis progression in the liver. In our study, we analyzed the possibility of utilizing drug-loaded vehicles such as hyaluronic acid (HA) micelles carrying losartan to attenuate HSC activation. Losartan, which exhibits inherent lipophilicity, was loaded into the hydrophobic core of HA micelles with a 19.5% drug loading efficiency. An advanced liver fibrosis model was developed using C3H/HeN mice subjected to 20 weeks of prolonged TAA/ethanol weight-adapted treatment. The cytocompatibility and cell uptake profile of losartan-HA micelles were studied in murine fibroblast cells (NIH3T3), human hepatic stellate cells (hHSC) and FL83B cells (hepatocyte cell line). The ability of these nanoparticles to attenuate HSC activation was studied in activated HSC cells based on alpha smooth muscle actin (α-sma) expression. Mice treated with oral losartan or losartan-HA micelles were analyzed for serum enzyme levels (ALT/AST, CK and LDH) and collagen deposition (hydroxyproline levels) in the liver. The accumulation of HA micelles was observed in fibrotic livers, which suggests increased delivery of losartan compared to normal livers and specific uptake by HSC. Active reduction of α-sma was observed in hHSC and the liver sections of losartan-HA micelle-treated mice. The serum enzyme levels and collagen deposition of losartan-HA micelle-treated mice was reduced significantly compared to the oral losartan group. Losartan-HA micelles demonstrated significant attenuation of hepatic fibrosis via an HSC-targeting mechanism in our in vitro and in vivo studies. These nanoparticles can be considered as an alternative therapy for liver fibrosis.

  8. Analyzing the behavior of a porous nano-hydroxyapatite/polyamide 66 (n-HA/PA66) composite for healing of bone defects

    Science.gov (United States)

    Xiong, Yan; Ren, Cheng; Zhang, Bin; Yang, Hongsheng; Lang, Yun; Min, Li; Zhang, Wenli; Pei, Fuxing; Yan, Yonggang; Li, Hong; Mo, Anchun; Tu, Chongqi; Duan, Hong

    2014-01-01

    The aim of this study was to analyze the behavior of the porous nano-hydroxyapatite/polyamide 66 (n-HA/PA66) composite grafted for bone defect repair through a series of biological safety experiments, animal experiments, and a more than 5-year long clinical follow-up. The biological safety experiments, carried out in accordance with the Chinese Guo Biao and Tolerancing (GB/T)16886 and GB/T16175, revealed that porous n-HA/PA66 composite had no cytotoxicity, no sensitization effect, no pyrogenic reaction, and that its hemolysis rate was 0.59% (less than 5%). Rabbit models of tibia defects with grafted porous n-HA/PA66 composite were established. After 2 weeks, the experiment showed that osteogenesis was detected in the porous n-HA/PA66 composite; the density of new bone formation was similar to the surrounding host bone at 12 weeks. After 26 weeks, the artificial bone rebuilt to lamellar bone completely. In the clinical study, a retrospective review was carried out for 21 patients who underwent serial radiographic assessment after treatment with porous n-HA/PA66 composite grafts following bone tumor resection. All wounds healed to grade A. No postoperative infections, delayed deep infection, nonspecific inflammation, rejection, or fractures were encountered. At a mean follow-up of 5.3 years, the mean Musculoskeletal Tumor Society’s (MSTS) 93 score was 29.3 points (range: 28–30 points) and mean radiopaque density ratio was 0.77±0.10. The radiologic analysis showed that porous n-HA/PA66 composite had been completely incorporated with the host bone about 1.5 years later. In conclusion, this study indicated that the porous n-HA/PA66 composite had biological safety, and good biocompatibility, osteoinduction, and osseointegration. Thus, the porous n-HA/PA66 composite is an ideal artificial bone substitute and worthy of promotion in the field. PMID:24531621

  9. 7 CFR Exhibit E to Subpart K of... - Guide Letter to Delinquent FmHA or Its Successor Agency Under Public Law 103-354 Single Family...

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 13 2010-01-01 2009-01-01 true Guide Letter to Delinquent FmHA or Its Successor Agency Under Public Law 103-354 Single Family Housing Loan Borrowers E Exhibit E to Subpart K of Part..., Subpt. K, Exh. E Exhibit E to Subpart K of Part 1944—Guide Letter to Delinquent FmHA or Its Successor...

  10. Fabrication and characterization of nano-HA-45S5 bioglass composite coatings on calcium-phosphate containing micro-arc oxidized CP-Ti substrates

    Energy Technology Data Exchange (ETDEWEB)

    Farnoush, Hamidreza, E-mail: farnoush@aut.ac.ir [Department of Metallurgy and Materials Engineering, Faculty of Engineering, University of Kashan, P.O. Box 87317-51167, Kashan (Iran, Islamic Republic of); Muhaffel, Faiz; Cimenoglu, Huseyin [Department of Metallurgical and Materials Engineering, Istanbul Technical University, 34469 Maslak, Istanbul (Turkey)

    2015-01-01

    Highlights: • Introducing a calcium-containing titanium oxide interlayer by MAO on CP-Ti. • EPD was utilized for HA and HA-BG coatings on MAO CP-Ti substrates. • Highest bonding strength was obtained for HA-BG/MAO 360 Ti sample. • Enhancement of corrosion resistance for HA-BG/MAO 360 Ti sample in SBF. - Abstract: In the present study, micro-arc oxidation (MAO) was carried out on commercially pure titanium (CP-Ti) to fabricate porous titanium oxide coatings containing calcium phosphates (CaP) at different applied voltages of 300, 330 and 360 V for 5 min. Subsequently, nano-hydroxyapatite (HA) and HA-45S5 bioglass (BG) composite were effectively coated on micro-arc oxidized substrate by electrophoretic deposition (EPD) at a constant voltage of 30 V for 120 s. The phase, structural agents, microstructure and composition of MAO interlayer and subsequent EPD coatings were characterized by X-ray diffraction, Fourier transform infrared spectroscopy, scanning electron microscopy and energy-dispersive X-ray spectroscopy, respectively. Thermal stability of the as-deposited coatings was analyzed by simultaneous differential scanning calorimetry and thermal gravimetery. The pull-off adhesion tests showed the highest bonding strength was obtained for HA-BG coating on micro-oxidized sample at 360 V. The results of potentiodynamic polarization and impedance spectroscopic measurements in simulated body fluid solution depicted that the combination of MAO treatment at 360 V and EPD of HA-BG composite could effectively increase the corrosion resistance of CP-Ti substrates.

  11. Effectiveness of Losartan-Loaded Hyaluronic Acid (HA Micelles for the Reduction of Advanced Hepatic Fibrosis in C3H/HeN Mice Model.

    Directory of Open Access Journals (Sweden)

    Reju George Thomas

    Full Text Available Advanced hepatic fibrosis therapy using drug-delivering nanoparticles is a relatively unexplored area. Angiotensin type 1 (AT1 receptor blockers such as losartan can be delivered to hepatic stellate cells (HSC, blocking their activation and thereby reducing fibrosis progression in the liver. In our study, we analyzed the possibility of utilizing drug-loaded vehicles such as hyaluronic acid (HA micelles carrying losartan to attenuate HSC activation. Losartan, which exhibits inherent lipophilicity, was loaded into the hydrophobic core of HA micelles with a 19.5% drug loading efficiency. An advanced liver fibrosis model was developed using C3H/HeN mice subjected to 20 weeks of prolonged TAA/ethanol weight-adapted treatment. The cytocompatibility and cell uptake profile of losartan-HA micelles were studied in murine fibroblast cells (NIH3T3, human hepatic stellate cells (hHSC and FL83B cells (hepatocyte cell line. The ability of these nanoparticles to attenuate HSC activation was studied in activated HSC cells based on alpha smooth muscle actin (α-sma expression. Mice treated with oral losartan or losartan-HA micelles were analyzed for serum enzyme levels (ALT/AST, CK and LDH and collagen deposition (hydroxyproline levels in the liver. The accumulation of HA micelles was observed in fibrotic livers, which suggests increased delivery of losartan compared to normal livers and specific uptake by HSC. Active reduction of α-sma was observed in hHSC and the liver sections of losartan-HA micelle-treated mice. The serum enzyme levels and collagen deposition of losartan-HA micelle-treated mice was reduced significantly compared to the oral losartan group. Losartan-HA micelles demonstrated significant attenuation of hepatic fibrosis via an HSC-targeting mechanism in our in vitro and in vivo studies. These nanoparticles can be considered as an alternative therapy for liver fibrosis.

  12. Los diarios frente al reto digital

    Directory of Open Access Journals (Sweden)

    Ramón Salaverría

    2007-03-01

    Full Text Available Ha llegado la época en que los medios deben percatarse que el monopolio de la información ha llegado a su fin. Hasta ahora todos los diarios han adoptado en Internet políticas erráticas, cuando no declaradamente defensivas. En cuanto a la publicidad se han multiplicado de manera espectacular los ingresos, por este rubro, en los medios digitales siendo halagüeñas las perspectivas para el futuro.

  13. Microencapsulation-protected l-ascorbic acid for the application of human epithelial HaCaT cell proliferation.

    Science.gov (United States)

    Lam, P-L; Kok, S H-L; Bian, Z-X; Lam, K-H; Gambari, R; Lee, K K-H; Chui, C-H

    2014-01-01

    l-ascorbic acid is an abundant water-soluble nutrient found in vegetables and fruits. It enhances the cell proliferation, which is helpful in wound healing process. However, it is relatively unstable and easily degraded under external environments including acidity, alkalinity, evaporation, heat, oxidization, light or moisture. Its storage remains challenged. This study reported the development of l-ascorbic acid microcapsules using the natural protein, gelatin, and the natural polysaccharide, agar, as the wall protection carrier. The physical properties including entrapment efficiency, particle size, surface morphology, chemical compositions and release profile were identified. The cell proliferation of l-ascorbic acid microcapsules was stronger than the free drug. Significant cell growth in microencapsulated l-ascorbic acid-treated human epithelial HaCaT cells was observed when compared with untreated control. Since cell proliferation and wound repair are closely related, it is believed that l-ascorbic acid microcapsules would effectively increase the potential effect of wound healing activity in human skin.

  14. ¿Puede demandarse el Divorcio, cuando ya se ha debatido y resuelto judicialmente la Separación Judicial?

    Directory of Open Access Journals (Sweden)

    Jorge Baraona González

    2005-01-01

    Full Text Available El presente trabajo se plantea el efecto que tiene una sentencia que se ha pronunciado sobre una separación judicial en la nueva Ley de Matrimonio Civil, de cara a la posibilidad de iniciar, fundado en los mismos hechos, un juicio de divorcio. El autor concluye que la sentencia judicial que decreta la separación tiene un efecto preclusivo sobre la futura acción de divorcio intentada por los mismos hechos. En el artículo se revisa la historia de la de aprobación de las normas y se analiza el panorama en derecho comparado, en países en que existe tanto separación como.This paper examines the effect of a judicial resolution that has accepted the separation, according to the new Ley de Matrimonio Civil, in relation with the possibility to begin a divorce trial in the future, pleading the same facts. The author concludes that the judicial resolution has precluded the divorce action supported in the same facts. The paper offers the approving history of the Act and a comparative law survey, in the countries that have in their marriage law, separation and divorce.

  15. ¿QUÉ HA FALLADO EN LA MACROECONOMÍA Y FINANZAS SURAMERICANAS DESDE LOS AÑOS NOVENTA?

    Directory of Open Access Journals (Sweden)

    Ricardo Ffrench-Davis

    2012-01-01

    Full Text Available Este artículo examina las experiencias macroeconómicas de cinco países surame-ricanos —Argentina, Brasil, Chile, Colombia y Perú— desde los años noventa. Se destacan características comunes en sus políticas macroeconómicas y en las crisis cíclicas que experimentan, las que predominan sobre diferencias relevantes que se examinan. Se analiza cómo, no obstante la estabilización de los precios y la mayor disciplina fiscal logrados, se obtiene un crecimiento mediocre del PIB(3.2% desde los años noventa, resultado que ha estado asociado a una baja for-mación de capital. Al examinar las causas se encuentra una intensa asociación con la inestabilidad del entorno macroeconómico —en particular, demanda agregada y tipo de cambio real—, una especie de “montaña rusa” que enfrentan los pro-ductores del PIB. Esta inestabilidad, a su vez, aparece determinada por choques cíclicos de los flujos de capitales y términos del intercambio. Se concluye que la “incompletitud” de los logros macroeconómicos está en el centro de la falta de convergencia al desarrollo.

  16. Ecto-nucleoside triphosphate diphosphohydrolase 2 modulates local ATP-induced calcium signaling in human HaCaT keratinocytes.

    Directory of Open Access Journals (Sweden)

    Chia-Lin Ho

    Full Text Available Keratinocytes are the major building blocks of the human epidermis. In many physiological and pathophysiological conditions, keratinocytes release adenosine triphosphate (ATP as an autocrine/paracrine mediator that regulates cell proliferation, differentiation, and migration. ATP receptors have been identified in various epidermal cell types; therefore, extracellular ATP homeostasis likely determines its long-term, trophic effects on skin health. We investigated the possibility that human keratinocytes express surface-located enzymes that modulate ATP concentration, as well as the corresponding receptor activation, in the pericellular microenvironment. We observed that the human keratinocyte cell line HaCaT released ATP and hydrolyzed extracellular ATP. Interestingly, ATP hydrolysis resulted in adenosine diphosphate (ADP accumulation in the extracellular space. Pharmacological inhibition by ARL 67156 or gene silencing of the endogenous ecto-nucleoside triphosphate diphosphohydrolase (NTPDase isoform 2 resulted in a 25% reduction in both ATP hydrolysis and ADP formation. Using intracellular calcium as a reporter, we found that although NTPDase2 hydrolyzed ATP and generated sustainable ADP levels, only ATP contributed to increased intracellular calcium via P2Y2 receptor activation. Furthermore, knocking down NTPDase2 potentiated the nanomolar ATP-induced intracellular calcium increase, suggesting that NTPDase2 globally attenuates nucleotide concentration in the pericellular microenvironment as well as locally shields receptors in the vicinity from being activated by extracellular ATP. Our findings reveal an important role of human keratinocyte NTPDase2 in modulating nucleotide signaling in the extracellular milieu of human epidermis.

  17. Trichophyton rubrum conidia modulate the expression and transport of Toll-like receptor 2 in HaCaT cell.

    Science.gov (United States)

    Huang, Xiaoqiang; Yi, Jinling; Yin, Songchao; Li, Meirong; Ye, Congxiu; Lai, Wei; Chen, Jian

    2015-01-01

    Trichophyton rubrum (T. rubrum) represents the most important agent of dermatophytosis in humans. T. rubrum infection causes slight inflammation, and tends to be chronic and recurrent. It is suggested that T. rubrum can modulate the innate immune responses of host cells, which result in the failure of host cells to recognize T. rubrum and initiate effective immune responses. In this study we show how T. rubrum conidia modulate the expression and transport of Toll-like receptor 2 in HaCaT cell. Flow cytometric analysis showed that the surface and total expression of Toll-like receptor 2 were upregulated at the very early stage when keratinocytes were exposed to T. rubrum conidia regardless of the dose, and the upregulation of surface TLR2 was much more significant than that of total TLR2. Moreover, TLR2 expression was suppressed after upregulation in the initial stage of T. rubrum exposure, and the decrease of total TLR2 was earlier than that of surface TLR2. Our results suggest that in the early stage, TLR2 of keratinocytes were upregulated and transported to the cell surface. After then, the expression of TLR2 was suppressed by T. rubrum conidia. Copyright © 2015 Elsevier Ltd. All rights reserved.

  18. Del sujeto que ha intentado suicidarse y el Otro: la Institución Psiquiátrica

    Science.gov (United States)

    Liliana, Mondragón B.; Miguel Ángel, Caballero G.

    2009-01-01

    El hospital psiquiátrico se ha constituido como un lugar donde se posibilita legitimar la exclusión y la radicalidad de ese otro “que no es igual”, como es el caso del sujeto que atenta contra su propia vida. En consecuencia, el intento de suicidio desde el pensamiento foucaultiano, es una resistencia que desmantela la estructura de dominación a través de un acto de poder, el cual se ejerce sobre el propio cuerpo. Así, la intención de este texto es mostrar que la relación Otro-otro es un lugar en la estructura subjetiva, que se deposita en la institución psiquiátrica, la cual representa el poder, la ley, y es aquello a lo que se le quiere agredir, resistir, abatir con un intento de suicidio. Para demostrar como se materializan estos hechos, se exponen los testimonios de tres adolescentes atendidas en un hospital psiquiátrico por intentos suicidas, en los cuales se señalan los diferentes significados que le atribuyen a la institución psiquiátrica en tanto que representa un Otro en sus actos autoinfligidos. PMID:25400324

  19. THE EFFECT OF KARANJA OIL METHYL ESTER ON KIRLOSKAR HA394DI DIESEL ENGINE PERFORMANCE AND EXHAUST EMISSIONS

    Directory of Open Access Journals (Sweden)

    Sharanappa K Godiganur

    2010-01-01

    Full Text Available Biofuels are being investigated as potential substitutes for current high pollutant fuels obtained from the conventional sources. The primary problem associated with using straight vegetable oil as fuel in a compression ignition engine is caused by viscosity. The process of transesterifiction of vegetable oil with methyl alcohol provides a significant reduction in viscosity, thereby enhancing the physical properties of vegetable oil. The Kirloskar HA394 compression ignition, multi cylinder diesel engine does not require any modification to replace diesel by karanja methyl ester. Biodiesel can be used in its pure form or can be blended with diesel to form different blends. The purpose of this research was to evaluate the potential of karanja oil methyl ester and its blend with diesel from 20% to 80% by volume. Engine performance and exhaust emissions were investigated and compared with the ordinary diesel fuel in a diesel engine. The experimental results show that the engine power of the mixture is closed to the values obtained from diesel fuel and the amounts of exhaust emissions are lower than those of diesel fuel. Hence, it is seen that the blend of karanja ester and diesel fuel can be used as an alternative successfully in a diesel engine without any modification and in terms of emission parameters; it is an environmental friendly fuel

  20. In vitro and in vivo performance of bioactive Ti6Al4V/TiC/HA implants fabricated by a rapid microwave sintering technique.

    Science.gov (United States)

    Choy, Man Tik; Tang, Chak Yin; Chen, Ling; Wong, Chi Tak; Tsui, Chi Pong

    2014-09-01

    Failure of the bone-implant interface in a joint prosthesis is a main cause of implant loosening. The introduction of a bioactive substance, hydroxyapatite (HA), to a metallic bone-implant may enhance its fixation on human bone by encouraging direct bone bonding. Ti6Al4V/TiC/HA composites with a reproducible porous structure (porosity of 27% and pore size of 6-89 μm) were successfully fabricated by a rapid microwave sintering technique. This method allows the biocomposites to be fabricated in a short period of time under ambient conditions. Ti6Al4V/TiC/HA composites exhibited a compressive strength of 93 MPa, compressive modulus of 2.9 GPa and microhardness of 556 HV which are close to those of the human cortical bone. The in vitro preosteoblast MC3T3-E1 cells cultured on the Ti6Al4V/TiC/HA composite showed that the composite surface could provide a biocompatible environment for cell adhesion, proliferation and differentiation without any cytotoxic effects. This is among the first attempts to study the in vivo performance of load-bearing Ti6Al4V/TiC and Ti6Al4V/TiC/HA composites in a live rabbit. The results indicated that the Ti6Al4V/TiC/HA composite had a better bone-implant interface compared with the Ti6Al4V/TiC implant. Based on the microstructural features, the mechanical properties, and the in vitro and in vivo test results from this study, the Ti6Al4V/TiC/HA composites have the potential to be employed in load-bearing orthopedic applications. Copyright © 2014 Elsevier B.V. All rights reserved.

  1. Correlations between the in vitro and in vivo bioactivity of the Ti/HA composites fabricated by a powder metallurgy method.

    Science.gov (United States)

    Ning, Congqin; Zhou, Yu

    2008-11-01

    Ti/HA composites were successfully prepared by a powder metallurgy method and the effect of phase composition on the in vitro and in vivo bioactivity of the Ti/HA composites was investigated in the present study. The correlations between the in vitro and in vivo biological behaviors were highlighted. The results showed that the in vitro and in vivo bioactivity of the Ti/HA composites was dependent on their phase composition. The in vitro bioactivity of the Ti/HA composites was evaluated in simulated body fluid with ion concentrations similar to those of human plasma. After immersion in the simulated body fluid for a certain time, apatite precipitations formed on the surface of the composites with an initial titanium content of 50 and 70 wt.%, and no apatite was found on the surface of the composite with 30% titanium. Ti(2)O was responsible for the apatite formation on the surfaces of the composites. For in vivo analysis, Ti/HA cylinders were implanted in the metaphases of the rabbit femur. At the early stage of implantation, the new bone formed on the surface of the composite with 30% titanium was much less than that on the surfaces of the composites with 50% and 70% titanium. All the Ti/HA composites formed a chemical bone-bonding interface with the host bone by 6 months after implantation. The Ti/HA composites formed the bone-bonding interface with the surrounding bone through an apatite layer. The results in the present study suggested that the in vivo results agreed well with the in vitro results.

  2. Testing aggregation hypotheses among Neotropical trees and shrubs: results from a 50-ha plot over 20 years of sampling

    Directory of Open Access Journals (Sweden)

    Randall W. Myster

    2012-09-01

    Full Text Available Spatial patterns of tropical trees and shrubs are important to understanding their interaction and the resultant structure of tropical rainforests. To assess this issue, we took advantage of previously collected data, on Neotropical tree and shrub stem identified to species and mapped for spatial coordinates in a 50ha plot, with a frequency of every five years and over a 20 year period. These stems data were first placed into four groups, regardless of species, depending on their location in the vertical strata of the rainforest (shrubs, understory trees, mid-sized trees, tall trees and then used to generate aggregation patterns for each sampling year. We found shrubs and understory trees clumped at small spatial scales of a few meters for several of the years sampled. Alternatively, mid-sized trees and tall trees did not clump, nor did they show uniform (regular patterns, during any sampling period. In general (1 groups found higher in the canopy did not show aggregation on the ground and (2 the spatial patterns of all four groups showed similarity among different sampling years, thereby supporting a “shifting mosaic” view of plant communities over large areas. Spatial analysis, such as this one, are critical to understanding and predicting tree spaces, tree-tree replacements and the Neotropical forest patterns, such as biodiversity and those needed for sustainability efforts, they produce.Con datos obtenidos previamente, se identificaron especies de árboles y arbustos neotropicales y se ubicaron con coordenadas espaciales en una parcela de 50ha cada cinco años durante un período de 20 años. Estos datos primero se dividieron en cuatro grupos según los estratos verticales del bosque (arbustos, árboles del sotobosque, árboles medios y árboles altos; después se usaron tres para estudiar patrones de agregación en cada año de muestreo. Los arbustos y árboles del sotobosque se agruparon en pequeñas escalas espaciales de pocos metros

  3. Postural change in intraocular pressure: a comparison of measurement with a Goldmann tonometer, Tonopen XL, pneumatonometer, and HA-2.

    Science.gov (United States)

    Barkana, Yaniv

    2014-01-01

    To compare directly the results of 4 tonometers in measuring postural change in the intraocular pressure (IOP) between sitting and lying body positions. In 19 healthy subjects, the IOP was measured both eyes with a Goldmann applanation tonometer (GAT) while sitting, then using the same GAT with the subject in the left lateral decubitus position after lying for 15 minutes, using a novel system comprising a motorized bed and a modified slit-lamp table. On the next day, the sitting IOP was measured in 1 eye using GAT, and additionally in random order Tonopen XL and pneumatonometer. Then subjects were asked to lie down, and the IOP was measured with these tonometers and also with a hand-held applanation tonometer (HA-2) after lying for 15 minutes and for 45 minutes; measurements were made with subjects in the supine position except with GAT. There were 10 male and 9 female subjects, with a mean age of 33.0±12.4 years. On day 1, the sitting GAT IOP (mm Hg) was 13.7±3.0 right eye and 13.6±2.8 left eye (P=0.7) and the lying GAT IOP was 17.8±3.5 right eye and 18.1±3.2 left eye (P=0.3 for inter-eye postural IOP change). Postural change in the right and the left eyes was moderately correlated, with a coefficient of 0.453. On day 2, postural changes after lying for 15 minutes as measured with a GAT, a Tonopen, a pneumatonometer, and a HA-2 were 4.9±2.6, 1.6±1.8, 4.2±2.0, and 3.1±2.7, respectively. After lying for 45 minutes, it decreased to 3.3±2.1, 1.1±4.3, 3.1±2.5, and 2.6±3.3, respectively; this IOP decrease was statistically significant for the GAT and the pneumatonometer. The inter-subject variability was large, as in some subjects there was nearly no postural change in the IOP, whereas in some the IOP increased by 8 to 10 mm Hg. Ninety-five percent limits of agreement showed a poor agreement between GAT and the other 3 tonometers in the sitting and lying IOPs and postural IOP changes measured. The average postural IOP change was similar when measured with

  4. Assessment of injection safety in Ha Dong General Hospital, Hanoi, in 2012 [version 3; referees: 2 approved

    Directory of Open Access Journals (Sweden)

    Phan Van Tuong

    2017-09-01

    Full Text Available Background: Injection is one of the most frequently used medical methods to introduce drugs or other substances into the body for purposes of treatment or prevention. Unsafe injection can cause adverse outcomes, such as abscess and anaphylactic shock, and increases the risk of blood-borne transmission of viruses to patients and health care workers, as well as the community. Recognizing the importance of injection safety, in 2000 the Vietnamese Ministry of Health (MOH collaborated with the Vietnam Nurses Association to launch the “Safe injection” program throughout the country, including Hanoi. Methods: This cross-sectional study, combining quantitative and qualitative analysis, was conducted from February to August 2012 in Ha Dong General Hospital using a structured questionnaire and observation checklist. The target population of the study was 109 nurses working in clinical departments and 436 injections were observed. Results: The percentage of nurses who are familiar with injection safety standards was found to be 82.6%. The proportion of practical injections that met the 23 standards of injection safety set by the MOH amounted to 22.2%. The factors related to safe injection practice of nurses who are younger age group (OR=3.1; p<0.05 and lower amount of working years (OR=2.8; p<0.05. Conclusions: Despite the high level of knowledge about safety injection, a low proportion of nurses performed correct safety injection practice. Moreover, the results demonstrated that experience might not always guarantee better practice. The findings raise the need for further training about this issue, especially among older nurses.

  5. Aurora-A overexpression enhances cell-aggregation of Ha-ras transformants through the MEK/ERK signaling pathway

    Directory of Open Access Journals (Sweden)

    Huang Chi-Ying F

    2009-12-01

    Full Text Available Abstract Background Overexpression of Aurora-A and mutant Ras (RasV12 together has been detected in human bladder cancer tissue. However, it is not clear whether this phenomenon is a general event or not. Although crosstalk between Aurora-A and Ras signaling pathways has been reported, the role of these two genes acting together in tumorigenesis remains unclear. Methods Real-time PCR and sequence analysis were utilized to identify Ha- and Ki-ras mutation (Gly -> Val. Immunohistochemistry staining was used to measure the level of Aurora-A expression in bladder and colon cancer specimens. To reveal the effect of overexpression of the above two genes on cellular responses, mouse NIH3T3 fibroblast derived cell lines over-expressing either RasV12and wild-type Aurora-A (designated WT or RasV12 and kinase-inactivated Aurora-A (KD were established. MTT and focus formation assays were conducted to measure proliferation rate and focus formation capability of the cells. Small interfering RNA, pharmacological inhibitors and dominant negative genes were used to dissect the signaling pathways involved. Results Overexpression of wild-type Aurora-A and mutation of RasV12 were detected in human bladder and colon cancer tissues. Wild-type Aurora-A induces focus formation and aggregation of the RasV12 transformants. Aurora-A activates Ral A and the phosphorylation of AKT as well as enhances the phosphorylation of MEK, ERK of WT cells. Finally, the Ras/MEK/ERK signaling pathway is responsible for Aurora-A induced aggregation of the RasV12 transformants. Conclusion Wild-type-Aurora-A enhances focus formation and aggregation of the RasV12 transformants and the latter occurs through modulating the Ras/MEK/ERK signaling pathway.

  6. Effects of lunar and mars dust on HaCaT keratinocytes and CHO-K1 fibroblasts

    Science.gov (United States)

    Brix, Klaudia; Slenzka, Klaus; Rehders, Maren; Sadhukhan, Annapurna; Mistry, Rima; Duenne, Matthias; Kempf, Juergen

    Exposure to lunar dust during Apollo missions resulted in occasional reports of ocular, respira-tory and dermal irritations which showed that lunar dust has a risk potential for human health. This is caused by its high reactivity as well as its small size, leading to a wide distribution also inside habitats. Hence, detailed information regarding effects of lunar dust on human health is required to best support future missions to moon. In this study, we used different methods to assess the specific effects of lunar dust onto mammalian skin by exposing HaCaT keratinocytes and CHO-K1 fibroblasts to dusts simulating lunar or mars soils. These particular cell types were chosen because the skin protects the human body from potentially harmful substances and since a well orchestrated program ensures proper repair in cases of wounding. Keratinocytes and fibroblasts were exposed to the dusts for different durations of time and their effects on morphology, metabolic state, survival and proliferation of the cells were determined. Cytotoxi-city and proliferation were measured using the MTT assay, metabolic activity was analyzed by vital staining of mitochondria, and phalloidin staining of the actin cytoskeleton was performed to address structural integrity of the cells. It was found that the effects of the two types of soils on the different features of both cell lines varied to considerable extent, and that lunar and mars dust were specific in their effects. The obtained results will facilitate detailed inves-tigations of dust exposure during wound healing and will ease risk assessment studies for e.g. lunar lander approaches. The investigations will help to assess the risks and to determine safety measures to be taken during extraterrestrial expeditions in order to minimize risks to human health associated with exposure of human skin to dust contaminants.

  7. Red Iron-Pigmented Tooth Enamel in a Multituberculate Mammal from the Late Cretaceous Transylvanian "Haţeg Island".

    Directory of Open Access Journals (Sweden)

    Thierry Smith

    Full Text Available Mammals that inhabit islands are characterized by peculiar morphologies in comparison to their mainland relatives. Here we report the discovery of a partial skull associated with the lower jaws of a Late Cretaceous (≈70 Ma multituberculate mammal from the Carpathian "Haţeg Island" of Transylvania, Romania. The mammal belongs to the Kogaionidae, one of the rare families that survived the Cretaceous-Paleogene mass extinction in Europe. The excellent preservation of this specimen allows for the first time description of the complete dentition of a kogaionid and demonstration that the enigmatic Barbatodon transylvanicus presents a mosaic of primitive and derived characters, and that it is phylogenetically basal among the Cimolodonta. Another peculiarity is the presence of red pigmentation in its tooth enamel. The red coloration is present on the anterior side of the incisors and on the cusps of most of the teeth. Energy-dispersive X-ray spectrometry (EDS analysis reveals that the pigmented enamel contains iron, as in living placentals. Such a red pigmentation is known in living soricine shrews and many families of rodents, where it is thought to increase the resistance of the enamel to the abrasion that occurs during "grinding" mastication. The extended pattern of red pigment distribution in Barbatodon is more similar to that in eulipotyplan insectivores than to that in rodents and suggests a very hard diet and, importantly, demonstrates that its grasping incisors were not ever-growing. As inferred for other endemic Transylvanian vertebrates such as dwarf herbivorous dinosaurs and unusual theropod dinosaurs, insularity was probably the main factor of survival of such a primitive mammalian lineage relative to other mainland contemporaries of the Northern hemisphere.

  8. Application of HTB-SiHa cells transfected with a recombinant plasmid for external quality assessment of Chlamydia trachomatis PCR.

    Science.gov (United States)

    Zhang, Kuo; Huo, Hong; Sun, Yu; Wang, Lunan; Zhang, Rui; Lin, Guigao; Xie, Jiehong; Wang, Qingtao; Li, Jinming

    2014-09-01

    The participation of laboratories in external quality assessment (EQA) programs is required for the quality assurance of nucleic acid amplification of Chlamydia trachomatis. This study aimed to construct a new quality control (QC) material applicated in EQA of C. trachomatis PCR. A QC material-HTB-SiHa cells transfected with a recombinant plasmid containing the cryptic plasmid sequence-was constructed for C. trachomatis PCR detection, and four different panels, each consisting of 4 positive samples with serial dilution of the constructed QC material and 1 negative sample, were distributed by the National Center for Clinical Laboratories among four groups of 275, 268, 317, and 304 participants across China from 2011 through 2012. A total of eight commercial kits were used for C. trachomatis PCR detection in participants. Nine laboratories reported false-positive results (0.9%). As the series dilution increased, the correct reporting of the data sets decreased; the lowest correct rate was 96.3% in the weakest positive samples (10(4) copies/mL). Eight laboratories reported false-positive results, and 42 laboratories reported false-negative results in the EQA detection of C. trachomatis. No significant differences were observed in the detection of the constructed C. trachomatis positive samples (97.9%, 98.5%, 100%, 98.5%; P=0.36) and negative samples (100%, 99.0%, 100%, 99.0%; P=0.764) using four commercial kits commonly used in China. The results of the EQA study indicated that the constructed material provides a noninfectious, stable control material with sufficient volume for PCR detection of C. trachomatis.

  9. Red Iron-Pigmented Tooth Enamel in a Multituberculate Mammal from the Late Cretaceous Transylvanian "Haţeg Island".

    Science.gov (United States)

    Smith, Thierry; Codrea, Vlad

    2015-01-01

    Mammals that inhabit islands are characterized by peculiar morphologies in comparison to their mainland relatives. Here we report the discovery of a partial skull associated with the lower jaws of a Late Cretaceous (≈70 Ma) multituberculate mammal from the Carpathian "Haţeg Island" of Transylvania, Romania. The mammal belongs to the Kogaionidae, one of the rare families that survived the Cretaceous-Paleogene mass extinction in Europe. The excellent preservation of this specimen allows for the first time description of the complete dentition of a kogaionid and demonstration that the enigmatic Barbatodon transylvanicus presents a mosaic of primitive and derived characters, and that it is phylogenetically basal among the Cimolodonta. Another peculiarity is the presence of red pigmentation in its tooth enamel. The red coloration is present on the anterior side of the incisors and on the cusps of most of the teeth. Energy-dispersive X-ray spectrometry (EDS) analysis reveals that the pigmented enamel contains iron, as in living placentals. Such a red pigmentation is known in living soricine shrews and many families of rodents, where it is thought to increase the resistance of the enamel to the abrasion that occurs during "grinding" mastication. The extended pattern of red pigment distribution in Barbatodon is more similar to that in eulipotyplan insectivores than to that in rodents and suggests a very hard diet and, importantly, demonstrates that its grasping incisors were not ever-growing. As inferred for other endemic Transylvanian vertebrates such as dwarf herbivorous dinosaurs and unusual theropod dinosaurs, insularity was probably the main factor of survival of such a primitive mammalian lineage relative to other mainland contemporaries of the Northern hemisphere.

  10. Radiochemistry, pre-clinical studies and first clinical investigation of 90Y-labeled hydroxyapatite (HA) particles prepared utilizing 90Y produced by (n,γ) route.

    Science.gov (United States)

    Vimalnath, K V; Chakraborty, Sudipta; Rajeswari, A; Sarma, H D; Nuwad, Jitendra; Pandey, Usha; Kamaleshwaran, K; Shinto, Ajit; Dash, Ashutosh

    2015-05-01

    The scope of using no carrier added (NCA) (90)Y [T(1/2) = 64.1 h, Eβ(max) = 2.28 MeV] obtained from (90)Sr/(90)Y generator in radiation synovectomy (RSV) is widely accepted. In the present study, the prospect of using (90)Y produced by (n,γ) route in a medium flux research reactor for use in RSV was explored. Yttrium-90 was produced by thermal neutron irradiation of Y(2)O(3) target at a neutron flux of ~1×10(14) n/cm(2).s for 14 d. The influence of various experimental parameters were systematically investigated and optimized to arrive at the most favorable conditions for the formulation of (90)Y labeled hydroxyapatite (HA) using HA particles of 1-10 μm size range. An optimized kit formulation strategy was developed for convenient one-step compounding of (90)Y-HA, which is easily adaptable at hospital radiopharmacy. The pre-clinical biological evaluation of (90)Y-HA particles was studied by carrying out biodistribution and bioluminiscence imaging studies in Wistar rats. The first clinical investigation using the radiolabeled preparation was performed on a patient suffering from chronic arthritis in knee joint by administering 185 MBq (90)Y-HA formulated at the hospital radiopharmacy deploying the proposed strategy. Yttrium-90 was produced with a specific activity of 851 ± 111 MBq/mg and radionuclidic purity of 99.95 ± 0.02%. (90)Y-labeled HA particles (185 ± 10 MBq doses) were formulated in high radiochemical purity (>99%) and excellent in vitro stability. The preparation showed promising results in pre-clinical studies carried out in Wistar rats. The preliminary results of the first clinical investigation of (90)Y-HA preparation in a patient with rheumatoid arthritis in knee joints demonstrated the effectiveness of the formulation prepared using (90)Y produced via (n,γ) route in the management of the disease. The studies revealed that effective utilization of (90)Y produced via (n,γ) route in a medium flux research reactor coupled with the developed

  11. Micro-scratch and corrosion behavior of functionally graded HA-TiO2 nanostructured composite coatings fabricated by electrophoretic deposition.

    Science.gov (United States)

    Farnoush, Hamidreza; Aghazadeh Mohandesi, Jamshid; Çimenoğlu, Hüseyin

    2015-06-01

    In the present study, functionally graded coatings of HA/TiO2 nanoparticles and HA-TiO2 nanocomposite coatings with 0, 10 and 20 wt% of TiO2 were fabricated by electrophoretic deposition on Ti-6Al-4V substrate. The functionally graded structure of HA/TiO2 coatings was formed by gradual addition of HA suspension into the deposition cell containing TiO2 nanoparticles. Micro-scratch test results showed the highest critical distances of crack initiation and delamination, normal load before failure and critical contact pressures for functionally graded coating. It was observed that the improvement of adhesion strength and fracture toughness of functionally graded coatings would be due to the reduction of thermal expansion coefficient mismatch between Ti-6Al-4V substrate and HA. The results of potentiodynamic polarization measurements showed that the graded structure of the coating could efficiently increase the corrosion resistance of substrate. Copyright © 2015 Elsevier Ltd. All rights reserved.

  12. HA14-1 selectively induces apoptosis in Bcl-2-overexpressing leukemia/lymphoma cells, and enhances cytarabine-induced cell death.

    Science.gov (United States)

    Lickliter, J D; Wood, N J; Johnson, L; McHugh, G; Tan, J; Wood, F; Cox, J; Wickham, N W

    2003-11-01

    The Bcl-2 oncoprotein is commonly overexpressed in hematological malignancy, where it promotes the survival of neoplastic cells. Recently, a small molecule (HA14-1) was reported to bind the surface pocket of Bcl-2 that mediates antiapoptotic interactions, triggering apoptosis in a Bcl-2-transfected cell line. We investigated the activity of this compound in a panel of malignant hematopoietic cell lines. Consistent with its proposed role as a Bcl-2 inhibitor, HA14-1 was most cytotoxic in lines expressing high levels of Bcl-2. In addition, at lower concentrations (5-12.5 muM), the compound predominantly triggered apoptosis. However, at concentrations two-fold higher than this and above, increasing primary necrosis was observed, suggesting the onset of interactions supplementary to Bcl-2 inhibition. In experiments on primary cells, 25 muM HA14-1 induced extensive apoptosis in acute leukemic blasts, but also suppressed normal hematopoietic colony formation to <50% of baseline. Importantly, low-concentration HA14-1 (5 muM) was nontoxic to normal colony-forming cells, whereas it enhanced the cytotoxicity of the antileukemia drug cytarabine in Bcl-2-positive lymphoblastic leukemia cells. In conclusion, our results indicate that HA14-1 at low concentration selectively triggers apoptosis in malignant hematopoietic cells that overexpress Bcl-2. Agents of this class may have particular utility in combination with cytotoxic chemotherapy drugs.

  13. Intranasal Delivery of Recombinant AAV Containing BDNF Fused with HA2TAT: a Potential Promising Therapy Strategy for Major Depressive Disorder.

    Science.gov (United States)

    Ma, Xian-cang; Liu, Peng; Zhang, Xiao-ling; Jiang, Wen-hui; Jia, Min; Wang, Cai-xia; Dong, Ying-ying; Dang, Yong-hui; Gao, Cheng-ge

    2016-03-03

    Depression is a disturbing psychiatric disease with unsatisfied therapy. Not all patients are sensitive to anti-depressants currently in use, side-effects are unavoidable during therapy, and the cases with effectiveness are always accompanied with delayed onset of clinical efficacy. Delivering brain-derived neurotrophic factor (BDNF) to brain seems to be a promising therapy. However, a better approach to delivery is still rudimentary. The purpose of our present work is to look for a rapid-onset and long-lasting therapeutic strategy for major depressive disorder (MDD) by effectively delivering BDNF to brain. BDNF, fused with cell-penetrating peptides (TAT and HA2), was packaged in adenovirus associated virus (AAV) to construct the BDNF-HA2TAT/AAV for intranasally delivering BDNF to central nervous system (CNS) via nose-brain pathway. Intranasal administration of BDNF-HA2TAT/AAV to normal mice displayed anti-depression effect in forced swimming test when the delivery lasted relatively longer. The AAV applied to mice subjected to chronic mild stress (CMS) through intranasal administration for 10 days also alleviated depression-like behaviors. Western-blotting analysis revealed that BDNF-HA2TAT/AAV nasal administration enhanced hippocampal BDNF content. These results indicate intranasal administration of constructed BDNF-HA2TAT/AAV exerts anti-depression effect in CMS mice by increasing hippocampal BDNF, suggesting that this strategy holds a promising therapeutic potential for MDD.

  14. Inulae Flos and Its Compounds Inhibit TNF-α- and IFN-γ-Induced Chemokine Production in HaCaT Human Keratinocytes

    Directory of Open Access Journals (Sweden)

    Jung-Hoon Kim

    2012-01-01

    Full Text Available The present study is to investigate which kinds of solvent extracts of Inulae Flos inhibit the chemokine productions in HaCaT cell and whether the inhibitory capacity of Inulae Flos is related with constitutional compounds. The 70% methanol extract showed comparatively higher inhibition of thymus and activation-regulated chemokine (TARC/CCL17 in HaCaT cells, therefore this extract was further partitioned with n-hexane, chloroform, ethyl acetate, butanol, and water. The ethyl acetate fraction inhibited TARC, macrophage-derived chemokine (MDC/CCL22, and regulated on activation of normal T-cell-expressed and -secreted (RANTES/CCL5 production in HaCaT cells better than the other fractions. The compounds of Inulae Flos, such as 1,5-dicaffeoylquinic acid and luteolin, inhibited TARC, MDC, and RANTES production in HaCaT cells. 1,5-Dicaffeoylquinic acid was contained at the highest concentrations both in the 70% methanol extract and ethyl acetate fraction and inhibited the secretion of chemokines dose-dependently more than the other compounds. Luteolin also represented dose-dependent inhibition on chemokine productions although it was contained at lower levels in 70% methanol extract and solvent fractions. These results suggest that the inhibitory effects of Inulae Flos on chemokine production in HaCaT cell could be related with constituent compounds contained, especially 1,5-dicaffeoylquinic acid and luteolin.

  15. Bone Regeneration Using a Mixture of Silicon-Substituted Coral HA and β-TCP in a Rat Calvarial Bone Defect Model

    Directory of Open Access Journals (Sweden)

    Jiyeon Roh

    2016-02-01

    Full Text Available The demand of bone graft materials has been increasing. Among various origins of bone graft materials, natural coral composed of up to 99% calcium carbonate was chosen and converted into hydroxyapatite (HA; silicon was then substituted into the HA. Then, the Si-HA was mixed with β-tricalcium phosphate (TCP in the ratios 100:0 (S100T0, 70:30 (S70T30, 60:40 (S60T40, and 50:50 (S50T50. The materials were implanted for four and eight weeks in a rat calvarial bone defect model (8 mm. The MBCPTM (HA:β-TCP = 60:40, Biomatalante, Vigneux de Bretagne, France was used as a control. After euthanasia, the bone tissue was analyzed by making histological slides. From the results, S60T40 showed the fastest bone regeneration in four weeks (p < 0.05. In addition, S60T40, S50T50, and MBCPTM showed significant new bone formation in eight weeks (p < 0.05. In conclusion, Si-HA/TCP showed potential as a bone graft material.

  16. Response of Human Osteoblast to n-HA/PEEK—Quantitative Proteomic Study of Bio-effects of Nano-Hydroxyapatite Composite

    Science.gov (United States)

    Zhao, Minzhi; Li, Haiyun; Liu, Xiaochen; Wei, Jie; Ji, Jianguo; Yang, Shu; Hu, Zhiyuan; Wei, Shicheng

    2016-03-01

    Nano-sized hydroxyapatite (n-HA) is considered as a bio-active material, which is often mixed into bone implant material, polyetheretherketone (PEEK). To reveal the global protein expression modulations of osteoblast in response to direct contact with the PEEK composite containing high level (40%) nano-sized hydroxyapatite (n-HA/PEEK) and explain its comprehensive bio-effects, quantitative proteomic analysis was conducted on human osteoblast-like cells MG-63 cultured on n-HA/PEEK in comparison with pure PEEK. Results from quantitative proteomic analysis showed that the most enriched categories in the up-regulated proteins were related to calcium ion processes and associated functions while the most enriched categories in the down-regulated proteins were related to RNA process. This enhanced our understanding to the molecular mechanism of the promotion of the cell adhesion and differentiation with the inhibition of the cell proliferation on n-HA/PEEK composite. It also exhibited that although the calcium ion level of incubate environment hadn’t increased, merely the calcium fixed on the surface of material had influence to intracellular calcium related processes, which was also reflect by the higher intracellular Ca2+ concentration of n-HA/PEEK. This study could lead to more comprehensive cognition to the versatile biocompatibility of composite materials. It further proves that proteomics is useful in new bio-effect discovery.

  17. A multi-scaled hybrid orthopedic implant: bone ECM-shaped Sr-HA nanofibers on the microporous walls of a macroporous titanium scaffold

    Science.gov (United States)

    Han, Yong; Zhou, Jianhong; Zhang, Lan; Xu, Kewei

    2011-07-01

    We report here, for the first time, a novel multi-scaled hybrid orthopedic implant material consisting of a macroporous Ti scaffold, whose macropores' walls have a microporous titania layer which is fully covered with nanofibers of Sr-doped hydroxyapatite (Sr-HA). The microporous titania layer is formed on and within the Ti scaffold by micro-arc oxidation, which firmly binds to the Ti substrate and contains Ca2 + , Sr2 + and PO43 - ions. It is then hydrothermally treated to form Sr-HA nanofibers. During the hydrothermal treatment, Sr-HA nanoprisms nucleate from Ca0.5Sr0.5TiO3 pre-formed on the TiO2 and grow in length to nanofibers at the expense of Ca2 + , Sr2 + and PO43 - ions that migrate from the TiO2. These Sr-HA nanofibers construct a network structure similar to the hierarchical organization of bone extracellular matrix (ECM), and the resulting nanofibrous surface displays a firm adhesion to substrate, superhydrophilicity and apatite-inducing ability. The induced apatite prefers to nucleate on the basal-faceted surfaces of Sr-HA nanofibers. The nanofiber-walled scaffold has a great potential for load-bearing orthotopic use.

  18. Response of Human Osteoblast to n-HA/PEEK—Quantitative Proteomic Study of Bio-effects of Nano-Hydroxyapatite Composite

    Science.gov (United States)

    Zhao, Minzhi; Li, Haiyun; Liu, Xiaochen; Wei, Jie; Ji, Jianguo; Yang, Shu; Hu, Zhiyuan; Wei, Shicheng

    2016-01-01

    Nano-sized hydroxyapatite (n-HA) is considered as a bio-active material, which is often mixed into bone implant material, polyetheretherketone (PEEK). To reveal the global protein expression modulations of osteoblast in response to direct contact with the PEEK composite containing high level (40%) nano-sized hydroxyapatite (n-HA/PEEK) and explain its comprehensive bio-effects, quantitative proteomic analysis was conducted on human osteoblast-like cells MG-63 cultured on n-HA/PEEK in comparison with pure PEEK. Results from quantitative proteomic analysis showed that the most enriched categories in the up-regulated proteins were related to calcium ion processes and associated functions while the most enriched categories in the down-regulated proteins were related to RNA process. This enhanced our understanding to the molecular mechanism of the promotion of the cell adhesion and differentiation with the inhibition of the cell proliferation on n-HA/PEEK composite. It also exhibited that although the calcium ion level of incubate environment hadn’t increased, merely the calcium fixed on the surface of material had influence to intracellular calcium related processes, which was also reflect by the higher intracellular Ca2+ concentration of n-HA/PEEK. This study could lead to more comprehensive cognition to the versatile biocompatibility of composite materials. It further proves that proteomics is useful in new bio-effect discovery. PMID:26956660

  19. Cross reactivity of serum antibody responses elicited by DNA vaccines expressing HA antigens from H1N1 subtype influenza vaccines in the past 30 years.

    Science.gov (United States)

    Almansour, Iman; Chen, Huaiqing; Wang, Shixia; Lu, Shan

    2013-10-01

    In the past three decades, ten H1 subtype influenza vaccines have been recommended for global seasonal flu vaccination. Some of them were used only for one year before being replaced by another H1 flu vaccine while others may be used for up to seven years. While the selection of a new seasonal flu vaccine was based on the escape of a new emerging virus that was not effectively protected by the existing flu formulation, there is limited information on the magnitude and breadth of cross reactivity among H1 subtype virus circulation over a long period. In the current study, HA-expressing DNA vaccines were constructed to express individual HA antigens from H1 subtype vaccines used in the past 30 y. Rabbits naïve to HA antibody responses were immunized with these HA DNA vaccines and the cross reactivity of these sera against HA antigen and related H1 viruses in the same period was studied. Our data indicate that the level of cross reactivity was different for different viral isolates and the key mutations responsible for the cross reactivity may involve only a limited number of residues. Our results provide useful information for the development of improved seasonal vaccines than can achieve broad protection against viruses within the same H1 subtype.

  20. Repair of rabbit cartilage defect based on the fusion of rabbit bone marrow stromal cells and Nano-HA/PLLA composite material.

    Science.gov (United States)

    Zhu, Weimin; Guo, Daiqi; Peng, Liangquan; Chen, Yun Fang; Cui, Jiaming; Xiong, Jianyi; Lu, Wei; Duan, Li; Chen, Kang; Zeng, Yanjun; Wang, Daping

    2017-02-01

    Objective To assess the effect of the fusion of rabbit bone marrow stromal cells (rBMSCs) and Nano-hydroxyapatite/poly (l-lactic acid) (Nano-HA/PLLA) in repairing the rabbit knee joint with full-thickness cartilage defect. Method The rBMSCs were isolated and cultured in vitro, and the third generation of rBMSCs was co-cultured with the Nano-HA/PLLA to construct the tissue-engineered cartilage (TEC). Eighteen New Zealand white rabbits were selected and randomly divided into three groups, namely, TEC group, Nano-HA/PLLA group, and control group. A cartilage defect model with the diameter of 4.5 mm and depth of 5 mm was constructed on the articular surface of medial malleolus of rabbit femur. General observation, histological observation, and Wakitani's histological scoring were conducted in the 12th and 24th week postoperatively. Results The results of TEC group indicated that new cartilage tissue was formed on the defect site and subchondral bone achieved physiological integration basically. Histological and immunohistochemical analyses indicated the generation of massive extracellular matrix. In contrast, limited regeneration and reconstruction of cartilage was achieved in the Nano-HA/PLLA group and control group, with a significant difference from the TEC group (p Nano-HA/PLLA combined with BMSCs promoted the repair of weight-bearing bone of adult rabbit's knee joint with cartilage defect.

  1. A multi-scaled hybrid orthopedic implant: bone ECM-shaped Sr-HA nanofibers on the microporous walls of a macroporous titanium scaffold.

    Science.gov (United States)

    Han, Yong; Zhou, Jianhong; Zhang, Lan; Xu, Kewei

    2011-07-08

    We report here, for the first time, a novel multi-scaled hybrid orthopedic implant material consisting of a macroporous Ti scaffold, whose macropores' walls have a microporous titania layer which is fully covered with nanofibers of Sr-doped hydroxyapatite (Sr-HA). The microporous titania layer is formed on and within the Ti scaffold by micro-arc oxidation, which firmly binds to the Ti substrate and contains Ca2+, Sr2+ and PO4(3-) ions. It is then hydrothermally treated to form Sr-HA nanofibers. During the hydrothermal treatment, Sr-HA nanoprisms nucleate from Ca0.5Sr0.5TiO3 pre-formed on the TiO2 and grow in length to nanofibers at the expense of Ca2+, Sr2+ and PO4(3-) ions that migrate from the TiO2. These Sr-HA nanofibers construct a network structure similar to the hierarchical organization of bone extracellular matrix (ECM), and the resulting nanofibrous surface displays a firm adhesion to substrate, superhydrophilicity and apatite-inducing ability. The induced apatite prefers to nucleate on the basal-faceted surfaces of Sr-HA nanofibers. The nanofiber-walled scaffold has a great potential for load-bearing orthotopic use.

  2. Northern Caribbean Tsunami Hazard: Earthquake and Gravity Source Contribution of the Tsunami of 2010 in Haïti

    Science.gov (United States)

    Poupardin, Adrien; Hébert, Hélène; Calais, Eric; Gailler, Audrey

    2015-04-01

    The Mw 7 earthquake of January 12, 2010, in Haïti was followed by a tsunami with wave heights reaching 3 m in some locations (Grand Goâve, Jacmel) on either side of the Presqu'Ile du Sud where the event took place. The tsunami was also recorded at DART buoy 42407 (about 600 km southeast of the earthquake source) and at a tide gauge in Santo Domingo (Dominican Republic). In the hours following the event, the National Earthquake Information Center (NEIC) suggested rupture of a south-dipping segment of the Enriquillo-Plantain Garden fault (EPGF). Fritz et al. (2013) used the NEIC source model to simulate the tsunami height and match coastal run-up measurements and DART data by (1) increasing coseismic slip on the EPGF while keeping a constant Mo by scaling the regional rigidity, and (2) invoking a coastal submarine landslide in addition to ground motion. Since then, several studies have considerably improved our understanding of the 2010 Haiti earthquake source using GPS, InSAR, seismological, geological, and/or teleseismic data (Meng et al., 2012; Hayes et al., 2010, Symithe et al., 2013). All show that rupture occurred on a north-dipping blind fault (Leogâne fault) with 1/3 of its moment expressed by reverse motion and up to 60 cm of coastal uplift. Here we revisit the January 12, 2010 Haiti tsunami by modeling runup heights, DART, and tide gauge observations using these recent source models as input parameters. We propagate the tsunami using a non linear shallow water tsunami model able to account for the shoaling effect thanks to imbricated bathymetric grids. Simulations indicate run-up heights much lower than observed (1) in the Grand Goâve Bay, consistent with the hypoythesis of a landslide-triggered tsunami at this location, (2) along the southern coast of Hispaniola and at the DART buoy, closest to observations however when using Symithe et al.'s source model. We also find wave heights up to 1 m in Port-au-Prince (harbor and coastal shantytowns) when using

  3. Aerosol optical properties in the North China Plain during HaChi campaign: an in-situ optical closure study

    Directory of Open Access Journals (Sweden)

    N. Ma

    2011-06-01

    Full Text Available The largest uncertainty in the estimation of climate forcing stems from atmospheric aerosols. In early spring and summer of 2009, two periods of in-situ measurements on aerosol physical and chemical properties were conducted within the HaChi (Haze in China project at Wuqing, a town between Beijing and Tianjin in the North China Plain (NCP. Aerosol optical properties, including the scattering coefficient (σsp, the hemispheric back scattering coefficient (σbsp, the absorption coefficient (σap, as well as the single scattering albedo (ω, are presented. The diurnal and seasonal variations are analyzed together with meteorology and satellite data. The mean values of σsp, 550 nm of the dry aerosol in spring and summer are 280±253 and 379±251 Mm−1, respectively. The average σap for the two periods is respectively 47±38 and 43±27 Mm−1. The mean values of ω at the wavelength of 637 nm are 0.82±0.05 and 0.86±0.05 for spring and summer, respectively. The relative high levels of σsp and σbsp are representative of the regional aerosol pollution in the NCP. Pronounced diurnal cycle of $σsp, σap and ω are found, mainly influenced by the evolution of boundary layer and the accumulation of local emissions during nighttime. The pollutants transported from the southwest of the NCP are more significant than that from the two megacities, Beijing and Tianjin, in both spring and summer. An optical closure experiment is conducted to better understand the uncertainties of the measurements. Good correlations (R>0.98 are found between the values measured by the nephelometer and the values calculated with a modified Mie model. The Monte Carlo simulation shows an uncertainty of about 30 % for the calculations. Considering all possible uncertainties of measurements, calculated σsp and σbsp agree well

  4. Hemin Reduces HMGB1 Release by UVB in an AMPK/HO-1-dependent Pathway in Human Keratinocytes HaCaT Cells.

    Science.gov (United States)

    Park, Eun Jung; Kim, Young Min; Chang, Ki Churl

    2017-07-01

    High mobility group box 1 (HMGB1) plays an important role as a pro-inflammatory cytokine that regulates inflammation in various diseases. We hypothesized that hemin might reduce HMGB1 release through the induction of HO-1 in UVB-induced HaCaTs. The effects of hemin on the release of HMGB1 in UVB exposure were evaluated. The mechanisms were investigated using various signal inhibitors and small interfering RNA techniques. Treatment with hemin inhibited reactive oxygen species (ROS) in UVB-induced HaCaTs in a dose-dependent manner. HMGB1 release by UVB was significantly reduced by hemin, N-acetyl-cysteine and DPI (NADPH oxidase inhibitor). Hemin increased HO-1 induction followed by phosphorylation of AMPK in a time- and dose-dependent manner. Additionally, hemin significantly increased the NAD+/NADH ratio in HaCaTs. The inhibitory effects of UVB-induced HMGB1 release by hemin were significantly reversed not only with pharmacological inhibitors of AMPK (compound c) or HO-1 (ZnPPIX) but also through transfection of small interfering RNAs (siRNAs) for AMPK or HO-1. Interestingly, hemin decreased phosphor-AMPK expression by HO-1 siRNA transfection, but it failed to induce HO-1 in AMPK siRNA-transfected cells, which suggested that HO-1 was involved in AMPK activation by hemin in HaCaT. Moreover, recombinant HMGB1 induced Snail and inhibited E-Cadherin in HaCaTs, whereas hemin reversed those effects through rHMGB1. It is concluded that the increased activity of HO-1/AMPK and scavenging ROS are, at least in part, responsible for the inhibition of UVB-induced HMGB1 release in keratinocyte HaCaTs. Therefore, hemin may be a useful agent for preventing UVB-induced skin cancer. Copyright © 2017 IMSS. Published by Elsevier Inc. All rights reserved.

  5. En Haïti, la technologie est mise au service de l'efficacité du système ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    7 oct. 2010 ... « Mieux reconstruire », tel est le mot d'ordre en Haïti à l'heure où le pays peine à se remettre du tremblement de terre dévastateur de janvier dernier. En Haïti, ce mot d'ordre vise tout particulièrement le système de santé, qui était chancelant même avant la catastrophe. En matière de santé, l'une des ...

  6. Les leçons apprises en Argentine aident Haïti à lutter contre le choléra

    International Development Research Centre (IDRC) Digital Library (Canada)

    17 janv. 2011 ... et sa mise en application en Haïti. Des mesures de diffusion de l'information et de formation des ... Le programme Pro Huerta Haïti ayant été mis sur pied en 2005, ses activités ont débuté avant le récent déclenchement de l'épidémie de choléra. Depuis cinq ans, des formations sont offertes à des familles, ...

  7. Cómo la informática ha reanimado los procesos y estéticas de la animación artística

    OpenAIRE

    Álvarez Sarrat, Sara; Lorenzo Hernández, María Carmen

    2012-01-01

    Este artículo analiza la evolución que ha experimentado la animación artística en la era digital, destacando la paradoja que supone la revitalización de los procedimientos de animación a mano (dibujo, pintura bajo cámara, procesos de grabado) en el entorno digital. De esta manera, se ha generado una relación paradójica entre modernidad y artesanía: a pesar de su virtualidad, las nuevas tecnologías proporcionan una interfaz de trabajo que permite al artista-animador expresar sus intenciones de...

  8. Análisis comparativo de la asignatura "organización del centro escolar" en el nuevo y antiguo plan de estudios de las universidades públicas de Madrid

    Directory of Open Access Journals (Sweden)

    Alexandra Tardón Morlanes

    2012-10-01

    Full Text Available En la actualidad los estudios universitarios se encuentran en un proceso de cambio. España ha apostado desde el principio por ese gran proyecto de ciudadanía europea que constituye el Proceso de Bolonia. Ha puesto todas las bases institucionales y jurídicas necesarias para implantar un sistema universitario capaz de formar personas con espíritu cívico, fundamentos intelectuales y capacidad profesional reconocidos en toda Europa, y más allá. No obstante, no son pocas las voces que se han levantado en contra de este nuevo plan de estudios. La realidad es que existe, actualmente, un pacto firmado por los ministros de educación Europeos que ha llegado casi sin previo aviso y que ya se encuentra implantado en todas nuestras Universidades ante el desconcierto general de los estudiantes. Son muchos los que se han movilizado, reclamando en términos generales, la no privatización de la enseñanza. Dado que este es un proceso de cambio en la universidad y dado que los estudiantes, como parte activa de la comunidad universitaria, tenemos la responsabilidad de velar por la mejora de los nuevos planes, nos planteamos la necesidad de analizar la forma en que los estudios de Grado afectan o modifican las asignaturas que en ellos se imparten. Nos centraremos, concretamente, en el análisis de la asignatura de “Organización del centro escolar” en las diferentes universidades españolas. En este sentido y como estudiantes de Magisterio de Ed. Primaria (especialidad en lengua extranjera, nos proponemos, en este trabajo de investigación, analizar los cambios pertinentes que se han producido en la asignatura de “Organización del centro escolar” y realizar una comparación de la asignatura respecto al plan antiguo y al nuevo. Desde esta perspectiva, nos planteamos como objetivo principal estudiar los cambios concretos que pueden observarse en dicha asignatura y valorar cómo éstos pueden beneficiar o perjudicar a los estudiantes universitarios

  9. Vesiculation, fragmentation and aggregation processes during the 2014-2015 eruption of Hunga Tonga-Hunga Ha'apai volcano

    Science.gov (United States)

    Colombier, Mathieu; Tost, Manuela; Cronin, Shane; Scheu, Bettina; Dobson, Katharine J.; Hess, Kai U.; Ruthensteiner, Bernhard; Yilmaz, Tim; Dingwell, Donald B.

    2017-04-01

    Surtseyan eruptions are shallow emergent subaqueous explosive volcanic eruptions. Conditions of water-magma interaction along with magma ejection rates and its gas/expansion conditions control eruption styles during progressive emergence of the volcano. In order to better assess the effect of water on processes such as vesiculation, fragmentation, cooling or aggregation, we studied the textural and morphological properties of ash, lapilli and bombs from the deposits of the 2014-2015 surtseyan eruption of Hunga Tonga-Hunga Ha'apai volcano, Tonga. We measured the vesicularity, vesicle connectivity, permeability and vesicle size distributions of juvenile lapilli and bombs from the deposits by Helium pycnometry, X-ray micro-computed tomography using Avizo 9.2 software and SEM using FOAMS software to infer the vesiculation processes. We also qualitatively assessed the fragmentation and aggregation mechanisms by analysing aggregates by X-ray micro-computed tomography and 2D textural analysis using BSE images at SEM. Finally, we measured the shape parameters of ash particles of different grain sizes to obtain further insights into the fragmentation processes. The bombs show gradual textural variations with increase of vesicle size and degree of coalescence from rim to core. These textural variations are also observed in the lapilli. The vesicle connectivity in the lapilli and bombs covers a wide range from fully isolated to completely connected. Vesicle connectivity and permeability increase strongly with vesicularity. The percolation threshold, that is the critical vesicularity corresponding to the onset of connectivity and permeability due to system-spanning coalescence is estimated at around 0.2-0.4 and is lower than for scoria from fire fountaining and strombolian eruptions. These variations of connectivity and permeability with vesicularity are likely to reflect post-fragmentation vesiculation interupted at different stages by quenching in water. 2D and 3D images

  10. Proceso de Bolonia (III): Educación en valores: profesionalismo

    OpenAIRE

    Gual Sala, Arcadi; Palés, J. L. (Jorge Luis); Nolla i Domenjó, Maria; Oriol Bosch, Albert

    2011-01-01

    El desarrollo profesional y personal de los estudiantes de grado y de formación especializada como objetivo de la educación médica requiere disponer de definiciones normativas sobre el contenido y los contextos de los términos 'profesional', 'profesionalidad' y 'profesionalismo' para que el sistema educativo pueda diseñar estrategias educativas y evaluadoras eficientes [1]. Esta necesidad no surge por carencias reales, puesto que las reflexiones abundan en la bibliografía de la última década ...

  11. 7 CFR 1944.548 - Counseling consent by FmHA or its successor agency under Public Law 103-354 single family housing...

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 13 2010-01-01 2009-01-01 true Counseling consent by FmHA or its successor agency... REGULATIONS (CONTINUED) HOUSING Technical and Supervisory Assistance Grants § 1944.548 Counseling consent by... will indicate the availability of the counseling services of the grantee and solicit the borrower's...

  12. 7 CFR 1980.452 - FmHA or its successor agency under Public Law 103-354 evaluation of application.

    Science.gov (United States)

    2010-01-01

    ... of authority. After the security code is furnished, all pertinent information contained on Form FmHA... borrower, individual customer credit file, installment Loan Ledger Card or Computer printouts and other... structured so that the lender bears a significant portion of the risk of loss from a default. “Significant...

  13. Mesenchymal Stem Cells and Platelet Gel Improve Bone Deposition within CAD-CAM Custom-Made Ceramic HA Scaffolds for Condyle Substitution

    Science.gov (United States)

    Ciocca, L.; Donati, D.; Ragazzini, S.; Dozza, B.; Rossi, F.; Fantini, M.; Spadari, A.; Romagnoli, N.; Landi, E.; Tampieri, A.; Piattelli, A.; Iezzi, G.; Scotti, R.

    2013-01-01

    Purpose. This study evaluated the efficacy of a regenerative approach using mesenchymal stem cells (MSCs) and CAD-CAM customized pure and porous hydroxyapatite (HA) scaffolds to replace the temporomandibular joint (TMJ) condyle. Methods. Pure HA scaffolds with a 70% total porosity volume were prototyped using CAD-CAM technology to replace the two temporomandibular condyles (left and right) of the same animal. MSCs were derived from the aspirated iliac crest bone marrow, and platelets were obtained from the venous blood of the sheep. Custom-made surgical guides were created by direct metal laser sintering and were used to export the virtual planning of the bone cut lines into the surgical environment. Sheep were sacrificed 4 months postoperatively. The HA scaffolds were explanted, histological specimens were prepared, and histomorphometric analysis was performed. Results. Analysis of the porosity reduction for apposition of newly formed bone showed a statistically significant difference in bone formation between condyles loaded with MSC and condyles without (P condyles with and without MSCs (P condyle with MSCs showed greater bone formation. Conclusion. The split-mouth design confirmed an increment of bone regeneration into the HA scaffold of up to 797% upon application of MSCs. PMID:24073409

  14. Fabrication and characterization of nano-HA-45S5 bioglass composite coatings on calcium-phosphate containing micro-arc oxidized CP-Ti substrates

    Science.gov (United States)

    Farnoush, Hamidreza; Muhaffel, Faiz; Cimenoglu, Huseyin

    2015-01-01

    In the present study, micro-arc oxidation (MAO) was carried out on commercially pure titanium (CP-Ti) to fabricate porous titanium oxide coatings containing calcium phosphates (CaP) at different applied voltages of 300, 330 and 360 V for 5 min. Subsequently, nano-hydroxyapatite (HA) and HA-45S5 bioglass (BG) composite were effectively coated on micro-arc oxidized substrate by electrophoretic deposition (EPD) at a constant voltage of 30 V for 120 s. The phase, structural agents, microstructure and composition of MAO interlayer and subsequent EPD coatings were characterized by X-ray diffraction, Fourier transform infrared spectroscopy, scanning electron microscopy and energy-dispersive X-ray spectroscopy, respectively. Thermal stability of the as-deposited coatings was analyzed by simultaneous differential scanning calorimetry and thermal gravimetery. The pull-off adhesion tests showed the highest bonding strength was obtained for HA-BG coating on micro-oxidized sample at 360 V. The results of potentiodynamic polarization and impedance spectroscopic measurements in simulated body fluid solution depicted that the combination of MAO treatment at 360 V and EPD of HA-BG composite could effectively increase the corrosion resistance of CP-Ti substrates.

  15. Engineering of papaya mosaic virus (PapMV nanoparticles through fusion of the HA11 peptide to several putative surface-exposed sites.

    Directory of Open Access Journals (Sweden)

    Gervais Rioux

    Full Text Available Papaya mosaic virus has been shown to be an efficient adjuvant and vaccine platform in the design and improvement of innovative flu vaccines. So far, all fusions based on the PapMV platform have been located at the C-terminus of the PapMV coat protein. Considering that some epitopes might interfere with the self-assembly of PapMV CP when fused at the C-terminus, we evaluated other possible sites of fusion using the influenza HA11 peptide antigen. Two out of the six new fusion sites tested led to the production of recombinant proteins capable of self assembly into PapMV nanoparticles; the two functional sites are located after amino acids 12 and 187. Immunoprecipitation of each of the successful fusions demonstrated that the HA11 epitope was located at the surface of the nanoparticles. The stability and immunogenicity of the PapMV-HA11 nanoparticles were evaluated, and we could show that there is a direct correlation between the stability of the nanoparticles at 37°C (mammalian body temperature and the ability of the nanoparticles to trigger an efficient immune response directed towards the HA11 epitope. This strong correlation between nanoparticle stability and immunogenicity in animals suggests that the stability of any nanoparticle harbouring the fusion of a new peptide should be an important criterion in the design of a new vaccine.

  16. Involvement of PI3K/AKT and MAPK Pathways for TNF-α Production in SiHa Cervical Mucosal Epithelial Cells Infected with Trichomonas vaginalis.

    Science.gov (United States)

    Yang, Jung-Bo; Quan, Juan-Hua; Kim, Ye-Eun; Rhee, Yun-Ee; Kang, Byung-Hyun; Choi, In-Wook; Cha, Guang-Ho; Yuk, Jae-Min; Lee, Young-Ha

    2015-08-01

    Trichomonas vaginalis; induces proinflammation in cervicovaginal mucosal epithelium. To investigate the signaling pathways in TNF-α production in cervical mucosal epithelium after T. vaginalis infection, the phosphorylation of PI3K/AKT and MAPK pathways were evaluated in T. vaginalis-infected SiHa cells in the presence and absence of specific inhibitors. T. vaginalis increased TNF-α production in SiHa cells, in a parasite burden-dependent and incubation time-dependent manner. In T. vaginalis-infected SiHa cells, AKT, ERK1/2, p38 MAPK, and JNK were phosphorylated from 1 hr after infection; however, the phosphorylation patterns were different from each other. After pretreatment with inhibitors of the PI3K/AKT and MAPK pathways, TNF-α production was significantly decreased compared to the control; however, TNF-α reduction patterns were different depending on the type of PI3K/MAPK inhibitors. TNF-α production was reduced in a dose-dependent manner by treatment with wortmannin and PD98059, whereas it was increased by SP600125. These data suggested that PI3K/AKT and MAPK signaling pathways are important in regulation of TNF-α production in cervical mucosal epithelial SiHa cells. However, activation patterns of each pathway were different from the types of PI3K/MAPK pathways.

  17. Water Absorption and Diffusion Characteristics of Nanohydroxyapatite (nHA and Poly(hydroxybutyrate-co-hydroxyvalerate- Based Composite Tissue Engineering Scaffolds and Nonporous Thin Films

    Directory of Open Access Journals (Sweden)

    Naznin Sultana

    2013-01-01

    Full Text Available Water uptake characteristics of poly(hydroxybutyrate-co-hydroxyvalerate (PHBV- based composite tissue engineering (TE scaffolds incorporating nanosized hydroxyapatite (nHA have been investigated. The water absorption of these composite scaffolds obeyed the classical diffusion theory for the initial period of time. The diffusion coefficients of the composite scaffolds during the water absorption were much faster than those for the nonporous thin films, suggesting that the water uptake process depends on the presence of porosity and porous microstructure of the composite scaffolds. The incorporation of nHA increased the water uptake of both the composite scaffolds and thin films. It was also observed that the equilibrium uptake increased with the incorporation of nHA. This increase in the water uptake was largely due to the nHA particle aggregates in the microstructure of both composite scaffolds and thin films. The activation energy for diffusion was also determined using the Arrhenius equation for both porous scaffolds and thin films and the results suggested that the activation energy for scaffolds was lower than that for thin films.

  18. Cardiovascular Risk Factors (Diabetes, Hypertension, Hypercholesterolemia and Metabolic Syndrome) in Older People with Intellectual Disability: Results of the HA-ID Study

    Science.gov (United States)

    de Winter, C. F.; Bastiaanse, L. P.; Hilgenkamp, T. I. M.; Evenhuis, H. M.; Echteld, M. A.

    2012-01-01

    Hypertension, diabetes, hypercholesterolemia and the metabolic syndrome are important risk factors for cardiovascular disease (CVD). In older people with intellectual disability (ID), CVD is a substantial morbidity risk. The aims of the present study, which was part of the Healthy Ageing in Intellectual Disability (HA-ID) study, were (1) to…

  19. HA-1 T TCR T Cell Immunotherapy for the Treating of Patients With Relapsed or Refractory Acute Leukemia After Donor Stem Cell Transplant

    Science.gov (United States)

    2017-11-14

    Acute Biphenotypic Leukemia in Relapse (Diagnosis); Acute Undifferentiated Leukemia in Relapse (Diagnosis); HLA-A*0201 HA-1 Positive Cells Present; Recurrent Adult Acute Lymphoblastic Leukemia; Recurrent Adult Acute Myeloid Leukemia; Recurrent Childhood Acute Lymphoblastic Leukemia; Recurrent Childhood Acute Myeloid Leukemia; Refractory Acute Myeloid Leukemia; Refractory Adult Acute Lymphoblastic Leukemia; Refractory Childhood Acute Lymphoblastic Leukemia; Refractory Childhood Acute Myeloid Leukemia

  20. Effect of chemical composition on hydrophobicity and zeta potential of plasma sprayed HA/CaO-P2O5 glass coatings.

    Science.gov (United States)

    Ferraz, M P; Monteiro, F J; Serro, A P; Saramago, B; Gibson, I R; Santos, J D

    2001-12-01

    Multilayered plasma sprayed coatings on the surface of Ti-6Al-4V alloys have been prepared, which were composed of an underlayer of HA and a surface layer of a CaO-P2O5 glass-HA composite, with 2 or 4wt% of glass. Contact angle and surface tension variation with time, for both water and a protein solution, were determined by the sessile and pendent drop methods respectively using the ADSA-P software. Wettability studies showed that hydrophobicity of the coatings increase with the glass addition. The work of adhesion of albumin was also altered in a controlled manner by the addition of the CaO-P2O5 glass, being lower on the composite coatings than on HA. Zeta potential (ZP) results showed that composite coatings presented a higher net negative charge than HA coatings and that ZP values were also influenced by the content of the glass. This study demonstrated that the surface properties of those coatings may be modified by the addition of CaO-P2O5 glass.

  1. Uus kunst vanadesse kirikutesse : Kölni Püha Peetruse jesuiidikirik : Ruhri katel / Friedhelm Mennekes ; tõlk. Heli Meisterson

    Index Scriptorium Estoniae

    Mennekes, Friedhelm

    2007-01-01

    Jesuiidikirikule kuuluvast Peter Paul Rubensi maalist "Peetruse ristilöömine" (1638), kunstist kirikus, kunstijaamas eksponeeritud tööde autoreid, kunsti ja kiriku suhtest, endast, huvist kaasaegse kunsti vastu. Reet Varblane Kölni Püha Peetruse jesuiidikiriku õpetajast, kunstijaama initsiaatorist Friedhelm Mennekesest ja kiriku kunstijaamast

  2. Kes andis Pirita kloostrile nime? : Püha Birgitta võis saada nägemusi oma langetõve tõttu / Virkko Lepassalu

    Index Scriptorium Estoniae

    Lepassalu, Virkko, 1971-

    2013-01-01

    Pirita klooster sai nime pühakuks kuulutatud Birgitta Birgersdotteri järgi, kes oli prohvet ja müstik. Püha Birgitta ilmutused levisid käsikirjade ja trükistena kogu keskaegses Euroopas ning mõjutasid ka kujutavat kunsti

  3. HemX is required for production of 2-ketogluconate, the predominant organic anion required for inorganic phosphate solubilization by Burkholderia sp. Ha185.

    Science.gov (United States)

    Hsu, Pei-Chun Lisa; Condron, Leo; O'Callaghan, Maureen; Hurst, Mark R H

    2015-12-01

    The bacterium Burkholderia sp. Ha185 readily solubilizes inorganic phosphate by releasing the low molecular weight organic anion, 2-ketogluconate. Using random transposon mutagenesis and in silico analysis, a mutation that caused almost complete abolition of phosphate solubilization was located within hemX, which is part of the hem operon. Burkholderia sp. Ha185 HemX is a multidomain protein, predicted to encode a bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase, which has not previously been implicated in phosphate solubilization. Complementation of hemX restored the ability of the mutant to solubilize phosphate in both plate and liquid cultures. Based on a combination of organic-anion profiling, quantitative polymerase chain reaction and in silico analyses, hemX was confirmed to be solely responsible for hydroxyapatite solubilization in Burkholderia sp. Ha185. It is proposed that the biosynthesis of a yet to be determined redox cofactor by HemX is the main pathway for generating 2-ketogluconate via a haem-dependent gluconate 2-dehydrogenase in Burkholderia sp. Ha185. © 2015 Society for Applied Microbiology and John Wiley & Sons Ltd.

  4. Teaching and Learning English in Tanzania: Blessing or Curse? A Practical Review of Phan Le Ha's Teaching English as an International Language

    Science.gov (United States)

    Mtallo, Godson Robert

    2015-01-01

    This paper is inspired by the work of Phan Le Ha (2008) in her book titled Teaching English as an International Language: Identity, Resistance, and Negotiation in which she presented the way English language is taught in Vietnam and the emergence of conflicting classes of western-trained Vietnamese teachers of English versus non western trained…

  5. HA/TCP compounding of a porous CaP biomaterial improves bone formation and scaffold degradation--a long-term histological study.

    Science.gov (United States)

    Schopper, Christian; Ziya-Ghazvini, Farzad; Goriwoda, Walter; Moser, Doris; Wanschitz, Felix; Spassova, Else; Lagogiannis, Georgios; Auterith, Alexandra; Ewers, Rolf

    2005-07-01

    In the present study, two biphasic calcium phosphate biomaterials (BCP) with HA/TCP ratios of 50/50 and 30/70 were obtained from a pure HA biomaterial. The biomaterials which showed the same three-dimensional geometry were implanted into corticocancellous costal defects of sheep. In the specimens of all three biomaterials, abundant bone formation, mineral dissolution from the biomaterial scaffolds, and active cellular resorption of the scaffolds was present after 6 and 12 months. Backscattered electron microscopy showed bone invasion into the pores of the scaffolds and micromechanical interlocking at the bone/biomaterial interface without intervening soft tissue. The pattern of bone formation and scaffold resorption was different for cortical and cancellous bone. No time-based effect, however, was observed. Overall, the BCP biomaterials had formed significantly more bone than the HA biomaterial. Also, scaffold resorption, which was followed by a replacement with newly formed bone, was significantly higher in the BCP biomaterials. Although no significant differences were observed between both BCP biomaterials, the present study had confirmed the assumption that HA/TCP compounding was suitable to improve bone formation and scaffold resorption in the investigated biomaterials and at the same time maintain the osteoconductive properties of the scaffolds. Copyright 2005 Wiley Periodicals, Inc.

  6. Hoopoes, cuckoos and birds of prey: the authorship of Sophocles, Fr. 581 R. (Arist., HA 633a 17-28 (Tereus

    Directory of Open Access Journals (Sweden)

    Miryam Librán Moreno

    2015-12-01

    Full Text Available Some mythographical and ornithological details in S., Fr. 581 R. (Tereus’ metamorphosis into both a hoopoe and a hawk; Itys’ transformation into a raptor, preserved by Aristotle, HA 633a17-28, are not compatible with what can be known of Sophocles’ Tereus. Such a discrepance casts doubts on the Sophoclean authorship of the fragment.

  7. Mesenchymal Stem Cells and Platelet Gel Improve Bone Deposition within CAD-CAM Custom-Made Ceramic HA Scaffolds for Condyle Substitution

    Directory of Open Access Journals (Sweden)

    L. Ciocca

    2013-01-01

    Full Text Available Purpose. This study evaluated the efficacy of a regenerative approach using mesenchymal stem cells (MSCs and CAD-CAM customized pure and porous hydroxyapatite (HA scaffolds to replace the temporomandibular joint (TMJ condyle. Methods. Pure HA scaffolds with a 70% total porosity volume were prototyped using CAD-CAM technology to replace the two temporomandibular condyles (left and right of the same animal. MSCs were derived from the aspirated iliac crest bone marrow, and platelets were obtained from the venous blood of the sheep. Custom-made surgical guides were created by direct metal laser sintering and were used to export the virtual planning of the bone cut lines into the surgical environment. Sheep were sacrificed 4 months postoperatively. The HA scaffolds were explanted, histological specimens were prepared, and histomorphometric analysis was performed. Results. Analysis of the porosity reduction for apposition of newly formed bone showed a statistically significant difference in bone formation between condyles loaded with MSC and condyles without (P<0.05. The bone ingrowth (BI relative values of split-mouth comparison (right versus left side showed a significant difference between condyles with and without MSCs (P<0.05. Analysis of the test and control sides in the same animal using a split-mouth study design was performed; the condyle with MSCs showed greater bone formation. Conclusion. The split-mouth design confirmed an increment of bone regeneration into the HA scaffold of up to 797% upon application of MSCs.

  8. Rhodomyrtus tomentosa Leaf Extract Inhibits Methicillin-Resistant Staphylococcus aureus Adhesion, Invasion, and Intracellular Survival in Human HaCaT Keratinocytes.

    Science.gov (United States)

    Srisuwan, Sutthirat; Voravuthikunchai, Supayang Piyawan

    2017-12-01

    Methicillin-resistant Staphylococcus aureus (MRSA) has an ability to invade nonprofessional phagocytic cells, resulting in persistent infections and most likely host cell death. Series of our studies have claimed pronounced antibacterial efficacy of Rhodomyrtus tomentosa leaf extract. This study was to further investigate potency of the extract in intracellular killing of human HaCaT keratinocytes. Pretreatment of MRSA with the extract resulted in a remarkable reduction in the bacterial adhesion to HaCaT keratinocytes, compared with untreated control (p extract exhibited strong antibacterial activity against intracellular MRSA at nontoxic concentrations (128 mg/L), which may have resulted from the increase in bactericidal activity under phagolysosomal pH. Transmission electron microscopy displayed the effects of the extract on alterations in the bacterial cell morphology with cell lysis. Fluorescence microscopy revealed that the extract decreased MRSA-induced apoptosis in HaCaT cells. In addition, cytotoxicity of HaCaT cells caused by MRSA supernatant was reduced at least 50% by the extract. The potential activities of R. tomentosa extract may be useful in an alternative treatment of MRSA infections in slight acidic compartments, particularly skin infections.

  9. The hot deformation behavior and microstructure evolution of HA/Mg-3Zn-0.8Zr composites for biomedical application.

    Science.gov (United States)

    Liu, Debao; Liu, Yichi; Zhao, Yue; Huang, Y; Chen, Minfang

    2017-08-01

    The hot deformation behavior of nano-sized hydroxylapatite (HA) reinforced Mg-3Zn-0.8Zr composites were performed by means of Gleeble-1500D thermal simulation machine in a temperature range of 523-673K and a strain rate range of 0.001-1s-1, and the microstructure evolution during hot compression deformation were also investigated. The results show that the flow stress increases increasing strain rates at a constant temperature, and decreases with increasing deforming temperatures at a constant strain rate. Under the same processing conditions, the flow stresses of the 1HA/Mg-3Zn-0.8Zr specimens are higher than those of the Mg-3Zn-0.8Zr alloy specimens, and the difference is getting closer with increasing deformation temperature. The hot deformation behaviors of Mg-3Zn-0.8Zr and 1HA/Mg-3Zn-0.8Zr can be described by constitutive equation of hyperbolic sine function with the hot deformation activation energy being 124.6kJ/mol and 125.3kJ/mol, respectively. Comparing with Mg-3Zn-0.8Zr alloy, the instability region in the process map of 1HA/Mg-3Zn-0.8Zr expanded to a bigger extent at the same conditions. The optimum process conditions of 1HA/Mg-3Zn-0.8Zr composite is concluded as between the temperature window of 573-623K with a strain rate range of 0.001-0.1s-1. A higher volume fraction and smaller grain size of dynamic recrystallization (DRX) grains was observed in 1HA/Mg-3Zn-0.8Zr specimens after the hot compression deformation compared with Mg-3Zn-0.8Zr alloy, which was ascribed to the presence of the HA particles that play an important role in particle-stimulated nucleation (PSN) mechanism and can effectively hinder the migration of interfaces. Copyright © 2017 Elsevier B.V. All rights reserved.

  10. Differential effects of miR-34c-3p and miR-34c-5p on SiHa cells proliferation apoptosis, migration and invasion

    Energy Technology Data Exchange (ETDEWEB)

    Lopez, Jesus Adrian [Laboratorio de Terapia Genica, Departamento de Genetica y Biologia Molecular, CINVESTAV, Av. IPN 2508, Mexico 07360 D.F. (Mexico); Alvarez-Salas, Luis Marat, E-mail: lalvarez@cinvestav.mx [Laboratorio de Terapia Genica, Departamento de Genetica y Biologia Molecular, CINVESTAV, Av. IPN 2508, Mexico 07360 D.F. (Mexico)

    2011-06-10

    Highlights: {yields} In this study we examine miR-34c-3p and miR-34c-5p functions in SiHa cells. {yields} We study miRNA effect on cell proliferation, anchorage independent growth, apoptosis, cell motility and invasion. {yields} We find that miR-34c-3p and miR-34c-5p inhibition of proliferation and anchorage independent growth are exclusive to SiHa cells. {yields} miR-34c-3p induces apoptosis and inhibits cell motility and invasion in SiHa cells. {yields} In this study we conclude that miR-34c-3p functions as a tumor suppressor differ from miR-34c-5p. -- Abstract: MicroRNAs (miRNA) regulate expression of several genes associated with human cancer. Here, we analyzed the function of miR-34c, an effector of p53, in cervical carcinoma cells. Expression of either miR-34c-3p or miR-34c-5p mimics caused inhibition of cell proliferation in the HPV-containing SiHa cells but not in other cervical cells irrespective of tumorigenicity and HPV content. These results suggest that SiHa cells may lack of regulatory mechanisms for miR-34c. Monolayer proliferation results showed that miR-34c-3p produced a more pronounced inhibitory effect although both miRNAs caused inhibition of anchorage independent growth at similar extent. However, ectopic expression of pre-miR-34c-3p, but not pre-miR-34c-5p, caused S-phase arrest in SiHa cells triggering a strong dose-dependent apoptosis. A significant inhibition was observed only for miR-34c-3p on SiHa cells migration and invasion, therefore implying alternative regulatory pathways and targets. These results suggest differential tumor suppressor roles for miR-34c-3p and miR-34c-5p and provide new insights in the understanding of miRNA biology.

  11. Formation mechanism, degradation behavior, and cytocompatibility of a nanorod-shaped HA and pore-sealed MgO bilayer coating on magnesium.

    Science.gov (United States)

    Li, Bo; Han, Yong; Qi, Kai

    2014-10-22

    A novel bilayer coating (HT24h) was fabricated on magnesium using microarc oxidation (MAO) and hydrothermal treatment (HT). The coating comprises an outer layer of narrow interrod spaced hydroxyapatite (HA) nanorods and an inner layer of MgO containing Mg(OH)2/HA-sealing-pores. The hydrothermal formation mechanism of HA nanorods on MAO-formed MgO was explored. Also, evolution of structure and bonding integrity of HT24h coating with immersion in physiological saline (PS) for 0-90 days, corrosion resistance and cytocompatibility of the coating were investigated, together with MgO containing Mg(OH)2-sealing-pores (HT2h) and porous MgO (MAO) coatings. Corrosion resistance was identified by three-point bending and electrochemical tests in PS, while cytocompatibility was determined by MTT, live/dead staining, and vinculin-actin-nucleus tricolor staining assays of hFOB1.19 cells. Immersion tests indicate that cracking rather than delamination is a common feature in most areas of the coatings up to day 90 and degradation is the reason for thinning in thickness of the coatings. MAO and HT2h coatings exhibit a significant thinning due to fast degradation of MgO. However, HT24h coating shows a quite small thinning, owing to the fact that the HA nanorods underwent quite slow degradation while the underlying MgO only underwent conversion to Mg(OH)2 without dissolution of the Mg(OH)2. Scratch tests reveal that HT24h coating still retains relatively high bonding integrity, although the failure position changes from the MgO interior to a point between the HA and MgO layers after 90 days of immersion. HT24h coating appears far more effective than MAO and HT2h coatings in reducing degradation and maintaining the mechanical integrity of Mg, as well as enhancing the mitochondrial activity, adhesion, and proliferation of osteoblasts.

  12. Progesterone augments epirubicin-induced apoptosis in HA22T/VGH cells by increasing oxidative stress and upregulating Fas/FasL.

    Science.gov (United States)

    Chang, Wen-Tsan; Hsieh, Bau-Shan; Cheng, Hsiao-Ling; Lee, King-Teh; Chang, Kee-Lung

    2014-05-15

    Although epirubicin, an anthracycline drug, is widely used to treat hepatocellular carcinoma, its therapeutic efficacy is disappointing. Thus, the efficacy of epirubicin may be improved when combined with other drugs. This study investigated the therapeutic potential of combination of progesterone and epirubicin in the treatment of the human hepatoma cell line HA22T/VGH and the possible mechanisms through which this combination might induce apoptosis. HA22T/VGH cells were treated without or with 25 μM progesterone and/or 0.5 μM epirubicin and analyzed for oxidative stress, redox status, Fas/FasL expression, caspase activity, and apoptosis. HA22T/VGH cells treated with epirubicin increased the production of reactive oxygen species and nitric oxide, the expression of Fas, FasL, and Fas-associated death domain, and the activities of caspase-8 and caspase-3. Epirubicin treatment also decreased glutathione resulting in the induction of apoptosis. Treatment with progesterone alone increased nitric oxide production, but it did not affect the other parameters. However, when HA22T/VGH cells were treated with progesterone and epirubicin, the effects of epirubicin were enhanced. Our observations suggest that progesterone enhances the efficacy of epirubicin. The increased efficacy is potentially attributed to progesterone's enhancement of epirubicin-induced oxidative stress, thereby reducing redox status. In addition, progesterone sequentially upregulates Fas/FasL to induce the caspase-8 and caspase-3 pathways, thereby resulting in increased apoptosis. The combination had a greater effect on the induction of HA22T/VGH cell apoptosis and could potentially serve as a more effective treatment for hepatocellular carcinoma than epirubicin alone. Copyright © 2014 Elsevier Inc. All rights reserved.

  13. Citric acid induces cell-cycle arrest and apoptosis of human immortalized keratinocyte cell line (HaCaT) via caspase- and mitochondrial-dependent signaling pathways.

    Science.gov (United States)

    Ying, Tsung-Ho; Chen, Chia-Wei; Hsiao, Yu-Ping; Hung, Sung-Jen; Chung, Jing-Gung; Yang, Jen-Hung

    2013-10-01

    Citric acid is an alpha-hydroxyacid (AHA) widely used in cosmetic dermatology and skincare products. However, there is concern regarding its safety for the skin. In this study, we investigated the cytotoxic effects of citric acid on the human keratinocyte cell line HaCaT. HaCaT cells were treated with citric acid at 2.5-12.5 mM for different time periods. Cell-cycle arrest and apoptosis were investigated by 4,6-diamidino-2-phenylindole dihydrochloride (DAPI) staining, flow cytometry, western blot and confocal microscopy. Citric acid not only inhibited proliferation of HaCaT cells in a dose-dependent manner, but also induced apoptosis and cell cycle-arrest at the G2/M phase (before 24 h) and S phase (after 24 h). Citric acid increased the level of Bcl-2-associated X protein (BAX) and reduced the levels of B-cell lymphoma-2 (BCL-2), B-cell lymphoma-extra large (BCL-XL) and activated caspase-9 and caspase-3, which subsequently induced apoptosis via caspase-dependent and caspase-independent pathways. Citric acid also activated death receptors and increased the levels of caspase-8, activated BH3 interacting-domain death agonist (BID) protein, Apoptosis-inducing factor (AIF), and Endonuclease G (EndoG). Therefore, citric acid induces apoptosis through the mitochondrial pathway in the human keratinocyte cell line HaCaT. The study results suggest that citric acid is cytotoxic to HaCaT cells via induction of apoptosis and cell-cycle arrest in vitro.

  14. The reliability of DIVA test based on M2e peptide exceed those based on HA2 or NS1 peptides

    Directory of Open Access Journals (Sweden)

    Simson Tarigan

    2015-06-01

    Full Text Available One of the most important disadvantage of vaccination against avian influenza is that it cannot protect vaccinated birds against infection. When vaccinated poultry are heavily exposed to the virus, prolonged, unrecognised, subclinical infection may persist on the farm. The condition can only be serologically monitored by a DIVA (differentiation of infected from vaccinated animals test, whereas conventional diagnostic tests cannot be used. The DIVA tests based on an antibody response following virus replication is the most appropriate approach. For H5N1 influenza such antibodies includes those to the M2e and NS1 proteins and an epitope on the HA2 subunit (HA_488-516. The purpose of this study was to compare the magnitude of the antibody response in chickens vaccinated and infected with an H5N1 virus strain. For that purpose, sera collected from naïve, vaccinated and infected birds, at 1, 2-3, ≥4 weeks post challenge were used. Antibodies were measured by ELISA using biotinylated synthetic peptides as coating antigens. The peptides used include four NS1 peptides corresponding to different regions of the NS1 protein and HA_488-516and M2e peptides. Peptides were coated onto microtitre plates either directly or via a streptavidin bridge. The results showed that vaccination did not cause antibody conversion to any of the peptides, where as challenged birds developed a high antibody response to M2e but, low response to the NS1 and HA2 peptides. Antibodies to the later peptides were detected only by the streptavidin-peptide ELISA. The ELISA based on NS1 or HA_488-516 peptides, therefore, are not reliable for use as DIVA test in H5N1 avian influenza virus infection

  15. Intranasal vaccination of recombinant H5N1 HA1 proteins fused with foldon and Fc induces strong mucosal immune responses with neutralizing activity: Implication for developing novel mucosal influenza vaccines.

    Science.gov (United States)

    Yu, Fei; Li, Ye; Guo, Yan; Wang, Lili; Yang, Jie; Zhao, Guangyu; Zhou, Yusen; Du, Lanying; Jiang, Shibo

    2015-01-01

    The highly pathogenic avian influenza (HPAI) H5N1 virus remains a threat to public health because of its continued spread in poultry in some countries and its ability to infect humans with high mortality rate, calling for the development of effective and safe vaccines against H5N1 infection. Here, we constructed 4 candidate vaccines by fusing H5N1 hemagglutinin 1 (HA1) with foldon (HA1-Fd), human IgG Fc (HA1-Fc), foldon and Fc (HA1-FdFc) or His-tag (HA1-His). We then compared their ability to induce mucosal immune responses and neutralizing antibodies in the presence or absence of Poly(I:C) and CpG adjuvants via the intranasal route. Without an adjuvant, HA1-FdFc could elicit appreciable humoral immune responses and local mucosal IgA antibodies in immunized mice, while other vaccine candidates only induced background immune responses. In the presence of Poly(I:C) and CpG, both HA1-Fd and HA1-Fc elicited much higher levels of serum IgG and local mucosal IgA antibodies than HA1-His. Poly(I:C) and CpG could also augment the neutralizing antibody responses induced by these 4 vaccine candidates in the order of HA1-FdFc > HA1-Fc > HA1-Fd > HA1-His. These results suggest that both Fd and Fc potentiate the immunogenicity of the recombinant HA1 protein and that Poly(I:C) and CpG serve as efficient mucosal adjuvants in promoting efficacy of these vaccine candidates to induce strong systemic and local antibody responses and potent neutralizing antibodies, providing a useful strategy to develop effective and safe mucosal H5N1 vaccines.

  16. Moto-cine en Madrid – Barajas

    Directory of Open Access Journals (Sweden)

    Chueca Goitia, Fernando

    1959-05-01

    Full Text Available Madrid, después de Roma, ha sido la segunda capital de Europa que ha construido y puesto en funcionamiento un motocine, es decir, un cine para automóviles, con arreglo a los últimos adelantos que este tipo de espectáculos ha llegado a alcanzar.

  17. ¿Ha muerto el punk? : análisis de videoclips, letras y música del punk internacional de ayer y de hoy

    OpenAIRE

    Morón Vilches, Alex

    2016-01-01

    El treball pretén demostrar la hipòtesi que el moviment punk tal i com es va concebre en els seus inicis i en el seu moment de màxima expansió, ja pràcticament no existeix. S'ha passat de l'àmbit underground al comercial per l'assimilació gairebé total del gènere musical dins la cultura de masses. A través d'un meticulós estudi de videoclips, lletres i música de bandes d'ahir i d'avui es vol provar que el que era rebel i antiautoritari per definició s'ha tornat dòcil i passiu. El trabajo p...

  18. Cytotoxic agents for KB and SiHa cells from n-hexane fraction of Cissampelos pareira and its chemical composition.

    Science.gov (United States)

    Bala, Manju; Pratap, Kunal; Verma, Praveen Kumar; Padwad, Yogendra; Singh, Bikram

    2015-01-01

    Eleven constituents were characterised by gas chromatography-mass spectrometry analysis, and five molecules were isolated using column chromatography. The in vitro study of the extract and isolated molecules against KB and SiHa cell lines revealed oleanolic acid (1) and oleic acid (2) as potent cytotoxic molecules with potential anticancer activity. The IC50 values of n-hexane extract (CPHF), oleanolic acid (1) and oleic acid (2) were >300, 56.08 and 70.7 μg/mL (μM), respectively, against KB cell lines and >300, 47.24 and 80.2 μg/mL (μM), respectively, against SiHa cell lines.

  19. Supporting Timely Humanitarian Assistance/Disaster Relief (HA/DR) Decisions Through Geospatial Intelligence (GEOINT) and Geographical Information Systems (GIS) Tools

    Science.gov (United States)

    2014-05-22

    following an earthquake. Third, the African Tectonic Plate meets the Arabian Tectonic Plate 160 kilometers south of the city making the city...Logistics require a holistic view from the start of the disaster because HA/DR focuses on the movement of people and resources. Natural disasters often... movement by displaced persons overwhelms any undamaged transportation nodes and routes. Natural byproducts of the disruption and damage, fleeing

  20. Fabrication and characterization of highly porous barium titanate based scaffold coated by Gel/HA nanocomposite with high piezoelectric coefficient for bone tissue engineering applications.

    Science.gov (United States)

    Ehterami, Arian; Kazemi, Mansure; Nazari, Bahareh; Saraeian, Payam; Azami, Mahmoud

    2018-03-01

    It is well established that the piezoelectric effect plays an important physiological role in bone growth, remodeling and fracture healing. Barium titanate, as a well-known piezoelectric ceramic, is especially an attractive material as a scaffold for bone tissue engineering applications. In this regard, we tried to fabricate a highly porous barium titanate based scaffolds by foam replication method and polarize them by applying an external electric field. In order to enhance the mechanical and biological properties, polarized/non-polarized scaffolds were coated with gelatin and nanostructured HA and characterized for their morphologies, porosities, piezoelectric and mechanical properties. The results showed that the compressive strength and piezoelectric coefficient of porous scaffolds increased with the increase of sintering temperature. After being coated with Gel/HA nanocomposite, the interconnected porous structure and pore size of the scaffolds almost remain unchanged while the Gel/nHA-coated scaffolds exhibited enhanced compressive strength and elastic modulus compared with the uncoated samples. Also, the effect of polarizing and coating of optimal scaffolds on adhesion, viability, and proliferation of the MG63 osteoblast-like cell line was evaluated by scanning electron microscope (SEM) and MTT assay. The cell culture experiments revealed that developed scaffolds had good biocompatibility and cells were able to adhere, proliferate and migrate into pores of the scaffolds. Furthermore, cell density was significantly higher in the coated scaffolds at all tested time-points. These results indicated that highly porous barium titanate scaffolds coated with Gel/HA nanocomposite has great potential in tissue engineering applications for bone tissue repair and regeneration. Copyright © 2018 Elsevier Ltd. All rights reserved.

  1. Intranasal immunization with recombinant HA and mast cell activator C48/80 elicits protective immunity against 2009 pandemic H1N1 influenza in mice.

    Directory of Open Access Journals (Sweden)

    Shu Meng

    Full Text Available BACKGROUND: Pandemic influenza represents a major threat to global health. Vaccination is the most economic and effective strategy to control influenza pandemic. Conventional vaccine approach, despite being effective, has a number of major deficiencies including limited range of protection, total dependence on embryonated eggs for production, and time consuming for vaccine production. There is an urgent need to develop novel vaccine strategies to overcome these deficiencies. METHODOLOGY/PRINCIPAL FINDINGS: The major objective of this work was to develop a novel vaccine strategy combining recombinant haemagglutinin (HA protein and a master cell (MC activator C48/80 for intranasal immunization. We demonstrated in BALB/c mice that MC activator C48/80 had strong adjuvant activity when co-administered with recombinant HA protein intranasally. Vaccination with C48/80 significantly increased the serum IgG and mucosal surface IgA antibody responses against HA protein. Such increases correlated with stronger and durable neutralizing antibody activities, offering protection to vaccinated animals from disease progression after challenge with lethal dose of A/California/04/2009 live virus. Furthermore, protected animals demonstrated significant reduction in lung virus titers, minimal structural alteration in lung tissues as well as higher and balanced production of Th1 and Th2 cytokines in the stimulated splenocytes when compared to those without C48/80. CONCLUSIONS/SIGNIFICANCE: The present study demonstrates that the novel vaccine approach of combining recombinant HA and mucosal adjuvant C48/80 is safe and effective in eliciting protective immunity in mice. Future studies on the mechanism of action of C48/80 and potential combination with other vaccine strategies such as prime and boost approach may help to induce even more potent and broad immune responses against viruses from various clades.

  2. En Haïti, la technologie est mise au service de l'efficacité du système ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    7 oct. 2010 ... ... d'approvisionnement s'est accentuée. La distribution de fournitures médicales et de médicaments essentiels au traitement des victimes est devenue à toutes fins utiles impossible. L'absence de dossiers électroniques sur les fournitures arrivant en Haïti n'a fait qu'exacerber le cauchemar logistique que ...

  3. Eficacia de la acupuntura en la espasticidad del paciente que ha padecido un ictus. Revisión sistemática

    Directory of Open Access Journals (Sweden)

    Juan Rodríguez-Mansilla

    2016-04-01

    Conclusión: Aunque se muestran mejoras respecto a la reducción de la espasticidad, la eficacia de la técnica no ha podido demostrarse para esta enfermedad. Son necesarios estudios que calculen el tamaño de los efectos reportados, aplicando procedimientos homogéneos en el diseño así como en la duración, frecuencia e instrumentos de medida utilizados.

  4. Long-term selenium supplementation in HaCaT cells: importance of chemical form for antagonist (protective versus toxic) activities.

    Science.gov (United States)

    Hazane-Puch, Florence; Champelovier, Pierre; Arnaud, Josiane; Garrel, Catherine; Ballester, Bruno; Faure, Patrice; Laporte, François

    2013-08-01

    The beneficial effect of selenium (Se) on cancer is known to depend on the chemical form, the dose and the duration of the supplementation. The aim of this work was to explore long term antagonist (antioxidant versus toxic) effects of an inorganic (sodium selenite, Na2SeO3) and an organic (seleno-L-methionine, SeMet) forms in human immortalized keratinocytes HaCaT cells. HaCaT cells were supplemented with Na2SeO3 or SeMet at micromolar concentrations for 144 h, followed or not by UVA radiation. Se absorption, effects of UVA radiation, cell morphology, antioxidant profile, cell cycle processing, DNA fragmentation, cell death triggered and caspase-3 activity were determined. At non-toxic doses (10 μM SeMet and 1 μM Na2SeO3), SeMet was better absorbed than Na2SeO3. The protection of HaCaT from UVA-induced cell death was observed only with SeMet despite both forms increased glutathione peroxidase-1 (GPX1) activities and selenoprotein-1 (SEPW1) transcript expression. After UVA irradiation, malondialdehyde (MDA) and SH groups were not modulated whatever Se chemical form. At toxic doses (100 μM SeMet and 5 μM Na2SeO3), Na2SeO3 and SeMet inhibited cell proliferation associated with S-G2 blockage and DNA fragmentation leading to apoptosis caspase-3 dependant. SeMet only led to hydrogen peroxide production and to a decrease in mitochondrial transmembrane potential. Our study of the effects of selenium on HaCaT cells reaffirm the necessity to take into account the chemical form in experimental and intervention studies.

  5. Enquête auprès des ménages par suite du séisme en Haïti - besoins ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    En janvier 2010, un tremblement de terre dévastateur a semé la mort et la destruction en Haïti. Des secours d'urgence colossaux ont été organisés et la planification de la reconstruction à long terme des infrastructures est déjà amorcée. On ne dispose actuellement d'aucunes données empiriques sur les besoins des ...

  6. Selenium Polysaccharide SPMP-2a from Pleurotus geesteranus Alleviates H2O2-Induced Oxidative Damage in HaCaT Cells

    Directory of Open Access Journals (Sweden)

    Yujun Sun

    2017-01-01

    Full Text Available Selenium- (Se- enriched polysaccharide SPMP-2a was extracted and purified from Pleurotus geesteranus. SPMP-2a is a white flocculent polysaccharide and soluble in water, with a molecular weight of 3.32 × 104 Da. Fourier transform infrared spectroscopy spectral analysis indicated that it belongs to an acid Se polysaccharide with α-D-glucopyranoside bond. The effects of Se polysaccharide SPMP-2a in P. geesteranus against hydrogen peroxide- (H2O2- induced oxidative damage in human keratinocytes (HaCaT cells were evaluated further. Reduced cell viability and elevated apoptotic rates in H2O2-treated HaCaT cells were proven by MTT and flow cytometry assays. Hoechst 33342 staining revealed chromatin condensations in the nuclei of HaCaT cells. However, with the addition of SPMP-2a, cell viability improved, nuclear condensation declined, and cell apoptotic rates dropped significantly. Ultrastructural observation consistently revealed that treatments with SPMP-2a reduced the number of swollen and vacuolar mitochondria in the H2O2-treated cells compared with the controls. Furthermore, SPMP-2a increased the superoxide dismutase (SOD and catalase (CAT activities and reduced reactive oxygen species (ROS content. Western blot analysis showed that SPMP-2a treatment effectively increased B-cell lymphoma 2 (Bcl-2 protein expression. Therefore, SPMP-2a could improve cellular antioxidant enzyme activities, reduce ROS levels, and increase Bcl-2 protein expression levels, thereby reducing cell apoptosis and protecting HaCaT cells from H2O2-induced oxidative damage.

  7. Risk factors associated with diarrhoeal disease and diarrheagenic E.coli disease in Duc Giang Hospital, north-eastern corner of Ha Noi, Viet Nam

    OpenAIRE

    Nguyen, Dong Tu

    2006-01-01

    Summary Risk factors associated with diarrhoeal disease and diarrheagenic E. coli disease in Duc Giang Hospital, north-eastern corner of Ha Noi, Viet Nam Background: Diarrheagenic E. coli (DEC) disease is more prevalent in infants and children is a very important cause of sporadic diarrhoea cases and diarrhoea outbreaks in many countries. Currently, DEC also stands as a chief causal factor for diarrhoea among travellers. DEC disease is usually transmitted through food or wa...

  8. Suppression of AcMNPV replication by adf and thymosin protein up-regulation in a new testis cell line, Ha-shl-t.

    Science.gov (United States)

    Zhang, Xiaoqian; Chen, Ming; Ma, Xinlei; Zhao, Xiaofan; Wang, Jinxing; Shao, Honglian; Song, Qisheng; Stanley, David

    2013-03-01

    Host cytoskeletons facilitate the entry, replication, and egress of viruses because cytoskeletons are essential for viral survival. One mechanism of resisting viral infections involves regulating cytoskeletal polymerization/depolymerization. However, the molecular mechanisms of regulating these changes in cytoskeleton to suppress viral replication remain unclear. We established a cell line (named Ha-shl-t) from the pupal testis of Helicoverpa armigera (Lepidoptera: Noctuidae). The new testis cell line suppresses Autographa californica multiple nucleocapsid nucleopolyhedrovirus (AcMNPV) replication via disassembly of cytoskeleton. Up-regulation of thymosin (actin disassembling factor) and adf (actin depolymerizing factor) reduces F-actin. Silencing thymosin or adf or treating cells with the F-actin stabilizer phalloidin led to increased AcMNPV replication, while treating cells with an F-actin assembly inhibitor cytochalasin B decreased viral replication. We infer that Ha-shl-t cells utilize F-actin depolymerization to suppress AcMNPV replication by up-regulating thymosin and adf. We propose Ha-shl-t as a model system for investigating cytoskeletal regulation in antiviral action and testicular biology generally. © 2013 Wiley Periodicals, Inc.

  9. Measurement of anti-inflammatory effects of glucocorticoids on human keratinocytes in vitro. Comparison of normal human keratinocytes with the keratinocyte cell line HaCaT.

    Science.gov (United States)

    Stein, M; Bernd, A; Ramirez-Bosca, A; Kippenberger, S; Holzmann, H

    1997-11-01

    There are only few objective in vitro methods available for the testing of anti-inflammatory pharmaceutical products. One possibility is in the stimulation of cytokine production in cultivated human keratinocytes by UV light and the subsequent testing of suppressing activities. From the dermatological aspect the interleukins 6 and 8 are especially interesting because they are elevated in psoriatic skin. In the present work three glucocorticoids were tested in cultures of normal human keratinocytes and in the permanent keratinocyte cell line HaCaT. Both cell species produced IL-6 and IL-8 spontaneously, albeit in very small amounts. After UV irradiation the interleukin production increased in a dose dependent manner. The IL-6 and IL-8 induction could be suppressed by each of the glucocorticoids tested. The thymidine incorporation rate of the cells was not affected by the glucocorticoids indicating that the observed suppression of cytokine induction was not the result of a generalised cell damage. The response of both HaCaT keratinocytes and primary human keratinocytes to UV irradiation and glucocorticoid application was similar indicating the possible use of the generally available HaCaT cells for the pharmacological testing of anti-inflammatory activities in vitro.

  10. The Proteasome Inhibitor MG-132 Protects Hypoxic SiHa Cervical Carcinoma Cells after Cyclic Hypoxia/Reoxygenation from Ionizing Radiation

    Directory of Open Access Journals (Sweden)

    Frank Pajonk

    2006-12-01

    Full Text Available INTRODUCTION: Transient hypoxia and subsequent reoxygenation are common phenomena in solid tumors that greatly influence the outcome of radiation therapy. This study was designed to determine how varying cycles of hypoxia/reoxygenation affect the response of cervical carcinoma cells irradiated under oxic and hypoxic conditions and whether this could be modulated by proteasome inhibition. MATERIALS AND METHODS: Plateau-phase SiHa cervical carcinoma cells in culture were exposed to varying numbers of 30-minute cycles of hypoxia/reoxygenation directly before irradiation under oxic or hypoxic conditions. 26S Proteasome activity was blocked by addition of MG-132. Clonogenic survival was measured by a colonyforming assay. RESULTS: Under oxic conditions, repeated cycles of hypoxia/reoxygenation decreased the clonogenic survival of SiHa cells. This effect was even more pronounced after the inhibition of 26S proteasome complex. In contrast, under hypoxic conditions, SiHa cells were radioresistant, as expected, but this was increased by proteasome inhibition. CONCLUSIONS: Proteasome inhibition radiosensitizes oxygenated tumor cells but may also protect tumor cells from ionizing radiation under certain hypoxic conditions.

  11. Demethoxycurcumin in combination with ultraviolet radiation B induces apoptosis through the mitochondrial pathway and caspase activation in A431 and HaCaT cells.

    Science.gov (United States)

    Xin, Yong; Huang, Qian; Zhang, Pei; Guo, Wen Wen; Zhang, Long Zhen; Jiang, Guan

    2017-06-01

    Photodynamic therapy is widely used in the clinical treatment of tumors, especially skin cancers. It has been reported that the photosensitizer curcumin, in combination with ultraviolet radiation B, induces HaCaT cell apoptosis, and this effect may be due to the activation of caspase pathways. In this study, we examined the photodynamic effects of demethoxycurcumin, a more stable analogue of curcumin, to determine whether it could induce apoptosis in skin cancer cells. We investigated the effects of a combination of ultraviolet radiation B and demethoxycurcumin on apoptotic cell death in A431 and HaCaT cells and determined the molecular mechanism of action. Our results showed increased apoptosis with a combination of ultraviolet radiation B with demethoxycurcumin, as compared to ultraviolet radiation B or demethoxycurcumin alone. The combination of ultraviolet radiation B irradiation with demethoxycurcumin synergistically induced apoptotic cell death in A431 and HaCaT cells through activation of p53 and caspase pathways, as well as through upregulation of Bax and p-p65 expression and downregulation of Bcl-2, Mcl-1, and nuclear factor-κB expression. In addition, we found that reactive oxygen species significantly increased with treatment, and mitochondrial membrane potential depolarization was remarkably enhanced. In conclusion, our data indicate that demethoxycurcumin may be a promising photosensitizer for use in photodynamic therapy to induce apoptosis in skin cancer cells.

  12. Evaluation of Lagergren Kinetics Equation by Using Novel Kinetics Expression of Sorption of Zn2+ onto Horse Dung Humic Acid (HD-HA

    Directory of Open Access Journals (Sweden)

    Bambang Rusdiarso

    2016-12-01

    Full Text Available Extraction and purification of humic acid from dry horse dung powder (HD-HA was performed successfully and the purified HD-HA was then applied as sorbent to adsorb Zn2+. Extraction and purification were performed based on procedure of Stevenson (1994 under atmospheric air. Parameters investigated in this work consist of effect of medium sorption acidity, sorption rate (ka and desorption rate constant (kd, Langmuir (monolayer and Freundlich (multilayer sorption capacities, and energy (E of sorption. The ka and kd were determined according to the kinetic model of second order sorption reaching equilibrium, monolayer sorption capacity (b and energy (E were determined according to Langmuir isotherm model, and multilayer sorption capacity (B was determined based on Freundlich isotherm model. Sorption of Zn2+ on purified HD-HA was maximum at pH 5.0. The novel kinetic expression resulted from proposed kinetic model has been shown to be more applicable than the commonly known Lagergren equation obtained from the pseudo-first order sorption model. The application of the equation revealed that the intercept of Lagergren equation, ln qe was more complex function of initial concentration of Zn2+ (a, Langmuir sorption capacity (b, and sorbed Zn2+ at equilibrium (xe.

  13. A cerato-platanin-like protein HaCPL2 from Heterobasidion annosum sensu stricto induces cell death in Nicotiana tabacum and Pinus sylvestris.

    Science.gov (United States)

    Chen, Hongxin; Quintana, Julia; Kovalchuk, Andriy; Ubhayasekera, Wimal; Asiegbu, Fred O

    2015-11-01

    The cerato-platanin family is a group of small secreted cysteine-rich proteins exclusive for filamentous fungi. They have been shown to be involved in the interactions between fungi and plants. Functional characterization of members from this family has been performed mainly in Ascomycota, except Moniliophthora perniciosa. Our previous phylogenetic analysis revealed that recent gene duplication of cerato-platanins has occurred in Basidiomycota but not in Ascomycota, suggesting higher functional diversification of this protein family in Basidiomycota than in Ascomycota. In this study, we identified three cerato-platanin homologues from the basidiomycete conifer pathogen Heterobasidion annosum sensu stricto. Expression of the homologues under various conditions as well as their roles in the H. annosum s.s.-Pinus sylvestris (Scots pine) pathosystem was investigated. Results showed that HaCPL2 (cerato-platanin-like protein 2) had the highest sequence similarity to cerato-platanin from Ceratocystis platani and hacpl2 was significantly induced during nutrient starvation and necrotrophic growth. The treatment with recombinant HaCPL2 induced cell death, phytoalexin production and defense gene expression in Nicotiana tabacum. Eliciting and cell death-inducing ability accompanied by retardation of apical root growth was also demonstrated in Scots pine seedlings. Our results suggest that HaCPL2 might contribute to the virulence of H. annosum s.s. by promoting plant cell death. Copyright © 2015 Elsevier Inc. All rights reserved.

  14. Hyaluronan viscosupplementation: state of the art and insight into the novel cooperative hybrid complexes based on high and low molecular weight HA of potential interest in osteoarthritis treatment.

    Science.gov (United States)

    Schiraldi, Chiara; Stellavato, Antonietta; de Novellis, Francesca; La Gatta, Annalisa; De Rosa, Mario

    2016-01-01

    Osteoarthritis (OA) represents a group of chronic, painful, disabling conditions affecting synovial joints. It is characterized by degeneration of articular cartilage, alterations of peri-articular and subchondral bone, low-grade synovial inflammation (synovitis). Despite OA is commonly described as a non-inflammatory disease, it is known that its progression and the subsequent increment of symptoms correlate to the production of inflammatory factors that induce the secretion of enzymes responsible for cartilage degradation. In clinical practice, to alleviate pain and stiffness, not only during acute phases but also as maintenance therapy, intra-articular injections of corticosteroids or similar drugs are used, besides it is well diffused the viscosupplementation procedure based on hyaluronan gel. There are many different products containing high molecular weight linear HA or cross-linked derivatives, however the novelty in the field consist in the hybrid cooperative complexes derived from high and low molecular weight HA through a patented processing. This technique permit to double the amount of HA delivered to the injured site without increasing the injected volume, beside in vitro assay on human chondrocytes suggested hybrid complexes as effective in the modulation of several inflammatory cytokines in joints.

  15. Optimization of influenza A vaccine virus by reverse genetic using chimeric HA and NA genes with an extended PR8 backbone.

    Science.gov (United States)

    Medina, Julie; Boukhebza, Houda; De Saint Jean, Amélie; Sodoyer, Régis; Legastelois, Isabelle; Moste, Catherine

    2015-08-20

    The yield of influenza antigen production may significantly vary between vaccine strains; for example the A/California/07/09 (H1N1)-X179A vaccine virus, prepared during 2009 influenza pandemic, presented a low antigen yield in eggs compared to other seasonal H1N1 reassortants. In this study a bi-chimeric virus expressing HA and NA genes with A/Puerto Rico/8/34 (H1N1) (PR8) and X179A domains was rescued by reverse genetics using a mixture of Vero/CHOK1 cell lines (Medina et al. [7]). The bi-chimeric virus obtained demonstrated to yield much larger amounts of HA than X179A in eggs as measured by single-radial-immunodiffusion (SRID), the reference method to quantify HA protein in influenza vaccine. Such kind of optimized virus using PR8 backbone derived chimeric glycoproteins could be used as improved seed viruses for vaccine production. Copyright © 2015 Elsevier Ltd. All rights reserved.

  16. Study of the Higgs boson discovery potential in the process $pp \\to H/A \\to \\mu^+\\mu^-/\\tau^+\\tau^-$ with the ATLAS detector

    CERN Document Server

    Dedes, Georgios

    2008-01-01

    In this thesis, the discovery potential of the ATLAS experiment at the Large Hadron Collider (LHC) at CERN for the heavy neutral Higgs bosons H/A of the Min- imal Supersymmetric extension of the Standard Model of particle physics (MSSM) in the decay channels H/A → τ + τ − → e/μ + X and H/A → μ+ μ− has been studied. The ATLAS detector is designed to study the full spectrum of the physics phenomena occuring in the proton-proton collisions at 14 TeV center-of-mass energy and to provide answers to the question of the origin of particle masses and of elec- troweak symmetry breaking. For the studies, the ATLAS muon spectrometer plays an important role. The spectrometer allows for a precise muon momentum measure- ment independently of other ATLAS subdetectors. The performance of the muon spectrometer depends strongly on the performance of the muon tracking detectors, the Monitored Drift Tube Chambers (MDT). Computer programs have been developed in order to test and verify the ATLAS muon spectrometer s...

  17. When top-down becomes bottom up: behaviour of hyperdense howler monkeys (Alouatta seniculus trapped on a 0.6 ha island.

    Directory of Open Access Journals (Sweden)

    Gabriela Orihuela

    Full Text Available Predators are a ubiquitous presence in most natural environments. Opportunities to contrast the behaviour of a species in the presence and absence of predators are thus rare. Here we report on the behaviour of howler monkey groups living under radically different conditions on two land-bridge islands in Lago Guri, Venezuela. One group of 6 adults inhabited a 190-ha island (Danto where they were exposed to multiple potential predators. This group, the control, occupied a home range of 23 ha and contested access to food resources with neighbouring groups in typical fashion. The second group, containing 6 adults, was isolated on a remote, predator-free 0.6 ha islet (Iguana offering limited food resources. Howlers living on the large island moved, fed and rested in a coherent group, frequently engaged in affiliative activities, rarely displayed agonistic behaviour and maintained intergroup spacing through howling. In contrast, the howlers on Iguana showed repulsion, as individuals spent most of their time spaced widely around the perimeter of the island. Iguana howlers rarely engaged in affiliative behaviour, often chased or fought with one another and were not observed to howl. These behaviors are interpreted as adjustments to the unrelenting deprivation associated with bottom-up limitation in a predator-free environment.

  18. Dioscin Induces Apoptosis in Human Cervical Carcinoma HeLa and SiHa Cells through ROS-Mediated DNA Damage and the Mitochondrial Signaling Pathway.

    Science.gov (United States)

    Zhao, Xinwei; Tao, Xufeng; Xu, Lina; Yin, Lianhong; Qi, Yan; Xu, Youwei; Han, Xu; Peng, Jinyong

    2016-06-04

    Dioscin, a natural product, has activity against glioblastoma multiforme, lung cancer and colon cancer. In this study, the effects of dioscin against human cervical carcinoma HeLa and SiHa cells were further confirmed, and the possible mechanism(s) were investigated. A transmission electron microscopy (TEM) assay and DAPI staining were used to detect the cellular morphology. Flow cytometry was used to assay cell apoptosis, ROS and Ca(2+) levels. Single cell gel electrophoresis and immunofluorescence assays were used to test DNA damage and cytochrome C release. The results showed that dioscin significantly inhibited cell proliferation and caused DNA damage in HeLa and SiHa cells. The mechanistic investigation showed that dioscin caused the release of cytochrome C from mitochondria into the cytosol. In addition, dioscin significantly up-regulated the protein levels of Bak, Bax, Bid, p53, caspase-3, caspase-9, and down-regulated the protein levels of Bcl-2 and Bcl-xl. Our work thus demonstrated that dioscin notably induces apoptosis in HeLa and SiHa cells through adjusting ROS-mediated DNA damage and the mitochondrial signaling pathway.

  19. Sublingual administration of bacteria-expressed influenza virus hemagglutinin 1 (HA1) induces protection against infection with 2009 pandemic H1N1 influenza virus.

    Science.gov (United States)

    Shim, Byoung-Shik; Choi, Jung-Ah; Song, Ho-Hyun; Park, Sung-Moo; Cheon, In Su; Jang, Ji-Eun; Woo, Sun Je; Cho, Chung Hwan; Song, Min-Suk; Kim, Hyemi; Song, Kyung Joo; Lee, Jae Myun; Kim, Suhng Wook; Song, Dae Sub; Choi, Young Ki; Kim, Jae-Ouk; Nguyen, Huan Huu; Kim, Dong Wook; Bahk, Young Yil; Yun, Cheol-Heui; Song, Man Ki

    2013-02-01

    Influenza viruses are respiratory pathogens that continue to pose a significantly high risk of morbidity and mortality of humans worldwide. Vaccination is one of the most effective strategies for minimizing damages by influenza outbreaks. In addition, rapid development and production of efficient vaccine with convenient administration is required in case of influenza pandemic. In this study, we generated recombinant influenza virus hemagglutinin protein 1 (sHA1) of 2009 pandemic influenza virus as a vaccine candidate using a well-established bacterial expression system and administered it into mice via sublingual (s.l.) route. We found that s.l. immunization with the recombinant sHA1 plus cholera toxin (CT) induced mucosal antibodies as well as systemic antibodies including neutralizing Abs and provided complete protection against infection with pandemic influenza virus A/CA/04/09 (H1N1) in mice. Indeed, the protection efficacy was comparable with that induced by intramuscular (i.m.) immunization route utilized as general administration route of influenza vaccine. These results suggest that s.l. vaccination with the recombinant non-glycosylated HA1 protein offers an alternative strategy to control influenza outbreaks including pandemics.

  20. Trifloxystrobin induces tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)-mediated apoptosis in HaCaT, human keratinocyte cells.

    Science.gov (United States)

    Jang, Yoonjeong; Lee, Ah Young; Chang, Seung-Hee; Jeong, Sang-Hee; Park, Kyung-Hun; Paik, Min-Kyoung; Cho, Nam-Joon; Kim, Ji-Eun; Cho, Myung-Haing

    2017-01-01

    As the outermost layer of the body, the skin plays an important role in exposure to pesticides, which could have negative impacts on human health. Trifloxystrobin is a widely used fungicide of the strobilurin class, however, there is little information regarding the skin contact-associated toxic mechanism. Therefore, the present study was performed in order to identify the skin toxicity mechanism of trifloxystrobin using HaCaT (keratinocyte of human skin) cells. Following 24 or 48 h treatment, cell viability, and subsequent Annexin V-FITC/propidium iodide assay, TUNEL assay and Western blotting were performed to investigate the cell death mechanism of trifloxystrobin. Exposure to trifloxystrobin resulted in diminished viability of HaCaT cells in both a time- and concentration-dependent manner. The cell death was derived through apoptotic pathways in the HaCaT cells. Furthermore, we explored the effect of trifloxystrobin on TRAIL-mediated extrinsic apoptosis using siRNA transfection. Knockdown of death receptor 5 suppressed trifloxystrobin-provoked apoptosis. These results indicate that trifloxystrobin induces TRAIL-mediated apoptosis and has an inhibitory effect in keratinocytes that can interfere with the barrier function and integrity of the skin. This could be proposed as a mechanism of skin toxicity by trifloxystrobin and considered in the management of pesticide exposure.

  1. A (H1N1 pdm09 HA D222 variants associated with severity and mortality in patients during a second wave in Mexico

    Directory of Open Access Journals (Sweden)

    Vazquez-Perez Joel A

    2013-01-01

    Full Text Available Abstract Background Pandemic type A (H1N1 influenza arose in early 2009, probably in Mexico and the United States, and reappeared in North America in September for seven more months. An amino acid substitution in the hemagglutinin (HA, D222G, has been reported in a significant proportion of patients with a severe and fatal outcome. We studied the prevalence of HA222 substitutions in patients in Mexico during the second wave and its association with clinical outcome and pathogenicity in a mouse model. Methods The nucleotide sequences of hemagglutinin (HA from viruses collected from 77 patients were determined including 50 severe and fatal cases and 27 ambulatory cases. Deep sequencing was done on 5 samples from severe or fatal cases in order to determine the quasispecies proportion. Weight loss and mortality due to infection with cultured influenza viruses were analyzed in a mouse model. Results Viruses from 14 out of 50 hospitalized patients (28% had a non aspartic acid residue at the HA 222 position (nD222, while all 27 ambulatory patients had D222 (p = 0.0014. G222 was detected as sole species or in coexistence with N222 and D222 in 12 patients with severe disease including 8 who died. N222 in coexistence with D222 was detected in 1 patient who died and co-occurrence of A222 and V222, together with D222, was detected in another patient who died. The patients with a nD222 residue had higher mortality (71.4%, compared to the group with only D222 (22.2%, p = 0.0008. Four of the 14 viruses from hospitalized patients were cultured and intranasally infected into mice. Two viruses with G222 were lethal while a third virus, with G222, caused only mild illness in mice similar to the fourth virus that contained D222. Conclusions We confirm the elevated incidence of HA222 (H1N1pdm09 variants in severe disease and mortality. Both clinical and mouse infection data support the idea that nD222 mutations contribute to increased severity of disease but

  2. PCB153 reduces telomerase activity and telomere length in immortalized human skin keratinocytes (HaCaT) but not in human foreskin keratinocytes (NFK)

    Energy Technology Data Exchange (ETDEWEB)

    Senthilkumar, P.K. [Interdisciplinary Graduate Program in Human Toxicology, The University of Iowa, Iowa City, IA (United States); Robertson, L.W. [Interdisciplinary Graduate Program in Human Toxicology, The University of Iowa, Iowa City, IA (United States); Department of Occupational and Environmental Health, The University of Iowa, Iowa City, IA (United States); Ludewig, G., E-mail: Gabriele-ludewig@uiowa.edu [Interdisciplinary Graduate Program in Human Toxicology, The University of Iowa, Iowa City, IA (United States); Department of Occupational and Environmental Health, The University of Iowa, Iowa City, IA (United States)

    2012-02-15

    Polychlorinated biphenyls (PCBs), ubiquitous environmental pollutants, are characterized by long term-persistence in the environment, bioaccumulation, and biomagnification in the food chain. Exposure to PCBs may cause various diseases, affecting many cellular processes. Deregulation of the telomerase and the telomere complex leads to several biological disorders. We investigated the hypothesis that PCB153 modulates telomerase activity, telomeres and reactive oxygen species resulting in the deregulation of cell growth. Exponentially growing immortal human skin keratinocytes (HaCaT) and normal human foreskin keratinocytes (NFK) were incubated with PCB153 for 48 and 24 days, respectively, and telomerase activity, telomere length, superoxide level, cell growth, and cell cycle distribution were determined. In HaCaT cells exposure to PCB153 significantly reduced telomerase activity, telomere length, cell growth and increased intracellular superoxide levels from day 6 to day 48, suggesting that superoxide may be one of the factors regulating telomerase activity, telomere length and cell growth compared to untreated control cells. Results with NFK cells showed no shortening of telomere length but reduced cell growth and increased superoxide levels in PCB153-treated cells compared to untreated controls. As expected, basal levels of telomerase activity were almost undetectable, which made a quantitative comparison of treated and control groups impossible. The significant down regulation of telomerase activity and reduction of telomere length by PCB153 in HaCaT cells suggest that any cell type with significant telomerase activity, like stem cells, may be at risk of premature telomere shortening with potential adverse health effects for the affected organism. -- Highlights: ► Human immortal (HaCaT) and primary (NFK) keratinocytes were exposed to PCB153. ► PCB153 significantly reduced telomerase activity and telomere length in HaCaT. ► No effect on telomere length and

  3. Evaluation of Bio-Rad D-100 HbA1c analyzer against Tosoh G8 and Menarini HA-8180V.

    Science.gov (United States)

    Maesa, José María; Fernández-Riejos, Patricia; Mora, Catalina Sánchez; de Toro, María; Valladares, Paloma Menéndez; González-Rodriguez, Concepción

    2016-08-01

    To evaluate the Bio-Rad D-100®, an HPLC analyzer for glycated hemoglobin (HbA1c) determination, and to compare its performance with the Menarini HA-8180V® and Sysmex G8®. Method comparison was performed according to Clinical and Laboratory Standards Institute (CLSI) EP9-A2 guidelines. We selected 100 samples from the routine laboratory workload and analyzed them in duplicate with the three analyzers. The imprecision study was performed according to CLSI EP5-A2 guidelines for both inter-assay and intra-assay variability. Bias was assessed with external quality control material. To establish linearity, CLSI EP6-A protocol was followed. Method comparison (95% confidence intervals in parentheses): D-100 vs G8: Passing-Bablok regression; y=0.973(0.963-0.983)×-0.07(-0.07-0.069); r=0.9989. Bland-Altman mean difference: -0.229%HbA1c (-0.256: -0.202); Relative bias plot: D-100/G8 vs D100-G8 mean ratio=0.971(0.967-0.975). D-100 vs HA-8180V: Passing-Bablok regression; y=0.944(0.932-0.958)×-0.078(0.024-0.173); r=0.9989. Bland-Altman mean difference: -0.363%HbA1c (-0.401: -0.325); Relative bias plot D-100/HA-8180V vs D100-HA-8180V mean ratio=0.955(0.952-0.958). Inter-assay coefficient of variation (CV): 0.81%. Intra-assay CV: 1.04% (low level), and 0.78% (high level). Bias against target value=2.332%. Linearity: r2=0.998 in the concentration range 4.4-13.9%HbA1c. Carry-over: 0.0024%. The Bio-Rad D-100 shows good correlation with G8 and HA-8180V. There is a small proportional systematic difference (2.7% and 5.6%, respectively) in both comparisons. Inter and intra-assay CVs are both lower than the lowest CV obtained in studies performed with D-100 and other instruments.

  4. Development and validation of TOF-SIMS and CLSM imaging method for cytotoxicity study of ZnO nanoparticles in HaCaT cells

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Pei-Ling; Chen, Bo-Chia; Gollavelli, Ganesh [Department of Chemistry, National Tsing Hua University, Hsinchu 30013, Taiwan (China); Shen, Sin-Yu [Graduate Institute of Medical Science, Taipei Medical University, Taipei 11031, Taiwan (China); Yin, Yu-Sheng; Lei, Shiu-Ling [Department of Chemistry, National Tsing Hua University, Hsinchu 30013, Taiwan (China); Jhang, Cian-Ling; Lee, Woan-Ruoh [Department of Dermatology, Taipei Medical University, Taipei 11031, Taiwan (China); Ling, Yong-Chien, E-mail: ycling@mx.nthu.edu.tw [Department of Chemistry, National Tsing Hua University, Hsinchu 30013, Taiwan (China); Graduate Institute of Medical Science, Taipei Medical University, Taipei 11031, Taiwan (China)

    2014-07-30

    Highlights: • Assorted material, chemical, and toxicological analysis methods were used to confirm the shape, size, crystalline structure, and aggregation properties of ZnO NPS as well as their dissolution behavior and effect on HaCaT cell viability. • The developed TOF-SIMS and CLSM imaging method for rapid and sensitive study of ZnO NPs in HaCaT cells was validated by comparative and correlative analyses to aforementioned experimental results. • The imaging results demonstrate spatially-resolved cytotoxicity relationship between intracellular ZnO NPs concentration, {sup 40}Ca/{sup 39}K ratio, phosphocholine fragments, and glutathione fragments. CLSM images reveal the localization of ZnO NPs in cytoplasm and nuclei. • The trend of change in TOF-SIMS spectra and images of ZnO NPs treated HaCaT cells demonstrate the possible mode of actions by ZnO NP involves cell membrane disruption, cytotoxic response, and ROS mediated apoptosis. - Abstract: Zinc oxide nanoparticles (ZnO NPs) exhibit novel physiochemical properties and have found increasing use in sunscreen products and cosmetics. The potential toxicity is of increasing concern due to their close association with human skin. A time-of-flight secondary ion mass spectrometry (TOF-SIMS) and confocal laser scanning microscopy (CLSM) imaging method was developed and validated for rapid and sensitive cytotoxicity study of ZnO NPs using human skin equivalent HaCaT cells as a model system. Assorted material, chemical, and toxicological analysis methods were used to confirm their shape, size, crystalline structure, and aggregation properties as well as dissolution behavior and effect on HaCaT cell viability in the presence of various concentrations of ZnO NPs in aqueous media. Comparative and correlative analyses of aforementioned results with TOF-SIMS and CLSM imaging results exhibit reasonable and acceptable outcome. A marked drop in survival rate was observed with 50 μg/ml ZnO NPs. The CLSM images reveal the

  5. [DR. Hanka Weinberg-Heruti: the pediatrician from Merchavia--the first woman-doctor 'Kibbutznik' in the Kibbutz Ha'artzi].

    Science.gov (United States)

    Shehory-Rubin, Zipora

    2015-07-01

    Dr. Hanka Weinberg-Heruti, a pediatrician at the Ha'Emek Hospital and a member of Kibbutz Merchavia is regarded in the history of medicine in Eretz Israel as the first female physician in the Kibbutz Ha'Artzi movement-Hashomer Hatsa'ir, and one of the founders of children's medicine in the country. Dr. Weinberg-Heruti was able to break the accepted norms of the period and prove "you could be both a hospital doctor and a loyal kibbutz member". This was far from simple for there was an iron rule in that kibbutz movement: "Every member must perform physical labour to build the kibbutz and to work in its framework. This principle is inviolable nor can one deviate from the norm". Dr. Weinberg-Heruti dared to break that rule and prove that a successful combination of both her purposes in life was possible. Thus, the aim of the article is twofold: to survey her unique position as hospital doctor and faithful 'kibbutznik', who dared to break the "holy" principle at the ideological roots of kibbutz life--that it was unthinkable for a member to refrain from physical labour. Secondly, to illuminate her medical career as pediatrician in Ha'Emek Hospital, and describe the innovations she introduced to the children's ward, survey her groundbreaking research, that examined the influence of the Beit Shean Valley climate on infant development. Her conclusions dramatically affected the treatment and upbringing of children in that climate, and were adopted not only in local kibbutzim but throughout the country.

  6. Bacillus thuringiensis DB27 produces two novel protoxins, Cry21Fa1 and Cry21Ha1, which act synergistically against nematodes.

    Science.gov (United States)

    Iatsenko, Igor; Boichenko, Iuliia; Sommer, Ralf J

    2014-05-01

    Bacillus thuringiensis has been widely used as a biopesticide, primarily for the control of insect pests, but some B. thuringiensis strains specifically target nematodes. However, nematicidal virulence factors of B. thuringiensis are poorly investigated. Here, we describe virulence factors of nematicidal B. thuringiensis DB27 using Caenorhabditis elegans as a model. We show that B. thuringiensis DB27 kills a number of free-living and animal-parasitic nematodes via intestinal damage. Its virulence factors are plasmid-encoded Cry protoxins, since plasmid-cured derivatives do not produce Cry proteins and are not toxic to nematodes. Whole-genome sequencing of B. thuringiensis DB27 revealed multiple potential nematicidal factors, including several Cry-like proteins encoded by different plasmids. Two of these proteins appear to be novel and show high similarity to Cry21Ba1. Named Cry21Fa1 and Cry21Ha1, they were expressed in Escherichia coli and fed to C. elegans, resulting in intoxication, intestinal damage, and death of nematodes. Interestingly, the effects of the two protoxins on C. elegans are synergistic (synergism factor, 1.8 to 2.5). Using purified proteins, we determined the 50% lethal concentrations (LC50s) for Cry21Fa1 and Cry21Ha1 to be 13.6 μg/ml and 23.9 μg/ml, respectively, which are comparable to the LC50 of nematicidal Cry5B. Finally, we found that signaling pathways which protect C. elegans against Cry5B toxin are also required for protection against Cry21Fa1. Thus, B. thuringiensis DB27 produces novel nematicidal protoxins Cry21Fa1 and Cry21Ha1 with synergistic action, which highlights the importance of naturally isolated strains as a source of novel toxins.

  7. Cytotoxicity of 11-epi-Sinulariolide Acetate Isolated from Cultured Soft Corals on HA22T Cells through the Endoplasmic Reticulum Stress Pathway and Mitochondrial Dysfunction.

    Science.gov (United States)

    Lin, Jen-Jie; Wang, Robert Y L; Chen, Jiing-Chuan; Chiu, Chien-Chih; Liao, Ming-Hui; Wu, Yu-Jen

    2016-10-27

    Natural compounds from soft corals have been increasingly used for their antitumor therapeutic properties. This study examined 11-epi-sinulariolide acetate (11-epi-SA), an active compound isolated from the cultured soft coral Sinularia flexibilis, to determine its potential antitumor effect on four hepatocellular carcinoma cell lines. Cell viability was investigated using 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide assay, and the results demonstrated that 11-epi-SA treatment showed more cytotoxic effect toward HA22T cells. Protein profiling of the 11-epi-SA-treated HA22T cells revealed substantial protein alterations associated with stress response and protein synthesis and folding, suggesting that the mitochondria and endoplasmic reticulum (ER) play roles in 11-epi-SA-initiated apoptosis. Moreover, 11-epi-SA activated caspase-dependent apoptotic cell death, suggesting that mitochondria-related apoptosis genes were involved in programmed cell death. The unfolded protein response signaling pathway-related proteins were also activated on 11-epi-SA treatment, and these changes were accompanied by the upregulated expression of growth arrest and DNA damage-inducible protein (GADD153) and CCAAT/enhancer binding protein (C/EBP) homologous protein (CHOP), the genes encoding transcription factors associated with growth arrest and apoptosis under prolonged ER stress. Two inhibitors, namely salubrinal (Sal) and SP600125, partially abrogated 11-epi-SA-related cell death, implying that the protein kinase R (PKR)-like endoplasmic reticulum kinase (PERK)-activating transcription factor (ATF) 6-CHOP or the inositol-requiring enzyme 1 alpha (IRE1α)-c-Jun N-terminal kinase (JNK)-cJun signal pathway was activated after 11-epi-SA treatment. In general, these results suggest that 11-epi-SA exerts cytotoxic effects on HA22T cells through mitochondrial dysfunction and ER stress cell death pathways.

  8. Efectividad de la funcionalidad familiar de persona que ha intentado suicidarse The effectiveness in the functionality of families with a who has tried to commit suicide

    Directory of Open Access Journals (Sweden)

    Consuelo González Montañéz

    2011-04-01

    Full Text Available Introducción: Para Friedemann toda familia se conforma para funcionar adecuadamente en las dimensiones que la autora ha identificado en su teoría, existiendo momentos críticos cuando uno de sus miembros intenta suicidarse. Objetivos: determinar y analizar la efectividad del funcionamiento familiar con la persona que ha intentado suicidar. Metodología: Se diseñó un estudio descriptivo transversal, con muestreo por conveniencia, con la utilización la ficha sociodemográfica de convivencia familiar y la Escala de Evaluación de la Efectividad de la Funcionalidad Familiar. En total fueron 23 familias donde una persona ha intentado suicidarse. Resultados: La efectividad de la funcionalidad familiar fue baja en el 60,9% de las familias, debido a que presentaron dificultades en su estabilidad y crecimiento familiar. Conclusiones: Las familias se resisten a modificar sus patrones y costumbres y tienen dificultades en la comunicación asertiva. Salud UIS 2011; 43(1: 33-37Introduction: For Friedemann a family is made up with the purpose of performing adequately in the dimensions that the author has identified in her theory, but some critical problems appears when one of the members of that family tries to commit suicide. Objectives: To determine and analyze the way the individuals family works. Methodology: A transversal descriptive study was designed using a convenient sampling of the individuals family's convenience social demographic form and the Evaluation Scale for the Effectiveness of the Family's Function. Twenty three families had a person who had tried suicide. Results: The effectiveness of the family's function was low in a 60.9% of the families because some difficulties appeared when trying to establish their stability and growth. Conclusions: The families refused to modify their patterns and customs and showed difficulties in their assertive communication. Salud UIS 2011; 43(1: 33-37.

  9. Routine delayed voiding cystourethography after initial successful endoscopic treatment with Dextranomer/Hialuronic Acid Copolimer (Dx/HA) of vesicoureteral reflux (VUR). Is it necessary?

    Science.gov (United States)

    García-Aparicio, L; Blázquez-Gómez, E; Vila Santandreu, A; Camacho Diaz, J A; Vila-Cots, J; Ramos Cebrian, M; de Haro, I; Martin, O; Tarrado, X

    2016-12-01

    Some guidelines recommend an early voiding cystourethrography (VCUG) after endoscopic treatment of vesicoureteral reflux (VUR), but there's no consensus if it's necessary a long-term follow-up in these patients. The aim of our study is analyze if it's necessary a delayed VCUG after initial successful treatment with Dx/HA. We have reviewed all medical charts of patients that underwent Dx/HA treatment from 2006 to 2010. We have selected patients with initial successful treatment and more than 3 years of radiological and clinical follow-up. We have analyzed late clinical and radiological outcomes. One hundred and sixty children with 228 refluxing ureters underwent Dx/HA endoscopic treatment with a mean follow-up of 52.13 months. Early VCUG was performed in 215 ureters with an initial successful rate of 84.1%. The group of study was 94/215 ureters with more than 3 years of follow-up with a delayed VCUG. VUR was still resolved in 79,8% of the ureters. Clinical success rate was 91.7%. The incidence of febrile urinary tract infection in those patients with cured VUR and those with a relapsed VUR was 8 and 15%, respectively; but there were no significant differences. We have not found any variable related with relapsed VUR except those ureters that initially received 2 injections (P<.05). If our objective in the treatment of VUR is to reduce the incidence of febrile urinary tract infection it is not necessary to perform a delayed VCUG even though the long-term radiological outcomes is worse than clinical outcome. Copyright © 2016 AEU. Publicado por Elsevier España, S.L.U. All rights reserved.

  10. La poésie créole haïtienne: notes de lecture de l’« Anthologie bilingue de la poésie créole haïtienne de 1986 à nos jours »

    Directory of Open Access Journals (Sweden)

    Ralph Ludwig

    2016-01-01

    Full Text Available Mehdi Chalmers, Chantal Kénol, Jean-Laurent Lhérisson et Lyonel Trouillot, éds.,Anthologie bilingue de la poésie créole haïtienne de 1986 à nos jours (Arles : Actes Sud/Atelier Jeudi Soir, 2015, 192 pages

  11. Bâtir un avenir pour Haïti grâce aux études supérieures | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    9 mai 2017 ... Le tremblement de terre d'une magnitude de 7,0 qui a frappé Haïti en janvier 2010 a touché particulièrement durement les universités de ce pays. ... L'ISTEAH offre des programmes d'études supérieures menant à la maîtrise et au doctorat qui s'inspirent des pratiques exemplaires d'universités d'Amérique ...

  12. PCR Múltiplo - SSCP - HA: Una eficiente metodología para la detección de alteraciones de secuencia en el gen BRCA1

    Directory of Open Access Journals (Sweden)

    Barreto G.

    2001-06-01

    Full Text Available El barrido mutacional de genes de tamaño apreciable tiene limitaciones importantes entérminos económicos y de tiempo sobre todo cuando se trata de estudiar un número grandede individuos. Estos problemas se acentúan cuando se considera que las técnicas de detecciónde mutaciones de ejecución más simple (SSCP y HA son sensibles solo cuando se trabaja conpequeños fragmentos de DNA (200 pb – 400 pb.

  13. Overexpression of S100A7 protects LPS-induced mitochondrial dysfunction and stimulates IL-6 and IL-8 in HaCaT cells.

    Directory of Open Access Journals (Sweden)

    Wenyan Sun

    Full Text Available S100A7 (or psoriasin is distributed in the cytoplasm of keratinocytes of normal human epidermis, and it is overexpressed in many epidermal inflammatory diseases. Lipopolysaccharide (LPS induces mitochondrial function changes, which play important roles in multiple cellular mechanisms including inflammation. Although S100A7 expression is regulated by various factors in the human epidermis during inflammation, whether S100A7 interacts with mitochondria in keratinocytes is not clear.Our study was designed to investigate whether S100A7 could prohibit mitochondrial dysfunction and stimulate cytokines in cultured normal HaCaT cells treated with LPS.We generated HaCaT cells that constitutively express enhanced green fluorescence protein (EGFP-S100A7 (S100A7-EGFP or EGFP alone, as a control. Here, we show that S100A7-EGFP HaCaT cells exhibit an increase in mitochondrial DNA (mtDNA copy number and mitochondrial membrane potential (MMP. qRT-PCR revealed that expression of three main mitochondrial biogenesis-associated genes was significantly increased: PPAR-coactivator-1alpha (PGC-1α, the mitochondrial transcription factor A (Tfam and nuclear respiratory factor-1 (NRF1. S100A7 overexpression increased mtDNA content and effectively increased intracellular adenosine 5'-triphosphate (ATP production, while decreasing reactive oxygen species (ROS generation. S100A7 overexpression also significantly decreased the expression of Mfn2 and increased DRP1 expression compared with control EGFP cells. S100A7 down-regulated the expression of the autophagy-related proteins Beclin-1 and LC3B. S100A7 also increased expression of IL-6 and IL-8 cytokines. Knockdown of S100A7 decreased MMP and disrupted mitochondrial homeostasis.These findings demonstrate that S100A7 stimulates mitochondrial biogenesis and increases mitochondrial function in HaCaT cells treated with LPS; and S100A7 also promotes secretion of IL-6 and IL-8.

  14. Permian ginkgophyte fossils from the Dolomites resemble extant O-ha-tsuki aberrant leaf-like fructifications of Ginkgo biloba L

    Science.gov (United States)

    2010-01-01

    Background Structural elucidation and analysis of fructifications of plants is fundamental for understanding their evolution. In case of Ginkgo biloba, attention was drawn by Fujii in 1896 to aberrant fructifications of Ginkgo biloba whose seeds are attached to leaves, called O-ha-tsuki in Japan. This well-known phenomenon was now interpreted by Fujii as being homologous to ancestral sporophylls. The common fructification of Ginkgo biloba consists of 1-2 (rarely more) ovules on a dichotomously divided stalk, the ovules on top of short stalklets, with collars supporting the ovules. There is essentially no disagreement that either the whole stalk with its stalklets, collars and ovules is homologous to a sporophyll, or, alternatively, just one stalklet, collar and ovule each correspond to a sporophyll. For the transition of an ancestral sporophyll resembling extant O-ha-tsuki aberrant leaves into the common fructification with stalklet/collar/ovule, evolutionary reduction of the leaf lamina of such ancestral sporophylls has to be assumed. Furthermore, such ancestral sporophylls would be expected in the fossil record of ginkgophytes. Results From the Upper Permian of the Bletterbach gorge (Dolomites, South Tyrol, Italy) ginkgophyte leaves of the genus Sphenobaiera were discovered. Among several specimens, one shows putatively attached seeds, while other specimens, depending on their state of preservation, show seeds in positions strongly suggesting such attachment. Morphology and results of a cuticular analysis are in agreement with an affiliation of the fossil to the ginkgophytes and the cuticle of the seed is comparable to that of Triassic and Jurassic ones and to those of extant Ginkgo biloba. The Sphenobaiera leaves with putatively attached seeds closely resemble seed-bearing O-ha-tsuki leaves of extant Ginkgo biloba. This leads to the hypothesis that, at least for some groups of ginkgophytes represented by extant Ginkgo biloba, such sporophylls represent the

  15. Effect of Culture Supernatant Derived from Trichophyton Rubrum Grown in the Nail Medium on the Innate Immunity-related Molecules of HaCaT.

    Science.gov (United States)

    Huang, Xin-Zhu; Liang, Pan-Pan; Ma, Han; Yi, Jin-Ling; Yin, Song-Chao; Chen, Zhi-Rui; Li, Mei-Rong; Lai, Wei; Chen, Jian

    2015-11-20

    Trichophyton rubrum is superficial fungi characteristically confined to dead keratinized tissues. These observations suggest that the soluble components released by the fungus could influence the host immune response in a cell in contact-free manner. Therefore, this research aimed to analyze whether the culture supernatant derived from T. rubrum grown in the nail medium could elicit the immune response of keratinocyte effectively. The culture supernatants of two strains (T1a, T XHB ) were compared for the β-glucan concentrations and their capacity to impact the innate immunity of keratinocytes. The β-glucan concentrations in the supernatants were determined with the fungal G-test kit and protein concentrations with bicinchoninic acid protein quantitative method, then HaCaT was stimulated with different concentrations of culture supernatants by adopting morphological method to select a suitable dosage. Expressions of host defense genes were assessed by quantitative polymerase chain reaction after the HaCaT was stimulated with the culture supernatants. Data were analyzed with one-way analysis of variance, followed by the least significant difference test. The T. rubrum strains (T1a and T XHB ) released β-glucan of 87.530 ± 37.581 pg/ml and 15.747 ± 6.453 pg/ml, respectively into the media. The messenger RNA (mRNA) expressions of toll-like receptor-2 (TLR2), TLR4, and CARD9 were moderately up-regulated in HaCaT within 6-h applications of both supernatants. HaCaT cells were more responsive to T1a than T XHB . The slight increase of dendritic cells-specific intercellular adhesion molecule 3-grabbing nonintegrin expression was faster and stronger, induced by T1a supernatant than T XHB . The moderate decreases of RNase 7, the slight up-regulations of Dectin-1 and interleukin-8 at the mRNA level were detected only in response to T1a rather than T XHB . After a long-time contact, all the elevated defense genes decreased after 24 h. The culture supernatant of T. rubrum

  16. Effect of Culture Supernatant Derived from Trichophyton Rubrum Grown in the Nail Medium on the Innate Immunity-related Molecules of HaCaT

    Directory of Open Access Journals (Sweden)

    Xin-Zhu Huang

    2015-01-01

    Full Text Available Background: Trichophyton rubrum is superficial fungi characteristically confined to dead keratinized tissues. These observations suggest that the soluble components released by the fungus could influence the host immune response in a cell in contact-free manner. Therefore, this research aimed to analyze whether the culture supernatant derived from T. rubrum grown in the nail medium could elicit the immune response of keratinocyte effectively. Methods: The culture supernatants of two strains (T1a, T XHB were compared for the β-glucan concentrations and their capacity to impact the innate immunity of keratinocytes. The β-glucan concentrations in the supernatants were determined with the fungal G-test kit and protein concentrations with bicinchoninic acid protein quantitative method, then HaCaT was stimulated with different concentrations of culture supernatants by adopting morphological method to select a suitable dosage. Expressions of host defense genes were assessed by quantitative polymerase chain reaction after the HaCaT was stimulated with the culture supernatants. Data were analyzed with one-way analysis of variance, followed by the least significant difference test. Results: The T. rubrum strains (T1a and T XHB released β-glucan of 87.530 ± 37.581 pg/ml and 15.747 ± 6.453 pg/ml, respectively into the media. The messenger RNA (mRNA expressions of toll-like receptor-2 (TLR2, TLR4, and CARD9 were moderately up-regulated in HaCaT within 6-h applications of both supernatants. HaCaT cells were more responsive to T1a than T XHB . The slight increase of dendritic cells-specific intercellular adhesion molecule 3-grabbing nonintegrin expression was faster and stronger, induced by T1a supernatant than T XHB . The moderate decreases of RNase 7, the slight up-regulations of Dectin-1 and interleukin-8 at the mRNA level were detected only in response to T1a rather than T XHB . After a long-time contact, all the elevated defense genes decreased after

  17. Emerged HA and NA mutants of the pandemic influenza H1N1 viruses with increasing epidemiological significance in Taipei and Kaohsiung, Taiwan, 2009-10.

    Directory of Open Access Journals (Sweden)

    Chuan-Liang Kao

    Full Text Available The 2009 influenza pandemic provided an opportunity to observe dynamic changes of the hemagglutinin (HA and neuraminidase (NA of pH1N1 strains that spread in two metropolitan areas--Taipei and Kaohsiung. We observed cumulative increases of amino acid substitutions of both HA and NA that were higher in the post-peak than in the pre-peak period of the epidemic. About 14.94% and 3.44% of 174 isolates had one and two amino acids changes, respective, in the four antigenic sites. One unique adaptive mutation of HA2 (E374K was first detected three weeks before the epidemic peak. This mutation evolved through the epidemic, and finally emerged as the major circulated strain, with significantly higher frequency in the post-peak period than in the pre-peak (64.65% vs 9.28%, p<0.0001. E374K persisted until ten months post-nationwide vaccination without further antigenic changes (e.g. prior to the highest selective pressure. In public health measures, the epidemic peaked at seven weeks after oseltamivir treatment was initiated. The emerging E374K mutants spread before the first peak of school class suspension, extended their survival in high-density population areas before vaccination, dominated in the second wave of class suspension, and were fixed as herd immunity developed. The tempo-spatial spreading of E374K mutants was more concentrated during the post-peak (p = 0.000004 in seven districts with higher spatial clusters (p<0.001. This is the first study examining viral changes during the naïve phase of a pandemic of influenza through integrated virological/serological/clinical surveillance, tempo-spatial analysis, and intervention policies. The vaccination increased the percentage of E374K mutants (22.86% vs 72.34%, p<0.001 and significantly elevated the frequency of mutations in Sa antigenic site (2.36% vs 23.40%, p<0.001. Future pre-vaccination public health efforts should monitor amino acids of HA and NA of pandemic influenza viruses isolated at

  18. Evaluación del impacto que ha tenido la certificación ISO 9001 en una empresa manufacturera transnacional

    OpenAIRE

    Calzada Cruz, Esther; López Gutiérrez, Yannel

    2004-01-01

    El término "calidad" ha marcado la pauta en la manera de hacer negocios en todas las organizaciones empresariales e industriales. Hoy en día, la calidad tiene como objetivo superar las expectativas de los clientes así como generar confianza entre ellos y se refiere al rompimiento de las estructuras convencionales y de las estrategias tradicionales de administración de las empresas, adaptándolas a las nuevas condiciones del mercado. Las grandes empresas buscan consolidar su...

  19. Permian ginkgophyte fossils from the Dolomites resemble extant O-ha-tsuki aberrant leaf-like fructifications of Ginkgo biloba L

    Directory of Open Access Journals (Sweden)

    Kustatscher Evelyn

    2010-11-01

    Full Text Available Abstract Background Structural elucidation and analysis of fructifications of plants is fundamental for understanding their evolution. In case of Ginkgo biloba, attention was drawn by Fujii in 1896 to aberrant fructifications of Ginkgo biloba whose seeds are attached to leaves, called O-ha-tsuki in Japan. This well-known phenomenon was now interpreted by Fujii as being homologous to ancestral sporophylls. The common fructification of Ginkgo biloba consists of 1-2 (rarely more ovules on a dichotomously divided stalk, the ovules on top of short stalklets, with collars supporting the ovules. There is essentially no disagreement that either the whole stalk with its stalklets, collars and ovules is homologous to a sporophyll, or, alternatively, just one stalklet, collar and ovule each correspond to a sporophyll. For the transition of an ancestral sporophyll resembling extant O-ha-tsuki aberrant leaves into the common fructification with stalklet/collar/ovule, evolutionary reduction of the leaf lamina of such ancestral sporophylls has to be assumed. Furthermore, such ancestral sporophylls would be expected in the fossil record of ginkgophytes. Results From the Upper Permian of the Bletterbach gorge (Dolomites, South Tyrol, Italy ginkgophyte leaves of the genus Sphenobaiera were discovered. Among several specimens, one shows putatively attached seeds, while other specimens, depending on their state of preservation, show seeds in positions strongly suggesting such attachment. Morphology and results of a cuticular analysis are in agreement with an affiliation of the fossil to the ginkgophytes and the cuticle of the seed is comparable to that of Triassic and Jurassic ones and to those of extant Ginkgo biloba. The Sphenobaiera leaves with putatively attached seeds closely resemble seed-bearing O-ha-tsuki leaves of extant Ginkgo biloba. This leads to the hypothesis that, at least for some groups of ginkgophytes represented by extant Ginkgo biloba, such

  20. Eficacia de la acupuntura en la espasticidad del paciente que ha padecido un ictus. Revisión sistemática

    OpenAIRE

    Rodríguez-Mansilla, Juan; Espejo-Antúnez, Luis; Bustamante-López, Ana Isabel

    2016-01-01

    Objetivo: Determinar la eficacia de la acupuntura para la reducción de la espasticidad en el paciente que ha sufrido un ictus. Diseño: Revisión sistemática. Fuente de datos: Búsqueda sistemática en las principales bases de datos de los ensayos clínicos, publicados en español e inglés desde enero de 2000 a enero de 2013, en los que los participantes cursaran con espasticidad a consecuencia de un ictus. Selección de los estudios: Se seleccionaron 9 registros de los 110 localizados. Los...

  1. ESPACIOS CONTEMPORÁNEOS PARA LA UTOPÍA - Entrevista a la Dra. Vita Fortunati

    Directory of Open Access Journals (Sweden)

    Lucas E. Misseri

    2010-04-01

    Full Text Available Entrevista a la Dra. Vita FortunatiUniBo – ItaliaDoctora en literatura y profesora de literatura inglesa en laUniversidad de Bolonia, Italia. Se ha especializado en latemática del utopismo a la cual ha contribuido con creces. En1989 fundó el Centro interdepartamental de estudios sobre lautopía en la mencionada universidad.

  2. In Silico Prediction and Experimental Confirmation of HA Residues Conferring Enhanced Human Receptor Specificity of H5N1 Influenza A Viruses

    Science.gov (United States)

    Schmier, Sonja; Mostafa, Ahmed; Haarmann, Thomas; Bannert, Norbert; Ziebuhr, John; Veljkovic, Veljko; Dietrich, Ursula; Pleschka, Stephan

    2015-06-01

    Newly emerging influenza A viruses (IAV) pose a major threat to human health by causing seasonal epidemics and/or pandemics, the latter often facilitated by the lack of pre-existing immunity in the general population. Early recognition of candidate pandemic influenza viruses (CPIV) is of crucial importance for restricting virus transmission and developing appropriate therapeutic and prophylactic strategies including effective vaccines. Often, the pandemic potential of newly emerging IAV is only fully recognized once the virus starts to spread efficiently causing serious disease in humans. Here, we used a novel phylogenetic algorithm based on the informational spectrum method (ISM) to identify potential CPIV by predicting mutations in the viral hemagglutinin (HA) gene that are likely to (differentially) affect critical interactions between the HA protein and target cells from bird and human origin, respectively. Predictions were subsequently validated by generating pseudotyped retrovirus particles and genetically engineered IAV containing these mutations and characterizing potential effects on virus entry and replication in cells expressing human and avian IAV receptors, respectively. Our data suggest that the ISM-based algorithm is suitable to identify CPIV among IAV strains that are circulating in animal hosts and thus may be a new tool for assessing pandemic risks associated with specific strains.

  3. Curcumin ameliorates TNF-α-induced ICAM-1 expression and subsequent THP-1 adhesiveness via the induction of heme oxygenase-1 in the HaCaT cells

    Directory of Open Access Journals (Sweden)

    Gi Soo Youn

    2013-08-01

    Full Text Available Adhesion molecules such as ICAM-1 are important in theinfiltration of leukocytes into the site of inflammation. In thisstudy, we investigated the inhibitory effects of curcumin onICAM-1 expression and monocyte adhesiveness as well as itsunderlying action mechanism in the TNF-α-stimulated keratinocytes.Curcumin induced expression of heme oxygenase-1(HO-1 in the human keratinocyte cell line HaCaT. In addition,curcumin induced Nrf2 activation in dose- and time-dependentmanners in the HaCaT cells. Curcumin suppressed TNF-α-induced ICAM-1 expression and subsequent monocyte adhesion,which were reversed by the addition of tin protoporphyrinIX (SnPP, a specific inhibitor of HO-1, or HO-1knockdown using siRNA. Furthermore, Nrf2 knockdown usingsiRNA reversed the inhibitory effect of curcumin on theTNF-α-induced ICAM-1 expression and adhesion of monocytesto keratinocytes. These results suggest that curcumin may exertits anti-inflammatory activity by suppressing the TNF-α-inducedICAM-1 expression and subsequent monocyte adhesion viaexpression of HO-1 in the keratinocytes. [BMB Reports 2013;46(8: 410-415

  4. Pro-oxidant status and Nrf2 levels in psoriasis vulgaris skin tissues and dimethyl fumarate-treated HaCaT cells.

    Science.gov (United States)

    Lee, Yoon Jin; Bae, Jin Ho; Kang, Sang-Gue; Cho, Sung Woo; Chun, Dong-Il; Nam, Seung Min; Kim, Chul Han; Nam, Hae Seon; Lee, Seon Hwa; Lee, Sang Han; Cho, Moon Kyun

    2017-09-01

    Reactive oxygen species (ROS) contribute to pathogenesis of many inflammatory skin diseases, including psoriasis. The aim of this study is to compare antioxidant protein expression in psoriasis vulgaris (PV) skin tissues with that in normal skin tissues in vivo and to evaluate the effects of dimethyl fumarate (DMF), used for the treatment of psoriasis, on ROS generation and apoptosis in a human keratinocyte cell line HaCaT. Compared with normal skin tissues, PV skin tissues showed increased protein oxidation as well as down-regulation of Nrf2 and its regulatory proteins such as HO-1 and AKR1C3. Using HaCaT cells to model DMF-induced pro-oxidant effects in the skin cells, we found that DMF treatment induced increased ROS levels and apoptotic cell death, as signified by increased proportion of cells with Annexin V-PE(+) staining and a sub-G 0 /G 1 peak in the cell cycle. Preceding these changes, DMF treatment resulted in up-regulation of Nrf2, HO-1, and AKR1C3 proteins in these cells. Collectively, increased oxidative stress and impaired cellular anti-oxidant enzyme systems may participate in the pathogenesis of PV. DMF may exert an additive therapeutic efficacy in PV by attenuating the redox burden and subsequent oxidative damage to normal keratinocytes through activation of Nrf2 pathway relative to PV.

  5. A Mathematical Model of Neutral Lipid Content in terms of Initial Nitrogen Concentration and Validation in Coelastrum sp. HA-1 and Application in Chlorella sorokiniana

    Directory of Open Access Journals (Sweden)

    Zhenhua Yang

    2017-01-01

    Full Text Available Microalgae are considered to be a potential major biomass feedstock for biofuel due to their high lipid content. However, no correlation equations as a function of initial nitrogen concentration for lipid accumulation have been developed for simplicity to predict lipid production and optimize the lipid production process. In this study, a lipid accumulation model was developed with simple parameters based on the assumption protein synthesis shift to lipid synthesis by a linear function of nitrogen quota. The model predictions fitted well for the growth, lipid content, and nitrogen consumption of Coelastrum sp. HA-1 under various initial nitrogen concentrations. Then the model was applied successfully in Chlorella sorokiniana to predict the lipid content with different light intensities. The quantitative relationship between initial nitrogen concentrations and the final lipid content with sensitivity analysis of the model were also discussed. Based on the model results, the conversion efficiency from protein synthesis to lipid synthesis is higher and higher in microalgae metabolism process as nitrogen decreases; however, the carbohydrate composition content remains basically unchanged neither in HA-1 nor in C. sorokiniana.

  6. Binary Central Stars of Planetary Nebulae Discovered Through Photometric Variability. V. The Central Stars of HaTr 7 and ESO 330-9

    Science.gov (United States)

    Hillwig, Todd C.; Frew, David J.; Reindl, Nicole; Rotter, Hannah; Webb, Andrew; Margheim, Steve

    2017-01-01

    We find the central stars (CSs) of the planetary nebulae (PNe) HaTr 7 and ESO 330-9 to be close-binary systems. Both have orbital periods of less than half a day and contain an irradiated cool companion to the hot CS. We provide light curves, spectra, radial velocity curves, orbital periods, and binary modeling results for both systems. The binary modeling leads to system parameters, or ranges of allowed parameters for each system. We find that for the CS of HaTr 7 we need to use limb-darkening values for the cool companion that are different than the expected values for an isolated star. We also fit the CS spectrum to determine {log}g and temperature values independent of the binary modeling. For ESO 330-9 we find that based on our binary modeling, the hot CS is most likely a post-red giant branch (RGB) star with a mass of around 0.4 {M}⊙ . We discuss our derived stellar and nebular parameters in the broader context of close-binary CSs and their surrounding planetary nebulae (PNe). We also discuss the present status of known or suspected post-RGB stars in PNe.

  7. Bone-Forming Capabilities of a Newly Developed NanoHA Composite Alloplast Infused with Collagen: A Pilot Study in the Sheep Mandible

    Directory of Open Access Journals (Sweden)

    Charles Marin

    2013-01-01

    Full Text Available Lateral or vertical bone augmentation has always been a challenge, since the site is exposed to constant pressure from the soft tissue, and blood supply only exists from the donor site. Although, for such clinical cases, onlay grafting with autogenous bone is commonly selected, the invasiveness of the secondary surgical site and the relatively fast resorption rate have been reported as a drawback, which motivated the investigation of alternative approaches. This study evaluated the bone-forming capability of a novel nanoHA alloplast infused with collagen graft material made from biodegradable polylactic acid/polyglycolic acid versus a control graft material with the same synthesized alloplast without the nanoHA component and collagen infiltration. The status of newly formed bone and the resorption of the graft material were evaluated at 6 weeks in vivo histologically and three dimensionally by means of 3D microcomputed tomography. The histologic observation showed that newly formed bone ingrowth and internal resorption of the block were observed for the experimental blocks, whereas for the control blocks less bone ingrowth occurred along with lower resorption rate of the block material. The three-dimensional observation indicated that the experimental block maintained the external geometry, but at the same time successfully altered the graft material into bone. It is suggested that the combination of numerous factors contributed to the bone ingrowth and the novel development could be an alternative bone grafting choice.

  8. Nicotinamide enhances repair of arsenic and ultraviolet radiation-induced DNA damage in HaCaT keratinocytes and ex vivo human skin.

    Directory of Open Access Journals (Sweden)

    Benjamin C Thompson

    Full Text Available Arsenic-induced skin cancer is a significant global health burden. In areas with arsenic contamination of water sources, such as China, Pakistan, Myanmar, Cambodia and especially Bangladesh and West Bengal, large populations are at risk of arsenic-induced skin cancer. Arsenic acts as a co-carcinogen with ultraviolet (UV radiation and affects DNA damage and repair. Nicotinamide (vitamin B3 reduces premalignant keratoses in sun-damaged skin, likely by prevention of UV-induced cellular energy depletion and enhancement of DNA repair. We investigated whether nicotinamide modifies DNA repair following exposure to UV radiation and sodium arsenite. HaCaT keratinocytes and ex vivo human skin were exposed to 2μM sodium arsenite and low dose (2J/cm2 solar-simulated UV, with and without nicotinamide supplementation. DNA photolesions in the form of 8-oxo-7,8-dihydro-2'-deoxyguanosine and cyclobutane pyrimidine dimers were detected by immunofluorescence. Arsenic exposure significantly increased levels of 8-oxo-7,8-dihydro-2'-deoxyguanosine in irradiated cells. Nicotinamide reduced both types of photolesions in HaCaT keratinocytes and in ex vivo human skin, likely by enhancing DNA repair. These results demonstrate a reduction of two different photolesions over time in two different models in UV and arsenic exposed cells. Nicotinamide is a nontoxic, inexpensive agent with potential for chemoprevention of arsenic induced skin cancer.

  9. Nicotinamide enhances repair of arsenic and ultraviolet radiation-induced DNA damage in HaCaT keratinocytes and ex vivo human skin.

    Science.gov (United States)

    Thompson, Benjamin C; Halliday, Gary M; Damian, Diona L

    2015-01-01

    Arsenic-induced skin cancer is a significant global health burden. In areas with arsenic contamination of water sources, such as China, Pakistan, Myanmar, Cambodia and especially Bangladesh and West Bengal, large populations are at risk of arsenic-induced skin cancer. Arsenic acts as a co-carcinogen with ultraviolet (UV) radiation and affects DNA damage and repair. Nicotinamide (vitamin B3) reduces premalignant keratoses in sun-damaged skin, likely by prevention of UV-induced cellular energy depletion and enhancement of DNA repair. We investigated whether nicotinamide modifies DNA repair following exposure to UV radiation and sodium arsenite. HaCaT keratinocytes and ex vivo human skin were exposed to 2μM sodium arsenite and low dose (2J/cm2) solar-simulated UV, with and without nicotinamide supplementation. DNA photolesions in the form of 8-oxo-7,8-dihydro-2'-deoxyguanosine and cyclobutane pyrimidine dimers were detected by immunofluorescence. Arsenic exposure significantly increased levels of 8-oxo-7,8-dihydro-2'-deoxyguanosine in irradiated cells. Nicotinamide reduced both types of photolesions in HaCaT keratinocytes and in ex vivo human skin, likely by enhancing DNA repair. These results demonstrate a reduction of two different photolesions over time in two different models in UV and arsenic exposed cells. Nicotinamide is a nontoxic, inexpensive agent with potential for chemoprevention of arsenic induced skin cancer.

  10. 3D fabrication and characterization of phosphoric acid scaffold with a HA/β-TCP weight ratio of 60:40 for bone tissue engineering applications.

    Science.gov (United States)

    Wang, Yanen; Wang, Kai; Li, Xinpei; Wei, Qinghua; Chai, Weihong; Wang, Shuzhi; Che, Yu; Lu, Tingli; Zhang, Bo

    2017-01-01

    A key requirement for three-dimensional printing (3-DP) at room temperature of medical implants depends on the availability of printable and biocompatible binder-powder systems. Different concentration polyvinyl alcohol (PVA) and phosphoric acid solutions were chosen as the binders to make the artificial stent biocompatible with sufficient compressive strength. In order to achieve an optimum balance between the bioceramic powder and binder solution, the biocompatibility and mechanical properties of these artificial stent samples were tested using two kinds of binder solutions. This study demonstrated the printable binder formulation at room temperature for the 3D artificial bone scaffolds. 0.6 wt% PVA solution was ejected easily via inkjet printing, with a supplementation of 0.25 wt% Tween 80 to reduce the surface tension of the polyvinyl alcohol solution. Compared with the polyvinyl alcohol scaffolds, the phosphoric acid scaffolds had better mechanical properties. Though both scaffolds supported the cell proliferation, the absorbance of the polyvinyl alcohol scaffolds was higher than that of the phosphoric acid scaffolds. The artificial stents with a hydroxyapatite/beta-tricalcium phosphate (HA/β-TCP) weight ratios of 60:40 depicted good biocompatibility for both scaffolds. Considering the scaffolds' mechanical and biocompatible properties, the phosphoric acid scaffolds with a HA/β-TCP weight ratio of 60:40 may be the best combination for bone tissue engineering applications.

  11. Protective effects of compounds from Garcinia mangostana L. (mangosteen) against UVB damage in HaCaT cells and hairless mice.

    Science.gov (United States)

    Im, A-Rang; Kim, Young-Mi; Chin, Young-Won; Chae, Sungwook

    2017-12-01

    Ultraviolet B (UVB) radiation causes alterations in the skin, such as epidermal thickening, wrinkle formation and inflammation. Therefore, preventing UVB-induced skin damage can promote general health among the human population. Garcinia mangostana L. (mangosteen) is a fruit that has become a popular botanical dietary supplement because of its perceived role in promoting overall health. The present study investigated the photoprotective effects of α-, β-, γ-mangostins and gartanin against UVB radiation using the HaCaT immortalized human keratinocyte cell line as an in vitro model and hairless mice as an in vivo model. UVB radiation increased the expression of matrix metalloproteinase (MMP)‑1 and ‑9 and decreased the mRNA expression levels of involucrin, filaggrin and loricrin in HaCaT cells; however, these changes were attenuated by pretreating the cells with α-, β-, γ-mangostins and gartanin. Among these compounds, α-mangostin exhibited the greatest effects in reducing UVB-induced skin wrinkles, inhibited epidermal thickening in hairless mice in vivo. Exposure to UVB radiation increased the expression of MMPs and pro-inflammatory cytokines and activated mitogen-activated protein kinases in hairless mice, but these changes were attenuated by α-mangostin. The authors suggested that α-mangostin exerts anti-wrinkle and anti-aging properties.

  12. Saussurea lappa alleviates inflammatory chemokine production in HaCaT cells and house dust mite-induced atopic-like dermatitis in Nc/Nga mice.

    Science.gov (United States)

    Lim, Hye-Sun; Ha, Hyekyung; Lee, Mee-Young; Jin, Seong-Eun; Jeong, Soo-Jin; Jeon, Woo-Young; Shin, Na-Ra; Sok, Dai-Eun; Shin, Hyeun-Kyoo

    2014-01-01

    Saussurea lappa is a traditional herbal medicine used for to treat various inflammatory diseases. In this study, we investigated the protective effects of S. lappa against atopic dermatitis using human keratinocyte HaCaT cells, murine mast cell line MC/9 cells, and a house dust mite-induced atopic dermatitis model of Nc/Nga mice. Treatment with the S. lappa caused a significant reduction in the mRNA levels and production of inflammatory chemokines and cytokine, including thymus- and activation-regulated chemokine (TARC), macrophage-derived chemokine (MDC), regulated on activation, normal T-cell expressed and secreted (RANTES), and interleukin-8 (IL-8) in tumor necrosis factor-α/interferone-γ-stimulated HaCaT cells. S. lappa exhibited the significant reduction in histamine production in MC/9 cells. In the atopic dermatitis model, S. lappa significantly reduced the dermatitis score and serum IgE and TARC levels. In addition, the back skin and ears of S. lappa-treated Nc/Nga mice exhibited reduced histological manifestations of atopic skin lesions such as erosion, hyperplasia of the epidermis and dermis, and inflammatory cell infiltration. In conclusion, an extract of S. lappa effectively suppressed the development of atopic dermatitis, which was closely related to the reduction of chemokines and cytokine. Our study suggests that S. lappa may be a potential treatment for atopic dermatitis. Crown Copyright © 2013. Published by Elsevier Ltd. All rights reserved.

  13. Oxidative stress and DNA damage induced by cadmium in the human keratinocyte HaCaT cell line: role of glutathione in the resistance to cadmium.

    Science.gov (United States)

    Nzengue, Yves; Steiman, Régine; Garrel, Catherine; Lefèbvre, Emmanuel; Guiraud, Pascale

    2008-01-14

    Cadmium affects the cellular homeostasis and generates damage via complex mechanisms involving interactions with other metals and oxidative stress induction. In this work we used a human keratinocyte cell line (HaCaT) as a model to study the oxidative damage induced by cadmium to cellular macromolecules, its effect on the antioxidant systems and the role of glutathione in cell protection toward cadmium toxicity. The cells were incubated for 24 and 48 h with cadmium (3, 15, 50 and 100 microM). High doses of cadmium were required to induce a cytotoxicity: 100 microM lead to 30% mortality after 24h and 50% after 48 h. The oxidation of lipids and proteins and the DNA damage, respectively, assessed by thiobarbituric acid reactants determination, thiol group measurement and comet assay, were observed for 50-100 microM cadmium. The cytotoxic effects were strongly correlated to the cellular cadmium content. The glutathione peroxidase and the catalase activities were decreased, while the glutathione reductase activity and the glutathione concentration were increased after cadmium treatment. The superoxide dismutases activities were unchanged. A depletion in glutathione prior to cadmium exposure increased the cytotoxic effects and provoked DNA damage. Our results suggested that the hydroxyl radical could be the major compound involved in the oxidative stress generated by cadmium and that glutathione could play a major role in the protection of HaCaT cells from cytotoxicity but mostly from DNA damage induced by cadmium.

  14. Barium Promotes Anchorage-Independent Growth and Invasion of Human HaCaT Keratinocytes via Activation of c-SRC Kinase

    Science.gov (United States)

    Thang, Nguyen Dinh; Yajima, Ichiro; Kumasaka, Mayuko Y.; Ohnuma, Shoko; Yanagishita, Takeshi; Hayashi, Rumiko; Shekhar, Hossain U.; Watanabe, Daisuke; Kato, Masashi

    2011-01-01

    Explosive increases in skin cancers have been reported in more than 36 million patients with arsenicosis caused by drinking arsenic-polluted well water. This study and previous studies showed high levels of barium as well as arsenic in the well water. However, there have been no reports showing a correlation between barium and cancer. In this study, we examined whether barium (BaCl2) may independently have cancer-related effects on human precancerous keratinocytes (HaCaT). Barium (5–50 µM) biologically promoted anchorage-independent growth and invasion of HaCaT cells in vitro. Barium (5 µM) biochemically enhanced activities of c-SRC, FAK, ERK and MT1-MMP molecules, which regulate anchorage-independent growth and/or invasion. A SRC kinase specific inhibitor, protein phosphatase 2 (PP2), blocked barium-mediated promotion of anchorage-independent growth and invasion with decreased c-SRC kinase activity. Barium (2.5–5 µM) also promoted anchorage-independent growth and invasion of fibroblasts (NIH3T3) and immortalized nontumorigenic melanocytes (melan-a), but not transformed cutaneous squamous cell carcinoma (HSC5 and A431) and malignant melanoma (Mel-ret) cells, with activation of c-SRC kinase. Taken together, our biological and biochemical findings newly suggest that the levels of barium shown in drinking well water independently has the cancer-promoting effects on precancerous keratinocytes, fibroblast and melanocytes in vitro. PMID:22022425

  15. Protective effect of Vaccinium myrtillus extract against UVA- and UVB-induced damage in a human keratinocyte cell line (HaCaT cells).

    Science.gov (United States)

    Calò, Rossella; Marabini, Laura

    2014-03-05

    Recently, the field of skin protection have shown a considerable interest in the use of botanicals. Vaccinium myrtillus contains several polyphenols and anthocyanins with multiple pharmacological properties. The purpose of our study was to examine whether a water-soluble V. myrtillus extract (dry matter 12.4%; total polyphenols 339.3mg/100 g fw; total anthocyanins 297.4 mg/100 g fw) was able to reduce UVA- and UVB-induced damage using a human keratinocyte cell line (HaCaT). HaCaT cells were pretreated for 1h with extract in a serum-free medium and then irradiated with UVA (8-40 J/cm(2)) and UVB (0.008-0.72 J/cm(2)) rays. All experiments were performed 24h after the end of irradiation, except for oxidative stress tests. The extract was able to reduce the UVB-induced cytotoxicity and genotoxicity (studied by comet and micronucleous assays) at lower doses. V. myrtillus extract reduced lipid peroxidation UVB-induced, but had no effect against the ROS UVB-produced. With UVA-induced damage V. myrtillus reduced genotoxicity as well as the unbalance of redox intracellular status. Moreover our extract reduced the UVA-induced apoptosis, but had no effect against the UVB one. V. myrtillus extract showed its free radical scavenging properties reducing oxidative stress and apoptotic markers, especially in UVA-irradiated cells. Copyright © 2014 Elsevier B.V. All rights reserved.

  16. Lonicera caerulea and Vaccinium myrtillus fruit polyphenols protect HaCaT keratinocytes against UVB-induced phototoxic stress and DNA damage.

    Science.gov (United States)

    Svobodová, Alena; Zdarilová, Adéla; Vostálová, Jitka

    2009-12-01

    Sunlight is a very potent environmental factor in skin pathogenesis and can induce skin cancer. UVB irradiation is known to cause oxidative stress, inflammation and especially DNA damage. Topical application of agents with UV absorbing, antioxidant and anti-inflammatory activities is a successful strategy in the protection of the skin against UV-caused damage. To examine the ability of the phenolic fraction of Lonicera caerulea and Vaccinum myrtillus fruits to moderate UVB-induced damage. HaCaT keratinocytes, a well-established in vitro system for investigations on UV radiation induced cell damage, were used to assess the effects of pre- and post-treatment with L. caerulea (LCE) and V. myrtillus (VME) phenolic fractions (5-50 mg/l) on keratinocyte damage induced by a solar simulator (295-315 nm). In this study, a model of UVB-induced damage to HaCaT was established. LCE and VME efficiently reduced the extent of DNA breakage (especially at concentrations of 25 and 10 mg/l) together with caspase-3 and -9 activity and DNA laddering induced by UVB (100 or 200 mJ/cm(2)). LCE and VME significantly decreased RONS generation and partially diminished IL-6 expression. LCE pre-treatment also prevented keratinocytes proliferation. The results suggest that the phenolic fraction of L. caerulea and V. myrtillus fruits suppress UVB-caused injury to keratinocytes. These results now need to be demonstrated in vivo.

  17. Burkholderia Hep_Hag autotransporter (BuHA proteins elicit a strong antibody response during experimental glanders but not human melioidosis

    Directory of Open Access Journals (Sweden)

    Foster Simon J

    2007-03-01

    Full Text Available Abstract Background The bacterial biothreat agents Burkholderia mallei and Burkholderia pseudomallei are the cause of glanders and melioidosis, respectively. Genomic and epidemiological studies have shown that B. mallei is a recently emerged, host restricted clone of B. pseudomallei. Results Using bacteriophage-mediated immunoscreening we identified genes expressed in vivo during experimental equine glanders infection. A family of immunodominant antigens were identified that share protein domain architectures with hemagglutinins and invasins. These have been designated Burkholderia Hep_Hag autotransporter (BuHA proteins. A total of 110/207 positive clones (53% of a B. mallei expression library screened with sera from two infected horses belonged to this family. This contrasted with 6/189 positive clones (3% of a B. pseudomallei expression library screened with serum from 21 patients with culture-proven melioidosis. Conclusion Members of the BuHA proteins are found in other Gram-negative bacteria and have been shown to have important roles related to virulence. Compared with other bacterial species, the genomes of both B. mallei and B. pseudomallei contain a relative abundance of this family of proteins. The domain structures of these proteins suggest that they function as multimeric surface proteins that modulate interactions of the cell with the host and environment. Their effect on the cellular immune response to B. mallei and their potential as diagnostics for glanders requires further study.

  18. Modulation of mitochondrial activity in HaCaT keratinocytes by the cell penetrating peptide Z-Gly-RGD(DPhe)-mitoparan.

    Science.gov (United States)

    Richardson, Adam; Muir, Lewis; Mousdell, Sasha; Sexton, Darren; Jones, Sarah; Howl, John; Ross, Kehinde

    2018-01-30

    Biologically active cell penetrating peptides (CPPs) are an emerging class of therapeutic agent. The wasp venom peptide mastoparan is an established CPP that modulates mitochondrial activity and triggers caspase-dependent apoptosis in cancer cells, as does the mastoparan analogue mitoparan (mitP). Mitochondrial depolarisation and activation of the caspase cascade also underpins the action of dithranol, a topical agent for treatment of psoriasis. The effects of a potent mitP analogue on mitochondrial activity were therefore examined to assess its potential as a novel approach for targeting mitochondria for the treatment of psoriasis. In HaCaT keratinocytes treated with the mitP analogue Z-Gly-RGD(DPhe)-mitP for 24 h, a dose-dependent loss of mitochondrial activity was observed using the methyl-thiazolyl-tetrazolium (MTT) assay. At 10 μmol L-1, MTT activity was less than 30% that observed in untreated cells. Staining with the cationic dye JC-1 suggested that Z-Gly-RGD(DPhe)-mitP also dissipated the mitochondrial membrane potential, with a threefold increase in mitochondrial depolarisation levels. However, caspase activity appeared to be reduced by 24 h exposure to Z-Gly-RGD(DPhe)-mitP treatment. Furthermore, Z-Gly-RGD(DPhe)-mitP treatment had little effect on overall cell viability. Our findings suggest Z-Gly-RGD(DPhe)-mitP promotes the loss of mitochondrial activity but does not appear to evoke apoptosis in HaCaT keratinocytes.

  19. Sequential expression and cooperative interaction of c-Ha-ras and c-erbB genes in in vivo chemical carcinogenesis

    Energy Technology Data Exchange (ETDEWEB)

    Husain, Z.; Fei, Y.; Roy, S.; Biswas, D.K. (Harvard School of Dental Medicine, Boston, MA (USA)); Solt, D.B.; Polverini, P.J. (Northwestern Univ. Medical School, Chicago, IL (USA))

    1989-02-01

    The level of expression of several cellular protooncogenes is examined at different stages of 7,12-dimethylbenzanthracene (DMBA)-induced tumor development in hamster buccal pouch epithelium (HBPE). Results presented demonstrate overexpression of c-Ha-ras gene at a very early stage of tumor development, and this elevated level of expression of the gene persists throughout the tumorigenesis process. The expression of the cellular protooncogene c-erbB, on the other hand, can be detected only after 8-10 weeks of DMBA treatment of the tissue and increases with the progression of the disease. The overexpression of c-erbB gene can be correlated with the stage of extensive proliferation and subsequent invasion of the HBPE cells into the underlying connective tissue. This sequential pattern of stage-specific expression of the two cellular protooncogenes can be observed in (i) treated tissues, (ii) stage-representative cultured cells, and (iii) NIH 3T3 transformants derived with DNA from HBPE cells. The sequential overexpression of c-Ha-ras and c-erbB genes in a stage-specific manner and their cooperative interaction in the DMBA-induced in vivo oral carcinogenesis have been demonstrated.

  20. Nerve growth factor regulates the expression of vascular endothelial growth factor in human HaCaT keratinocytes via PI3K/mTOR pathway.

    Science.gov (United States)

    Zhang, J; Ma, W Y

    2014-01-24

    Decades of research have provided the data to confirm the hypothesis that there is bidirectional communication between the central nervous system and the immune system in psoriasis pathogenesis, but the contribution of the cutaneous neural system remains underexplored. In this study, we evaluated the molecular mechanisms by which nerve growth factor (NGF) regulates hypoxia-inducible factor-1α (HIF-1α) and vascular endothelial growth factor (VEGF) production. The mRNA and protein levels of VEGF secretion from HaCaT cells by NGF were increased in a concentration-dependent manner. In addition, the NGF- induced increase in VEGF is accompanied by an increase in HIF-1α, but not HIF-2α or HIF-1β. However, this increase is abrogated by pretreatment with a mammalian target of rapamycin (mTOR) inhibitor rapamycin. Pharmacologic inhibitors of the Trk tyrosine kinase, PI-3 kinase, and mTOR pathways prevent NGF-stimulated increases in HIF-1α and VEGF. Mutation of the siRNA-mediated silencing of HIF-1α expression blocks NGF-induced increases in VEGF transcription. Our study indicates that NGF regulates the expression of VEGF through the PI3K/mTOR signaling pathway in human HaCaT keratinocytes.

  1. HA/nylon 6,6 porous scaffolds fabricated by salt-leaching/solvent casting technique: effect of nano-sized filler content on scaffold properties.

    Science.gov (United States)

    Mehrabanian, Mehran; Nasr-Esfahani, Mojtaba

    2011-01-01

    Nanohydroxyapatite (n-HA)/nylon 6,6 composite scaffolds were produced by means of the salt-leaching/solvent casting technique. NaCl with a distinct range size was used with the aim of optimizing the pore network. Composite powders with different n-HA contents (40%, 60%) for scaffold fabrication were synthesized and tested. The composite scaffolds thus obtained were characterized for their microstructure, mechanical stability and strength, and bioactivity. The microstructure of the composite scaffolds possessed a well-developed interconnected porosity with approximate optimal pore size ranging from 200 to 500 μm, ideal for bone regeneration and vascularization. The mechanical properties of the composite scaffolds were evaluated by compressive strength and modulus tests, and the results confirmed their similarity to cortical bone. To characterize bioactivity, the composite scaffolds were immersed in simulated body fluid for different lengths of time and results monitored by scanning electron microscopy and energy dispersive X-ray microanalysis to determine formation of an apatite layer on the scaffold surface.

  2. Epidermal Growth Factor Receptor Transactivation Is Required for Mitogen-Activated Protein Kinase Activation by Muscarinic Acetylcholine Receptors in HaCaT Keratinocytes

    Directory of Open Access Journals (Sweden)

    Wymke Ockenga

    2014-11-01

    Full Text Available Non-neuronal acetylcholine plays a substantial role in the human skin by influencing adhesion, migration, proliferation and differentiation of keratinocytes. These processes are regulated by the Mitogen-Activated Protein (MAP kinase cascade. Here we show that in HaCaT keratinocytes all five muscarinic receptor subtypes are expressed, but M1 and M3 are the subtypes involved in mitogenic signaling. Stimulation with the cholinergic agonist carbachol leads to activation of the MAP kinase extracellular signal regulated kinase, together with the protein kinase Akt. The activation is fully dependent on the transactivation of the epidermal growth factor receptor (EGFR, which even appears to be the sole pathway for the muscarinic receptors to facilitate MAP kinase activation in HaCaT cells. The transactivation pathway involves a triple-membrane-passing process, based on activation of matrix metalloproteases, and extracellular ligand release; whereas phosphatidylinositol 3-kinase, Src family kinases or protein kinase C do not appear to be involved in MAP kinase activation. Furthermore, phosphorylation, ubiquitination and endocytosis of the EGF receptor after cholinergic transactivation are different from that induced by a direct stimulation with EGF, suggesting that ligands other than EGF itself mediate the cholinergic transactivation.

  3. Hesperidin ameliorates UV radiation-induced skin damage by abrogation of oxidative stress and inflammatory in HaCaT cells.

    Science.gov (United States)

    Li, Min; Lin, Xiang-Fei; Lu, Jie; Zhou, Bing-Rong; Luo, Dan

    2016-12-01

    Ultraviolet A (UVA) radiation contributes to skin photoaging. Hesperidin which is a flavanone glycoside found in citrus fruit peels, have been intensively studied for their UVA-protective activity, but its effects and mechanisms on UVA irradiation-induced inflammation and oxidative stress have never been described. Thus, the purpose of this study was to evaluate the effects of hesperidin in skin oxidative stress and inflammation induced by UVA irradiation. In this study, we firstly examined whether hesperidin may exert direct protective effects on the UVA-induced in human keratinocytes (HaCaT) cell injury in vitro. Cell viability was determined by MTT assay. The levels of superoxide dismutase (SOD), malondialdehyde (MDA) and total antioxidative capacity (T-AOC) were measured by using a commercially available kits. Quantitative reverse transcriptase PCR (qRT-PCR) and ELISA were used to determine messenger RNA (mRNA) and protein levels of the tumor necrosis factor (TNF)-α, interleukin (IL)-1β and IL-6. UVA significantly decreased the cell viability (Phesperidin (220μg/ml) significantly reduced UVA-induced oxidative stress and inflammatory response. In conclusion, hesperidin treatment effectively protected HaCaT keratinocytes from these UVA radiation-induced skin injuries, suggesting that the underlying mechanism involves the anti-oxidative and anti-inflammatory capacities, it is possible to be used as a sunscreen agent. Copyright © 2016. Published by Elsevier B.V.

  4. Evaluation of Bio-Rad D-100 HbA1c analyzer against Tosoh G8 and Menarini HA-8180V

    Directory of Open Access Journals (Sweden)

    José María Maesa

    2016-08-01

    Full Text Available Objectives: To evaluate the Bio-Rad D-100®, an HPLC analyzer for glycated hemoglobin (HbA1c determination, and to compare its performance with the Menarini HA-8180V® and Sysmex G8®. Methods: Method comparison was performed according to Clinical and Laboratory Standards Institute (CLSI EP9-A2 guidelines. We selected 100 samples from the routine laboratory workload and analyzed them in duplicate with the three analyzers. The imprecision study was performed according to CLSI EP5-A2 guidelines for both inter-assay and intra-assay variability. Bias was assessed with external quality control material. To establish linearity, CLSI EP6-A protocol was followed. Results: Method comparison (95% confidence intervals in parentheses: D-100 vs G8: Passing-Bablok regression; y=0.973(0.963–0.983×−0.07(−0.07−0.069; r=0.9989. Bland-Altman mean difference: −0.229%HbA1c (−0.256: −0.202; Relative bias plot: D-100/G8 vs D100-G8 mean ratio=0.971(0.967−0.975. D-100 vs HA-8180V: Passing-Bablok regression; y=0.944(0.932–0.958×−0.078(0.024−0.173; r=0.9989. Bland-Altman mean difference: −0.363%HbA1c (−0.401: −0.325; Relative bias plot D-100/HA-8180V vs D100-HA-8180V mean ratio=0.955(0.952−0.958. Inter-assay coefficient of variation (CV: 0.81%. Intra-assay CV: 1.04% (low level, and 0.78% (high level. Bias against target value=2.332%. Linearity: r2=0.998 in the concentration range 4.4−13.9%HbA1c. Carry-over: 0.0024%. Conclusions: The Bio-Rad D-100 shows good correlation with G8 and HA-8180V. There is a small proportional systematic difference (2.7% and 5.6%, respectively in both comparisons. Inter and intra-assay CVs are both lower than the lowest CV obtained in studies performed with D-100 and other instruments. Keywords: Glycated hemoglobin, High performance liquid chromatography, Analyzer, Intra-assay variability, Inter-assay variability

  5. Ethanol extracts of Sanguisorba officinalis L. suppress TNF-α/IFN-γ-induced pro-inflammatory chemokine production in HaCaT cells.

    Science.gov (United States)

    Yang, Ju-Hye; Hwang, Youn-Hwan; Gu, Min-Jung; Cho, Won-Kyung; Ma, Jin Yeul

    2015-12-15

    Sanguisorba officinalis L. (SOL) is a perennial plant widely distributed in Asia, its roots are well-known as a traditional herbal medicine to treat burns, chronic intestinal infections, scalds, and inflammation in Korea. Also, the roots of SOL are used for treatment of many types of allergic skin diseases, including urticarial, eczema, and allergic dermatitis. In this study we investigated the underlying mechanism of anti-inflammatory effect of an ethanol extract of SOL roots (ESOL). The ability of ESOL to inhibit inflammatory skin disorder was tested in human keratinocyte HaCaT cells. Viability test using MTT assay were used to determine non-cytotoxic concentrations of ESOL on HaCaT cells. ESOL-mediated inhibition of the tumor necrosis factor (TNF)-α/interferon (IFN)-γ-induced production of pro-inflammatory chemokines-such as macrophage-derived chemokine (MDC), regulated on activation, normal T-cell expressed and secreted (RANTES), interleukin (IL)-8, and thymus and activation regulated chemokine (TARC)-at the mRNA level was determined by real-time reverse transcription-polymerase chain reaction (RT-PCR). The ability of ESOL to reduce the expression of pro-inflammatory marker proteins was evaluated by Western blot analysis and immunocytochemistry. ESOL reduced the production of MDC, RANTES, IL-8, and TARC in HaCaT cells stimulated with TNF-α/IFN-γ at both protein and mRNA levels. ESOL also suppressed the phosphorylation of signal transducer and activator of transcription (STAT)-1, extracellular signal-regulated kinase (ERK), and inhibited both nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-alpha (IκB-α) degradation and the nuclear translocation of NF-κB/p65. ESOL exerts anti-inflammatory effects by suppressing the expression of TNF-α/IFN-γ-stimulated chemokines and pro-inflammatory molecules via a blockade NF-κB, STAT-1, and ERK activation. Our results suggest the preventive potential of ESOL as a herbal medicine for the

  6. A novel method to generate monocyte-derived dendritic cells during coculture with HaCaT facilitates detection of weak contact allergens in cosmetics.

    Science.gov (United States)

    Frombach, Janna; Sonnenburg, Anna; Krapohl, Björn-Dirk; Zuberbier, Torsten; Stahlmann, Ralf; Schreiner, Maximilian

    2017-01-01

    The in vitro sensitization assay LCSA (Loose-fit Coculture-based Sensitization Assay) has proved reliable for the detection of contact sensitizers in the past. However, the coculture of human monocyte-derived dendritic cells (DCs) with primary human keratinocytes (KCs) in serum-free medium is relatively complex compared to other sensitization assays which use continuous cell lines. To facilitate high-throughput screening of chemicals, we replaced KCs with the