WorldWideScience

Sample records for gy boninite-like metabasalts

  1. The Hadean upper mantle conundrum: evidence for source depletion and enrichment from Sm-Nd, Re-Os, and Pb isotopic compositions in 3.71 Gy boninite-like metabasalts from the Isua Supracrustal Belt, Greenland

    Science.gov (United States)

    Frei, Robert; Polat, Ali; Meibom, Anders

    2004-04-01

    Here we present Sm-Nd, Re-Os, and Pb isotopic data of carefully screened, least altered samples of boninite-like metabasalts from the Isua Supracrustal Belt (ISB, W Greenland)that characterize their mantle source at the time of their formation. The principal observations of this study are that by 3.7-3.8 Ga melt source regions existed in the upper mantle with complicated enrichment/depletion histories. Sm-Nd isotopic data define a correlation line with a slope corresponding to an age of 3.69 ± 0.18 Gy and an initial εNd value of +2.0 ± 4.7. This Sm-Nd age is consistent with indirect (but more precise) U-Pb geochronological estimates for their formation between 3.69-3.71 Ga. Relying on the maximum formation age of 3.71 Gy defined by the external age constraints, we calculate an average εNd [T = 3.71 Ga] value of +2.2 ± 0.9 (n = 18, 1σ) for these samples, which is indicative of a strongly depleted mantle source. This is consistent with the high Os concentrations, falling in the range between 1.9-3.4 ppb, which is similar to the estimated Os concentration for the primitive upper mantle. Re-Os isotopic data (excluding three outliers) yield an isochron defining an age of 3.76 ± 0.09 Gy (with an initial γOs value of 3.9 ± 1.2), within error consistent with the Sm-Nd age and the indirect U-Pb age estimates. An average initial γOs [T = 3.71 Ga] value of + 4.4 ± 1.2 (n = 8; 2σ) is indicative of enrichment of their source region during, or prior to, its melting. Thus, this study provides the first observation of an early Archean upper mantle domain with a distinctly radiogenic Os isotopic signature. This requires a mixing component characterized by time-integrated suprachondritic Re/Os evolution and a Os concentration high enough to strongly affect the Os budget of the mantle source; modern sediments, recycled basaltic crust, or the outer core do not constitute suitable candidates. At this point, the nature of the mantle or crustal component responsible for the

  2. The Triassic metabasalts of Dudin Krš, near Kosovska Mitrovica, Serbia

    Directory of Open Access Journals (Sweden)

    Memović Emin

    2003-01-01

    Full Text Available This paper presents the geochemical characteristics of the metabasalts of Dudin Krš, near Kosovska Mitrovica. The Dudin Krš is the easternmost occurrence of Middle Triassic rift-related volcanic rocks in the Dinarides. Generally, these rocks show similarities to other Triassic volcanic rocks of the Dinarides. They are high-magnesian, ol and ne-normative basalts, with low Zr/Nb and medium/low Ti/Zr and Ti/Y ratios. They exhibit transitional geochemical characteristics, between E-MORB and subalkaline basalts of continental rift zones. Their presence and geochemical affinity is evidence of rifting processes along the continental slope of the Adria block during Middle Triassic.

  3. Geological constraints on the thermodynamic properties of the stilbite - stellerite solid solution in low-grade metabasalts

    Science.gov (United States)

    Fridriksson, Thráinn; Neuhoff, Philip S.; Arnórsson, Stefán; Bird, Dennis K.

    2001-11-01

    Standard state thermodynamic data for stilbite (Ca2NaAl5Si13O36∗16H2O) and stellerite (Ca2Al4Si14O36∗14H2O), together with mixing properties of the stilbite -stellerite solid solution (stilbite SS) are derived through assessment of geological observations of stilbite SS compositions in metabasalts, experimental phase equilibria, and calorimetric observations. Measured compositions of stilbite SS in Tertiary metabasalts in Iceland and Icelandic geothermal systems change systematically towards the stellerite endmember with increasing stratigraphic depth and temperature. Standard molal volumes, heat capacities, and entropies for the endmembers of the solid solution are derived through critical review of published crystallographic and calorimetric data for natural stilbite SS. Standard molal Gibbs energies of formation at 298.15 K and 1 bar for stilbite (-4,946,475cal mol-1) and stellerite (-4,762,036 cal mol-1) and the mixing properties of the solid solution are retrieved from observed phase- and compositional-relations in metabasalts at Berufjördur, Iceland, measured temperatures of zeolite mineral distribution in active geothermal systems, and published observations of reversed phase equilibria. Mixing in stilbite SS can be described with an athermal solid solution model. Thermodynamic data resulting from our analysis provide close correlation between compositions of stilbite SS in Icelandic geothermal systems predicted from compositions of geothermal solutions and observed compositions of these minerals in low-grade metabasalts of Iceland, as well as the observed temperature of the stilbite SS to laumontite (leonhardite) transition in Icelandic geothermal systems. Stilbite SS composition in metabasalts is a sensitive function of temperature, fluid composition, coexisting minerals (especially silica polymorphs) and geothermal gradient.

  4. Intra-slab COH fluid fluxes evidenced by fluid-mediated decarbonation of lawsonite eclogite-facies altered oceanic metabasalts

    Science.gov (United States)

    Vitale Brovarone, Alberto; Chu, Xu; Martin, Laure; Ague, Jay J.; Monié, Patrick; Groppo, Chiara; Martinez, Isabelle; Chaduteau, Carine

    2018-04-01

    The interplay between the processes controlling the mobility of H2O and C-bearing species during subduction zone metamorphism exerts a critical control on plate tectonics and global volatile recycling. Here we present the first study on fresh, carbonate-bearing, lawsonite eclogite-facies metabasalts from Alpine Corsica, France, which reached the critical depths at which important devolatilization reactions occur in subducting slabs. The studied samples indicate that the evolution of oceanic crustal sequences subducted under present-day thermal regimes is dominated by localized fluid-rock interactions that are strongly controlled by the nature and extent of inherited (sub)seafloor hydrothermal processes, and by the possibility of deep fluids to be channelized along inherited or newly-formed discontinuities. Fluid channelization along inherited discontinuities controlled local rehydration and dehydration/decarbonation reactions and the stability of carbonate and silicate minerals at the blueschist-eclogite transition. Fluid-mediated decarbonation was driven by upward, up-temperature fluid flow in the inverted geothermal gradient of a subducting oceanic slab, a process that has not been documented in natural samples to date. We estimate that the observed fluid-rock reactions released 20-60 kg CO2 per m3 of rock (i.e. 0.7-2.1 wt% CO2), which is in line with the values predicted from decarbonation of metabasalts in open systems at these depths. Conversely, the estimated time-integrated fluid fluxes (20-50 t/m2) indicate that the amount of carbon transported by channelized fluid flow within the volcanic part of subducting oceanic plates is potentially much higher than previous numerical estimates, testifying to the percolation of C-bearing fluids resulting from devolatilization/dissolution processes operative in large reservoirs.

  5. Metabasalts from the Mid-Atlantic Ridge: new insights into hydrothermal systems in slow-spreading crust

    Science.gov (United States)

    Gillis, Kathryn M.; Thompson, Geoffrey

    1993-12-01

    An extensive suite of hydrothermally altered rocks were recovered by Alvin and dredging along the MARK [Mid-Atlantic Ridge, south of the Kane Fracture Zone (23 24°N)] where detachment faulting has provided a window into the crustal component of hydrothermal systems. Rocks of basaltic composition are altered to two assemblages with these characteristics: (i) type I: albitic plagioclase (An02 10)+mixed-layer smectite/chlorite or chlorite±actinolite±quartz±sphene, 20% of the clinopyroxene is altered, and Cu and Zn are leached. The geochemical signature of these alteration types reflects the relative proportion and composition of secondary minerals, and the degree of alteration of primary phases, and does not show simple predictive relationships. Element mobilities indicate that both alteration types formed at low water/rock ratios. The MARK assemblages are typical of the greenschist and transition to the amphibolite facies, and represent two distinct, albeit overlapping, temperature regimes: type I-180 to 300°C and type II-250 to 450°C. By analogy with DSDP/ODP Hole 504B and many ophiolites, the MARK metabasalts were altered within the downwelling limb of a hydrothermal cell and type I and II samples formed in the upper and lower portions of the sheeted like complex, respectively. Episodic magmatic and hydrothermal events at slow-spreading ridges suggest that these observed mineral assemblages represent the cumulative effects of more than one hydrothermal event. Groundmass and vein assemblages in the MARK metabasalts indicate either that alteration conditions did not change during successive hydrothermal events or that these assemblages record only the highest temperature event. Lack of retrograde reactions or overprinting of lower temperature assemblages (e.g., zeolites) suggests that there is a continuum in alteration conditions while crustal segments remain in the ridge axis environment. The type II samples may be representative of the reaction zone where

  6. Geochemistry of the Shuksan greenschists and blueschists, North Cascades, Washington: Variably fractionated and altered metabasalts of oceanic affinity

    Science.gov (United States)

    Dungan, M. A.; Vance, J. A.; Blanchard, D. P.

    1983-06-01

    The Shuksan schist comprises a structurally coherent, metabasaltic member of the Easton Formation, the uppermost allochthon (Shuksan thrust plate) in the thrust system of the western North Cascades of Washington State. Late Jurassic metamorphism at moderately high P/T produced interlayering of actinolite-bearing greenschist assemblages with blue amphibole-bearing rocks. Major and trace element analyses of twelve greenschist and blueschist samples have been used to establish similarities between the basaltic protolith and moderately to strongly fractionated Type I MORB, to distinguish the effects of seafloor alteration superimposed on the primary igneous chemistry, and to evaluate the origin and nature of the chemical controls which produced the two mineral assemblages. The twelve analyzed samples exhibit moderate to strong LREE depletion, and characteristically low concentrations of other non-labile trace elements such as Nb, Th and Hf. The highly to moderately incompatible elements Ti, P, Nb, Zr, Hf, Y, Sc, and the REE vary by factors of 1.5 to 3.5 within the suite in a systematic pattern, increasing smoothly with increasing total iron. The relative enrichments of these elements are inversely proportional to bulk partition coefficients estimated for fractionation of basaltic magmas. The magnitude of the negative europium anomaly increases with overall incompatible element enrichment. These variations are consistent with the production of a wide spectrum of compositions by different degrees of low pressure fractionation of similar Type I MORB parent magmas. The concentrations of Sr, Rb, Na, and K vary irregularly and do not correlate with the non-labile trace elements. K and Rb are substantially elevated over typical MORB values in most samples and exhibit a consistently lower ratio (K/Rb=400 vs 1000) than fresh MORB. Concentrations of these four elements are believed to have been modified by low temperature seafloor alteration (pre-metamorphic) characterized by

  7. Neoarchean paleoweathering of tonalite and metabasalt: Implications for reconstructions of 2.69Ga early terrestrial ecosystems and paleoatmospheric chemistry

    Science.gov (United States)

    Driese, S.G.; Jirsa, M.A.; Ren, M.; Brantley, S.L.; Sheldon, N.D.; Parker, Dana C.; Schmitz, M.

    2011-01-01

    Field and laboratory investigations of a 2690.83Ma (207Pb/206Pb age of Saganaga Tonalite) unconformity exposed in outcrop in northeastern Minnesota, USA, reveal evidence for development of a deep paleoweathering profile with geochemical biosignatures consistent with the presence of microbial communities and weakly oxygenated conditions. Weathering profiles are characterized by a 5-50m thick regolith that consists of saprolitized Saganaga Tonalite and Paulson Lake succession basaltic metavolcanic rocks retaining rock structure, which is cross-cut by a major unconformity surface marking development of a successor basin infilled with alluvial deposits. The regolith and unconformity are overlain by thick conglomerate deposits that contain both intrabasinal (saprock) as well as extrabasinal detritus. Thin-section microscopy and electron microprobe analyses reveal extensive hydrolysis and sericitization of feldspars, exfoliation and chloritization of biotite, and weathering of Fe-Mg silicates and Cu-Fe sulfides; weathering of Fe-Ti oxides was relatively less intense than for other minerals and evidence was found for precipitation of Fe oxides. Geochemical analyses of the tonalite, assuming immobile TiO2 during weathering (??Ti,j), show depletion of SiO2, Al2O3, Na2O, CaO, MgO, and MnO, and to a lesser degree of K2O, relative to least-weathered parent materials. Significant Fe was lost from the tonalite. A paleoatmospheric pCO2 of 10-50 times PAL is estimated based on geochemical mass-balance of the tonalite profile and assuming a formation time of 50-500Kyr. Interpretations of metabasalt paleoweathering are complicated by additions of sediment to the profile and extensive diagenetic carbonate (dolomite) overprinting. Patterns of release of P and Fe and retention of Y and Cu in tonalite are consistent with recent laboratory experiments of granite weathering, and with the presence of acidic conditions in the presence of organic ligands (produced, for example, by a

  8. Hortobágy National Park

    Directory of Open Access Journals (Sweden)

    István Gyarmathy

    2017-06-01

    Full Text Available National parks and protected areas have an important role in protecting starry sky and the undisturbed nighttime environment. Hortobágy which is one of the darkest areas in Hungary, became an International Dark Sky Parks recently. Its significance is mostly related to the protection of the high biodiversity which is endangered by the effects of light pollution. A special monitoring program has been started to survey the nocturnal species and also to monitor the quality of the night sky using   digital cameras. Stargazing night walks are frequently organized. There is a high interest by the general public to attend these night adventures.

  9. Cerebral necrosis after 25 Gy radiotherapy in childhood followed 28 years later by 54 Gy radiotherapy

    NARCIS (Netherlands)

    Koot, Radboud W.; Stalpers, Lukas J. A.; Aronica, Eleonora; Bosch, D. Andries

    2007-01-01

    The development of brain necrosis is life-long risk of repeat radiation therapy, even after a long time interval and a moderate radiation dose. We report on a 34-year-old patient who had prophylactic cranial irradiation with 25 Gy and adjuvant chemotherapy in childhood for leukaemia and in

  10. Repairs in 104 Gy/h?

    International Nuclear Information System (INIS)

    Anon.

    1994-01-01

    In 1989 it was found that in each unit of the MAPS Candu nuclear power station in India the centre portion of the heavy water inlet manifold opposite the 300 mm inlet pipe had torn away. Equipment for remote inspection, repair and removal of debris in an area with constricted and difficult access and radiation fields of about 10 4 Gy/h was developed by Ricardo Hitec of the United Kingdom. This consists of a work performing manipulator, TV viewing systems and a posting tube manipulator for insertion of tools and debris containers into the calandria. A variety of special end effector and tools were also developed jointly with AEA Technology. A first repair campaign was carried out on Unit 1 in 1991. Following a detailed TV survey of the damage a reappraisal of the situation was undertaken and a programme of equipment enhancement carried out. In July 1992 a second repair campaign took place on Unit 2. The difficulties encountered and the degree of success achieved are described. Work proceeded at an intensive level for 14 days when the campaign was ended in view of the exhaustion both of personnel and the equipment. Although more work could have been done a major improvement had been achieved. (UK)

  11. Key technology studies of GY-20 and GY-40 High-capacity cobalt-60 transport casks

    International Nuclear Information System (INIS)

    Liu Huifang; Zhang Xin

    2012-01-01

    GY-20 and GY-40 high-capacity cobalt-60 transport casks are used to transport cobalt-60 industrial irradiators and cobalt-60 bundles. The radioactive contents have special features of high-activity and high residual heat, so only a few countries such as Canada, England and Russia have design capacity. The key technologies and corresponding solutions were studied for the design and manufacture of the cask taking into account the structural, thermal, mechanics and shield requests. A series of tests prove that the cask structure design, design criteria for lead coating structure and quality control measurements are reasonable and effective, and the cask shield integrity can be ensured for all conditions. The casks have ability to transport high-activity sealed sources safely, and the design of cask satisfies the requirement of design code and standard. It can provide reference for other B type package. (authors)

  12. Valine-spectrophotometric readout dosimeter (1 Gy-50 kGy)

    International Nuclear Information System (INIS)

    Nilekani, S.R.; Gupta, B.L.

    2005-01-01

    In this method 20 mg unirradiated/irradiated L-valine powder [(CH 3 ) 2 CH.NH 2 CH.COOH] is dissolved in 10 ml of a solution containing 4x10 -4 mol dm -3 Fe 2+ and 2.5x10 -4 mol dm -3 xylenol orange (XO) in aerated aqueous 0.060 mol dm -3 sulphuric acid (FX). The plot of absorbance at 550 nm against dose is non linear. A dose of 1-50 kGy can be measured. However, dosimeter can be sensitized in the dose range of 1 to 16 kGy by dissolving 50-mg valine powder in 10 ml of a solution which contains 5x10 -4 mol dm -3 Fe 2+ and 3x10 -4 mol dm -3 XO in aerated aqueous 0.065 mol dm -3 sulphuric acid. The plot of absorbance at 549 nm against dose is non-linear. However, dosimeter shows linear response when 500 mg unirradiated/irradiated L-valine powder is dissolved in 10 ml of a solution containing 7.5x10 -4 mol dm -3 Fe 2+ and 3x10 -4 mol dm -3 XO in aerated aqueous 0.25 mol dm -3 sulphuric acid. The plot of absorbance at 557 nm against dose is linear in the dose range of 20-400Gy and doses down to about 1 Gy can be measured using 10-cm path cells. Response of the dosimeter is independent of irradiation temperature in the temperature range 20-50 deg C. Irradiated valine powder is stable for about 1 month. The reproducibility of the method is better than ±2%. This dosimeter is very useful as transfer dosimeter for food irradiation and radiation sterilization

  13. The GETUG 70 Gy vs. 80 Gy randomized trial for localized prostate cancer: Feasibility and acute toxicity

    International Nuclear Information System (INIS)

    Beckendorf, Veronique; Guerif, Stephane; Le Prise, Elisabeth; Cosset, Jean Marc; Lefloch, Olivier; Chauvet, Bruno; Salem, Naji; Chapet, Olivier; Bourdin, Sylvain; Bachaud, Jean Marc; Maingon, Philippe; Lagrange, Jean-L.eon; Malissard, Luc; Simon, Jean-Marc; Pommier, Pascal M.D.; Hay, Men H.; Dubray, Bernard; Luporsi, Elisabeth; Bey, Pierre

    2004-01-01

    Purpose: To describe treatments and acute tolerance in a randomized trial comparing 70 Gy and 80 Gy to the prostate in patients with localized prostate cancer. Methods and materials: Between September 1999 and February 2002, 306 patients were randomized to receive 70 Gy (153 patients) or 80 Gy (153 patients) in 17 institutions. Patients exhibited intermediate-prognosis tumors. If the risk of node involvement was greater than 10%, surgical staging was required. Previous prostatectomy was excluded, and androgen deprivation was not admitted. The treatment was delivered in two steps. PTV1-including seminal vesicles, prostate, and a 1-0.5-cm margin-received 46 Gy given with a 4-field conformal technique. PTV2, reduced to prostate with the same margins, irradiated with at least 5 fields. Dose was prescribed according to ICRU recommendations in the 70 Gy group, but adapted at the 80 Gy level. Results: All patients but one in the 80 Gy arm completed the treatment. In the 70 Gy arm, the mean dose to the PTV2 was 69.5 Gy. In the 80 Gy arm, the mean dose in the PTV2 was 78.5 Gy. Acute toxicity according to Radiation Therapy Oncology Group scale during treatment was reported in 306 patients. There was no statistically significant difference between the two arms: 12% had no toxicity, 80% complained of bladder toxicity, and 70% complained of rectal symptoms. Two months after the end of treatment, 43% of the 70 Gy level and 48% of the 80 Gy level complained of side effects, including 24% and 20% of sexual disorders. There was 6% and 2% of Grade 3 urinary and rectal toxicity. Five patients required a 10-29-day suspension of the treatment. Acute Grade 2 and 3 side effects were related to PTV and CTV1 size, which was the only independent predictive factor in multivariate analysis. Toxicity was not related to the center, age, arm of treatment, or selected data from dose-volume histogram of organ at risk. Conclusion: Treatments were completed in respect to constraints. Acute toxicity

  14. Mass-balance modeling of mineral weathering rates and CO2 consumption in the forested, metabasaltic Hauver Branch watershed, Catoctin Mountain, Maryland, USA

    Science.gov (United States)

    Rice, Karen; Price, Jason R.; Szymanski, David W.

    2013-01-01

    Mineral weathering rates and a forest macronutrient uptake stoichiometry were determined for the forested, metabasaltic Hauver Branch watershed in north-central Maryland, USA. Previous studies of Hauver Branch have had an insufficient number of analytes to permit determination of rates of all the minerals involved in chemical weathering, including biomass. More equations in the mass-balance matrix were added using existing mineralogic information. The stoichiometry of a deciduous biomass term was determined using multi-year weekly to biweekly stream-water chemistry for a nearby watershed, which drains relatively unreactive quartzite bedrock.At Hauver Branch, calcite hosts ~38 mol% of the calcium ion (Ca2+) contained in weathering minerals, but its weathering provides ~90% of the stream water Ca2+. This occurs in a landscape with a regolith residence time of more than several Ka (kiloannum). Previous studies indicate that such old regolith does not typically contain dissolving calcite that affects stream Ca2+/Na+ ratios. The relatively high calcite dissolution rate likely reflects dissolution of calcite in fractures of the deep critical zone.Of the carbon dioxide (CO2) consumed by mineral weathering, calcite is responsible for approximately 27%, with the silicate weathering consumption rate far exceeding that of the global average. The chemical weathering of mafic terrains in decaying orogens thus may be capable of influencing global geochemical cycles, and therefore, climate, on geological timescales. Based on carbon-balance calculations, atmospheric-derived sulfuric acid is responsible for approximately 22% of the mineral weathering occurring in the watershed. Our results suggest that rising air temperatures, driven by global warming and resulting in higher precipitation, will cause the rate of chemical weathering in the Hauver Branch watershed to increase until a threshold temperature is reached. Beyond the threshold temperature, increased recharge would

  15. Comparison between external beam radiotherapy (70 Gy/74 Gy) and permanent interstitial brachytherapy in 890 intermediate risk prostate cancer patients

    International Nuclear Information System (INIS)

    Goldner, Gregor; Pötter, Richard; Battermann, Jan J.; Kirisits, Christian; Schmid, Maximilian P.; Sljivic, Samir; Vulpen, Marco van

    2012-01-01

    Purpose: Aim of this analysis was to compare biochemical no evidence of disease (bNED) rates in intermediate-risk prostate-cancer patients treated at two centres of excellence using different approaches: permanent interstitial brachytherapy (BT) and external beam radiotherapy (EBRT). Materials and methods: A total of 890 intermediate-risk prostate-cancer patients, who were treated from 1998 to 2008, were identified in the two local databases. In Utrecht 601 patients received I-125 BT applying a dose of 144 Gy. In Vienna 289 patients were treated by EBRT, applying a local dose of 70 Gy in 105 patients and 74 Gy in 184 patients. bNED-rates (Phoenix-definition) were assessed. Results: Median follow-up was 48 months (1–150). 5-Year actuarial bNED-rates were 81% for BT-patients and 75% for EBRT-patients (67% for 70 Gy and 82% for 74 Gy), respectively. In univariate analysis no difference between BT and EBRT could be detected. In multivariate analysis including tumour-stage, GleasonScore, initial PSA, hormonal therapy and treatment-centre (BT vs. EBRT) only T-stage, GleasonScore and PSA were found to be significant. Additional analysis including radiation dose showed the same outcome. Conclusions: Intermediate-risk prostate cancer patients treated by permanent interstitial brachytherapy show biochemical tumour-control-rates which are comparable to EBRT of 74 Gy.

  16. 45 Gy - tolerance dose spinal cord - dogma or the facts?

    International Nuclear Information System (INIS)

    Maciejewski, B.; Hliniak, A.; Danczak-Ginalska, Z.; Meder, M.; Skolyszewski, J.; Reinfuss, M.; Korzeniowski, S.; Peszynski, J.; Jassem, J.

    1993-01-01

    Dose of 45 Gy as a tolerance dose for spinal cord was questioned based on review of clinical data. Some data show that for conventional fractionation with the dose per fraction of less than 2.0 Gy spinal cord tolerance dose may arise up to 50-55 Gy. This was the base for round-table discussion and the importance of clinical and physical risk factors of postirradiation spinal cord injury was discussed and previous diseases of spinal cord, size of dose per fraction and length of irradiated spinal cord were pointed out as high risk factors. It was concluded that from clinical point of view there is no reason and on need to verify and to increase tolerance dose for spinal cord. (author)

  17. INDUCTION OF ARTIFICIAL MEIOTIC GY~OGENESIS WITH ...

    African Journals Online (AJOL)

    BSN

    INDUCTION OF ARTIFICIAL MEIOTIC GY~OGENESIS WITH. ULTRAVIOLET RAYS IN THE AFRICA:" CATFISH, CI.ARIAS. ANGUILLARIS. ABSTRACT. P.O. ALUKO. National Institute for Freshwater Fisheries. Research, P.M.B. 6006, New Bussa. Artificial gynogenesis was induced in Clarias a11gw aris ) fenilizing the eggs ...

  18. Lowy, Schiller win 2018 Szent-Györgyi Prize

    Science.gov (United States)

    A press release announcing that NCI scientists Douglas R. Lowy and John T. Schiller will receive the 2018 Szent-Györgyi Prize for Progress in Cancer Research from the National Foundation for Cancer Research for their work on HPV vaccines.

  19. Biodegradation polyurethane derived from vegetable oil irradiated with gamma rays 25 kGy and 100 kGy; Biodegradacao de poliuretano derivado de oleo vegetal irradiado com raios gama 25 kGy e 100 kGy

    Energy Technology Data Exchange (ETDEWEB)

    Santos, Antonia M. dos, E-mail: amsantos@rc.unesp.br [Universidade Estadual Paulista - Unesp, Rio Claro, SP (Brazil); Claro Neto, Salvador [Universidade de Sao Paulo - USP, Campus de Sao Carlos, SP (Brazil); Azevedo, Elaine C. de [Universidade Federal do Parana, Campus de Curitiba, PR (Brazil)

    2011-07-01

    The environment requires polymers that can be degraded by the action of microorganisms. In this work was studied the biodegradation of polyurethane samples derived from vegetable oil (castor oil), which were irradiated with gamma rays 25 kGy and 100 kGy compared with the same polyurethane without being irradiated. Biodegradation of polyurethane was carried out in culture medium containing the fungus Aspergillus niger by 146 days and the result was evaluated using the technique of thermogravimetric analysis, where there was a change of behavior of the curves TGA / DTG occurred indicating that chemical modifications of molecules present in the structure of the polymer chain, thus confirming that the material has undergone the action of microorganisms. (author)

  20. Services of Economic Development Organisations in Győr

    Directory of Open Access Journals (Sweden)

    Adrienn Reisinger

    2017-12-01

    Full Text Available Economic development of a municipality is highly depended on organizations and institutions, which services target local entrepreneurs and other economic actors. In the summer of 2015 we have collected and mapped the services of organizations with the function of economic development in the Hungarian city, Győr. Through our research we could identify the services and the characteristics of linkages and cooperation of the economic development organizations (EDOs. Most important findings of the study are the followings: activity of the organizations has a wide range. Some of them are presented in more organizations at the same time. Level of diversification is quite low. Directions of cooperation are mainly based on personal or ad hoc relations. We conducted that EDOs know about each other, despite of this fact the number of linkages is low. In this paper we provide findings about Győr, but the results can be used for other settlements’ economic development, too.

  1. Biodegradation polyurethane derived from vegetable oil irradiated with gamma rays 25 kGy and 100 kGy

    International Nuclear Information System (INIS)

    Santos, Antonia M. dos; Claro Neto, Salvador; Azevedo, Elaine C. de

    2011-01-01

    The environment requires polymers that can be degraded by the action of microorganisms. In this work was studied the biodegradation of polyurethane samples derived from vegetable oil (castor oil), which were irradiated with gamma rays 25 kGy and 100 kGy compared with the same polyurethane without being irradiated. Biodegradation of polyurethane was carried out in culture medium containing the fungus Aspergillus niger by 146 days and the result was evaluated using the technique of thermogravimetric analysis, where there was a change of behavior of the curves TGA / DTG occurred indicating that chemical modifications of molecules present in the structure of the polymer chain, thus confirming that the material has undergone the action of microorganisms. (author)

  2. Photometry of the long period dwarf nova GY Hya

    Science.gov (United States)

    Bruch, Albert; Monard, Berto

    2017-08-01

    Although comparatively bright, the cataclysmic variable GY Hya has not attracted much attention in the past. As part of a project to better characterize such systems photometrically, we observed light curves in white light, each spanning several hours, at Bronberg Observatory, South Africa, in 2004 and 2005, and at the Observatório do Pico dos Dias, Brazil, in 2014 and 2016. These data permit to study orbital modulations and their variations from season to season. The orbital period, already known from spectroscopic observations of Peters and Thorstensen (2005), is confirmed through strong ellipsoidal variations of the mass donor star in the system and the presence of eclipses of both components. A refined period of 0.34723972 (6) days and revised ephemeries are derived. Seasonal changes in the average orbital light curve can qualitatively be explained by variations of the contribution of a hot spot to the system light together with changes of the disk radius. The amplitude of the ellipsoidal variations and the eclipse contact phases permit to put some constraints on the mass ratio, orbital inclination and the relative brightness of the primary and secondary components. There are some indications that the disk radius during quiescence, expressed in units of the component separation, is smaller than in other dwarf novae.

  3. Re-irradiation with 36 Gy (1.5 Gy Twice Daily) Plus Paclitaxel for Advanced Recurrent and Previously Irradiated SCCHN is Feasible.

    Science.gov (United States)

    Rades, Dirk; Bartscht, Tobias; Idel, Christian; Hakim, Samer G

    2018-01-01

    Many patients developing a loco-regional recurrence of squamous cell carcinoma of head and neck (SCCHN) have a poor prognosis. Often, recurrences are unresectable, and patients require a second course of radiotherapy or chemoradiation. We present an approach of chemoradiation including mainly 30 Gy of radiotherapy (1.5 Gy twice daily) plus concurrent paclitaxel. To further improve the prognoses of these patients, we increased the radiation dose from 30 to 36 Gy. In four patients with recurrent and previously irradiated SCCHN (60-70 Gy) chemoradiation was carried out using 36 Gy (1.5 Gy twice daily) and concurrent paclitaxel (4-5 times 20-25 mg/m 2 ). One-year loco-regional control rates were 75% inside and 67% outside re-irradiated regions. One-year survival was 50%, and median survival time 11 months. Toxicities were mild (grade 0-2). Re-irradiation with 36 Gy (1.5 Gy twice daily) plus paclitaxel appears feasible and may lead to promising outcomes. This study is preceding a phase I trial. Copyright© 2018, International Institute of Anticancer Research (Dr. George J. Delinasios), All rights reserved.

  4. Interaction of 2-Gy Equivalent Dose and Margin Status in Perioperative High-Dose-Rate Brachytherapy

    International Nuclear Information System (INIS)

    Martinez-Monge, Rafael; Cambeiro, Mauricio; Moreno, Marta; Gaztanaga, Miren; San Julian, Mikel; Alcalde, Juan; Jurado, Matias

    2011-01-01

    Purpose: To determine patient, tumor, and treatment factors predictive of local control (LC) in a series of patients treated with either perioperative high-dose-rate brachytherapy (PHDRB) alone (Group 1) or with PHDRB combined with external-beam radiotherapy (EBRT) (Group 2). Patient and Methods: Patients (n = 312) enrolled in several PHDRB prospective Phase I-II studies conducted at the Clinica Universidad de Navarra were analyzed. Treatment with PHDRB alone, mainly because of prior irradiation, was used in 126 patients to total doses of 32 Gy/8 b.i.d. or 40 Gy/10 b.i.d. treatments after R0 or R1 resections. Treatment with PHDRB plus EBRT was used in 186 patients to total doses of 16 Gy/4 b.i.d. or 24 Gy/6 b.i.d. treatments after R0 or R1 resections along with 45 Gy of EBRT with or without concomitant chemotherapy. Results: No dose-margin interaction was observed in Group 1 patients. In Group 2 patients there was a significant interaction between margin status and 2-Gy equivalent (Eq2Gy) dose (p = 0.002): (1) patients with negative margins had 9-year LC of 95.7% at Eq2Gy = 62.9Gy; (2) patients with close margins of >1 mm had 9-year LC of 92.4% at Eq2Gy = 72.2Gy, and (3) patients with positive/close <1-mm margins had 9-year LC of 68.0% at Eq2Gy = 72.2Gy. Conclusions: Two-gray equivalent doses ≥70 Gy may compensate the effect of close margins ≥1 mm but do not counterbalance the detrimental effect of unfavorable (positive/close <1 mm) resection margins. No dose-margin interaction is observed in patients treated at lower Eq2Gy doses ≤50 Gy with PHDRB alone.

  5. Comparison of seed brachytherapy or external beam radiotherapy (70 Gy or 74 Gy) in 919 low-risk prostate cancer patients

    Energy Technology Data Exchange (ETDEWEB)

    Goldner, G.; Poetter, R.; Schmid, M.P.; Kirisits, C. [University Hospital of Vienna (Austria). Dept. of Radiotherapy and Radiobiology; Battermann, J.J.; Sljivic, S.; Vulpen, M. van [University Medical Center Utrecht (Netherlands). Dept. of Radiation Oncology

    2012-04-15

    The aim of this analysis was to compare the biochemical no evidence of disease (bNED) rates in low-risk prostate cancer patients treated at two centers of excellence using different approaches: seed brachytherapy (BT) and external beam radiotherapy (EBRT). Materials and methods: A total of 919 low-risk prostate cancer patients, treated from 1998-2008, were identified in the two databases. In Utrecht, 667 patients received I-125 BT applying a dose of 144 Gy. In Vienna, 252 patients were treated with EBRT, applying a local dose of 70 Gy in 82 patients and 74 Gy in 170 patients. bNED rates (Phoenix definition) were assessed. Results: The median follow-up was 46 months (range 1-148 months). The 5-year actuarial bNED rates were 94% for BT patients and 88% for EBRT patients (p = 0.002) - 84% for patients receiving 70 Gy and 91% for patients receiving 74 Gy, respectively. In the univariate analysis, patients receiving 70 Gy showed significantly worse outcome compared to BT (p = 0.001) and a difference close to significance compared to 74 Gy (p = 0.06). In the multivariate analysis including tumor stage, Gleason score, initial PSA, hormonal therapy, and dose, patients receiving 70 Gy EBRT showed significantly worse bNED rates compared to BT patients. Conclusion: Low-risk prostate cancer patients receiving 74 Gy by EBRT show comparable biochemical control rates to patients receiving seed brachytherapy, whereas patients receiving 70 Gy show significantly worse outcome. (orig.)

  6. Acute and late complications after radiotherapy for prostate cancer: Results of a multicenter randomized trial comparing 68 Gy to 78 Gy

    International Nuclear Information System (INIS)

    Peeters, Stephanie T.H.; Heemsbergen, Wilma D.; Putten, Wim L.J. van; Slot, Annerie; Tabak, Hans; Mens, Jan Willem; Lebesque, Joos V.; Koper, Peter C.M.

    2005-01-01

    Purpose: To compare acute and late gastrointestinal (GI) and genitourinary (GU) side effects in prostate cancer patients randomized to receive 68 Gy or 78 Gy. Methods and materials: Between June 1997 and February 2003, 669 prostate cancer patients were randomized between radiotherapy with a dose of 68 Gy and 78 Gy, in 2 Gy per fraction and using three-dimensional conformal radiotherapy. All T stages with prostate-specific antigen (PSA) 120 days) was scored according to the slightly adapted RTOG/European Organization for Research and Treatment of Cancer (EORTC) criteria. Results: The median follow-up time was 31 months. For acute toxicity no significant differences were seen between the two randomization arms. GI toxicity Grade 2 and 3 was reported as the maximum acute toxicity in 44% and 5% of the patients, respectively. For acute GU toxicity, these figures were 41% and 13%. No significant differences between both randomization arms were seen for late GI and GU toxicity, except for rectal bleeding requiring laser treatment or transfusion (p = 0.007) and nocturia (p = 0.05). The 3-year cumulative risk of late RTOG/EORTC GI toxicity grade ≥2 was 23.2% for 68 Gy, and 26.5% for 78 Gy (p = 0.3). The 3-year risks of late RTOG/EORTC GU toxicity grade ≥2 were 28.5% and 30.2% for 68 Gy and 78 Gy, respectively (p = 0.3). Factors related to acute GI toxicity were HT (p < 0.001), a higher dose-volume group (p = 0.01), and pretreatment GI symptoms (p = 0.04). For acute GU toxicity, prognostic factors were: pretreatment GU symptoms (p < 0.001), HT (p = 0.003), and prior transurethral resection of the prostate (TURP) (p = 0.02). A history of abdominal surgery (p < 0.001) and pretreatment GI symptoms (p = 0.001) were associated with a higher incidence of late GI grade ≥2 toxicity, whereas HT (p < 0.001), pretreatment GU symptoms (p < 0.001), and prior TURP (p = 0.006) were prognostic factors for late GU grade ≥2. Conclusions: Raising the dose to the prostate from 68 Gy to

  7. Influence of neuraminidase and X-ray irradiation (2 Gy and 8 Gy) on microvilli and membrane invaginations of Ehrlich ascites tumor cells in monolayer culture

    International Nuclear Information System (INIS)

    Laudenbach, G.; Baganz, O.; Pfab, R.; Hess, F.; Schachtschabel, D.O.

    1987-01-01

    A monolayer culture (Eagle basal medium plus 10% of fetal calf serum) of Ehrlich ascites tumor cells was exposed to X-radiation with 2 Gy and 8 Gy and treated with Vibrio cholerae neuraminidase alone or combined with sublethal X-ray irradiation (2 Gy). Pictures of the Ehrlich ascites tumor cells taken with the electron microscope were investigated in order to find out any cell surface modifications due to membrane invaginations and microvilli. The results showed that the rate of microvilli as well as that of membrane invaginations became higher with the increasing X-ray dose (2 Gy; 8 Gy). Following to neuraminidase treatment there was a considerable augmentation of membran invaginations as compared to control cells, whereas the number of microvilli was slightly reduced. As it has been already described before, the influence of neuraminidase produced an increased endocytosis activity and a strengthening of the cytoskeleton. Combined treatment with neuraminidase and sublethal X-radiation (2 Gy) caused a higher rate of membrane invaginations than each method alone; the number of microvilli was slightly increased by combined treatment. The conclusion is drawn that these structure modifications are due to reparation processes induced by radiation on the one hand and to an enzymic action of neuraminidase on the cell surface on the other hand. (orig.) [de

  8. Gamma Radiation (5-10 Gy) Impairs Neuronal Function in the Guinea Pig Hippocampus

    Science.gov (United States)

    1993-01-01

    Radiation (5-10 Gy) Impairs Neuronal Function in the Guinea Pig Hippocampus TERRY C. PELLMAR AND DENNIS L. LEPINSKI Ph.vsiology Department..Irmned Forces...L. Gamma Radiation ioral effects. Within hours of irradiation with 10 Gy and (5- 10 Gy) Impairs Neuronal Function in the Guinea Pig Hippo- less...acti v- Guinea pigs were exposed to 5 and 10 Gy ’y radiation. Hippo- ity (9) are evident. campal brain slices were isolated 30 min, I day, 3 days and 5

  9. Comparison of 1 x 8 Gy and 10 x 3 Gy for functional outcome in patients with metastatic spinal cord compression

    Energy Technology Data Exchange (ETDEWEB)

    Rades, Dirk [Department of Radiation Oncology, University Hospital Hamburg-Eppendorf, Hamburg (Germany); Stalpers, Lukas J.A. [Department of Radiatiotherapy, Academic Medical Center, Amsterdam (Netherlands); Hulshof, Maarten C [Department of Radiatiotherapy, Academic Medical Center, Amsterdam (Netherlands); Borgmann, Kerstin [Department of Radiation Oncology, Section Radiobiology, University Hospital Hamburg-Eppendorf, Hamburg (Germany); Karstens, Johann H [Department of Radiation Oncology, Hannover Medical School, Hannover (Germany); Koning, Caro C.E. [Department of Radiatiotherapy, Academic Medical Center, Amsterdam (Netherlands); Alberti, Winfried [Department of Radiation Oncology, University Hospital Hamburg-Eppendorf, Hamburg (Germany)

    2005-06-01

    Purpose: Since life expectancy is markedly reduced in patients with metastatic spinal cord compression (MSCC), a short and effective radiation schedule is desired. This study investigates a reduction of the overall treatment time to only one day by comparing 1 x 8 Gy to the multi-fractionated 10 x 3 Gy for functional outcome. Methods and materials: Data of 204 patients, treated for MSCC with either 1 x 8 Gy (n = 96) or 10 x 3 Gy (n = 108), were analyzed retrospectively. Motor function and ambulatory status were evaluated before and up to 24 weeks after RT. A multivariate analysis (nominal regression) was performed including radiation schedule, performance status, age, irradiated vertebra, and relevant prognostic factors (histology, ambulatory status, time of developing motor deficits). Improvement of motor deficits was selected as basic category and compared with no change and deterioration. Results: Univariate analysis showed no significant difference between the schedules for post-treatment motor function and ambulatory rates. Multivariate analysis demonstrated a significant effect on functional outcome for the prognostic factors, but not for the radiation schedule (p = 0.853 for no change, p = 0.237 for deterioration). Conclusions: Our data suggest the two fractionation schedules to be comparably effective for functional outcome. Thus, 1 x 8 Gy should be considered for patients with a poor survival prognosis.

  10. Comparison of 1 x 8 Gy and 10 x 3 Gy for functional outcome in patients with metastatic spinal cord compression

    International Nuclear Information System (INIS)

    Rades, Dirk; Stalpers, Lukas J.A.; Hulshof, Maarten C.; Borgmann, Kerstin; Karstens, Johann H.; Koning, Caro C.E.; Alberti, Winfried

    2005-01-01

    Purpose: Since life expectancy is markedly reduced in patients with metastatic spinal cord compression (MSCC), a short and effective radiation schedule is desired. This study investigates a reduction of the overall treatment time to only one day by comparing 1 x 8 Gy to the multi-fractionated 10 x 3 Gy for functional outcome. Methods and materials: Data of 204 patients, treated for MSCC with either 1 x 8 Gy (n = 96) or 10 x 3 Gy (n = 108), were analyzed retrospectively. Motor function and ambulatory status were evaluated before and up to 24 weeks after RT. A multivariate analysis (nominal regression) was performed including radiation schedule, performance status, age, irradiated vertebra, and relevant prognostic factors (histology, ambulatory status, time of developing motor deficits). Improvement of motor deficits was selected as basic category and compared with no change and deterioration. Results: Univariate analysis showed no significant difference between the schedules for post-treatment motor function and ambulatory rates. Multivariate analysis demonstrated a significant effect on functional outcome for the prognostic factors, but not for the radiation schedule (p = 0.853 for no change, p = 0.237 for deterioration). Conclusions: Our data suggest the two fractionation schedules to be comparably effective for functional outcome. Thus, 1 x 8 Gy should be considered for patients with a poor survival prognosis

  11. Hypothyroidism in children with medulloblastoma: a comparison of 3600 and 2340 cGy craniospinal radiotherapy

    International Nuclear Information System (INIS)

    Paulino, Arnold C.

    2002-01-01

    Purpose: To determine if low-dose craniospinal irradiation (2340 cGy) with chemotherapy is associated with a lower incidence of hypothyroidism compared to standard dose (3600 cGy) with or without chemotherapy in children with medulloblastoma. Patients and Methods: Between 1980 and 1999, 32 patients ≤20 years old survived after craniospinal irradiation with or without chemotherapy. Twenty patients received 3600 cGy craniospinal irradiation (CSI), whereas 12 had 2340 cGy CSI; all patients received a posterior fossa boost to a total dose 5040-5580 cGy. The median ages at the time of CSI for those receiving 2340 cGy and 3600 cGy were 7.2 and 10.2 years, respectively. Chemotherapy (CT) was employed in 22 children. All children who received 2340 cGy had CT consisting of vincristine, CCNU, and either cisplatin or cyclophosphamide. Ten of 20 (50%) patients receiving 3600 cGy had CT; the most common regimen was vincristine, CCNU, and prednisone. Serum-free thyroxine and thyroid-stimulating hormone concentrations were measured in all children at variable times after radiotherapy. Thyroid-stimulating hormone responses to i.v. thyrotrophin-releasing hormone were assessed in those suspected of having central hypothyroidism. Median follow-up for children receiving 2340 cGy was 5 years (range: 2-11.2 years), whereas for those receiving 3600 cGy, follow-up was 12.5 years (range: 2.4-20 years). Results: Eighteen patients (56%) developed hypothyroidism at a median time after radiotherapy of 41 months (range: 10 months to 18 years). Primary hypothyroidism was more common than central hypothyroidism (38% and 19%). All 7 children 10 years had hypothyroidism (p<0.001). Hypothyroidism was documented in 10 of 12 (83%) who had 2340 cGy + CT, 6 of 10 (60%) who had 3600 cGy + CT, and 2 of 10 (20%) who had 3600 cGy without CT (p<0.025). Conclusions: Current treatment regimens consisting of chemotherapy and 2340 cGy craniospinal irradiation followed by a posterior fossa boost for

  12. Multi-Institution Prospective Trial of Reduced-Dose Craniospinal Irradiation (23.4 Gy) Followed by Conformal Posterior Fossa (36 Gy) and Primary Site Irradiation (55.8 Gy) and Dose-Intensive Chemotherapy for Average-Risk Medulloblastoma

    International Nuclear Information System (INIS)

    Merchant, Thomas E.; Kun, Larry E.; Krasin, Matthew J.; Wallace, Dana; Chintagumpala, Murali M.; Woo, Shiao Y.; Ashley, David M.; Sexton, Maree; Kellie, Stewart J.; Ahern, Verity M.B.B.S.; Gajjar, Amar

    2008-01-01

    Purpose: Limiting the neurocognitive sequelae of radiotherapy (RT) has been an objective in the treatment of medulloblastoma. Conformal RT to less than the entire posterior fossa (PF) after craniospinal irradiation might reduce neurocognitive sequelae and requires evaluation. Methods and Materials: Between October 1996 and August 2003, 86 patients, 3-21 years of age, with newly diagnosed, average-risk medulloblastoma were treated in a prospective, institutional review board-approved, multi-institution trial of risk-adapted RT and dose-intensive chemotherapy. RT began within 28 days of definitive surgery and consisted of craniospinal irradiation (23.4 Gy), conformal PF RT (36.0 Gy), and primary site RT (55.8 Gy). The planning target volume for the primary site included the postoperative tumor bed surrounded by an anatomically confined margin of 2 cm that was then expanded with a geometric margin of 0.3-0.5 cm. Chemotherapy was initiated 6 weeks after RT and included four cycles of high-dose cyclophosphamide, cisplatin, and vincristine. Results: At a median follow-up of 61.2 months (range, 5.2-115.0 months), the estimated 5-year event-free survival and cumulative incidence of PF failure rate was 83.0% ± 5.3% and 4.9% ± 2.4% (± standard error), respectively. The targeting guidelines used in this study resulted in a mean reduction of 13% in the volume of the PF receiving doses >55 Gy compared with conventionally planned RT. The reductions in the dose to the temporal lobes, cochleae, and hypothalamus were statistically significant. Conclusion: This prospective trial has demonstrated that irradiation of less than the entire PF after 23.4 Gy craniospinal irradiation for average-risk medulloblastoma results in disease control comparable to that after treatment of the entire PF

  13. GY SAMPLING THEORY AND GEOSTATISTICS: ALTERNATE MODELS OF VARIABILITY IN CONTINUOUS MEDIA

    Science.gov (United States)

    In the sampling theory developed by Pierre Gy, sample variability is modeled as the sum of a set of seven discrete error components. The variogram used in geostatisties provides an alternate model in which several of Gy's error components are combined in a continuous mode...

  14. Preliminary results of a randomized trial comparing 400 cGy vs 700 cGy as an adjuvant to prevent heterotopic ossification after total hip arthroplasty

    International Nuclear Information System (INIS)

    Nguyen, Cam; Gupta-Burt, Shalina; Silverton, Craig; Cummings, Marilyn; Galante, Jorge O.

    1997-01-01

    Purpose/Objective: We report our preliminary results of a randomized trial comparing one single dose of 400 cGy versus 700 cGy given postoperatively in an attempt to prevent heterotopic ossification after total hip arthroplasty. Materials and Methods: From 09/1993 and 05/1996, over 800 total hip replacements were performed at our hospital. From this group of patients, 120 hips in 114 high-risk patients (14%) were enrolled in a randomized trial to determine if 400 cGy (Group A) is as efficacious as 700 cGy (Group B) in preventing heterotopic ossification. In Group A, there were 42 males (46 hips) and 12 females (12 hips) with a mean age of 60 (range 41-79); with 18 primary cementless femoral components (33%), 30 primary cemented stems (55%) and 10 revisions. In Group B, there were 30 males (32 hips) and 30 females (31 hips) with a median age of 59 (range 41-85); with 12 primary cementless femoral components (20%), 44 primary cemented stems (73%) and 6 revisions. All acetabular components were of the cementless type. Patients were randomized to receive either 400 cGy or 700 cGy in one fraction. Radiotherapy is given within 48 hours post-operatively using paired anterior and posterior fields, with blocking of the cementless acetabular component and the femoral component. Results: All 114 patients were available for a minimum follow-up of 6 months (range 6-30 months). None of the arthroplasties has failed at the latest follow-up. There were no radiation therapy complications noted. Statistical analysis revealed no difference in the distribution of patients in either group according to age, sex, primary or revision arthroplasty, cemented or cementless femoral component fixation, preoperative heterotopic ossification risk, or surgical approach. Of the 58 hips in Group A, heterotopic ossification was graded as Grade 0 in 24 hips, Grade I in 10 hips, Grade II in 18 hips, Grade III in 6 hips, with no cases of Grade IV. Of the 63 hips in Group B, heterotopic ossification was

  15. Spine Radiosurgery: A Dosimetric Analysis in 124 Patients Who Received 18 Gy

    International Nuclear Information System (INIS)

    Schipani, Stefano; Wen, Winston; Jin, Jain-Yue; Kim, Jin Koo; Ryu, Samuel

    2012-01-01

    Purpose: To define the safely tolerated doses to organs at risk (OARs) adjacent to the target volume (TV) of spine radiosurgery (SRS) with 18-Gy in a single fraction. Methods and Materials: A total of 124 patient cases with 165 spine metastases were reviewed. An 18-Gy single-fraction regimen was prescribed to the 90% isodose line encompassing the TV. A constraint of 10 Gy to 10% of the spinal cord outlined 6 mm above and below the TV was used. Dosimetric data to OARs were analyzed. Results: A total of 124 patients (100%) were followed-up, and median follow-up time was 7 months (1-50 months). Symptoms and local control were achieved in 114 patients (92%). Acute Radiation Therapy Oncology Group (RTOG) grade 1 oral mucositis occurred in 11 of 11 (100%) patients at risk for oropharyngeal toxicity after cervical spine treatment. There were no RTOG grade 2-4 acute or late complications. Median TV was 43.2 cc (5.3-175.4 cc) and 90% of the TV received median dose of 19 Gy (17-19.8 Gy). Median (range) of spinal cord maximum dose (Dmax), dose to spinal cord 0.35 cc (Dsc0.35), and cord volume receiving 10 Gy (Vsc10) were 13.8 Gy (5.4-21 Gy), 8.9 Gy (2.6-11.4 Gy) and 0.33 cc (0-1.6 cc), respectively. Other OARs were evaluated when in proximity to the TV. Esophagus (n=58), trachea (n=28), oropharynx (n=11), and kidneys (n=34) received median (range) V10 and V15 of 3.1 cc (0-5.8 cc) and 1.2 cc (0-2.9 cc), 2.8 cc (0-4.9 cc), and 0.8 cc (0-2.1 cc), 3.4 cc (0-6.2 cc) and 1.6 cc (0-3.2 cc), 0.3 cc (0-0.8 cc) and 0.08 cc (0-0.1 cc), respectively. Conclusions: Cord Dmax of 14 Gy and D0.35 of 10 Gy are safe dose constraints for 18-Gy single-fraction SRS. Esophagus V10 of 3 cc and V15 of 1 cc, trachea V10 of 3 cc, and V15 of 1 cc, oropharynx V10 of 3.5 cc and V15 of 1.5 cc, kidney V10 of 0.3 cc, and V15 of 0.1 cc are planning guidelines when these OARs are in proximity to the TV.

  16. Increased Risk of Biochemical and Clinical Failure for Prostate Patients with a Large Rectum at Radiotherapy Planning: Results from the Dutch Trial of 68 GY Versus 78 Gy

    International Nuclear Information System (INIS)

    Heemsbergen, Wilma D.; Hoogeman, Mischa S.; Witte, Marnix G.; Peeters, Stephanie T.H.; Incrocci, Luca; Lebesque, Joos V.

    2007-01-01

    Purpose: To investigate whether a large rectum filling visible on the planning CT scan was associated with a decrease in freedom from any failure (FFF) and freedom from clinical failure (FFCF) for prostate cancer patients. Methods and Materials: Patients from the Dutch trial (78 Gy vs. 68 Gy) with available acute toxicity data were analyzed (n = 549). A 10-mm margin was applied for the first 68 Gy and 0-5 mm for the 10-Gy boost. The dose in the seminal vesicles (SVs) was prescribed within four treatment groups according to the estimated risk of SV involvement. Two potential risk factors (RFs) for a geometric miss were defined: (1) an anorectal volume ≥ 90 cm 3 and ≥ 25% of treatment-time diarrhea (RF1); and (2) the mean cross-sectional area of the anorectum (RF2). We tested whether these were significant predictors for FFF and FFCF within each treatment group. Results: Significant results were observed only for patients with a risk of SV involvement > 25% (dose of 68-78 Gy to the SVs, n = 349). We found a decrease in FFF (p = 0.001) and FFCF (p = 0.01) for the 87 patients with RF1 (for RF2, p = 0.02 and p = 0.01, respectively). The estimated decrease in the FFCF rate at 5 years was 15%. Conclusion: Tumor control was significantly decreased in patients with a risk of SV involvement > 25% and at risk of geometric miss. Current image guidance techniques offer several solutions to geometrically optimize the treatment. Additional research is needed to evaluate whether geometric misses can be prevented using these techniques

  17. Studies of the effect of 0.4-Gy and 0.6-Gy prenatal X-irradiation on postnatal adult behavior in the Wistar rat.

    Science.gov (United States)

    Jensh, R P; Brent, R L; Vogel, W H

    1987-02-01

    Thirty-four pregnant Wistar rats were X-irradiated on the 9th or 17th day of gestation at a dosage level 0.4 Gy or 0.6 Gy or were sham-irradiated. All mothers were allowed to deliver their offspring, and litters were limited to a maximum of eight on day 2. On day 30, 224 offspring were weaned and raised until 60 days of age, at which time testing began. Each rat randomly received, in random order, three of the following six behavioral tests: Water T-maze, Conditioned Avoidance Response, Forelimb Hanging, Activity Wheel, Swimming, and Open Field. There were no statistically significant differences between the irradiated and control groups for maternal weight or weight gain or mean litter size, although the litter size of the 17th day 0.6-Gy group was slightly lower. Among offspring irradiated with 0.6 Gy on the 17th day, 3-day-old neonates' weights were significantly reduced. Offspring irradiated on the 17th day with 0.6 Gy exhibited higher Conditioned Avoidance Response 5th-day and retest avoidance scores than did the controls. There were also significant sex differences in responses within the irradiated and control groups for several tests, which were unrelated to radiation exposure. The results of this study indicate that low-level X-irradiation during the fetal period of rat gestation results in neonatal growth retardation and subtle behavioral alterations that may be manifested in adult life. Growth retardation may be the most sensitive indicator of subtle effects that result from low-level prenatal exposure to X-rays.

  18. Studies of the effect of 0.4-Gy and 0.6-Gy prenatal X-irradiation on postnatal adult behavior in the Wistar rat

    International Nuclear Information System (INIS)

    Jensh, R.P.; Brent, R.L.; Vogel, W.H.

    1987-01-01

    Thirty-four pregnant Wistar rats were X-irradiated on the 9th or 17th day of gestation at a dosage level 0.4 Gy or 0.6 Gy or were sham-irradiated. All mothers were allowed to deliver their offspring, and litters were limited to a maximum of eight on day 2. On day 30, 224 offspring were weaned and raised until 60 days of age, at which time testing began. Each rat randomly received, in random order, three of the following six behavioral tests: Water T-maze, Conditioned Avoidance Response, Forelimb Hanging, Activity Wheel, Swimming, and Open Field. There were no statistically significant differences between the irradiated and control groups for maternal weight or weight gain or mean litter size, although the litter size of the 17th day 0.6-Gy group was slightly lower. Among offspring irradiated with 0.6 Gy on the 17th day, 3-day-old neonates' weights were significantly reduced. Offspring irradiated on the 17th day with 0.6 Gy exhibited higher Conditioned Avoidance Response 5th-day and retest avoidance scores than did the controls. There were also significant sex differences in responses within the irradiated and control groups for several tests, which were unrelated to radiation exposure. The results of this study indicate that low-level X-irradiation during the fetal period of rat gestation results in neonatal growth retardation and subtle behavioral alterations that may be manifested in adult life. Growth retardation may be the most sensitive indicator of subtle effects that result from low-level prenatal exposure to X-rays

  19. 20 Gy Versus 44 Gy of Supplemental External Beam Radiotherapy With Palladium-103 for Patients With Greater Risk Disease: Results of a Prospective Randomized Trial

    International Nuclear Information System (INIS)

    Merrick, Gregory S.; Wallner, Kent E.; Butler, Wayne M.; Galbreath, Robert W.; Taira, Al V.; Orio, Peter; Adamovich, Edward

    2012-01-01

    Purpose: The necessity of external beam radiotherapy (EBRT) as a supplement to prostate brachytherapy remains unknown. We report brachytherapy outcomes for patients with higher risk features randomized to substantially different supplemental EBRT regimens. Methods and Materials: Between December 1999 and June 2004, 247 patients were randomized to 20 Gy vs. 44 Gy EBRT followed by a palladium-103 boost (115 Gy vs. 90 Gy). The eligibility criteria included clinically organ-confined disease with Gleason score 7–10 and/or pretreatment prostate-specific antigen (PSA) level 10–20 ng/mL. The median follow-up period was 9.0 years. Biochemical progression-free survival (bPFS) was defined as a PSA level of ≤0.40 ng/mL after nadir. The median day 0 prescribed dose covering 90% of the target volume was 125.7%; 80 men received androgen deprivation therapy (median, 4 months). Multiple parameters were evaluated for their effect on bPFS. Results: For the entire cohort, the cause-specific survival, bPFS, and overall survival rates were 97.7%, 93.2%, and 80.8% at 8 years and 96.9%, 93.2%, and 75.4% at 10 years, respectively. The bPFS rate was 93.1% and 93.4% for the 20-Gy and 44-Gy arms, respectively (p = .994). However, no statistically significant differences were found in cause-specific survival or overall survival were identified. When stratified by PSA level of ≤10 ng/mL vs. >10 ng/mL, Gleason score, or androgen deprivation therapy, no statistically significant differences in bPFS were discerned between the two EBRT regimens. On multivariate analysis, bPFS was most closely related to the preimplant PSA and clinical stage. For patients with biochemically controlled disease, the median PSA level was <0.02 ng/mL. Conclusion: The results of the present trial strongly suggest that two markedly different supplemental EBRT regimens result in equivalent cause-specific survival, bPFS, and overall survival. It is probable that the lack of benefit for a higher supplemental EBRT

  20. Effects of nano bamboo charcoal on PAHs-degrading strain Sphingomonas sp. GY2B.

    Science.gov (United States)

    She, Bojia; Tao, Xueqin; Huang, Ting; Lu, Guining; Zhou, Zhili; Guo, Chuling; Dang, Zhi

    2016-03-01

    Nano bamboo charcoal (NBC) has been commonly used in the production of textiles, plastics, paint, etc. However, little is known regarding their effects towards the microorganisms. The effects of NBC on phenanthrene degrading strain Sphingomonas sp. GY2B were investigated in the present study. Results showed that the addition of NBC could improve the phenanthrene removal by Sphingomonas sp. GY2B, with removal efficiencies increased by 10.29-18.56% in comparison to the control at 24h, and phenanthrene was almost completely removed at 48h. With the presence of low dose of NBC (20 and 50mgL(-1)), strain GY2B displayed a better growth at 6h, suggesting that NBC was beneficial to the growth of GY2B and thus resulting in the quick removal of phenanthrene from water. However, the growth of strain GY2B in high dose of NBC (200mgL(-1)) was inhibited at 6h, and the inhibition could be attenuated and eliminated after 12h. NBC-effected phenanthrene solubility experiment suggested that NBC makes a negligible contribution to the solubilization of phenanthrene in water. Results of electronic microscopy analysis (SEM and TEM) indicated NBC may interact with the cell membrane, causing the enhanced membrane permeability and then NBC adsorbed on the membrane would enter into the cells. The findings of this work would provide important information for the future usage and long-term environmental risk assessment of NBC. Copyright © 2015 Elsevier Inc. All rights reserved.

  1. Randomized Comparison of Whole Brain Radiotherapy, 20 Gy in Four Daily Fractions Versus 40 Gy in 20 Twice-Daily Fractions, for Brain Metastases

    International Nuclear Information System (INIS)

    Graham, P.H.; Bucci, J.; Browne, L.

    2010-01-01

    Purpose: The present study compared the intracranial control rate and quality of life for two radiation fractionation schemes for cerebral metastases. Methods and Materials: A total of 113 patients with a Eastern Cooperative Oncology Group performance status 2 months), absent, or concurrent presentation of extracranial disease were randomized to 40 Gy in 20 twice-daily fractions (Arm A) or 20 Gy in four daily fractions (Arm B), stratified by resection status. The European Organization for Research and Treatment of Cancer Quality of Life 30-item questionnaire was administered monthly during Year 1, bimonthly during Year 2, and then every 6 months to Year 5. Results: The patient age range was 28-83 years (mean 62). Of the 113 patients, 41 had undergone surgical resection, and 74 patients had extracranial disease (31 concurrent and 43 stable). The median survival time was 6.1 months in Arm A and 6.6 months in Arm B, and the overall 5-year survival rate was 3.5%. Intracranial progression occurred in 44% of Arm A and 64% of Arm B patients (p = .03). Salvage surgery or radiotherapy was used in 4% of Arm A patients and 21% of Arm B patients (p = .004). Death was attributed to central nervous system progression in 32% of patients in Arm A and 52% of patients in Arm B (p = .03). The toxicity was minimal, with a minor increase in short-term cutaneous reactions in Arm A. The patients' quality of life was not impaired by the more intense treatment in Arm A. Conclusion: Intracranial disease control was improved and the quality of life was maintained with 40 Gy in 20 twice-daily fractions. This schema should be considered for better prognosis subgroups of patients with cerebral metastases.

  2. ESR dosimetry below 1 Gy, in X-ray irradiated tooth enamel

    International Nuclear Information System (INIS)

    Fainstein, Carlos; Winkler, Elin

    2000-01-01

    Tooth enamel, extracted from molars, was irradiated with 66 keV X-rays, with doses up to 1 Gy. The preparation of the powder samples is described, as well as the protocol for the acquisition and processing of the spectra. The radiation induced paramagnetism is measured, at room temperature, by ESR Spectroscopy. The ESR spectra is well described considering two paramagnetic species, with magnetic moments (in units of Bohr magneton) g=2,0041, and g 1 =2,0018, g 2 =1,9972. The ESR data (peak-to-peak amplitude per mg, hpp/mg, vs dose D), for doses 0 Gy 2 =0,996) with the linear expression: [hpp/mg] = -0,2(0,4)+14,9(0,5). D [Gy]. The result supports the growing confidence in the use of this material, and method, in Retrospective Dosimetry. (author)

  3. ESR Dosimetry Below 1 Gy, in X-Ray Irradiated Tooth Enamel

    International Nuclear Information System (INIS)

    Fainstein, Carlos; Winkler, E; Dubner, D; Gisone, P; Perez, M.R; Saravi, M; Alvarez, P; Davila, F

    2000-01-01

    Tooth enamel, extracted from molars, was irradiated with 66keV X-rays, with doses up to 1Gy.The preparation of the powder samples is described, as well as the protocol for the acquisition and processing of the spectra.The radiation induced paramagnetism is measured, at room temperature, by ESR Spectroscopy.The ESR spectra is well described considering two paramagnetic species, with magnetic moments (in units of Bohr magnetons) g=2,0041, and g1=2,0018, g2=1,9972.The ESR data (peak-to-peak amplitude per mg, hpp/mg, vs dose D), for doses 0Gy 2 =0,996) with the linear expression: [hpp/mg] = -0,2( 0,4)+14,9(0,5). D [Gy].The result supports the growing confidence in the use of this material, and method, in Retrospective Dosimetry

  4. 哈氏弧菌EcGY020401优化培养%Optimization Culture of Vibrio harveyi EcGY020401

    Institute of Scientific and Technical Information of China (English)

    陶家发; 赖迎迢; 潘厚军; 石存斌; 吴淑勤

    2010-01-01

    目的:为规模化制备弧菌疫苗提供相关数据.方法:利用摇瓶和小型发酵罐培养,通过平板计数测定培养菌液的活菌数.结果:哈氏弧菌(Vibrio harveyi)EcGY020401株最适盐度为20~25g/L,合适的pH为7.5~7.7,葡萄糖浓度最适浓度为2~5g/L,用TSB优化培养基:胰蛋白胨5g/L、蛋白胨15g/L、大豆蛋白胨3g/L、酵母膏1g/L、葡萄糖4g/L、磷酸氢二钾5g/L、氯化钠15g/L、pH 7.5,培养EcGY020401菌株,可达2.95×1010 cfu/mL;小型发酵罐培养,10h可达到生长最大值,菌液浓度为3.46×1010cfu/mL 结论:用优化TSB培养基,采用发酵罐培养弧菌,可降低成本,提搞培养效率.

  5. Effect of 30-Gy irradiation in conjunction with leukocyte reduction filter on platelet and transfusion efficiency

    International Nuclear Information System (INIS)

    Shimojima, Hiromi; Sawada, Umihiko; Horie, Takashi; Itoh, Takeyoshi

    2001-01-01

    To evaluate the effect of 30-Gy irradiation in conjunction with leukocyte reduction filter on platelet and transfusion efficiency, we studied platelet recovery, leukocyte reduction rate, content of platelet factor 4 and β-thromboglobulin in platelet products, platelet functions, and positive rates of platelet surface membranes CD42 and CD62, prior to and after treatment. We also evaluated the efficiency of platelet transfusion by estimating post- transfusion (1 and 24 hour) corrected count increment (CCI), and transfusion side effects. Recovery of platelets was 91.8±6.5% and depletion rate of leukocytes was 1.7±1.1 log. There was no significant difference in platelet activation markers or function tests prior to and after the procedure. The mean post-transfusion CCI and 1 and 24 hours were 16,550 (n=114) and 13,310 (n=93), respectively, with 30-Gy irradiation and leukocyte reduction filter. Those treated solely with leukocyte reduction filter were 14,970 (n=114) and 10,880 (n=118), respectively. There was no increase in transfusion side effects after the treatment of platelet concentrate with 30-Gy irradiation combined with leukocyte reduction filter compared with treatment by leukocyte reduction filter alone. These results indicate that treatment with 30 Gy irradiation in conjunction with leukocyte reduction filter is safe and effective in platelet transfusion. (author)

  6. 125I Monotherapy Using D90 Implant Doses of 180 Gy or Greater

    International Nuclear Information System (INIS)

    Kao, Johnny; Stone, Nelson N.; Lavaf, Amir; Dumane, Vishruta; Cesaretti, Jamie A.; Stock, Richard G.

    2008-01-01

    Purpose: The purpose of this study was to characterize the oncologic results and toxicity profile of patients treated with 125 I implants using the dose delivered to 90% of the gland from the dose-volume histogram (D90) of greater than 144 Gy. Methods and Materials: From June 1995 to Feb 2005, a total of 643 patients were treated with 125 I monotherapy for T1-T2 prostate cancer with a D90 of 180 Gy or greater (median, 197 Gy; range, 180-267 Gy). Implantations were performed using a real-time ultrasound-guided seed-placement method and intraoperative dosimetry to optimize target coverage and homogeneity by using modified peripheral loading. We analyzed biochemical disease-free survival (bDFS) of 435 patients who had a minimum 2-year prostate-specific antigen follow-up (median follow-up, 6.7 years; range, 2.0-11.1 years). Results: Five-year bDFS rates for the entire cohort using the American Society for Therapeutic Radiology and Oncology and Phoenix definitions were 96.9% and 96.5%, respectively. Using the Phoenix definition, 5-year bDFS rates were 97.3% for low-risk patients and 92.8% for intermediate/high-risk patients. The positive biopsy rate was 4.1%. The freedom rate from Grade 2 or higher rectal bleeding at 5 years was 88.5%. Acute urinary retention occurred in 10.7%, more commonly in patients with high pretreatment International Prostate Symptom Scores (p < 0.01). In patients who were potent before treatment, 73.4% remained potent at 5 years after implantation. Conclusions: Patients with a minimum D90 of 180 Gy had outstanding local control based on prostate-specific antigen control and biopsy data. Toxicity profiles, particularly for long-term urinary and sexual function, were excellent and showed that D90 doses of 180 Gy or greater performed using the technique described were feasible and tolerable

  7. Moving Beyond IGY: An Electronic Geophysical Year (eGY) Concept

    Science.gov (United States)

    Baker, D. N.; Barton, C. E.; Rodger, A. S.; Thompson, B. J.; Fraser, B.; Papitashvili, V.

    2003-12-01

    During the International Geophysical Year (1957-1958), member countries established many new geophysical observatories pursuing the major IGY objectives - to collect geophysical data as widely as possible and to provide free access to these data for all scientists around the globe. Today, geophysics has attained a rather good understanding within traditional regions, i.e., the atmosphere, ionosphere, magnetosphere, and other such geospheres. At the same time, it has become clear that much of the new and important science is coming from the studies of interfaces and coupling between geospheres. Thus, if geophysical data are made `'transparently'' available to a much wider range of scientists and students than to those who do the observations, then new and exciting discoveries can be expected. An International Association of Geomagnetic and Aeronomy (IAGA) task force, recognizing that a key achievement of the IGY was the establishment of a worldwide system of data centers and physical observatories, proposes that for the 50th anniversary of IGY, the worldwide scientific community should endorse and promote an electronic Geophysical Year (eGY) initiative. The proposed eGY concept would both commemorate the IGY in 2007-2008 and provide a forward impetus to geophysics in 21st century, similar to that provided by the IGY fifty years ago. The IAGA task force strongly advocates: (1) Securing permission and release of existing data; (2) Creating access to information; and (3) Conversion of relevant analog data to digital form. The eGY concept embraces all available and upcoming geophysical data (e.g., atmospheric, ionospheric, geomagnetic, gravity, etc.) through the establishment of a series of virtual geophysical observatories now being `'deployed'' in cyberspace. The eGY concept is modern, global, and timely; it is attractive, pragmatic, and affordable. The eGY is based on the existing and continually developing computing/networking technologies (e.g., XML, Semantic Web

  8. Subacute Toxicity Study of 40 kGy Irradiated Ready-to-Eat Bulgogi

    International Nuclear Information System (INIS)

    Park, J.G.; Kim, J.H.; Lee, J.W.; Byun, M.W.; Jeon, Y.E.; Kang, I.J.; Hwang, H.J.

    2011-01-01

    The wholesomeness of 40 kGy irradiated ready-to-eat (RTE) bulgogi was evaluated by subacute toxicity studies (body weight, food consumption, organ weight, hematology, serum biochemistry, and histopathological examination) with groups of 40 male and female ICR mice fed the agent at dietary levels of 5% for 90 days. There were no treatment-related adverse effects with regard to body weight, food consumption, organ weight, hematology, serum biochemistry, and histopathology. The no-observed-adverse-effect-level (NOAEL) was also determined to be greater than dietary level of at least 5% (3900 mg/kg body weight/day for males, 3500 mg/kg body weight/day for females) for samples under the present experimental conditions. These results suggest that, under these experimental conditions, RTE bulgogi irradiated at 40 kGy did not show any toxic effects

  9. Results of Zea mays seeds β- irradiation in 0 - 5 Gy range

    International Nuclear Information System (INIS)

    Chicea, Dan; Racuciu, Mihaela

    2008-01-01

    In this study young plants, obtained from the control and beta irradiated seeds, were studied in laboratory experiments. Zea mays seeds with uniform genophond were irradiated with 90 Sr source in the 0 - 5 Gy range. Increased germination percentage was observed under the influence of different radiation doses. We found that small doses of β- radiation have a stimulating effect on the growth of the plantlets, the maximum simulation (among the doses we used) being induced by 0.615 Gy and is statistically significant. We investigated the chlorophyll a to b ratio and the average length variations with the irradiation dose and present the results. Key words: b- radiation, Zea mays, germination rate, plants growth, photoassimilatory pigments,

  10. Histochemical study of reaction of the nucleus supraopticus of rat brain to irradiation with 500 Gy

    International Nuclear Information System (INIS)

    Dosoudilova, M.; Kamarad, V.

    1987-01-01

    The activities were described of some enzymes in nucleus supraopticus of the rat brain at an early interval (5 min) after gamma irradiation with 500 Gy, at a dose rate of 6.9 Gy per minute. The study was performed using cryostat sections. The activities of the following enzymes were shown: alkaline phosphatase, acid phosphatase, ATP-splitting enzyme, thiaminepyrophosphatase, butyrylcholinesterase, acetylcholinesterase, glycero-3-phosphate-dehydrogenase, succinate dehydrogenase, acid nonspecific esterase, and beta glucuronidase. After irradiation, increased activities of acid phosphatase, thiaminepyrophosphatase, and acetylcholinesterase was observed in perikarya of magnocelullar neurons of the nucleus, whereas the activities of other enzymes were weak when compared to controls. A significant decrease in the activity of acidic nonspecific esterase was found. In contrast to the controls, blood capillaries showed increased activities of ATP-splitting enzyme, butyrylcholinesterase, thiaminepyrophosphatase. The activities of alkaline phosphatase and acid phosphatase were not changed. No activity of other enzymes was observed in that site. (author). 13 refs

  11. Pathological study on treated and untreated dogs dead after γ-irradiation with 6 Gy

    International Nuclear Information System (INIS)

    Wang Dewen; Guan Mingchen; Liu Xuetong

    1986-01-01

    Forty dogs γ-irradiated with 6 Gy were divided into three groups: control (8 cases), treated with antibiotics alone (8 cases) and with combined measures (24 cases). The death of dogs in these groups occurred between 8th-12th, 11th-14th and 12th-169th days after irradiation respectively. In the third group, regeneration of hematopoietic cells in sternal bone marrow was first observed in dog dead on 17.5th day after irradiation, and regeneration of lymphoid tissues in spleen on 14th day. The degree of recovery in both of these organs was worse than in dogs irradiated with 3.25 Gy. The complications were varied; for instance, in addition to infection and hemorrhage, there were intussusception, gastric dilation, necrosis and hemorrhage of pancrease, jaundice, cerebral edema, hemorrhage and hernia, cachexia during recovery and so on. The causes of death in these experimental animals were also varied

  12. Pathological study on treated and untreated dogs dead after. gamma. -irradiation with 6 Gy

    Energy Technology Data Exchange (ETDEWEB)

    Dewen, Wang; Mingchen, Guan; Xuetong, Liu

    1986-10-01

    Forty dogs ..gamma..-irradiated with 6 Gy were divided into three groups: control (8 cases), treated with antibiotics alone (8 cases) and with combined measures (24 cases). The death of dogs in these groups occurred between 8th-12th, 11th-14th and 12th-169th days after irradiation respectively. In the third group, regeneration of hematopoietic cells in sternal bone marrow was first observed in dog dead on 17.5th day after irradiation, and regeneration of lymphoid tissues in spleen on 14th day. The degree of recovery in both of these organs was worse than in dogs irradiated with 3.25 Gy. The complications were varied; for instance, in addition to infection and hemorrhage, there were intussusception, gastric dilation, necrosis and hemorrhage of pancrease, jaundice, cerebral edema, hemorrhage and hernia, cachexia during recovery and so on. The causes of death in these experimental animals were also varied.

  13. Transformation of soybean Gy3 gene into Artemisaarenaria mediated by corona discharge

    International Nuclear Information System (INIS)

    Chao, Lu-meng; Na, Ri; Xue, Dan; Xu, Yongze; Liu, Teng

    2013-01-01

    In order to improve the protein content of desert plant, a method of genetic transformation mediated by corona discharge was established. Artemisia seeds were processed in corona electric field for 120 min at 12 kV, and then soaked in 0.1 SSC media that contained Soybean Gy3 gene DNA to incubate for 12 h at 26 °C. Finally the seeds were inoculated on the differentiation medium. Polymerase Chain Reaction (PCR) and Reverse Transcription Polymerase Chain Reaction (RT-PCR) detection showed that the Soybean Gy3 gene had been successfully introduced into genomic DNA of the regenerated plants of Artemisaarenaria. The study provided a new way for corona discharge in plant genetic modification.

  14. Minerals sampling: sensibility analysis and correction factors for Pierre Gy's equation

    International Nuclear Information System (INIS)

    Vallebuona, G.; Niedbalski, F.

    2005-01-01

    Pierre Gy's equation is widely used in ore sampling. This equation is based in four parameters: shape factor, size distribution factor, mineralogical factor and liberation factor. The usual practice is to consider fixed values for the shape and size distribution factors. This practice does not represent well several important ores. The mineralogical factor considers only one specie of interest and the gangue, leaving out other cases such as polymetallic ores where there are more than one species of interest. A sensibility analysis to the Gy's equation factors was done and a procedure to determine specific values for them was developed and presented in this work. mean ore characteristics, associated with an insecure use of the actual procedure, were determined. finally, for a case study, the effects of using each alternative were evaluated. (Author) 4 refs

  15. Local Control With 21-Gy Radiation Therapy for High-Risk Neuroblastoma

    International Nuclear Information System (INIS)

    Casey, Dana L.; Kushner, Brian H.; Cheung, Nai-Kong V.; Modak, Shakeel; LaQuaglia, Michael P.; Wolden, Suzanne L.

    2016-01-01

    Purpose: To evaluate local control after 21-Gy radiation therapy (RT) to the primary site in patients with high-risk neuroblastoma. Methods and Materials: After receiving dose-intensive chemotherapy and gross total resection (GTR), 246 patients (aged 1.2-17.9 years, median 4.0 years) with high-risk neuroblastoma underwent RT to the primary site at Memorial Sloan Kettering from 2000 to 2014. Radiation therapy consisted of 21 Gy in twice-daily fractions of 1.5 Gy each. Local failure (LF) was correlated with biologic prognostic factors and clinical findings at the time of diagnosis and start of RT. Results: Median follow-up of surviving patients was 6.4 years. Cumulative incidence of LF was 7.1% at 2 years after RT and 9.8% at 5 years after RT. The isolated LF rate was 3.0%. Eighty-six percent of all local failures were within the RT field. Local control was worse in patients who required more than 1 surgical resection to achieve GTR (22.4% vs 8.3%, P=.01). There was also a trend toward inferior local control with MYCN-amplified tumors or serum lactate dehydrogenase ≥1500 U/L (P=.09 and P=.06, respectively). Conclusion: After intensive chemotherapy and maximal surgical debulking, hyperfractionated RT with 21 Gy in high-risk neuroblastoma results in excellent local control. Given the young patient age, concern for late effects, and local control >90%, dose reduction may be appropriate for patients without MYCN amplification who achieve GTR.

  16. ESR/Alanine {gamma}-dosimetry in the 10-30 Gy range

    Energy Technology Data Exchange (ETDEWEB)

    Fainstein, C. E-mail: cfainstein@cab.cnea.gov.ar; Winkler, E.; Saravi, M

    2000-05-15

    We report Alanine Dosimeter preparation, procedures for using the ESR/Dosimetry method, and the resulting calibration curve for {gamma}-irradiation in the range from 10-30 Gy. We use calibration curve to measure the irradiation dose in {gamma}-irradiation of human blood, as required in Blood Transfusion Therapy. The ESR/Alanine results are compared against those obtained using the thermoluminescent dosimetry (TLD) method.

  17. Comparing morbidity and cancer control after 3D-conformal (70/74 Gy) and intensity modulated radiotherapy (78/82 Gy) for prostate cancer

    International Nuclear Information System (INIS)

    Dolezel, Martin; Odrazka, Karel; Zouhar, Milan; Jansa, Jan; Paluska, Petr; Vaculikova, Miloslava; Sefrova, Jana; Kohlova, Tereza; Vanasek, Jaroslav; Kovarik, Josef

    2015-01-01

    The purpose of this work was to compare toxicity and cancer control between patients with prostate cancer treated using three-dimensional conformal radiotherapy (3D-CRT) and those treated using intensity-modulated radiation therapy (IMRT). A total of 553 patients with prostate cancer were treated with 3D-CRT 70-74 Gy (3D-CRT 70, 3D-CRT 74) or IMRT 78-82 Gy (IMRT 78, IMRT/SIB 82). Late toxicity was scored according to FC-RTOG/LENT criteria. Biochemical failure was defined using the Phoenix and ASTRO definitions. The 5-year risk of grade 2-4 genitourinary toxicity was 26.3 % (3D-CRT 70), 27.2 % (3D-CRT 74), 17.3 % (IMRT 78), and 25.1 % (IMRT/SIB 82) without statistical differences. The 5-year risk of grade 2-4 gastrointestinal toxicity was 19.4 % (3D-CRT 70), 42.1 % (3D-CRT 74), 20.5 % (IMRT 78), and 26.6 % (IMRT/SIB 82). The differences between 3D-CRT 74 and 3D-CRT 70 and between 3D-CRT 74 and IMRT 78 were statistically significant (log rank p = 0.03). The 5-year Phoenix PSA relapse-free survival (PSA-RFS) in low-risk, intermediate-risk, and high-risk patients treated using 3D-CRT were 89.4, 65.5, and 57.8 %, respectively. Patients treated with IMRT achieved the following results: 90.9, 89.4, and 83.9 %. Clinical relapse-free survival (C-RFS) in patients treated using 3D-CRT vs. IMRT for the aforementioned groups were 94.7 vs. 100 %, 86.8 vs. 98.6 %, and 84.4 vs. 94.5 %. Disease-free survival (DFS) for patients treated using 3D-CRT were 83.1, 70.9, and 71.5 %. The IMRT group reached 95.8, 89.1, and 87.6 %. The PSA-RFS for intermediate- and high-risk patients were statistically significant, while C-RFS and DFS were marginally better. Dose escalation with IMRT was associated with improved cancer control in intermediate- and high-risk patients in comparison with 3D-CRT, without compromising toxicity. (orig.) [de

  18. The Ringhoffer family firm´s stratégy between continuity and change

    Czech Academy of Sciences Publication Activity Database

    Hlavačka, Milan

    2015-01-01

    Roč. 30, č. 2 (2015), s. 201-206 ISSN 0231-7540 R&D Projects: GA ČR(CZ) GA14-19640S Institutional support: RVO:67985963 Keywords : the Ringhoffer family * firm stratégy * economic history * transformation into joint-venture company Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  19. Local Control With 21-Gy Radiation Therapy for High-Risk Neuroblastoma

    Energy Technology Data Exchange (ETDEWEB)

    Casey, Dana L. [Department of Radiation Oncology, Memorial Sloan Kettering Cancer Center, New York, New York (United States); Kushner, Brian H.; Cheung, Nai-Kong V.; Modak, Shakeel [Department of Pediatrics, Memorial Sloan Kettering Cancer Center, New York, New York (United States); LaQuaglia, Michael P. [Department of Surgery, Memorial Sloan Kettering Cancer Center, New York, New York (United States); Wolden, Suzanne L., E-mail: woldens@mskcc.org [Department of Radiation Oncology, Memorial Sloan Kettering Cancer Center, New York, New York (United States)

    2016-10-01

    Purpose: To evaluate local control after 21-Gy radiation therapy (RT) to the primary site in patients with high-risk neuroblastoma. Methods and Materials: After receiving dose-intensive chemotherapy and gross total resection (GTR), 246 patients (aged 1.2-17.9 years, median 4.0 years) with high-risk neuroblastoma underwent RT to the primary site at Memorial Sloan Kettering from 2000 to 2014. Radiation therapy consisted of 21 Gy in twice-daily fractions of 1.5 Gy each. Local failure (LF) was correlated with biologic prognostic factors and clinical findings at the time of diagnosis and start of RT. Results: Median follow-up of surviving patients was 6.4 years. Cumulative incidence of LF was 7.1% at 2 years after RT and 9.8% at 5 years after RT. The isolated LF rate was 3.0%. Eighty-six percent of all local failures were within the RT field. Local control was worse in patients who required more than 1 surgical resection to achieve GTR (22.4% vs 8.3%, P=.01). There was also a trend toward inferior local control with MYCN-amplified tumors or serum lactate dehydrogenase ≥1500 U/L (P=.09 and P=.06, respectively). Conclusion: After intensive chemotherapy and maximal surgical debulking, hyperfractionated RT with 21 Gy in high-risk neuroblastoma results in excellent local control. Given the young patient age, concern for late effects, and local control >90%, dose reduction may be appropriate for patients without MYCN amplification who achieve GTR.

  20. Increased expressions of MMP-2 and MMP-9 in lung following 12 Gy local irradiation

    International Nuclear Information System (INIS)

    Yang Kunyu; Liu Li; Zhang Tao; Wu Gang; Hu Yu; Ruebe, C.; Ruebe, C.

    2006-01-01

    Objective: To measure expressions of metalloproteinases and tissue inhibitors of metalloproteinases in the lung following thoracic irradiation of 12 Gy, and explore its possible role in the development of radiation-induced lung damage. Methods: C57BL/6J mice at age of 8 weeks were thoracically irradiated with 12 Gy X-rays (10 MV, 2.4 Gy/min, single exposure), and the control mice were sham-irradiated. The mice were sacrificed at 4 or 8 weeks after thoracic irradiation by decapitation. Lung tissues samples were collected. Expressions of MMP-2, MMP-9, MMP-3, MMP-13, TIMP-1, TIMP-2, and TIMP-3 in lung samples were measured. Results: There was no significant difference in expressions of MMP-3, MMP-13, TIMP-1 TIMP-2, and TIMP-3 in the lung between the two groups at 4 and 8 weeks after thoracic irradiation (or sham-irradiation). However, the expressions of MMP-2 were enhanced by 1.7 and 1.9 folds, and MMP-9 by 2.7 and 2.6 folds at 4 and 8 weeks after thoracic irradiation, respectively. Conclusion: Enhanced expressions of MMP-2 and MMP-9 in the lung were involved in the development of acute lung injury after thoracic irradiation, leading to a disruption of the structure and fibrosis. (authors)

  1. Sterilization of allograft bone: is 25 kGy the gold standard for gamma irradiation?

    Science.gov (United States)

    Nguyen, Huynh; Morgan, David A F; Forwood, Mark R

    2007-01-01

    For several decades, a dose of 25 kGy of gamma irradiation has been recommended for terminal sterilization of medical products, including bone allografts. Practically, the application of a given gamma dose varies from tissue bank to tissue bank. While many banks use 25 kGy, some have adopted a higher dose, while some choose lower doses, and others do not use irradiation for terminal sterilization. A revolution in quality control in the tissue banking industry has occurred in line with development of quality assurance standards. These have resulted in significant reductions in the risk of contamination by microorganisms of final graft products. In light of these developments, there is sufficient rationale to re-establish a new standard dose, sufficient enough to sterilize allograft bone, while minimizing the adverse effects of gamma radiation on tissue properties. Using valid modifications, several authors have applied ISO standards to establish a radiation dose for bone allografts that is specific to systems employed in bone banking. These standards, and their verification, suggest that the actual dose could be significantly reduced from 25 kGy, while maintaining a valid sterility assurance level (SAL) of 10(-6). The current paper reviews the methods that have been used to develop radiation doses for terminal sterilization of medical products, and the current trend for selection of a specific dose for tissue banks.

  2. γ-Radiation (0-150 kGy) Effects on HDPE/LDPE Blends

    International Nuclear Information System (INIS)

    Albano, C.

    2006-01-01

    In the present work, irradiation with 60 C o source was employed to study the effect of γ-rays on some physical properties of HDPE/LDPE blends (0/100, 10/90, 25/75, 50/50, 75/25, 100/0), using various doses: 0, 50, 150 kGy. The blends were prepared by extrusion and plates were compression molded employing fast and slow cooling methods from the melt. Density, degree of crystallinity and mechanical properties were dependant on the cooling rate used and blend composition. Better properties were found for HDPE-rich blends. Mechanical properties showed no significant variations in tensile modulus and yield stress. Instead, a decrease in elongation at break, due to molecular crosslinking or branching reaction effects, with the raise of radiation dose was obtained. Density measurements and differential scanning calorimetry results failed to exhibit significant changes with radiation dose. Some qualitative aspects included changes in endotherms shape. These were attributed to the variation of in crystallite sizes, probably due to structural changes originated by crosslinking and chain scission reactions occurring as a result of γ-rays exposure. On the other hand, there was an abrupt reduction of the melt flow index (MFI) from the range of 16-9 dg/min for 0 kGy to non-fluidity for an exposure of 150 kGy; this behavior is another sign of high crosslinking, impairing the viscous fluidity of the blends

  3. Conformal radiotherapy to 76 Gy in localized prostate cancer. Therapeutic modalities and preliminary results

    International Nuclear Information System (INIS)

    Pontvert, D.; Mammar, H.; Flam, T.; Debre, B.; Thiounn, N.; Gaboriaud, G.; Jourdan-Da Silvae, N.; Beuzeboc, P.

    2008-01-01

    Purpose: to describe therapeutic modalities for localized prostate cancer treated by conformal radiation to 76 Gy with or without androgen ablation. To evaluate the preliminary results in terms of survival, biological control and toxicity. Patients and method: between January 1998 and June 2001, 321 patients with localized prostate cancer were irradiated at Institut Curie. Tumors were stratified into the three Memorial Sloan-Kettering Cancer Center prognostic groups (1998) for analysis: favorable risk group (F.G.) 23%, intermediate risk group (I.G.) 36.5%, unfavorable risk group (U.G.) 40.5%. Androgen deprivation, mainly neo-adjuvant, less or equal to one year was prescribed to 93.8% of patients (72.6% less or equal to six months). Planning target volume prescription doses were: prostate: 76 Gy, seminal vesicles: 56 to 76 Gy, and pelvic lymph nodes: 44 Gy to 16.8% of patients. Results: the five-year actuarial overall survival was 94% (95% I.C.: 90-97%). The median post-therapeutic follow-up was 36 months (nine to 60 months). The 48-month actuarial rates of biochemical control for the three prognostic groups were statistically different according to both the American Society for Therapeutic Radiology and Oncology consensus (A.S.T.R.O. 1997) and the Fox Chase Cancer Center definitions of biochemical failure (F.C.C.C. 2000) with respectively 87 and 94% for F.G., 78 and 84% for I.G., 54 and 58% for U.G. (P < 10-6 and P < 10-8). At time of our analysis, late post-treatment rectal and bladder bleedings were 17,4 and 13,6%, respectively. According to a 1-4 scale adapted from M.D. Anderson Cancer Center criteria: rectal bleedings were grade 1 (9.6%), grade 2 (6.2%) and grade 3 (1.6%). Bladder bleedings were grade 2 (13%) and grade 3 (0.6%). Analysis of rectal bleeding risk factors showed significant correlations with pelvic lymph nodes irradiation for grade 2 and 3, (P = 0.02), and for all grades, a correlation with smaller rectal wall volumes (P = 0.03), and greater

  4. Muusikamaailm : "Represseeritud muusika" Moskvas. György Kurtagi festival Londonis. Junge Deutshe Philarmonie kevad. Herbert Wernicke lahkunud / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    Moskvas toimuvast festivalist "Represseeritud muusika". Londonis toimuvast György Kurtagi festivalist. Saksa orkestri Junge Deutshe Philarmonie kevadesinemistest. Suri saksa ooperilavastaja Herbert Wernicke

  5. Low-Dose Radiation Therapy (2 Gy × 2) in the Treatment of Orbital Lymphoma

    Energy Technology Data Exchange (ETDEWEB)

    Fasola, Carolina E. [Department of Radiation Oncology, Stanford University, Stanford, California (United States); Jones, Jennifer C. [Vaccine Branch, Center for Cancer Research, National Cancer Institute, Bethesda, Maryland (United States); Huang, Derek D. [Department of Internal Medicine, University of California-Los Angeles Olive View, Sylmar, California (United States); Le, Quynh-Thu; Hoppe, Richard T. [Department of Radiation Oncology, Stanford University, Stanford, California (United States); Donaldson, Sarah S., E-mail: sarah2@stanford.edu [Department of Radiation Oncology, Stanford University, Stanford, California (United States)

    2013-08-01

    Purpose: Low-dose radiation has become increasingly used in the management of indolent non-Hodgkin lymphoma (NHL), but has not been studied specifically for cases of ocular adnexal involvement. The objective of this study is to investigate the effectiveness of low-dose radiation in the treatment of NHL of the ocular adnexa. Methods and Materials: We reviewed the records of 20 NHL patients with 27 sites of ocular adnexal involvement treated with low-dose radiation consisting of 2 successive fractions of 2 Gy at our institution between 2005 and 2011. The primary endpoint of this study is freedom from local relapse (FFLR). Results: At a median follow-up time of 26 months (range 7-92), the overall response rate for the 27 treated sites was 96%, with a complete response (CR) rate of 85% (n=23) and a partial response rate of 11% (n=3). Among all treated sites with CR, the 2-year FFLR was 100%, with no in-treatment field relapses. The 2-year freedom from regional relapse rate was 96% with 1 case of relapse within the ipsilateral orbit (outside of the treatment field). This patient underwent additional treatment with low-dose radiation of 4 Gy to the area of relapse achieving a CR and no evidence of disease at an additional 42 months of follow-up. Orbital radiation was well tolerated with only mild acute side effects (dry eye, conjunctivitis, transient periorbital edema) in 30% of treated sites without any reports of long-term toxicity. Conclusions: Low-dose radiation with 2 Gy × 2 is effective and well tolerated in the treatment of indolent NHL of the ocular adnexa with high response rates and durable local control with the option of reirradiation in the case of locoregional relapse.

  6. Low-Dose Radiation Therapy (2 Gy × 2) in the Treatment of Orbital Lymphoma

    International Nuclear Information System (INIS)

    Fasola, Carolina E.; Jones, Jennifer C.; Huang, Derek D.; Le, Quynh-Thu; Hoppe, Richard T.; Donaldson, Sarah S.

    2013-01-01

    Purpose: Low-dose radiation has become increasingly used in the management of indolent non-Hodgkin lymphoma (NHL), but has not been studied specifically for cases of ocular adnexal involvement. The objective of this study is to investigate the effectiveness of low-dose radiation in the treatment of NHL of the ocular adnexa. Methods and Materials: We reviewed the records of 20 NHL patients with 27 sites of ocular adnexal involvement treated with low-dose radiation consisting of 2 successive fractions of 2 Gy at our institution between 2005 and 2011. The primary endpoint of this study is freedom from local relapse (FFLR). Results: At a median follow-up time of 26 months (range 7-92), the overall response rate for the 27 treated sites was 96%, with a complete response (CR) rate of 85% (n=23) and a partial response rate of 11% (n=3). Among all treated sites with CR, the 2-year FFLR was 100%, with no in-treatment field relapses. The 2-year freedom from regional relapse rate was 96% with 1 case of relapse within the ipsilateral orbit (outside of the treatment field). This patient underwent additional treatment with low-dose radiation of 4 Gy to the area of relapse achieving a CR and no evidence of disease at an additional 42 months of follow-up. Orbital radiation was well tolerated with only mild acute side effects (dry eye, conjunctivitis, transient periorbital edema) in 30% of treated sites without any reports of long-term toxicity. Conclusions: Low-dose radiation with 2 Gy × 2 is effective and well tolerated in the treatment of indolent NHL of the ocular adnexa with high response rates and durable local control with the option of reirradiation in the case of locoregional relapse

  7. Effects of 5-Gy irradiation on fertility and mating behaviour of Nezara viridula (Heteroptera: Pentatomidae)

    International Nuclear Information System (INIS)

    Zunic, A.; Cokl, A.; Sersa, G.

    2002-01-01

    Background. The polyphagous and cosmopolitan species Nezara viridula is one of the most important insect pests. The sterile insect technique (SIT) is a pest control strategy that involves sterilising males by exposing them to ionising radiation. Sterile males, released into wild population, mate with females, but eggs are not fertilised and the population gradually declines. Exposing insects to radiation during their growth stage might require lower sterilising dose. The aim of our study was to test whether 5-Gy irradiation of 5 th instar nymphs significantly affects: (1) moulting and further development of the irradiated nymphs, (2) the male's and female's reproductive system and (3) the mating competitiveness of treated males, with special focus on vibrational communication. Methods: The 5 th instar nymphs were irradiated with 5 Gy using X-ray generator and monitored daily. Results: The observed effects of irradiation were: prolonged moulting, increased mortality during development and during the first day of adult life, decreased males to females ratio, decreased fecundity, egg production, proportion of fertile eggs and progeny survival. The reaction of a male to stimulation with the model female calling song was tested. The irradiated and non-irradiated males responded to stimulation with emission of the courtship song (MCrS). Temporal parameters of MCrS emitted by non-irradiated males differed when compared with those of irradiated ones. Conclusions: The 5-Gy irradiation of 5 th instar nymphs did not affect mating behaviour. However since the irradiation during growth stage decreased the fertility and fecundity of emerged adults, this technique, in combination with certain other suppression techniques, could be a successful control strategy for management of Nezara viridula. On the other hand observed effects on moulting and further development of the irradiated nymphs could decrease the efficiency and application of this strategy. (author)

  8. Clinical results of definitive-dose (50 Gy/25 fractions) preoperative chemoradiotherapy for unresectable esophageal cancer

    International Nuclear Information System (INIS)

    Ishikawa, Kazuki; Nakamatsu, Kiyoshi; Shiraishi, Osamu; Yasuda, Takushi; Nishimura, Yasumasa

    2015-01-01

    The clinical results of definitive-dose preoperative chemoradiotherapy (CRT) of 50 Gy/25 fractions/5 weeks for unresectable esophageal cancer were analyzed. Inclusion criteria were unresectable esophageal squamous cell carcinoma with T4b or mediastinal lymph nodes invading to the trachea or aorta. Radiation therapy of 50 Gy/25 fractions/5 weeks was combined concurrently with two courses of FP therapy (CDDP 70 mg/m 2 + 5-FU 700 mg/m 2 /d x 5 days: day 1-5, day 29-33). Tumor response was evaluated 4 weeks after completion of RT. Subtotal esophagectomy was planned 6-8 weeks after RT. Thirty patients (26 male and 4 female) aged from 50-78 years (median 66) were enrolled between 2008 and 2011. The clinical stages according to the 7th edition of UICC were stages II/III/IV, 1/23/6; T1/2/3/4, 1/1/4/24; and N0/1/2/3, 3/25/1/1. All 30 patients completed RT of 50 Gy/ 25 fractions. Initial tumor responses were 21 patients with resectable disease, 7 with unresectable disease, and 2 with progressive disease. Subtotal esophagectomy was performed in 18 (60%) of the 30 patients. Pathological complete response was obtained in five (28%) patients. There were two patients with hospitalization death after surgery (11%). Six of the 7 patients who still had unresectable disease were treated with 1-3 courses of docetaxel, CDDP and 5-FU. Three patients treated without surgery showed long-term survival. The 3-year locoregional control rate and the 3-year overall survival rate for the 30 patients were 70 and 49%, respectively. Definitive-dose preoperative CRT was feasible, and is a promising treatment strategy for unresectable esophageal cancer. (author)

  9. Economic Development and Economic Governance Through the Example of the City of Győr

    Directory of Open Access Journals (Sweden)

    Dávid Fekete

    2018-04-01

    Full Text Available Since the 1990s the metropolitan region and its governance has got into the focus of regional science again. Nowadays a newer wave of metropolitan governance is authoritative, which has exceeded the former administrative-territorial planning aspects, and has appeared on the scene as the mechanism of economic development policy. Examining the development stages of regional policy it is well-known that the classical (modern approach was superseded by the postmodern one. While the national methods applied in the classical period were characterized by strictness, central regulation, indirect regulation of the market (Fordist approach, in the postmodern period flexibility, decentralization and direct regulation have come to the fore (Post-Fordism. In the postmodern period the state level also takes its role in the financing of innovation and research&development, and the notions of networking and competitiveness are coming more and more to the fore. In this article I analyze these processes through the case study of Győr. After the theoretical introduction I examine the tools of economic development and economic governance in the Győr metropolitan region. Activities observed in Győr can strengthen the view-point that the processes of economic development and economic governance have nowadays been going on in parallel with each other. Moreover, the coordinating activities of local authorities can be observed in the work of organizations that support economic governance. In the course of the research it was also confirmed that built infrastructure can serve as a fundamental condition for the cooperation of network-systems that operate the governance system of a municipality.

  10. A randomized phase II trial of concurrent chemoradiation with two doses of radiotherapy, 60Gy and 66Gy, concomitant with a fixed dose of oral vinorelbine in locally advanced NSCLC

    DEFF Research Database (Denmark)

    Hansen, Olfred; Knap, Marianne M; Khalil, Azza

    2017-01-01

    was local progression free interval. A scheduled FDG-PET-CT-scan was performed 9months after randomization. The study was registered at ClinicalTrials.gov (NCT 00887783). RESULTS: Both arms were well tolerated. The local progression free interval at 9months was 54% in the 60Gy arm and 59% in the 66Gy arm...

  11. Effects of 2.0 Gy of 60Co gamma rays irradiation on rat embryos

    International Nuclear Information System (INIS)

    Lee, Juing-Yi; Satow, Yukio

    1987-01-01

    Pregnant rats of Donryu strain were exposed to a whole-body 60 Co γ ray irradiation of a single dose of 2.0 Gy (Dose rate: 0.5 Gy/min) on day 7, 8, 9, 10 or 11 of gestation (sperm day = day 0). The rats were sacrificed on day 18 and the offspring were examined for external and visceral malformations. Malformed embryos occurred between days 7 and 11 with the highest incidence occurring on day 9. Dose with 2.0 Gy increased the rate of resorption or death (52.1 %), in the survivors, caused congenital malformation in a majority of embryos (86.5 %) on day 8 of gestation. There is an increase in malformation (93.3 %) and growth retardation, but no increase in mortality (42.9 %) on day 9 of gestation. Relatively few anomalies resulted from irradiation on day 7 of gestation. The peak day for cardiovascular anomalies occurred on day 9 (88.3 % of all survival embryos) with high levels also occurring on day 8 (86.5 %). Cardiovascular anomalies consisted of VSD, hypoplasia of the pulmonary trunk, coarctation of the aorta, double aortic arch, right aortic arch, riding aorta, complete transposition of the aorta, persistent atrioventricular canal, vascular ring, aberrant right subclavian artery and others. Similar anomalies, but at a lower incidence, were produced by 60 Co γ ray at dose levels of 2.0 Gy on day 10 or 11 of gestation. Cases of cleft lip and cleft palate or facial cleft were observed seventeen fetuses on day 9 of gestation (31 %). Exencephaly occurred in nine embryos treated on day 9 (16.1 %) and in one embryos treated on day 10. Tail defects appeared with treatment on day 9 with the latter predominating on day 11. The present study show that maximum resorption (52.1 %) was seen with treatment on day 8 whereas the highest rate of malformation (93.3 %) was observed with treatment on day 9. (J.P.N.)

  12. Effects of 2. 0 Gy of /sup 60/Co gamma rays irradiation on rat embryos

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Juing-Yi; Satow, Yukio

    1987-01-01

    Pregnant rats of Donryu strain were exposed to a whole-body /sup 60/Co ..gamma.. ray irradiation of a single dose of 2.0 Gy (Dose rate: 0.5 Gy/min) on day 7, 8, 9, 10 or 11 of gestation (sperm day = day 0). The rats were sacrificed on day 18 and the offspring were examined for external and visceral malformations. Malformed embryos occurred between days 7 and 11 with the highest incidence occurring on day 9. Dose with 2.0 Gy increased the rate of resorption or death (52.1 %), in the survivors, caused congenital malformation in a majority of embryos (86.5 %) on day 8 of gestation. There is an increase in malformation (93.3 %) and growth retardation, but no increase in mortality (42.9 %) on day 9 of gestation. Relatively few anomalies resulted from irradiation on day 7 of gestation. The peak day for cardiovascular anomalies occurred on day 9 (88.3 % of all survival embryos) with high levels also occurring on day 8 (86.5 %). Cardiovascular anomalies consisted of VSD, hypoplasia of the pulmonary trunk, coarctation of the aorta, double aortic arch, right aortic arch, riding aorta, complete transposition of the aorta, persistent atrioventricular canal, vascular ring, aberrant right subclavian artery and others. Similar anomalies, but at a lower incidence, were produced by /sup 60/Co ..gamma.. ray at dose levels of 2.0 Gy on day 10 or 11 of gestation. Cases of cleft lip and cleft palate or facial cleft were observed seventeen fetuses on day 9 of gestation (31 %). Exencephaly occurred in nine embryos treated on day 9 (16.1 %) and in one embryos treated on day 10. Tail defects appeared with treatment on day 9 with the latter predominating on day 11. The present study show that maximum resorption (52.1 %) was seen with treatment on day 8 whereas the highest rate of malformation (93.3 %) was observed with treatment on day 9. (J.P.N.).

  13. Local Sensorium, Local Cinema: György Pálfi’s Sensuous Body Politics

    Directory of Open Access Journals (Sweden)

    Kalmár György

    2014-09-01

    Full Text Available György Pálfi’s Hukkle (2002 and Taxidermia (2006 establish markedly unique cinematic styles and richly sensorial life-worlds, which function in both films as counter-discourses opposing official history, hegemonic ideologies, and conventional patterns of (cinematic understanding. In the present study I analyse the ways Pálfi’s films communicate through non-symbolic meaning, bodily discourses, and a heavy reliance on the multisensory evocation of the local sensorium (Marks and the local habitus (Bourdieu so as to create significance on the margins of established, hegemonic systems of meaning, cinema, ideology and identity.

  14. Wholesomeness of food irradiated with doses above 10 kGy

    Energy Technology Data Exchange (ETDEWEB)

    Kaferstein, F [Director, Programme of Food Safety and Food Aid, WHO, CH-1211, Geneva 27, (Switzerland)

    1998-12-31

    Strictly from the scientific point of view, no ceiling should be set for food irradiated with doses greater than the currently recommended upper level of 10 kGy by the Codex Alimentarius Commission. The food irradiation technology itself is safe to such a degree that as long as sensory qualities of food are retained and harmful microorganisms are destroyed, the actual amount of ionizing radiation applied is of secondary consideration. That was the main conclusion of a week-long meeting on high dose irradiation organized jointly by the World Health Organization (WHO), the United Nations Food and Agriculture Organization (FAO) and the International Atomic Energy Agency (IAEA). The knowledge of what can and does occur chemically in high dose irradiated foods which derives from over 50 years of research tells us that one can go as high as 75 kGy, as has already been done in some countries, and the result is the same food is safe and wholesome and nutritionally adequate. (Author)

  15. SyZyGy: A straight interferometric spacecraft system for gravity wave observations

    International Nuclear Information System (INIS)

    Estabrook, F.B.; Armstrong, J.W.; Tinto, Massimo; Folkner, William

    2003-01-01

    We consider a spaceborne gravitational wave (GW) detector formed by three spacecraft in a linear array, coherently exchanging laser beams and using the data combinations of time-delay interferometry (TDI). We previously showed how the measured time series of Doppler shifts in the six one-way laser links between spacecraft pairs in a general unequal-arm triangular configuration can be combined, using TDI, to exactly cancel the otherwise overwhelming phase noise of the lasers while retaining sensitivity to GWs. Here we apply TDI, unfolding the general triangular configuration, to the special case of a linear array of three spacecraft. We show that such an array ('SyZyGy') has, compared with an equilateral triangle GW detector of the same scale, a degraded (but non-zero) sensitivity at low frequencies [f -4 -10 -1 Hz). SyZyGy with ∼1 light-second scale could, for the same instrumental assumptions as LISA, make observations in this intermediate frequency GW band with 5σ sensitivity to sinusoidal waves ≅2.5x10 -23 in a year's integration

  16. Wholesomeness of food irradiated with doses above 10 kGy

    International Nuclear Information System (INIS)

    Kaferstein, F.

    1997-01-01

    Strictly from the scientific point of view, no ceiling should be set for food irradiated with doses greater than the currently recommended upper level of 10 kGy by the Codex Alimentarius Commission. The food irradiation technology itself is safe to such a degree that as long as sensory qualities of food are retained and harmful microorganisms are destroyed, the actual amount of ionizing radiation applied is of secondary consideration. That was the main conclusion of a week-long meeting on high dose irradiation organized jointly by the World Health Organization (WHO), the United Nations Food and Agriculture Organization (FAO) and the International Atomic Energy Agency (IAEA). The knowledge of what can and does occur chemically in high dose irradiated foods which derives from over 50 years of research tells us that one can go as high as 75 kGy, as has already been done in some countries, and the result is the same food is safe and wholesome and nutritionally adequate. (Author)

  17. Functional results of radioiodine therapy with a 300-GY absorbed dose in Graves' disease

    International Nuclear Information System (INIS)

    Willemsen, U.F.; Knesewitsch, P.; Kreisig, T.; Pickardt, C.R.; Kirsch, C.M.

    1993-01-01

    The aim of this study was to assess the results of high-dose radioiodine therapy given to 43 patients with recurrent hyperthyroidism due to Graves' disease between 1986 and 1992. We chose an intrathyroidal absorbed dose of 300 Gy and determined the applied activity individually, which ranged from 240 to 3120 MBq with a median of 752 MBq. Hperthyroidism was eliminated in 86% of cases after 3 months and in 100% after 12 months. No patient required a second radioiodine treatment. The incidnece of hyperthyroidism was 63% after 3 months and 93% after 18 months. Neither the pretherapeutic thyroid-stimulating immunoglobulin level nor the degree of co-existing endocrine ophthalmopathy was correlated with the time at which hypothyroidism developed. Patients with previous radioiodine therapy developed hypothyroidism earlier than patients with previous thyroid surgery. The results show that ablative radioiodine therapy with a 300-Gy absorbed dose is a very effective treatment of hyperthyroidism in Graves' disease, but it should be restricted to patients with recurrent hyperthyroidism combined with severe co-existing disorders or episodes of unfavourable reactions to antithyroid drugs. (orig.)

  18. Safety Evaluation of 30 kGy Irradiated Chocolate Ice Cream

    International Nuclear Information System (INIS)

    Jeon, Y.E.; Yin, X.F.; Chung, C.K.; Kang, I.J.

    2013-01-01

    This study was investigated the potential toxicity of gamma-irradiated chocolate ice cream for its future use in space. Chocolate ice cream was irradiated at a dose of 30 kGy at a temperature of -20°C. For the animal study, AIN-93G was used as a control diet and irradiated and non-irradiated chocolate ice cream diets were administered to male and female ICR mice (ten mice per group) for three months. During the experimental period, the group fed irradiated chocolate ice cream did not show any changes in appearance, behavior, mortality, body weight, organ weight, or food consumption compared to the control. Also, all biochemical parameters, including hematology profiles, erythrocyte counts, and serum biochemical values were in normal ranges. In histopathological examinations of liver and kidney tissues, there were no significant differences between the control group and the group fed irradiated chocolate ice cream. These results indicate that chocolate ice cream irradiated at 30 kGy did not cause any toxic effects and could be applied for the development of safe and hygienic space food

  19. Wholesomeness of food irradiated with doses above 10 kGy

    Energy Technology Data Exchange (ETDEWEB)

    Kaferstein, F. [Director, Programme of Food Safety and Food Aid, WHO, CH-1211, Geneva 27, (Switzerland)

    1997-12-31

    Strictly from the scientific point of view, no ceiling should be set for food irradiated with doses greater than the currently recommended upper level of 10 kGy by the Codex Alimentarius Commission. The food irradiation technology itself is safe to such a degree that as long as sensory qualities of food are retained and harmful microorganisms are destroyed, the actual amount of ionizing radiation applied is of secondary consideration. That was the main conclusion of a week-long meeting on high dose irradiation organized jointly by the World Health Organization (WHO), the United Nations Food and Agriculture Organization (FAO) and the International Atomic Energy Agency (IAEA). The knowledge of what can and does occur chemically in high dose irradiated foods which derives from over 50 years of research tells us that one can go as high as 75 kGy, as has already been done in some countries, and the result is the same food is safe and wholesome and nutritionally adequate. (Author)

  20. Effects of 15 Gy 137Cs γ-rays radiation of rat kidneys on bone metabolism

    International Nuclear Information System (INIS)

    Gao Linfeng; Wang Hongfu; Xu Peikang; Xu Aihong; Zhu Feipeng

    2003-01-01

    The work was to observe the effects of γ-rays radiation of rat kidneys on rat bone metabolism. Ten male SD rats aged 6 months were irradiated at their kidneys with 15 Gy 137 Cs γ-rays (0.91 Gy/min) and were raised for 3 months after the radiation. On collecting 24h urine of rats they were sacrificed for serum, kidney, spine, femur and tibia exams. Results show that the γ-ray irradiation could induce the pathological injuries of renal glomeruli, tubules and mesenchyme. Comparing to the control group, significant changes were found in the irradiated group in terms of their blood urea, nitrogen creatinine, urinal β-2 microglobulin, serum Ca and P, urine Ca and P, activity of serum alkaline phosphatase, 1,25 (OH) 2 D 3 , serum PTH, urine PYD/creatinine, bone mineral density (BMD) of lumbar vertebras, mineral mass of No.4 lumbar vertebra, BMD, dehydrated weight and ash weight of right femur. Marked changes were also found in bone trabecula volume, average bone trabecula thick and the ratio of nodes/points, and rate of mineralization deposition. It was concluded that renal dysfunction and metabolic bone disease might occur with the character of accelerated bone turnover and decreased bone mass

  1. Functional results of radioiodine therapy with a 300-GY absorbed dose in Graves' disease

    Energy Technology Data Exchange (ETDEWEB)

    Willemsen, U.F. (Dept. of Nuclear Medicine, Dept. of Radiology, Muenchen (Germany)); Knesewitsch, P. (Dept. of Nuclear Medicine, Dept. of Radiology, Muenchen (Germany)); Kreisig, T. (Dept. of Nuclear Medicine, Dept. of Radiology, Muenchen (Germany)); Pickardt, C.R. (Dept. of Internal Medicine, Muenchen Univ. (Germany)); Kirsch, C.M. (Dept. of Nuclear Medicine, Dept. of Radiology, Muenchen (Germany))

    1993-11-01

    The aim of this study was to assess the results of high-dose radioiodine therapy given to 43 patients with recurrent hyperthyroidism due to Graves' disease between 1986 and 1992. We chose an intrathyroidal absorbed dose of 300 Gy and determined the applied activity individually, which ranged from 240 to 3120 MBq with a median of 752 MBq. Hperthyroidism was eliminated in 86% of cases after 3 months and in 100% after 12 months. No patient required a second radioiodine treatment. The incidnece of hyperthyroidism was 63% after 3 months and 93% after 18 months. Neither the pretherapeutic thyroid-stimulating immunoglobulin level nor the degree of co-existing endocrine ophthalmopathy was correlated with the time at which hypothyroidism developed. Patients with previous radioiodine therapy developed hypothyroidism earlier than patients with previous thyroid surgery. The results show that ablative radioiodine therapy with a 300-Gy absorbed dose is a very effective treatment of hyperthyroidism in Graves' disease, but it should be restricted to patients with recurrent hyperthyroidism combined with severe co-existing disorders or episodes of unfavourable reactions to antithyroid drugs. (orig.)

  2. Health-Related Quality of Life in Patients With Locally Advanced Prostate Cancer After 76 Gy Intensity-Modulated Radiotherapy vs. 70 Gy Conformal Radiotherapy in a Prospective and Longitudinal Study

    International Nuclear Information System (INIS)

    Lips, Irene; Dehnad, Human; Kruger, Arto Boeken; Moorselaar, Jeroen van; Heide, Uulke van; Battermann, Jan; Vulpen, Marco van

    2007-01-01

    Purpose: To compare quality of life (QoL) after 70 Gy conformal radiotherapy with QoL after 76 Gy intensity-modulated radiotherapy (IMRT) in patients with locally advanced prostate carcinoma. Methods and Materials: Seventy-eight patients with locally advanced prostate cancer were treated with 70 Gy three-field conformal radiotherapy, and 92 patients received 76 Gy IMRT with fiducial markers for position verification. Quality of life was measured by RAND-36, the European Organization for Research and Treatment of Cancer core questionnaire (EORTC QLQ-C30(+3)), and the prostate-specific EORTC QLQ-PR25, before radiotherapy (baseline) and 1 month and 6 months after treatment. Quality of life changes in time (baseline vs. 1 month and baseline vs. 6 months) of ≥10 points were considered clinically relevant. Results: Differences between the treatment groups for QoL changes over time occurred in several QoL domains. The 76-Gy group revealed no significant deterioration in QoL compared with the 70-Gy group. The IMRT 76-Gy group even demonstrated a significantly better change in QoL from baseline to 1 month in several domains. The conformal 70-Gy group revealed temporary deterioration in pain, role functioning, and urinary symptoms; for the IMRT 76-Gy group a better QoL in terms of change in health existed after 1 month, which persisted after 6 months. For both treatment groups temporary deterioration in physical role restriction occurred after 1 month, and an improvement in emotional role restriction occurred after 6 months. Sexual activity was reduced after treatment for both groups and remained decreased after 6 months. Conclusions: Intensity-modulated radiotherapy and accurate position verification seem to provide a possibility to increase the radiation dose for prostate cancer without deterioration in QoL

  3. Identification of microbial isolates from vacuum-packaged ground pork irradiated at 1 kGy

    International Nuclear Information System (INIS)

    Ehioba, R.M.; Kraft, A.A.; Molins, R.A.; Walker, H.W.; Olson, D.G.; Subbaraman, G.; Skowronski, R.P.

    1988-01-01

    Bacterial cultures from irradiated (1 kGy) and nonirradiated, vacuum-packaged ground pork held at 5 0 C were isolated and characterized over a 12-day storage period. The initial flora of the meat was composed mostly of Pseudomonas sp., and Enterobacter sp. Although the microflora of nonirradiated samples gradually shifted from Gram-negative to Gram-positive microorganisms, 76% of the isolates were characterized as Gram-negative at the onset of spoilage (9 days at 5 0 C). In contrast, the irradiated ground pork microflora was mainly Gram-positive (66%) shortly after irradiation and increased to 97% after 9 days at 5 0 C. A total of 720 isolates were identified to genus

  4. The affect of bone marrow cell biomechanical characteristics to 6 Gy γ irradiation-injured mice

    International Nuclear Information System (INIS)

    Pu Xiaoyun; Chen Xiaoli; Pan Jing; Li Zhaoquan; Deng Jun; Huang Hui; Ye Yong

    2004-01-01

    Objective: To explore the change of bone marrow cell biomechanical characteristics in radiation-injured mice and the influencing factors. Methods: Male Kunming mice were exposed to total body irradiation of 6 Gy γ-rays from a 60 Co source. Electrophoresis, DPH probe-micropore filter, and adhesion rate methods were used to detect cell surface charge, membrane microviscosity, cell deformability, and cell adhesion, respectively. Results: The deformability, adhesiveness and cell surface charges of bone marrow cells (including hematopoietic cells and stromal cells) were dramatically decreased, but membrane microviscosity was obviously increased after irradiation on 1 d, 3 d and 7 d. Conclusion: The biomechanical characteristics of bone marrow cells are obviously changed after radiation injury. It might be one of the reasons of hematopoietic failure after irradiation. (authors)

  5. Pierre Gy's sampling theory and sampling practice heterogeneity, sampling correctness, and statistical process control

    CERN Document Server

    Pitard, Francis F

    1993-01-01

    Pierre Gy's Sampling Theory and Sampling Practice, Second Edition is a concise, step-by-step guide for process variability management and methods. Updated and expanded, this new edition provides a comprehensive study of heterogeneity, covering the basic principles of sampling theory and its various applications. It presents many practical examples to allow readers to select appropriate sampling protocols and assess the validity of sampling protocols from others. The variability of dynamic process streams using variography is discussed to help bridge sampling theory with statistical process control. Many descriptions of good sampling devices, as well as descriptions of poor ones, are featured to educate readers on what to look for when purchasing sampling systems. The book uses its accessible, tutorial style to focus on professional selection and use of methods. The book will be a valuable guide for mineral processing engineers; metallurgists; geologists; miners; chemists; environmental scientists; and practit...

  6. Cardiac ultrastructural changes in rats following 250 Gy whole body. gamma. -irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Yao, Guo; Mingyue, Zhu; Zhiqin, Zhao

    1985-10-01

    Sixteen rats were whole body irradiated with 250 Gy of /sup 60/Co ..gamma..-rays, killed at different intervals after exposure, and then observed by electron microscope. We found lysis of part of myofilaments in specimen obtained at 10 minutes after exposure, and resolution of Z-band at 30 minutes after exposure. These changes were more significant in sections at 12 hours postirradiation, but there also appeared cell regeneration at the same time. The vascular changes were more obvious with the endothelial cytoplasma projected in capillary lumen, nearly obstructing it. All of above described changes may be found in hematologic or intestinal forms of radiation sickness, but they must take place more late after exposure. In cardiovascular form, however, these changes were found as early as 10-30 minutes after exposure; this is a special feature helpful to diagnosis.

  7. Study of differential gene expression in human hepatocyte exposed to 50 cGy γ ray

    International Nuclear Information System (INIS)

    Wen Jianhua; Li Jianguo; Tian Huancheng; Li Yanling; Wang Xiaoli; Zuo Yanhui

    2008-01-01

    The study analyzed the differential transcriptional profile of the normal human hepatic cell and the human hepatic cell radiated with 50 cGy γ ray by gene chip technique. The results showed that there were 614 differentially expressed genes among 14 112 human genes analyzed, in which 521 genes were up-regulated and 93 genes down-regulated. These genes are associated with mitochondrial regulation, homo sapiens hepatitis A virus cellular receptor, tumor necrosis factor, cell cycle regulation, kinase and zinc finger protein etc. RT-PCR results indicated that up-regulated expression of gene HAVcr-1, HAVcr-2, MFTC, MOAP1 and down-regulated expression of gene TRIP12, DCN were consistent with gene chip data. (authors)

  8. Substantiation of 25 kGy (by use of VDmax25 method) as the sterilization dose

    International Nuclear Information System (INIS)

    2011-01-01

    The International standards for radiation sterilization require evidence of the effectiveness of a minimum sterilization dose of 25 kGy but do not provide detailed guidance on how this evidence can be generated. Although many of the procedural elements in method VD m ax are similar to those of Method 1 of ANSI/AAMI/ISO 11137-2, there are differences that require elaboration. In this project, test procedure of VD m ax 2 5 method was established and then validated in Radiation Microbiology Laboratory (RML) test conditions. Beside, this method has been applied successfully for two years in order to reply the demand of the manufacturer firms as routine test service. In the near future, RML will be the only accredited laboratory in Turkey on 'validation of radiation sterilization' standard (ANSI/AAMI/ISO 11137-2: 2006) that consists of VD m ax 2 5 method

  9. Low-dose (10-Gy) total skin electron beam therapy for cutaneous T-cell lymphoma

    DEFF Research Database (Denmark)

    Kamstrup, Maria R; Gniadecki, Robert; Iversen, Lars

    2015-01-01

    a total dose of 10 Gy in 10 fractions. Data from 10 of these patients were published previously but were included in the current pooled data analysis. Outcome measures were response rate, duration of response, and toxicity. RESULTS: The overall response rate was 95% with a complete cutaneous response......PURPOSE: Cutaneous T-cell lymphomas (CTCLs) are dominated by mycosis fungoides (MF) and Sézary syndrome (SS), and durable disease control is a therapeutic challenge. Standard total skin electron beam therapy (TSEBT) is an effective skin-directed therapy, but the possibility of retreatments...... or a very good partial response rate (response was 174 days (5.8 months; range: 60-675 days). TSEBT-related acute adverse events (grade 1 or 2) were observed in 60% of patients. CONCLUSIONS...

  10. Morphometric changes of pulmonary tissues after 20 Gy external irradiation of rat chest

    International Nuclear Information System (INIS)

    Cao Zhenshan; Ye Changqing; Yuan Lizhen

    1996-01-01

    The changes in the main parameters of the lungs at different periods of early stage after local 20 Gy external irradiation of the lungs were measured with morphometric method. The results indicated that the walls of pulmonary arterioles and venules thickened and the vascular permeability index (area of vascular lumen/total area of blood vessel) decreased 7 days after irradiation (P 2 , r = -0.919), indicating that narrowing of the vascular lumen was the result of thickening of the vascular wall. Fifteen days after irradiation, the pulmonary alveolar wall thickened, the area of alveolar cavity decreased and the area of pulmonary interstitial space increased (P<0.01). Electron microscopic examination demonstrated profuse exudation surrounding the microvessels, obvious evacuation of pulmonary type-II cells and increase in cellular types and quantity of pulmonary tissues

  11. Higher than standard radiation doses (≥72 Gy) with or without androgen deprivation in the treatment of localized prostate cancer

    International Nuclear Information System (INIS)

    Kupelian, Patrick A.; Mohan, Dasarahally S.; Lyons, Janice; Klein, Eric A.; Reddy, Chandana A.

    2000-01-01

    Purpose: To study the effect on biochemical relapse-free survival (bRFS) and clinical disease-free survival of radiation doses delivered to the prostate and periprostatic tissues for localized prostate cancer. Methods and Materials: A total of 1041 consecutive localized prostate cancer cases treated with external beam radiotherapy (RT) at our institution between 7/86 and 2/99 were reviewed. All cases had available pretreatment parameters including pretreatment prostate-specific antigen (iPSA), biopsy Gleason score (bGS), and clinical T stage. The median age was 69 years. Twenty-three percent of cases (n = 238) were African-American. The distribution by clinical T stage was as follows: T1 in 365 cases (35%), T2 in 562 cases (54%), and T3 in 114 cases (11%). The median iPSA level was 10.1 ng/ml (range: 0.4-692.9). The distribution by biopsy Gleason score (bGS) was as follows: ≤6 in 580 cases (56%) and ≥7 in 461 cases (44%). Androgen deprivation (AD) in the adjuvant or neoadjuvant setting was given in 303 cases (29%). The mean RT dose was 71.9 Gy (range: 57.6-78.0 Gy). The median RT dose was 70.2 Gy, with 458 cases (44%) receiving at least 72.0 Gy. The average dose in patients receiving <72 Gy was 68.3 Gy (median 68.4) versus 76.5 Gy (median 78.0) for patients receiving ≥72 Gy. The mean follow-up was 38 months (median 33 months). The number of follow-up prostate-specific antigen (PSA) levels available was 5998. Results: The 5- and 8-year bRFS rates were 61% (95% CI 55-65%) and 58% (95% CI 51-65%), respectively. The 5-year bRFS rates for patients receiving radiation doses ≥72 Gy versus <72 Gy were 87% (95% CI 82-92%) and 55% (95% CI 49-60%), respectively. The 8-year bRFS rates for patients receiving radiation doses ≥72 Gy versus <72 Gy were 87% (95% CI 82-92%) and 51% (95% CI 44-58%), respectively (p < 0.001). A multivariate analysis of factors affecting bRFS was performed using the following parameters: age (continuous variable), race, T-stage (T1-T2 vs. T3

  12. Quality of fresh-cut Iceberg lettuce and spinach irradiated at doses up to 4 kGy

    International Nuclear Information System (INIS)

    Fan Xuetong; Guan Wenqiang; Sokorai, Kimberly J.B.

    2012-01-01

    Fresh-cut Iceberg lettuce packaged in modified atmosphere packages and spinach in perforated film bags were irradiated with gamma rays at doses of 0, 1, 2, 3, and 4 kGy. After irradiation, the samples were stored for 14 days at 4 °C. O 2 levels in the packages of fresh-cut Iceberg lettuce decreased and CO 2 levels increased with increasing radiation dose, suggesting that irradiation increased respiration rates of lettuce. Tissue browning of irradiated cut lettuce was less severe than that of non-irradiated, probably due to the lower O 2 levels in the packages. However, samples irradiated at 3 and 4 kGy had lower maximum force and more severe sogginess than the non-irradiated control. In addition, ascorbic acid content of irradiated lettuce was 22–40% lower than the non-irradiated samples after 14 days of storage. The visual appearance of spinach was not affected by irradiation even at a dose of 4 kGy. Consumer acceptance suggested that more people would dislike and would not buy spinach that was treated at 3 and 4 kGy as compared to the non-irradiated sample. Overall, irradiation at doses of 1 and 2 kGy may be employed to enhance microbial safety of fresh-cut Iceberg lettuce and spinach while maintaining quality. - Highlights: ▶ Headspace composition in the modified atmosphere packages of cut lettuce was affected by irradiation. ▶ Fresh-cut lettuce in adapted atmosphere could tolerate 1 or 2 kGy rays without quality deterioration in look and texture. ▶ Lettuce irradiated at doses higher than 2 kGy developed sogginess. ▶ Irradiated spinach maintained a good appearance at doses of 3 and 4 kGy. ▶ Higher doses (3 and 4 kGy) of radiation decreased consumers' likingness and purchase intent of irradiated spinach.

  13. Role of NO in adrenergic regulation of the heart after chronic gamma irradiation in 1 Gy dose

    International Nuclear Information System (INIS)

    Suvorova, T.A.; Lobanok, L.M.

    2005-01-01

    Chronic irradiation in 1 Gy dose significantly decreased adrenoreactivity of the heart. Modification of NO-mediated mechanisms plays an important role in radiation-induced changes of adrenergic control of heart functional activity and coronary flow. (authors)

  14. eGY-Africa: addressing the digital divide for science in Africa

    Science.gov (United States)

    Baki, Paul; Nguno, Anna; Barton, Charles; Amaeshi, Larry; Tenthani, Chifundo; Petitdidier, Monique; Cottrell, Les

    2013-04-01

    Adoption of information and communication technologies and access to the Internet is expanding in Africa, but because of the rapid growth elsewhere, a Digital Divide between Africa and the rest of the world exists. In many sub-Saharan African countries, education and research sector suffers some of the worst deficiencies in access to the Internet, despite progress in the development of NRENs - National Research and Education (cyber) Networks. By contrast, it is widely acknowledged in policy statements from the African Union, the UN, and others that strength in this very sector provides the key to meeting and sustaining Millennium Development Goals. Developed countries with effective cyber-capabilities proclaim the benefits to rich and poor alike arising from the Information Revolution. This is still a dream for many scientists in African institutions. As the world of science becomes increasingly Internet-dependent, so they become increasingly isolated. eGY-Africa is a bottom-up initiative by African scientists and their collaborators to try to reduce this digital divide by a campaign of advocacy for better institutional facilities. Four approaches are being taken. The present status of Internet services, problems, and plans are being mapped via a combination of direct measurement of Internet performance (the PingER Project) and a questionnaire-based survey. Information is being gathered on policy statements and initiatives aimed at reducing the digital divide, which can be used for arguing the case for better Internet facilities. Groups of concerned scientists are being formed at the national, regional levels in Africa, building on existing networks as much as possible. Opinion in the international science community is being mobilized. Finally, and perhaps most important of all, eGY-Africa is seeking to engage with the many other programs, initiatives, and bodies that share the goal of reducing the digital divide - either as a direct policy objective, or indirectly

  15. Hyperfractionated radiotherapy (2100 cGY) for stage 4 neuroblastoma as part of intensive multimodality therapy

    International Nuclear Information System (INIS)

    Gollamudi, S.V.; Kushner, B.H.; Merchant, T.E.; LaQuaglia, M.; Lindsley, K.; Rosenfield, N.; Abramson, S.; Kramer, K.; Cheung, N.K.V.

    1997-01-01

    PURPOSE: To retrospectively evaluate the role of hyperfractionated radiotherapy to the primary site following induction chemotherapy and aggressive surgical resection in patients (pts) with stage 4 neuroblastoma. MATERIALS AND METHODS: 48 previously untreated children (median age at diagnosis 3 yo, range 1-10 yo) with stage 4 neuroblastoma achieved a complete-, near-complete-, or partial-remission after multimodality therapy (protocol N4: 6 pts, N5: 7 pts, N6: 27 pts, or N7: 8 pts). All protocols included a regimen consisting of dose-intensive multiagent chemotherapy, maximal surgical debulking, followed by hyperfractionated radiotherapy. Most pts then underwent consolidation with either autologous marrow transplantation (N4 and N5), or immunotherapy (N6 and N7) with radioimmunotherapy (N7). Of 48 pts, 46 had microscopic disease at the primary site prior to beginning radiotherapy (45 underwent gross total resection of the primary, and one had no residual primary disease after chemotherapy alone). One pt had a partial resection, and one remained unresectable after mutimodality therapy. The pre-chemotherapy volume of the primary tumor and regional lymph nodes were irradiated to a total dose of 2100cGy delivered twice-daily in 150 cGy fractions over 7 treatment days. RESULTS: With a median follow-up of 32.5 months (range= 8-145 months), local-regional control was achieved in 44 of the 48 pts. Of the pts who are progression-free, median follow-up was 53.5 months. Overall, 24 of 48 pts progressed, three with local-regional recurrence as the first site of relapse, one with distant failure first and subsequent local-regional recurrence, and 21 with distant failure only. The probability of local-regional control at 32 months was 83%. One of the four pts with local-regional relapse never achieved a complete remission with either systemic therapy, surgical resection or radiotherapy. The progression-free survival at 32 months was 46%. Median time to overall progression was 16

  16. eGY-Africa: Addressing the Digital Divide for Science in Africa

    Energy Technology Data Exchange (ETDEWEB)

    Barton, C.E.; /Australian Natl. U., Canberra; Amory-Mazaudier, C.; /Lab.Phys.Plasmas, Saint Maur des Fosses; Barry, B.; /Assoc.African Univ., Accra; Chukwuma; /Olabisi Onabanjo U.; Cottrell, R.L.; /SLAC; Kalim, U.; /Pakistan Natl. U.; Mebrahtu, A.; /Mekelle U.; Petitdidier, M.; /Lab. d' Atmos., Velizy; Rabiu, B.; /Federal Tech. U., Akure; Reeves, C.; /Earthworks bv, Delft

    2010-06-16

    Adoption of information and communication technologies and access to the Internet is expanding in Africa, but because of the rapid growth elsewhere, a Digital Divide between Africa and the rest of the world exists, and the gap is growing. In many sub-Saharan African countries, education and research sector suffers some of the worst deficiencies in access to the Internet, despite progress in development of NRENs - National Research and Education (cyber) Networks. By contrast, it is widely acknowledged in policy statements from the African Union, the UN, and others that strength in this very sector provides the key to meeting and sustaining Millennium Development Goals. Developed countries with effective cyber-capabilities proclaim the benefits to rich and poor alike arising from the Information Revolution. This is but a dream for many scientists in African institutions. As the world of science becomes increasingly Internet-dependent, so they become increasingly isolated. eGY-Africa is a bottom-up initiative by African scientists and their collaborators to try to reduce this Digital Divide by a campaign of advocacy for better institutional facilities. Four approaches are being taken. The present status of Internet services, problems, and plans are being mapped via a combination of direct measurement of Internet performance (the PingER Project) and a questionnaire-based survey. Information is being gathered on policy statements and initiatives aimed at reducing the Digital Divide, which can be used for arguing the case for better Internet facilities. Groups of concerned scientists are being formed at the national, regional levels in Africa, building on existing networks as much as possible. Opinion in the international science community is being mobilized. Finally, and perhaps most important of all, eGY-Africa is seeking to engage with the many other programs, initiatives, and bodies that share the goal of reducing the Digital Divide - either as a direct policy

  17. Graves' disease and radioiodine therapy. Is success of ablation dependent on the achieved dose above 200 Gy?

    Energy Technology Data Exchange (ETDEWEB)

    Kobe, C.; Eschner, W.; Sudbrock, F.; Weber, I.; Marx, K.; Dietlein, M.; Schicha, H. [Dept. of Nuclear Medicine, Univ. of Cologne (Germany)

    2008-07-01

    Aim: this study was performed to determine the results of ablative radioiodine therapy (RIT) when the achieved dose in the thyroid was above 200 Gy and to characterize predictive factors for treatment outcome. Patients, methods: a total of 571 consecutive patients were observed for 12 months between July 2001 and June 2004. Inclusion criteria were a confirmed diagnosis Groves' disease, compensation of hyperthyroidism and withdrawal of antithyroid drugs two days before preliminary radioiodine-testing and RIT. The intended dose was 250 Gy and the therapeutically achieved dose was calculated from serial uptake measurements. The end-point measure was thyroid function 12 months after RIT; success was defined as elimination of hyperthyroidism. The relation between success rate and the achieved dose, thyroid volume, age and sex of patients, TSH- and TRAb-values and presence of ophthalmopathy was analysed. Results: relief from hyperthyroidism was achieved in 96% of patients who received more than 200 Gy, even for thyroid volumes >40 ml. The success of ablative RIT was not influenced by age or sex of patients, or by TSH- or TRAb values or concomitant ophthalmopathy. The mean achieved dose in the thyroid was 298 Gy with a standard deviation of 74.6 Gy. Conclusion: to achieve a dose of over 200 Gy with the above standard deviation, we recommend calculating on intended dose of 250 Gy and using a dosimetric approach with early and late uptake values in the radioiodine test, to allow early therapeutic intervention should the posttherapeutic thyroid dose fall unexpectedly below 200 Gy. (orig.)

  18. Lack of evidence for increased tolerance of rat spinal cord with decreasing fraction doses below 2 Gy

    International Nuclear Information System (INIS)

    Ang, K.K.; van der Kogel, A.J.; van der Schueren, E.

    1985-01-01

    The radiation tolerance of the spinal cord, both in man and in rats, has been shown to depend strongly on the size of the dose per fraction. With fraction doses down to about 2 Gy, the spinal cord tolerance can be predicted by a modified Ellis formula. More recently alternative isoeffect formulas were based on the linear-quadratic (LQ) model of cell survival where the effect of dose fractionation is characterized by the ratio α/β which varies from tissue to tissue. For the spinal cord, as well as for other late responding tissues, the ratio α/β is small, in contrast to most acutely responding tissues. Both the Ellis-type formula, and to a lesser extent the LQ-model, predict a continuously increasing tolerance dose with decreasing fraction size. From previous experiments on the rat cervical spinal cord with doses per fraction down to about 2 Gy, the ratio α/β was determined to be 1.7 Gy, and the LQ-model would predict a rise in tolerance with a reduction in fraction size to far below 2 Gy. Based on these predictions clinical studies have been initiated assuming a significantly increased tolerance by reduction of fraction size to about 1 Gy. However, in the present experiments no evidence was found for such an increase in tolerance with fraction sizes below 2 Gy

  19. Clotting mechanism in beagles irradiated by 4.5 Gy γ-rays

    International Nuclear Information System (INIS)

    Zhao Zhenhu; Wang Ning; Li Ming; Xing Shuang; Huang Haixiao; Ou Hongling; Xiong Guolin; Zhao Yanfang; Xie Ling; Wang Jinxiang; Miao Jingcheng; Zhu Nankang; Zhang Xueguang; Luo Qingliang; Cong Yuwen

    2010-01-01

    Objective: To explore the clotting mechanism in beagles irradiated by 4.5 Gy γ-rays after treatment with supportive care, or supportive care and combined cytokines. Methods: Sixteen beagles were divided into irradiation control group, Supportive care group and combined cytokines treatment group. Platelet aggregation test, thrombelastography (TEG) and the time measurement were analyzed in vitro. Results: In irradiation group and supportive care group, the platelet aggregation rates in beagles were decreased markedly and the k value of TEG was increased 7 d post-irradiation, while those indexes in combined cytokines treatment group changed little. At 14 d post-irradiation, each parameter of TEG in irradiated group changed obviously. The values of r, k, r + k and M were elevated significantly, clotting time and the maximum coagulation time of thrombus delayed, the Ma value was decreased markedly, and the maximum elasticity amplitude of thrombus was diminished. All parameters in combined cytokines treatment group were better than those in supportive care group. The thrombin time was prolonged obviously in irradiated group 14 d post-irradiation, while the thrombin time was the longest at 2-3 weeks post irradiation in supportive care group and combined cytokines treatment group (P>0.05). Conclusions: Cytokines could improve the platelet aggregation and the blood clotting functions of beagles suffering from acute radiation sickness. (authors)

  20. Alpha-methyl-homocysteine thiolactone protects lung of BALB/c mice irradiated with 6 Gy

    International Nuclear Information System (INIS)

    Lubec, G.; Tichatschek, E.; Foltinova, J.; Leplawy, T.; Mallinger, R.; Getoff, N.

    1996-01-01

    The radiation protective activity of intaperitoneally administered alpha-methyl-homocysteine thiolactone (α-MHCTL); 100 mg/kg body weight) in female BALB/c mice and such treated with cysteine treated (100 mg/kg body weight), using unirradiated and placebo treated irradiated mice were tested as controls. 6Gy whole body irradiated was applied and after a period of three weeks the animals were sacrificed and lungs were taken for morphometry and the determination of o-tyrosine. Septal areas were highest in the irradiated, placebo treated mice (68.67 + 9.82% septal area to total area) and lowest in the α-MHCTL treated irradiated mice (55.67 + 11.29%), significant at the p < 0.05 level. Morphometric data were accompanied by highest levels of o-tyrosine, a reliable parameter for OH-attack, in the irradiated, placebo treated group with 1.87 + 0.40 μM/g lung tissue and 0.32 + 0.13 μM/g lung tissue in the αMHCTL treated group; the statistical difference was significant. Significant radiation protection in the mammalian system at the morphological and biochemical level were found. The potent effect could be explained by the influence of alpha-alkylation in homocysteine thiolactone (HCTL) which renders amino acids unmetabolizeable, nontoxic, increases lipophilicity and therefore improving permeability through membranes. The present report confirms morphological data on the radiation protective activity of this interesting thiol compound. (Author)

  1. Behavioural consequences of an 8 Gy total body irradiation in mice: Regulation by interleukin-4

    International Nuclear Information System (INIS)

    Van der Meeren, A.; Lebaron-Jacobs, L.

    2001-01-01

    The effects of an 8 Gy γ total body irradiation (TBI) on exploration and locomotion activities as well as temperature were studied in C57BL6/J mice. Survival, body weight, and blood cell counts were also assessed in irradiated mice treated with placebo or interleukin (IL)-4. The efficacy of IL-4 treatment on improvement in exploration activity was evaluated. The study was carried out from 3 h to 30 days following exposure. Our results showed a biphasic response to irradiation concerning the exploration activity of mice. Irradiated mice had reduced activity as early as 3 h after exposure, with recovery of activity within 24 h. The exploration activity again decreased 4 days after irradiation and the recovery occurred slowly after day 17. IL-4 ameliorated the exploration status in mice in both phases. The locomotion activity was studied using a telemetry apparatus. A similar pattern to that of the exploration data was observed, with a minimal activity observed between days 13 and 17. A radiation-induced hypothermia was also noticed over the same time period. (author)

  2. Histopathological findings in a surgically resected thalamic cavernous hemangioma 1 year after 40-Gy irradiation.

    Science.gov (United States)

    Nyáry, István; Major, Otto; Hanzély, Zoltán; Szeifert, György T

    2005-01-01

    Stereotactic radiosurgery is a controversial treatment modality in the management of cerebral cavernous hemangiomas (CHs), and results vary from center to center. Even the interpretation of treatment failure is controversial. It is suggested that the systematic pathological investigation of irradiated specimens could help to resolve the controversy. A hemorrhagic lesion in the posterior part of the thalamus had been diagnosed as a tumor and was treated with 40-Gy fractionated radiotherapy. One year after this treatment the case was reconsidered based on new imaging evidence, and the lesion was removed by conventional craniotomy. Histopathological examination revealed a CH with postirradiation changes. Compared with nonirradiated control CH tissue samples, there was endothelial cell destruction and marked fibrosis with scar tissue formation in the stroma of the treated lesion. The histopathological findings in this specimen were similar to those described in arteriovenous malformations after gamma knife surgery. The results of light microscopic investigations suggest that the ionizing effect of radiation energy evokes vascular and connective tissue stroma changes in CHs as well.

  3. Behavioural consequences of an 8 Gy total body irradiation in mice: Regulation by interleukin-4

    Energy Technology Data Exchange (ETDEWEB)

    Van der Meeren, A.; Lebaron-Jacobs, L. [Inst. de Protection et de Surete Nucleaire, Dept. de Protection de la sante de l' Homme et de Dosimetrie, Section Autonome de Radiobiologie Appliquee a la Medecine, IPSN, Fontenay-aux-Roses (France)

    2001-02-01

    The effects of an 8 Gy {gamma} total body irradiation (TBI) on exploration and locomotion activities as well as temperature were studied in C57BL6/J mice. Survival, body weight, and blood cell counts were also assessed in irradiated mice treated with placebo or interleukin (IL)-4. The efficacy of IL-4 treatment on improvement in exploration activity was evaluated. The study was carried out from 3 h to 30 days following exposure. Our results showed a biphasic response to irradiation concerning the exploration activity of mice. Irradiated mice had reduced activity as early as 3 h after exposure, with recovery of activity within 24 h. The exploration activity again decreased 4 days after irradiation and the recovery occurred slowly after day 17. IL-4 ameliorated the exploration status in mice in both phases. The locomotion activity was studied using a telemetry apparatus. A similar pattern to that of the exploration data was observed, with a minimal activity observed between days 13 and 17. A radiation-induced hypothermia was also noticed over the same time period. (author)

  4. 100 Gy 60Co γ-Ray Induced Novel Mutations in Tetraploid Wheat

    Directory of Open Access Journals (Sweden)

    Chuntao Yang

    2014-01-01

    Full Text Available 10 accessions of tetraploid wheat were radiated with 100 Gy 60Co γ-ray. The germination energy, germination rate, special characters (secondary tillering, stalk with wax powder, and dwarf, meiotic process, and high-molecular-weight glutenin subunits (HMW-GSs were observed. Different species has different radiation sensibility. With 1 seed germinated (5%, T. dicoccum (PI434999 is the most sensitive to this dose of radiation. With a seed germination rate of 35% and 40%, this dose also affected T. polonicum (As304 and T. carthlicum (As293. Two mutant dwarf plants, T. turgidum (As2255 253-10 and T. polonicum (As302 224-14, were detected. Abnormal chromosome pairings were observed in pollen mother cells of both T. dicoccoides (As835 237-9 and T. dicoccoides (As838 239-8 with HMW-GS 1Ax silent in seeds from them. Compared with the unirradiated seed of T. polonicum (As304 CK, a novel HMW-GS was detected in seed of T. polonicum (As304 230-7 and its electrophoretic mobility was between 1By8 and 1Dy12 which were the HMW-GSs of Chinese Spring. These mutant materials would be resources for wheat breeding.

  5. Histopathological findings in a surgically resected thalamic cavernous hemangioma 1 year after 40-Gy irradiation.

    Science.gov (United States)

    Nyáry, István; Major, Otto; Hanzély, Zoltán; Szeifert, György T

    2005-01-01

    ✓ Stereotactic radiosurgery is a controversial treatment modality in the management of cerebral cavernous hemangiomas (CHs), and results vary from center to center. Even the interpretation of treatment failure is controversial. It is suggested that the systematic pathological investigation of irradiated specimens could help to resolve the controversy. A hemorrhagic lesion in the posterior part of the thalamus had been diagnosed as a tumor and was treated with 40-Gy fractionated radiotherapy. One year after this treatment the case was reconsidered based on new imaging evidence, and the lesion was removed by conventional craniotomy. Histopathological examination revealed a CH with postirradiation changes. Compared with nonirradiated control CH tissue samples, there was endothelial cell destruction and marked fibrosis with scar tissue formation in the stroma of the treated lesion. The histopathological findings in this specimen were similar to those described in arteriovenous malformations after gamma knife surgery. The results of light microscopic investigations suggest that the ionizing effect of radiation energy evokes vascular and connective tissue stroma changes in CHs as well.

  6. Onset of behavioral effects in mice exposed to 10 Gy Co-60 radiation

    International Nuclear Information System (INIS)

    Maier, D.M.; Landauer, M.R.

    1990-01-01

    The effects of 10 Gray (Gy) Co-60 radiation on social behavior, locomotor activity, and body weight were assessed in individually housed male Swiss-Webster mice. In experiment 1, aggressive behavior was evaluated prior to irradiation and for 7 d postirradiation by placing an untreated intruder in the irradiated or sham-irradiated resident's home cage for 5 min. Offensive aggressive behavior was not affected significantly by radiation until day 7 postirradiation, when attack latency increased, the frequency and duration of fighting decreased, and the frequency of bites, lunges, and chases decreased. Untreated intruder mice paired with irradiated resident mice showed a decrease in the duration of defensive upright postures and a decrease in the frequency of defensive upright postures, squeaks, and escapes on day 7 postirradiation. In experiment 2, locomotor activity and body weight were monitored for 7 d postirradiation. Body weight was decreased in irradiated mice beginning 4 d postirradiation. Locomotor activity was suppressed in irradiated animals 90 min after irradiation and remained depressed throughout the 7-d testing period. 25 refs

  7. Histological studies in developing brain after 0.5 Gy neutron irradiation in utero

    International Nuclear Information System (INIS)

    Antal, S.; Fueloep, Z.

    1986-01-01

    Pregnant mice were irradiated with 0.5 Gy neutrons on day 13, 15 or 18 of gestation. There was no significant difference in number of living young born per litter between in neutron irradiated mice and controls. Mortality of irradiated offspings increased in the first 3 days after birth. The brain weight of 21-day old animals after neutron irradiation averaged only 55, 56 and 69% of controls, resp. At six hours after irradiation morphological analysis showed nuclear pyknosis in the central nervous system. On day 13 the telencephalon was severely affected. The 30% cells were pyknotic in the wall of the cerebral hemisphere and 20% of cells in corpus striatum. In the metencephalon marked pyknosis was established in the tectal lamina of mesencephalon (16%) and in the cerebellar anlage (21%). The olfactory plate (24%), the ventricular zone of cerebral hemisphere (30%) and colliculus ganglionaris were damaged mostly (40%) after radiation on day 15 of gestation. The tectum of the mesencephali and in metencephalon the external granular layer of cerebellum and area of the rhombic lip were affected by irradiation (17-20%). The telencephalon found pyknotic but to a less extent in group irradiated on day 18 than it was on day 15. In the olfactory bulb 10% of pyknotic cells were seen and 16% of primary cortex of cerebral hemisphere more over 30% of nucleus caudatus/putamen were affected. In metencephalon 19% of external granular layer of cerebellum and 13% of trigonum cerebelli were pyknotic. In general, lesions of irradiation were rather mild in diencephalon and myelencephalon at all examined ages. Histological examinations support that defined parts of brain are damaged after neutron irradiation in utero and it may lead to the described physiological 18-20 and biochemical consequences 20,23 . (orig.)

  8. Prevention of heterotopic bone formation with early post operative irradiation in high risk patients undergoing total hip arthroplasty: comparison of 10.00 Gy vs 20.00 Gy schedules

    International Nuclear Information System (INIS)

    Anthony, P.; Keys, H.; Evarts, C.M.; Rubin, P.; Lush, C.

    1987-01-01

    Prior studies have demonstrated the effectiveness of postoperative radiation therapy (RT) to the hip area following total hip replacement (THR) surgery in preventing the development of heterotopic bone formation in patients considered to be at high risk for development of this complication. Previously, patients received 20.00 Gy in 10 fractions (fx) over 2 weeks, beginning as soon postop as medically feasible (usually post-op day 2). In an effort to reduce hospital stay and risk of secondary malignancy, a prospective treatment program was initiated April 1982 using a reduced dose of 10.00 Gy in 5 fx over 5-7 days. As of February 1984, 46 consecutive hips determined to be at high risk were treated with this reduced dose. Prior studies have demonstrated that heterotopic bone is always radiographically evident by 8 weeks. Of the 46 hips, 41 had been evaluated with the minimum required 8 week follow-up X ray. Twenty-five of these hips, 61%, had a mean long term follow-up of 12 months. It historical control group, consisting of 54 consecutive high risk post-THR's, was shown to have a 68.5% incidence of heterotopic bone. The 20.00 Gy group, when RT was started by post-op day 5, demonstrated a 3.2% incidence, compared to 4.9% in the 10.00 Gy group. Complication rates were also comparable in the two RT groups, 19.4% and 7.3% respectively; 10.00 Gy is apparently as effective as 20.00 Gy in preventing heterotopic bone formation in high risk post-THR patients

  9. Phase 2 Trial of Accelerated, Hypofractionated Whole-Breast Irradiation of 39 Gy in 13 Fractions Followed by a Tumor Bed Boost Sequentially Delivering 9 Gy in 3 Fractions in Early-Stage Breast Cancer

    International Nuclear Information System (INIS)

    Kim, Ja Young; Jung, So-Youn; Lee, Seeyoun; Kang, Han-Sung; Lee, Eun Sook; Park, In Hae; Lee, Keun Seok; Ro, Jungsil; Lee, Nam Kwon; Shin, Kyung Hwan

    2013-01-01

    Purpose: To report a phase 2 trial of accelerated, hypofractionated whole-breast irradiation (AH-WBI) delivered as a daily dose of 3 Gy to the whole breast followed by a tumor bed boost. Methods and Materials: Two hundred seventy-six patients diagnosed with breast cancer (pT1-2 and pN0-1a) who had undergone breast-conserving surgery in which the operative margins were negative were treated with AH-WBI delivered as 39 Gy in 13 fractions of 3 Gy to the whole breast once daily over 5 consecutive working days, and 9 Gy in 3 sequential fractions of 3 Gy to a lumpectomy cavity, all within 3.2 weeks. Results: After a median follow-up period of 57 months (range: 27-75 months), the rate of 5-year locoregional recurrence was 1.4% (n=4), whereas that of disease-free survival was 97.4%. No grade 3 skin toxicity was reported during the follow-up period. Qualitative physician cosmetic assessments of good or excellent were noted in 82% of the patients at 2 months after the completion of AH-WBI. The global cosmetic outcome did not worsen over time, and a good or excellent cosmetic outcome was reported in 82% of the patients at 3 years. The mean pretreatment percentage breast retraction assessment was 12.00 (95% confidence interval [CI]: 11.14-12.86). The mean value of percentage breast retraction assessment increased to 13.99 (95% CI: 12.17-15.96) after 1 year and decreased to 13.54 (95% CI: 11.84-15.46) after 3 years but was not significant (P>.05). Conclusions: AH-WBI consisting of 39 Gy in 13 fractions followed by a tumor bed boost sequentially delivering 9 Gy in 3 fractions can be delivered with excellent disease control and tolerable skin toxicity in patients with early-stage breast cancer after breast-conserving surgery

  10. Effect of protracted whole-body gamma irradiation with 6.7 Gy and 4.8 Gy (700 and 500 R) on trypsin inhibition activity of blood, cervical mucus and on morphological structure of cervix in ewes

    International Nuclear Information System (INIS)

    Molnarova, M.; Arendarcik, J.; Molnar, P.

    1984-01-01

    The pattern of changes in the trypsin inhibition activities (TIA) of blood plasma, cervical mucus and the morphological structure of the cervix was studied in ewes exposed to 60 Co radiation for seven and five days, the radiation doses being 6.7 Gy and 4.8 Gy, respectively. During exposure, the group of ewes irradaited with 4.8 Gy was given the Roboran vitamin addition and following irradiation ampicillin (5250 mg). TIA was determined from retardation of the hydrolysis of the synthetic substrate N-alpha-tosyl-p-nitroanilide by bovine trypsin; the TIA was expressed as the percentage of inhibited trypsin. Almost all the studied TIA values of blood plasma and cervical mucus were increased in the irradiated animals, the range being from 103.1 to 155.0% of the levels for non-irradiated ewes. A reduction was recorded only in the total TIA of blood plasma in the group irradiated with a dose of 6.7 Gy (83.1% of the values for non-irradiated animals). In the group of animals irradiated with 4.8 Gy and non Roboran administered, the TIA of cervical mucus was observed to decrease to 92.4%. It was found during the study of changes in the proportion of glands in the stroma and changes in epithelium thickness in the mucous membrane of the cervix uteri that the irradiated ewes had the epithelium thickness reduced to 95.3% to 65.5% and that their stromal gland number decreased to 75.4% to 79.7% of that recorded in non-irradiated animals. It was only in the group given the Roboran supplement that an increase to 123.7% of the gland number for untreated ewes was recorded on the tenth day after termination of the irradiation

  11. Response of mesenchymal stem cells in mice to 3.5 Gy X-ray irradiation

    International Nuclear Information System (INIS)

    Su Wenxia; Liu Huimin; Chen Yonghong; Zeng Wen; Liu Wenli; Sun Hanying

    2011-01-01

    Objective: To investigate the response of mesenchymal stem cells in mice to medium-dose X-ray irradiation in vitro. Methods: The mouse mesenchymal stem cell line C3H10T1/2 was submitted to 3.5 Gy X-ray irradiation. Hoechst33258 staining of adherent cells and Annexin V-FITC staining and flow cytometry analysis of suspension cells were performed respectively to assess cellular apoptosis at 3, 6, 12, 24, 48, 72 h and 1 week after irradiation. SA-β-gal staining was performed to analyze the cellular senescence at 24, 48, 72 h and 1 week after irradiation. The mRNA level of both Fas with its ligand FasL and p53 with its downstream target p21 WAF1 were measured by Real-Time PCR analysis. The expression of Fas protein was determined by immunofluorescence staining. Results: An increased apoptosis was observed at 3 h after irradiation with apoptosis rate 11.72% ± 1.61% (t=9.01, P<0.01), the apoptosis rate reached the peak level at 12 h 20.52% ± 1.96% (t=16.27, P<0.01), and then declined progressively to normal level at 48 h 4.93% ±0.46% (t=2.26, P>0.05). The SA-β-gal positive rate of post-radiation cells at 72 h was 53.33% ± 5.62%, significantly higher than that of normal control 3.24% ± 0.39% (t=17.77, P<0.01). The level of Fas, FasL mRNA was found to be elevated 3 h after irradiation with a peak at 12 h, and no differences were found l week later. The level of Fas protein was observed to reach the peak at 12 h after irradiation. The occurrence of peak level of Fas/FasL mRNA and protein was consistent with that of apoptosis of C3H10T1/2 cell. A transient up-regulation of p53, p21 WAF1 mRNA expression was found at 12 h after irradiation followed by a significant increase later at 72 h after irradiation. The occurrence of the two peaks of p53, p21 WAF1 mRNA expression were coincident with that of cellular apoptosis and senescence, respectively. The levels of p53, p21 WAF1 mRNA in senescence group were significantly higher than those of apoptosis group (t=17.85, 13

  12. Biological dosimetry of low doses (0.05 - 0.4 Gy) with micronucleus dicentrics and chromosome fragments

    International Nuclear Information System (INIS)

    Rodriguez, L.; Sanchez, E.; Linares, C.; Navlet, J.

    1997-01-01

    This study was carried out within the framework of the agreement between the National Nuclear Safety Council and the University of Alcala of Hernares and in co-operation with the Radiological Service and the Radiation Protection Unit of the Gregorio Maranon General Hospital of Madrid, where irradiations were performed. Blood samples were taken of 4 individuals irradiated with 6 doses of gamma rays between 0.05 Gy and 0.40 Gy, leaving an aliquot dose of 0 Gy. Cultures of lymphocytes for the study of dicentric chromosomes (DC) and chromosomal fragments (fr), stopping the first mitosis after postirradiation with Colcemid. A study of micronuclei (MN) in binuclear cells was also performed, interrupting the first cytokinesis after postirradiation with citocalasina B. After the corresponding studies with optical microscope, statistical analysis was made on the observed data on DC, fr and MN. We made a multiple linear regression analysis of the data of the 4 individuals. We obtained the average of the 4 individuals for each variable and dose and performed the variance analysis. According to our study, neither the DC nor the MN are valid dosemeters for lower doses up to 0.4 Gy. Nevertheless there are indications that the fragments are correlated with the dose to these levels. By increasing both the points of dose and the number of metaphases studied, we believe that a dose curve can be done that would allow to estimate with a reasonable degree of confidence the dose received by a sample irradiated

  13. A thermoluminescence study of mineral silicates extracted from herbs in the dose range 0.5–5 Gy

    International Nuclear Information System (INIS)

    Della Monaca, Sara; Fattibene, Paola; Bortolin, Emanuela

    2013-01-01

    The presence of silicates in many personal objects suggests their potential use at low dose as fortuitous dosimeter in an accidental radiological exposure, when conventional dosimetry is not available. The goal of the present work is the dosimetric characterization of mineral silicates extracted from the plant Hibiscus Sabdariffa L, known as Jamaica flower, in the dose range 0.5–5 Gy. By studying the radiation-induced signal in time, the temperature integration region between 210 °C and 250 °C was found to be the most stable and also reduced the effects of thermal fading in the dose reconstruction process; the dose response curve was linear between 0.5 Gy and 5 Gy. By checking the change in sensitivity after repeated exposures to ionizing radiations and to high temperature heating, no variation in the glow curve shape or peak intensities were detected. To eliminate a pre-existing background signal, all the characterization measurements were performed with aliquots “annealed” by a preliminary readout of the TL. - Highlights: • Glow curves change in shape and intensity just in the first 3 days after irradiation. • The dose response is linear in the dose range 0.5–5 Gy. • The curve shape or intensity don't change after repeated exposures and heatings. • Encouraging results were obtained in the dose recovery test

  14. Development of a 10 kGy(Si) rad hard controller for a mobile robot using COTS

    International Nuclear Information System (INIS)

    Alexandre, J.M.; Marceau, M.

    1999-01-01

    The CEA has developed a 10 kGy(Si) hardened controller using only COTS (Commercial-Off-The-Shelf devices), to equip the mobile robot Andros. An electronic architecture adapted to the constraint of hardening have been carried out, leading to the construction of a complete set of electronics modules (power electronic, control computer). (authors)

  15. Creativity Beyond Originality: György Pálfi's FINAL CUT as Narrative Supercut : [an audiovisual essay / videographic adaptation

    NARCIS (Netherlands)

    Kiss, Miklós

    2015-01-01

    György Pálfi’s FINAL CUT – LADIES & GENTLEMEN (2012) is a movie made out of other movies, literally. It is Vimeo’s and YouTube’s beloved film mashups and supercuts on steroids. Nevertheless, Final Cut does not only offer a genre-, style-, year- or author- and actor-bound fan-made compilation; it is

  16. Palliative radiation therapy for AIDS-associated Kaposi's sarcoma by using a single fraction of 800 cGy

    NARCIS (Netherlands)

    de Wit, R.; Smit, W. G.; Veenhof, K. H.; Bakker, P. J.; Oldenburger, F.; González, D. G.

    1990-01-01

    A single radiation fraction of 800 cGy was used in the treatment of acquired immunodeficiency syndrome (AIDS)-associated Kaposi's sarcoma (KS). A total of 74 radiation treatments was given to a total of 31 patients. Of all 74 evaluable treatments, there were 25 objective major responses (6 complete,

  17. STAYGREEN (CsSGR) is a candidate for the anthracnose (Colletotrichum orbiculare) resistance locus cla in Gy14 cucumber.

    Science.gov (United States)

    Pan, Junsong; Tan, Junyi; Wang, Yuhui; Zheng, Xiangyang; Owens, Ken; Li, Dawei; Li, Yuhong; Weng, Yiqun

    2018-04-21

    Map-based cloning identified a candidate gene for resistance to the anthracnose fungal pathogen Colletotrichum orbiculare in cucumber, which reveals a novel function for the highly conserved STAYGREEN family genes for host disease resistance in plants. Colletotrichum orbiculare is a hemibiotrophic fungal pathogen that causes anthracnose disease in cucumber and other cucurbit crops. No host resistance genes against the anthracnose pathogens have been cloned in crop plants. Here, we reported fine mapping and cloning of a resistance gene to the race 1 anthracnose pathogen in cucumber inbred lines Gy14 and WI 2757. Phenotypic and QTL analysis in multiple populations revealed that a single recessive gene, cla, was underlying anthracnose resistance in both lines, but WI2757 carried an additional minor-effect QTL. Fine mapping using 150 Gy14 × 9930 recombinant inbred lines and 1043 F 2 individuals delimited the cla locus into a 32 kb region in cucumber Chromosome 5 with three predicted genes. Multiple lines of evidence suggested that the cucumber STAYGREEN (CsSGR) gene is a candidate for the anthracnose resistance locus. A single nucleotide mutation in the third exon of CsSGR resulted in the substitution of Glutamine in 9930 to Arginine in Gy14 in CsSGR protein which seems responsible for the differential anthracnose inoculation responses between Gy14 and 9930. Quantitative real-time PCR analysis indicated that CsSGR was significantly upregulated upon anthracnose pathogen inoculation in the susceptible 9930, while its expression was much lower in the resistant Gy14. Investigation of allelic diversities in natural cucumber populations revealed that the resistance allele in almost all improved cultivars or breeding lines of the U.S. origin was derived from PI 197087. This work reveals an unknown function for the highly conserved STAYGREEN (SGR) family genes for host disease resistance in plants.

  18. The use of potassium dichromate for ultra high dose up to 120 kGy measurements in industrial irradiation process

    International Nuclear Information System (INIS)

    Conceicao, Cirilo C.S.

    2009-01-01

    The purpose of this work is the study of radiation-induced reduction of the Potassium Dichromate dosimeter in perchloric acid using modification in the composition of Dichromate dosimeter proposed by Sharpe (NPL, October 1982) to extend dose limit up to 120 kGy. This modification can allow measuring dose in process of irradiation of gem and cork directly, in these processes that the absorbed doses are very high. The dosimeter study reached linear response between 10 to 120 kGy. This dosimeter was traceable to the international metrology system, using Gammacell calibrated by Fricke reference dosimeter. The evaluation of the doses was done by spectrophotometric method. Compared to the costs using PMMA (perpex dosimeters), the use of dichromate dosimeters can reduce up to 70% of the dosimetry costs in Brazil. (author)

  19. Experimental analysis of quasi-static and dynamic fracture initiation toughness of gy4 armor steel material

    Science.gov (United States)

    Ren, Peng; Guo, Zitao

    Quasi-static and dynamic fracture initiation toughness of gy4 armour steel material are investigated using three point bend specimen. The modified split Hopkinson pressure bar (SHPB) apparatus with digital image correlation (DIC) system is applied to dynamic loading experiments. Full-field deformation measurements are obtained by using DIC to elucidate on the strain fields associated with the mechanical response. A series of experiments are conducted at different strain rate ranging from 10-3 s-1 to 103 s-1, and the loading rate on the fracture initiation toughness is investigated. Specially, the scanning electron microscope imaging technique is used to investigate the fracture failure micromechanism of fracture surfaces. The gy4 armour steel material fracture toughness is found to be sensitive to strain rate and higher for dynamic loading as compared to quasi-static loading. This work is supported by National Nature Science Foundation under Grant 51509115.

  20. Initial experience of single fraction radiotherapy (8 Gy x 1) in the treatment of painful bone metastases

    International Nuclear Information System (INIS)

    Amano, Kosuke; Ikeda, Hiroko; Chigusa, Satoshi; Tanaka, Masahiro; Katayama, Hirofumi; Takeda, Koji

    2014-01-01

    Sixteen patients with painful bone metastases received single fraction radiotherapy of 8 Gy. Single fraction radiotherapy was effective in providing pain relief with response rate of 88.8%. There were no severe acute side effects. The therapeutic regimen was also safe and effective in patients with poor performance status and poor prognosis. Therefore single fraction radiotherapy should be considered to treat pain arising from bone metastases. (author)

  1. Effectiveness and toxicity of single-fraction radiotherapy with 1x8 Gy for metastatic spinal cord compression

    International Nuclear Information System (INIS)

    Rades, Dirk; Stalpers, Lukas J.A.; Hulshof, Maarten C.C.M.; Zschenker, Oliver; Alberti, Winfried; Koning, Caro C.E.

    2005-01-01

    Toxicity and functional outcome were evaluated in 199 MSCC-patients irradiated with 1x8 Gy. Motor function improved in 54/199 patients (27%). Patients who regained walking ability were 20/78 (26%). Long-term-survivors (≥12 months) who needed re-irradiation for in-field-recurrence were 19/65 (29%). Acute toxicity was mild, late toxicity not observed. A randomised trial comparing single-fraction RT to multi-fraction RT is mandatory

  2. Effectiveness and toxicity of single-fraction radiotherapy with 1x8 Gy for metastatic spinal cord compression

    Energy Technology Data Exchange (ETDEWEB)

    Rades, Dirk [Department of Radiation Oncology, University Hospital Hamburg-Eppendorf, Hamburg (Germany) and Department of Radiotherapy, Academic Medical Center, Amsterdam (Netherlands); Stalpers, Lukas J.A. [Department of Radiotherapy, Academic Medical Center, Amsterdam (Netherlands); Hulshof, Maarten C.C.M. [Department of Radiotherapy, Academic Medical Center, Amsterdam (Netherlands); Zschenker, Oliver [Department of Radiation Oncology, Section Radiobiology, University Hospital Hamburg-Eppendorf, Hamburg (Germany); Alberti, Winfried [Department of Radiation Oncology, University Hospital Hamburg-Eppendorf, Hamburg (Germany); Koning, Caro C.E. [Department of Radiotherapy, Academic Medical Center, Amsterdam (Netherlands)

    2005-04-01

    Toxicity and functional outcome were evaluated in 199 MSCC-patients irradiated with 1x8 Gy. Motor function improved in 54/199 patients (27%). Patients who regained walking ability were 20/78 (26%). Long-term-survivors ({>=}12 months) who needed re-irradiation for in-field-recurrence were 19/65 (29%). Acute toxicity was mild, late toxicity not observed. A randomised trial comparing single-fraction RT to multi-fraction RT is mandatory.

  3. Long-Term Follow-up of Acoustic Schwannoma Radiosurgery With Marginal Tumor Doses of 12 to 13 Gy

    International Nuclear Information System (INIS)

    Chopra, Rahul; Kondziolka, Douglas; Niranjan, Ajay; Lunsford, L. Dade; Flickinger, John C.

    2007-01-01

    Purpose: To define long-term tumor control and clinical outcomes of radiosurgery with marginal tumor doses of 12 to 13 Gy for unilateral acoustic schwannoma. Methods and Materials: A total of 216 patients with previously untreated unilateral acoustic schwannoma underwent Gamma Knife radiosurgery between 1992 and 2000 with marginal tumor doses of 12 to 13 Gy (median, 13 Gy). Median follow-up was 5.7 years (maximum, 12 years; 41 patients with >8 years). Treatment volumes were 0.08-37.5 cm 3 (median, 1.3 cm 3 ). Results: The 10-year actuarial resection-free control rate was 98.3% ± 1.0%. Three patients required tumor resection: 2 for tumor growth and 1 partial resection for an enlarging adjacent subarachnoid cyst. Among 121 hearing patients with >3 years of follow-up, crude hearing preservation rates were 71% for keeping the same Gardner-Robertson hearing level, 74% for serviceable hearing, and 95% for any testable hearing. For 25 of these patients with intracanalicular tumors, the respective rates for preserving the same Gardner-Robertson level, serviceable hearing, and testable hearing were 80%, 88%, and 96%. Ten-year actuarial rates for preserving the same Gardner-Robertson hearing levels, serviceable hearing, any testable hearing, and unchanged facial and trigeminal nerve function were 44.0% ± 11.7%, 44.5% ± 10.5%, 85.3% ± 6.2%, 100%, and 94.9% ± 1.8%, respectively. Conclusions: Acoustic schwannoma radiosurgery with 12 to 13 Gy provides high rates of long-term tumor control and cranial nerve preservation after long-term follow-up

  4. Repeated irradiations with γ-rays at a dose of 0.5 Gy may exacerbate asthma

    International Nuclear Information System (INIS)

    Fang, Su-ping; Tago, Fumitoshi; Tanaka, Takashi; Simura, Noriko; Kojima, Shuji; Muto, Yasuko; Goto, Resuke

    2005-01-01

    We previously showed that 0.5 Gy whole-body γ-ray irradiation with a single or small number of repeated exposures inhibits tumor growth in mice, via elevation of the IFNγ/IL-4 ratio concomitantly with a decrease in the percentage of B cells. Here we examined whether repeated 0.5 Gy γ-rays irradiation can improve asthma in an ovalbumin (OVA)-induced asthmatic mouse model. We found that repeated irradiation (10 times) with 0.5 Gy of γ-rays significantly increased total IgE in comparison with the disease-control group. The levels of IL-4 and IL-5 were also significantly higher in the γ-ray-irradiated group, while that of IFN-γ was significantly lower, resulting in a further decrease of the IFN-γ/IL-4 ratio from the normal value. These results indicate that the repeated irradiation with γ-rays may exacerbate asthma, and may have opposite effects on different immune reactions unlike the irradiation with a single or small number of repeated exposures. (author)

  5. Effect of prolonged gamma irradiation (6.7 Gy) on monoamine oxidase activity in ewe hypothalamus in anestral period

    International Nuclear Information System (INIS)

    Pastorova, B.; Arendarcik, J.

    1988-01-01

    Changes were studied of monoamine oxidase (MAO) activity in the hypothalamus and hypophysis of ewes in the anestral period following whole-body 60 Co irradiation for 7 days with a dose of 6.7 Gy. The gamma radiation exposure rate was 0.039 Gy/h. The activity of MAO was determined using the radiochemical method. 14 C-tryptamine was used as the substrate. The highest activity was determined in the rostral hypothalamus (1100 pmol.mg -1 .min -1 ). MAO activity was at its lowest in the caudal region of the hypothalamus (550 pmol). The results show that whole-body exposure to gamma radiation with a total dose of 6.7 Gy makes a statistically significant increase (P<0.001) in MAO activity in the caudal hypothalamus of ewes while remaining at the level of the control group or increasing insignificantly in the rostral and medial hypothalamus. A significant decrease (P<0.05) was recorded in the hypophysis. It may be assumed that the increased degradation of catecholamines caused by MAO is one of the mechanisms responsible for the decreased concentration of catecholamines in the hypothalamus of ewes after irradiation. (author). 1 fig., 22 refs

  6. A polymeric dosimeter film based on optically-stimulated luminescence for dose measurements below 1 kGy

    International Nuclear Information System (INIS)

    Kovacs, A.; Baranyai, M.; Wojnarovits, L.; Slezsak, I.; McLaughlin, W.L.; Miller, S.D.; Miller, A.; Fuochi, P.G.; Lavalle, M.

    1999-01-01

    A new potential dosimetry system 'Sunna' containing a microcrystalline dispersion of an optically-stimulated fluor in a plastic matrix has been recently developed to measure and image high doses. Our previous investigations have revealed that the new dosimeter system is capable of measuring absorbed doses in the dose range of 1-100 kGy. The optically-stimulated luminescence (OSL) analysis is based on the blue light stimulation of the colour center states produced upon irradiation, and the intensity of the resulting red-light emission is used to measure absorbed dose. This analysis is carried out with a simple table-top fluorimeter developed for this purpose having also the ability to calculate the mathematical formula of the calibration function. The Sunna dosimeter was recently investigated for potential use in lower dose range below 1 kGy. These investigations have shown that the film is suitable for measuring doses in the range of 1-1000 Gy for both electron and gamma radiation. To test the applicability of the film, its reproducibility, stability, sensitivity to ambient and UV light and irradiation temperature were measured. The stability of the dosimeter was investigated by monitoring the change of the OSL signal with storage time after irradiation. Further experiments proved the homogeneity of the film with respect to thickness variation, and limited differences in its response were found between batches. (author)

  7. An elective radiation dose of 46 Gy is feasible in nasopharyngeal carcinoma treated by intensity-modulated radiotherapy

    Science.gov (United States)

    Hung, Tsung-Min; Fan, Kang-Hsing; Chen, Eric Yen-Chao; Lin, Chien-Yu; Kang, Chung-Jan; Huang, Shiang-Fu; Liao, Chun-Ta; Ng, Shu-Hang; Wang, Hung-Ming; Chang, Joseph Tung-Chieh

    2017-01-01

    Abstract The purpose of this study is to compare the treatment outcome of different radiation doses of elective neck irradiation (ENI) in nasopharyngeal carcinoma (NPC) patients treated with intensity-modulated radiotherapy (IMRT). In total, 504 patients with nondisseminated NPC who underwent magnetic resonance imaging before radical IMRT between 2000 and 2008 were retrospectively reviewed. The patients were classified into 2 groups based on the ENI dose: low ENI when the ENI dose was 46 Gy (n = 446) and high ENI when the ENI doses were 50 to 60 Gy (n = 58). All the patients in both the groups received a median dose of 72 Gy to the gross tumor and involved nodes. The fraction size was 2 Gy per fraction. Matching was performed between low ENI and high ENI in a 2:1 ratio, and the matching criteria were N-stage, T-stage, treatment modality, pathology classification, sex, and age. The median follow-up for all patients was 63.5 months. In all patients, the 5-year progression-free survival (PFS), local control (LC), regional control (RC), distant metastasis-free survival (DMFS), overall survival (OS), and cancer-specific survival (CSS) for low ENI and high ENI patients were 69.0% and 63.2% (P = 0.331), 89.0% and 83.9% (P = 0.235), 90.1% and 85.2% (P = 0.246), 86.8% and 76.6% (P = 0.056), 77.5% and 80.8% (P = 0.926), and 84.4% and 82.5% (P = 0.237), respectively. In the matched-pair analysis, the 5-year PFS, LC, RC, DMFS, OS, and CSS for matched low ENI and high ENI patients were 74.1% and 63.2% (P = 0.134), 92.0% and 83.9% (P = 0.152), 90.1% and 85.2% (P = 0.356), 86.2% and 76.6% (P = 0.125), 87.0% and 80.8% (P = 0.102), and 88.6% and 82.5% (P = 0.080), respectively. In the multivariable analysis for all patients, the ENI group was not a significant factor for PFS, LC, RC, DMFS, OS, and CSS. A low ENI dose of 46 Gy in 23 fractions is feasible in NPC patients treated with IMRT, and this concept should be validated in

  8. Assessment of low-dose radiotherapy (two 2 Gy sessions) for the cure of MALT lymphoma of the lung; evaluation de la radiotherapie faible (deux seances de 2 Gy) a visee curative dans le lymphome du Malt pulmonaire

    Energy Technology Data Exchange (ETDEWEB)

    Paumier, A.; Ghalibafian, M.; Gilmore, J.; Girinsky, T. [Departement de radiotherapie, institut de cancerologie Gustave-Roussy, Villejuif (France); Hanna, C.; Raphael, J.; Ferme, C.; Ribrag, V. [Departement d' hematologie, institut de cancerologie Gustave-Roussy, Villejuif (France)

    2011-10-15

    The authors report the assessment of low-dose radiotherapy (two sessions of 2 Gy in two days) for the curative treatment of mucosa-associated lymphoid tissue (MALT) lymphoma of the lung. The treatment of this lymphoma is discussed in terms of surgery, chemotherapy, radiotherapy, or even simple monitoring. The authors analyse the results obtained on nine patients who have been treated this way since 2002, straight away for some of them, after surgery or chemotherapy for others. Survival rate, recurrence, evolutions and responses are discussed. Short communication

  9. Exposure to low doses (20 cGy) of Hze results in spatial memory impairment in rats.

    Science.gov (United States)

    Britten, Richard; Johnson, Angela; Davis, Leslie; Green-Mitchell, Shamina; Chabriol, Olivia; Sanford, Larry; Drake, Richard

    INTRODUCTION. Current models predict that the astronauts on a mission to a deep space destination, such as Mars, will be exposed to 25 cGy of Galactic cosmic radiation (GCR). The long-term consequence of exposure to such doses is largely unknown, but given that 1.3 Gy of X-rays has been reported to lead to long-term cognitive deficits (Shore et al, 1976) and that CGR have an RBE of 2-5, it is likely that the predicted 25 cGy of GCR will lead to defects in the cognitive ability of the astronauts during and after the mission. Our studies are designed to help define the GCR dose that will lead to defects in complex working memory, and also to elucidate the mechanisms whereby hadronic radiation diminishes neurocognitive function. The identification of such processes would provide an opportunity for post-mission surveillance, and hopefully will lead to intervention strategies that will ameliorate or attenuate GCR-induced neurocognitive deficits. MATERIALS METHODS. Four-week old male Wistar rats were exposed to either X-rays or 1 GeV 56Fe. At three or six months post exposure the performance of the rats in the Barnes' Maze (Spatial memory) was established. The duration and frequency of REM sleep was also monitored to determine if the neurocognitive deficits arose due to reduced memory consolidation as a result of diminished REM sleep. We used a novel, but maturing technique, called MALDI-MS imaging (or MALDI-MSI), to identify specific regions of the brain where the neuroproteome differs in rats that have developed spatial memory impairments. RESULTS. 11.5 Gy of X-rays led to reduced performance in the Barnes's maze. In contrast, exposure to 20 cGy of Hze (1 GeV 56Fe) resulted in a significant impairment of spatial memory performance as measured in the Barnes' Maze, which was manifested by an increase in relative escape latency REL over a 5 day testing period. Such an increase in REL could arise from the rats becoming less able, or perhaps less willing, to locate the

  10. Treatment outcome of localized prostate cancer by 70 Gy hypofractionated intensity-modulated radiotherapy with a customized rectal balloon

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Hyun Jung; Kim, Jun Won; Hong, Sung Joon; Rha, Koon Ho; Lee, Chang Geol; Yang, Seung Choul; Choi, Young Deuk; Suh, Chang Ok; Cho, Jae Ho [Yonsei Cancer Center, Yonsei University College of Medicine, Seoul (Korea, Republic of)

    2014-09-15

    We aimed to analyze the treatment outcome and long-term toxicity of 70 Gy hypofractionated intensity-modulated radiotherapy (IMRT) for localized prostate cancer using a customized rectal balloon. We reviewed medical records of 86 prostate cancer patients who received curative radiotherapy between January 2004 and December 2011 at our institution. Patients were designated as low (12.8%), intermediate (20.9%), or high risk (66.3%). Thirty patients received a total dose of 70 Gy in 28 fractions over 5 weeks via IMRT (the Hypo-IMRT group); 56 received 70.2 Gy in 39 fractions over 7 weeks via 3-dimensional conformal radiotherapy (the CF-3DRT group, which served as a reference for comparison). A customized rectal balloon was placed in Hypo-IMRT group throughout the entire radiotherapy course. Androgen deprivation therapy was administered to 47 patients (Hypo-IMRT group, 17; CF-3DRT group, 30). Late genitourinary (GU) and gastrointestinal (GI) toxicity were evaluated according to the Radiation Therapy Oncology Group criteria. The median follow-up period was 74.4 months (range, 18.8 to 125.9 months). The 5-year actuarial biochemical relapse-free survival rates for low-, intermediate-, and high-risk patients were 100%, 100%, and 88.5%, respectively, for the Hypo-IMRT group and 80%, 77.8%, and 63.6%, respectively, for the CF-3DRT group (p < 0.046). No patient presented with acute or late GU toxicity > or =grade 3. Late grade 3 GI toxicity occurred in 2 patients (3.6%) in the CF-3DRT group and 1 patient (3.3%) in the Hypo-IMRT group. Hypo-IMRT with a customized rectal balloon resulted in excellent biochemical control rates with minimal toxicity in localized prostate cancer patients.

  11. Longitudinal changes over 2 years in parotid glands of patients treated with preoperative 30-Gy irradiation for oral cancer

    International Nuclear Information System (INIS)

    Tomitaka, Etsushi; Murakami, Ryuji; Teshima, Keiko

    2011-01-01

    The objective of this study was to evaluate longitudinal changes in parotid volumes and saliva production over 2 years after 30 Gy irradiation. We retrospectively evaluated 15 assessable patients treated for advanced oral cancer. Eligibility criteria were a pathologic diagnosis of squamous cell carcinoma, preoperative radiation therapy with a total dose of 30 Gy delivered in 15 fractions, and the availability of longitudinal data of morphological assessments by computed tomography and functional assessments with the Saxon test spanning 2 years after radiation therapy. In the Saxon test, saliva production was measured by weighing a folded sterile gauze pad before and after chewing; the low-normal value is 2 g/2 min. Repeated-measures analysis of variance with Bonferroni adjustment for multiple comparisons was used to determine the longitudinal changes. The normalized ipsilateral parotid volumes 2 weeks and 6-, 12- and 24 months after radiation therapy were found to be 72.5, 63.7, 66.9 and 78.1%, respectively; the normalized contralateral volumes were 69.8, 64.6, 72.2 and 82.0%, respectively. The bilateral parotid volumes were significantly decreased after radiation therapy (P<0.01). The nadir appeared at 6 months post-radiation therapy and the volumes substantially recuperated 24 months after radiation therapy (P<0.01). Mean saliva production before radiation therapy was 3.7 g; the longitudinal changes after radiation therapy were 31.3, 38.0, 43.3 and 69.6%, respectively. Substantial recuperation of saliva production was observed 24 months after radiation therapy (P=0.01). Although parotid volumes and saliva production were decreased after 30 Gy irradiation, we observed the recuperation of morphological and functional changes in the parotid glands 2 years after radiation therapy. (author)

  12. A prospective study of the early clinical symptoms following a 2 Gy therapeutic whole-body irradiation; Etude prospective de la symptomatologie clinique precoce apres irradiation corporelle totale therapeutique de 2 Gy

    Energy Technology Data Exchange (ETDEWEB)

    Fizazi, K.; Chaillet, M.P.; Fourquet, A.; Jammet, P.; Cosset, J.M. [Institut Curie, 75 - Paris (France)

    1995-10-01

    Early human tolerance following total body irradiation (TBI) according to the dose received is still poorly known. Thirteen selected patients were prospectively evaluated for clinical side effects during the first 10 hours following a 2 Gy TBI prior to bone marrow transplantation. All of them but one were treated for haematological malignancies and were in clinical remission at the date of TBI. There were 10 males and 3 females, with a median age of 43 y (range 16*61) and a good performance status (WHO 0-1). They received granisetron (3 mg) injected intravenously 1 h before the time of TBI in order to prevent nausea and vomiting. The main symptoms consisted in drowsiness (69%), headache (62%), xerostomia (62%), nausea and vomiting (46%), anorexia (38%), parotid gland pain (23%) and abdominal pain (8%). Their intensity was always moderate, except for 2 patients who experimented severe vomiting. The incidence rate and the time-course of the symptoms of the prodromal phase may proved to be helpful for early clinical evaluation and triage of victims of an accidental irradiation. In particular, absence of fever at the 6{sup th} h after TBI supports the assumption of an estimated exposure dose below 2 Gy. (authors). 23 refs., 2 tabs.

  13. Clinical phase I/II trial to investigate neoadjuvant intensity-modulated short term radiation therapy (5 × 5 gy) and intraoperative radiation therapy (15 gy) in patients with primarily resectable pancreatic cancer - NEOPANC

    International Nuclear Information System (INIS)

    Roeder, Falk; Debus, Juergen; Huber, Peter E; Werner, Jens; Timke, Carmen; Saleh-Ebrahimi, Ladan; Schneider, Lutz; Hackert, Thilo; Hartwig, Werner; Kopp-Schneider, Annette; Hensley, Frank W; Buechler, Markus W

    2012-01-01

    The current standard treatment, at least in Europe, for patients with primarily resectable tumors, consists of surgery followed by adjuvant chemotherapy. But even in this prognostic favourable group, long term survival is disappointing because of high local and distant failure rates. Postoperative chemoradiation has shown improved local control and overalls survival compared to surgery alone but the value of additional radiation has been questioned in case of adjuvant chemotherapy. However, there remains a strong rationale for the addition of radiation therapy considering the high rates of microscopically incomplete resections after surgery. As postoperative administration of radiation therapy has some general disadvantages, neoadjuvant and intraoperative approaches theoretically offer benefits in terms of dose escalation, reduction of toxicity and patients comfort especially if hypofractionated regimens with highly conformal techniques like intensity-modulated radiation therapy are considered. The NEOPANC trial is a prospective, one armed, single center phase I/II study investigating a combination of neoadjuvant short course intensity-modulated radiation therapy (5 × 5 Gy) in combination with surgery and intraoperative radiation therapy (15 Gy), followed by adjuvant chemotherapy according to the german treatment guidelines, in patients with primarily resectable pancreatic cancer. The aim of accrual is 46 patients. The primary objectives of the NEOPANC trial are to evaluate the general feasibility of this approach and the local recurrence rate after one year. Secondary endpoints are progression-free survival, overall survival, acute and late toxicity, postoperative morbidity and mortality and quality of life. http://www.clinicaltrials.gov/ct2/show/NCT01372735

  14. Dwarf Rice Mutant Derived from 0.2 kGy Gamma Rays Irradiated Seeds of Atomita 4 Variety

    International Nuclear Information System (INIS)

    Sobrizal; Sutisna Sanjaya; Carkum; Mohamad Ismachin

    2004-01-01

    Dwarf rice mutant was obtained when Atomita 4 seeds were irradiated by 0.2 kGy gamma rays. The results of segregation analyses in F2 populations and F3 lines derived from reciprocal crosses of mutant and Atomita 4 suggested that the dwarf was controlled by a single recessive gene. This gene was not located on rice cytoplasmic genome but on nuclear genome. The gene for dwarf obtained in this study tentatively could be assumed as a new finding until the allelic relationships with other dwarf genes are verified. (author)

  15. Hormone regulation system and cyclic nucleotids in the Chernobyl accident liquidators with doses absorbed less then 1 Gy

    International Nuclear Information System (INIS)

    Kovalenko, A.N.

    1997-01-01

    During 6 years after the accident (1987-1992) a functional state of endocrine system that regulate the adaptation, reproduction, metabolism, vessels tonicity and water-electrolyte balance were investigated in 249 liquidators with doses absorbed less then 1 Gy. The changes of these systems activity in state of basal secretion and peculiarities of their reactions under influence of perturbation (adrenaline, insulin) were revealed. Post-irradiation endocrinopathy was characterized and its role in decrease of the organism's adaptation and in mechanism of sanogenesis and pathogenesis was found. (author)

  16. Dose-response relationship for life-shortening and carcinogenesis in mice irradiated at day 7 postnatal age with dose range below 1 Gy of gamma rays

    International Nuclear Information System (INIS)

    Sasaki, Shunsaku; Fukuda, Nobuo

    2006-01-01

    This study was designed to elucidate the dose-response relationships for life-shortening and tumorigenic effect in the dose range below 1 Gy of gamma rays delivered during the infant period. Female B6C3F 1 mice were irradiated with 0.10, 0.48 or 0.95 Gy at 7 days of age. All irradiated mice were allowed to live out their entire life span together with a simultaneously ongoing control group under a specific pathogen-free condition. Shortening of the mean life span was 1.58% in mice irradiated with 0.10 Gy, which was statistically significant. The coefficient of the linear dose-response relationship for life-shortening was 11.21% Gy -1 . The attributable death fraction for all causes of death in 0.10 Gy group reached 0.092. The excess relative risk for death rate from all causes was 0.102 in the group irradiated with 0.10 Gy. The coefficient of the linear dose-response relationship of the excess relative risk for death rate from all causes was 1.30 Gy -1 . The mean number of types of solid tumors at the time of death in mice irradiated with 0.10 Gy was distinctly larger than that in the control group. The excess relative risk for death rate from solid tumors was 0.45 in mice irradiated with 0.10 Gy. The coefficient of the linear dose-response relationship of excess relative risk for death rate from solid tumors was 4.52 Gy -1 . Increase in incidences of the pituitary, ovarian and adrenal tumors was observed in mice irradiated with 0.10 Gy. The results of the present study showed that infant mice are susceptible to solid tumor induction, especially of the endocrine organs. (author)

  17. Improvement of quality of radiation indicators used for food irradiation in dose range of 3-10 kGy

    International Nuclear Information System (INIS)

    Hoang Hoa Mai; Pham Duy Duong; Nguyen Dinh Duong

    2007-01-01

    A sensitive indicators based on the polyvinyl butyral dyed with leuco-malachite green and methyl orange were made for use as devices for discriminating and monitoring radiation treatment in food irradiation. The sensitivity and stability of the indicator have been improved by using several additives such as CCl 4 in combination with di(nonylphenyl) isophthalate [dinonyl phthalate -C 6 H 4 (COOC 9 H 19 ) 2 ]. The dosimeters change their color from orange to greenish when irradiated with gamma rays or electrons to dose just about 2 kGy. The greenish continue to develop to deep-green upon the increase of dose to 7 kGy. This makes the indicators useful for the dose range of food irradiation application, especially in treatment of frozen meat and sea products for elimination of micro-organism. The quality of indicators are also improved by adjusting of factors and procedures during preparation of film and dosimeters. The indicators were produced in a stick-on label type showing attractive characteristics in use. The orange color before irradiation keep well stable for as long as 20 months under normal conditions in laboratory. The green after irradiation was maintained up to 12 months in piratical conditions of products. The indicator can be produced in big amount to supply to the irradiation facilities in Vietnam instead of imported devices. (author)

  18. Ammonia formation and W coatings interaction with deuterium/nitrogen plasmas in the linear device GyM

    Energy Technology Data Exchange (ETDEWEB)

    Laguardia, L., E-mail: laguardia@ifp.cnr.it [CNR, Istituto di Fisica del Plasma“P. Caldirola”, Milan (Italy); Caniello, R.; Cremona, A. [CNR, Istituto di Fisica del Plasma“P. Caldirola”, Milan (Italy); Dellasega, D. [CNR, Istituto di Fisica del Plasma“P. Caldirola”, Milan (Italy); Politecnico di Milano, Dipartimento di Energia, Milan (Italy); Dell’Era, F.; Ghezzi, F.; Gittini, G.; Granucci, G.; Mellera, V.; Minelli, D.; Pallotta, F. [CNR, Istituto di Fisica del Plasma“P. Caldirola”, Milan (Italy); Passoni, M. [CNR, Istituto di Fisica del Plasma“P. Caldirola”, Milan (Italy); Politecnico di Milano, Dipartimento di Energia, Milan (Italy); Ricci, D.; Vassallo, E. [CNR, Istituto di Fisica del Plasma“P. Caldirola”, Milan (Italy)

    2015-08-15

    In this work results of the first D{sub 2}/N{sub 2} experiments in GyM, a linear device able to produce plasmas of interest for the ITER divertor (n{sub e} 5 ⋅ 10{sup 10} cm{sup −3}, Te 5 eV, ion flux 3–5 ⋅ 10{sup 20} m{sup −2}s{sup −1}) are presented. Plasmas simulating a N-seeding scenario have been performed to evaluate ammonia formation and its effect on exposed W coatings. The presence of ND emission lines in the plasma can be correlated with the formation of ammonia, further directly detected and quantified by chromatography analysis of the exhaust. Four different W specimens were exposed in GyM to a plasma fluence of 8.78 ⋅ 10{sup 23} m{sup −2}. XPS analysis evidenced the formation of W{sub x}N{sub y} layers with nitrogen concentration in the range of 1–10% depending on the initial morphology and structure of the W samples. In all analyzed cases, nitrogen was bound and retained within the first 6 nm below the surface and no further diffusion of N into the bulk was observed.

  19. A prospective study of the early clinical symptoms following a 2 Gy therapeutic whole-body irradiation

    International Nuclear Information System (INIS)

    Fizazi, K.; Chaillet, M.P.; Fourquet, A.; Jammet, P.; Cosset, J.M.

    1995-01-01

    Early human tolerance following total body irradiation (TBI) according to the dose received is still poorly known. Thirteen selected patients were prospectively evaluated for clinical side effects during the first 10 hours following a 2 Gy TBI prior to bone marrow transplantation. All of them but one were treated for haematological malignancies and were in clinical remission at the date of TBI. There were 10 males and 3 females, with a median age of 43 y (range 16*61) and a good performance status (WHO 0-1). They received granisetron (3 mg) injected intravenously 1 h before the time of TBI in order to prevent nausea and vomiting. The main symptoms consisted in drowsiness (69%), headache (62%), xerostomia (62%), nausea and vomiting (46%), anorexia (38%), parotid gland pain (23%) and abdominal pain (8%). Their intensity was always moderate, except for 2 patients who experimented severe vomiting. The incidence rate and the time-course of the symptoms of the prodromal phase may proved to be helpful for early clinical evaluation and triage of victims of an accidental irradiation. In particular, absence of fever at the 6 th h after TBI supports the assumption of an estimated exposure dose below 2 Gy. (authors). 23 refs., 2 tabs

  20. Immuno-enhancement in tumor-bearing mice induced by whole body X-irradiation with 75 mGy

    International Nuclear Information System (INIS)

    Zhang Ying; Li Xiuyi; Gong Shouliang; Liu Shuzheng

    2000-01-01

    Objective: In present study the authors observed the effect of whole body irradiation (WBI) with 75 mGy X-rays on the immune function of tumor-bearing mice. Methods: Lewis lung carcinoma cells were implanted into the right thigh muscle of C57BL/6J mice. Ten days after tumor implantation, the tumor-bearing mice were administrated with 75 mGy X-rays WBI, then the mice were sacrificed 18 h after irradiation to detect the immune parameters including the spontaneous proliferation of thymocytes, the proliferative response of splenocytes to ConA and LPS, the cytotoxic activities of specific cytotoxic lymphocytes (CTL) and natural killer cells (NK), as well as lymphokine activated killer cells (LAK) in spleen. The methods the authors used were 3 H-TdR incorporation or release assay. Results: the immune parameters of exposed tumor-bearing mice were much higher than those of sham-irradiated tumor-bearing mice (P<0.01). Conclusion: These results suggested that low dose radiation (LDR) could enhance the immune function of tumor-bearing mice, which might be of practical significance in the prevention and therapy of cancer

  1. The decreasing effect of exogenous SOD on damage of mice irradiated with 5 Gy 60Co-γ rays

    International Nuclear Information System (INIS)

    Liu Fenju; Jiang Jiagui; Yi Jian

    1999-01-01

    The author presents a report on the activity of Superoxide Dismutase (SOD) and the content of LPO measured in tissue of Liver, heart and brain of mice irradiated by 60 Co-γ rays 5 Gy 1, 3, 5 and 8 days after irradiation respectively. After radiation exogenous SOD was immediately i.p. injected into mice. The variation of LPO content in the above mentioned three kinds of tissue has been observed. The result of the measurement shows that after radiation at a dose of 5 Gy 60 Co-γ rays, the LPO content and SOD activity of mice organs varied with radiation time. The LPO content varied earliest in liver, while the variation of LPO content in heart and cerebrum took place 8 days after radiation, meanwhile the activity of SOD in the tissues significantly decreased in comparison with that the control group (P<0.01). After injection with SOD, the LPO content and SOD activity of the organs irradiated for different time significantly decreased and increased in comparison with that in the control group. This shows that the enzyme of SOD is of significant anti-radiation effect

  2. Frederick W. Alt received the 2015 Szent-Györgi Prize for Progress in Cancer Research.

    Science.gov (United States)

    Scully, Peter; Zhao, Jie; Ba, Sujuan

    2016-02-03

    The Szent-Györgyi Prize for Progress in Cancer Research is a prestigious scientific award established by the National Foundation for Cancer Research (NFCR)--a leading cancer research charitable organization in the United States that is committed to supporting scientific research and public education relating to the prevention, early diagnosis, better treatments, and ultimately, a cure for cancer. Each year, the Szent-Györgyi Prize honors an outstanding researcher, nominated by colleagues or peers, who has contributed outstanding, significant research to the fight against cancer, and whose accomplishments have helped improve treatment options for cancer patients. The Prize also promotes public awareness of the importance of basic cancer research and encourages the sustained investment needed to accelerate the translation of these research discoveries into new cancer treatments. This report highlights the pioneering work led by the 2015 Prize winner, Dr. Frederick Alt. Dr. Alt's work in the area of cancer genetics over four decades has helped to shape the very roots of modern cancer research. His work continues to profoundly impact the approaches that doctors around the globe use to diagnose and treat cancer. In particular, his seminal discoveries of gene amplification and his pioneering work on molecular mechanisms of DNA damage repair have helped to usher in the era of genetically targeted therapy and personalized medicine.

  3. Hyperfractionated accelerated radiotherapy with concomitant integrated boost of 70-75 Gy in 5 weeks for advanced head and neck cancer. A phase I dose escalation study

    Energy Technology Data Exchange (ETDEWEB)

    Cvek, J.; Skacelikova, E.; Otahal, B.; Halamka, M.; Feltl, D. [University Hospital Ostrava (Czech Republic). Dept. of Oncology; Kubes, J. [University Hospital Bulovka, Prague (Czech Republic). Dept. of Radiation Oncology; Kominek, P. [University Hospital Ostrava (Czech Republic). Dept. of Otolaryngology

    2012-08-15

    Background and purpose: The present study was performed to evaluate the feasibility of a new, 5-week regimen of 70-75 Gy hyperfractionated accelerated radiotherapy with concomitant integrated boost (HARTCIB) for locally advanced, inoperable head and neck cancer. Methods and materials: A total of 39 patients with very advanced, stage IV nonmetastatic head and neck squamous cell carcinoma (median gross tumor volume 72 ml) were included in this phase I dose escalation study. A total of 50 fractions intensity-modulated radiotherapy (IMRT) were administered twice daily over 5 weeks. Prescribed total dose/dose per fraction for planning target volume (PTV{sub tumor}) were 70 Gy in 1.4 Gy fractions, 72.5 Gy in 1.45 Gy fractions, and 75 Gy in 1.5 Gy fractions for 10, 13, and 16 patients, respectively. Uninvolved lymphatic nodes (PTV{sub uninvolved}) were irradiated with 55 Gy in 1.1 Gy fractions using the concomitant integrated boost. Results: Acute toxicity was evaluated according to the RTOG/EORTC scale; the incidence of grade 3 mucositis was 51% in the oral cavity/pharynx and 0% in skin and the recovery time was {<=} 9 weeks for all patients. Late toxicity was evaluated in patients in complete remission according to the RTOG/EORTC scale. No grade 3/4 late toxicity was observed. The 1-year locoregional progression-free survival was 50% and overall survival was 55%. Conclusion: HARTCIB (75 Gy in 5 weeks) is feasible for patients deemed unsuitable for chemoradiation. Acute toxicity was lower than predicted from radiobiological models; duration of dysphagia and confluent mucositis were particularly short. Better conformity of radiotherapy allows the use of more intensive altered fractionation schedules compared with older studies. These results suggest that further dose escalation might be possible when highly conformal techniques (e.g., stereotactic radiotherapy) are used.

  4. Standard (60 Gy) or Short-Course (40 Gy) Irradiation Plus Concomitant and Adjuvant Temozolomide for Elderly Patients With Glioblastoma: A Propensity-Matched Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Minniti, Giuseppe, E-mail: gminniti@ospedalesantandrea.it [Radiation Oncology Unit, Sant' Andrea Hospital, University Sapienza, Rome (Italy); Scientific Institute for Research, Hospitalization and Health Care (IRCCS) Neuromed, Pozzilli (Italy); Scaringi, Claudia [Radiation Oncology Unit, Sant' Andrea Hospital, University Sapienza, Rome (Italy); Lanzetta, Gaetano [Scientific Institute for Research, Hospitalization and Health Care (IRCCS) Neuromed, Pozzilli (Italy); Terrenato, Irene [Biostatistic Unit, Regina Elena National Cancer Institute, Rome (Italy); Esposito, Vincenzo; Arcella, Antonella [Scientific Institute for Research, Hospitalization and Health Care (IRCCS) Neuromed, Pozzilli (Italy); Pace, Andrea [Neurology Unit, Regina Elena National Cancer Institute, Rome (Italy); Giangaspero, Felice [Scientific Institute for Research, Hospitalization and Health Care (IRCCS) Neuromed, Pozzilli (Italy); Bozzao, Alessandro [Neuroradiology Unit, Sant' Andrea Hospital, University Sapienza, Rome (Italy); Enrici, Riccardo Maurizi [Radiation Oncology Unit, Sant' Andrea Hospital, University Sapienza, Rome (Italy)

    2015-01-01

    Purpose: To evaluate 2 specific radiation schedules, each combined with temozolomide (TMZ), assessing their efficacy and safety in patients aged ≥65 years with newly diagnosed glioblastoma (GBM). Methods and Materials: Patients aged ≥65 years with Karnofsky performance status (KPS) ≥60 who received either standard (60 Gy) or short-course (40 Gy) radiation therapy (RT) with concomitant and adjuvant TMZ between June 2004 and October 2013 were retrospectively analyzed. A propensity score analysis was executed for a balanced comparison of treatment outcomes. Results: A total of 127 patients received standard RT-TMZ, whereas 116 patients underwent short-course RT-TMZ. Median overall survival and progression-free survival times were similar: 12 months and 5.6 months for the standard RT-TMZ group and 12.5 months and 6.7 months for the short-course RT-TMZ group, respectively. Radiation schedule was associated with similar survival outcomes in either unadjusted or adjusted analysis. O{sup 6}-methylguanine-DNA methyltransferase promoter methylation was the most favorable prognostic factor (P=.0001). Standard RT-TMZ therapy was associated with a significant rise in grade 2 and 3 neurologic toxicity (P=.01), lowering of KPS scores during the study (P=.01), and higher posttreatment dosing of corticosteroid (P=.02). Conclusions: In older adults with GBM, survival outcomes of standard and short-course RT-TMZ were similar. An abbreviated course of RT plus TMZ may represent a reasonable therapeutic approach for these patients, without loss of survival benefit and acceptable toxicity.

  5. Therapeutic effects of combined cytokines on hematopoietic injuries induced by 4.5 Gy γ-rays irradiation in beagles

    International Nuclear Information System (INIS)

    Zhao Jianzhi; Li Ming; Xing Shuang; Hu Zhiqing; Xiong Guolin; Xie Ling; Ou Hongling; Huang Haixiao; Zhao Zhenhu; Wang Ning; Wang Jinxiang; Miao Jingcheng; Zhu Nankang; Zhang Xueguang; Cong Yuwen; Zhang Ri; Luo Qingliang

    2010-01-01

    Objective: To observe the therapeutic effects of combined cytokines on hematopoietic injuries induced by 4.5 Gy 60 Co γ-rays irradiation in beagles, and to provide experimental evidences for the clinical treatment of extremely severe myeloid acute radiation sickness (ARS). Methods: 16 beagles were given 4.5 Gy 60 Co γ-rays total body irradiation, and then randomly assigned into irradiation control group, supportive care group and cytokines group. In addition to supportive care, recombinant human granulocyte colony-stimulating factor (rhG-CSF), recombinant human interleukin-11 (rhIL-11) and recombinant human interleukin-2 (rhIL-2) were administered subcutaneouly to dogs in cytokines group. Peripheral blood hemogram was examined once every two days. Bone marrow and peripheral blood were collected to proceed colony cultivation 4 d pre-irradiation and 1 and 45 d post-irradiation. Conventional histopathological sections sternum were prepared to observe the histomorphology changes. Results: After irradiation, the population of all kinds of cells in peripheral blood declined sharply. WBC nadir was elevated (1.04 x 10 9 /L, but 0.28 x 10 9 /L and 0.68 x 10 9 /L for the irradiation control group and the supportive care group separately), the duration of thrombocytopenia was shortened (24 days, but 33 days for the supportive care group) and red blood cell counts were maintained in the range of normal values after cytokines treatment in combination. The colony forming efficiency of haemopoietic stem cells (HSCs) in bone marrow and peripheral blood decreased obviously 1 d post irradiation, but recovered to the level of that before irradiation 45 d post irradiation after supportive care and cytokines treatment. Hematopoietic cells disappeared in bone marrow of animals in irradiation control group, but hematopoietic functions were recovered after cytokines were administrated. Conclusions: RhG-CSF, rhIL-11 and rhIL-2 used in combination could elevate WBC nadir, accelerate the

  6. Value of low-dose 2 X 2 Gy palliative radiotherapy in advanced low-grade non-Hodgkin's lymphoma

    International Nuclear Information System (INIS)

    Ng, M.; Wirth, A.; Ryan, G.; MacManus, M.

    2006-01-01

    Low-dose radiotherapy over the last decade has been reported to provide effective palliation for patients with low-grade non-Hodgkin's lymphoma. In this retrospective case series of 10 patients, we report our early experience using low-dose radiotherapy (usually 2 x2 Gy) for patients with advanced-stage follicular, mucosal associated lymphoid tissue, mantle cell and small lymphocytic lymphomas. Median follow up was 27 weeks. Response rates were high (complete response, 70%; partial response, 20%), the response durable and the toxicity was minimal (no toxicity greater than grade 1). Low-dose irradiation is an effective treatment option for patients with low-grade lymphomas with local symptoms Copyright (2006) Blackwell Publishing Asia Pty Ltd

  7. Changes in microflora and other characteristics of vacuum-packaged pork loins irradiated at 3.0 kGy

    International Nuclear Information System (INIS)

    Lebepe, S.; Molins, R.A.; Charoen, S.P.; Farrar, H. IV; Skowronski, R.P.

    1990-01-01

    Effects of 3.0-kGy irradiation on microflora and other attributes of fresh, vacuum-packaged pork loins were examined during storage (2-4 degrees C, 98 days) and mishandling (24-25 degrees C, 24 and 48 hr). Shelf life of pork chops from irradiated loins was determined at 5 degrees C. Irradiated loins kept at 2-4 degrees C tested negative for Salmonella spp., Campylobacter spp., Clostridium perfringens and Staphylococcus aureus. Yersinia spp., was detected in pork chops held at 5 degrees C; this organism, C. perfringens and Aeromonas spp. were present in abused samples. In two irradiated samples Listeria monocytogenes was found. Irradiation reduced aerobic, anaerobic and Aeromonas spp. counts; lactobacilli were least affected. Chemical spoilage began after 91 days at 2-4 degrees C. With irradiation, TBA values were unaffected but Hunter a color values increased

  8. The use of biological isodoses ''IsobioGy 2'' for evaluation of tumour and normal tissues response for fractionated irradiation

    International Nuclear Information System (INIS)

    Maciejewski, B.; Skolyszewski, J.; Majewski, S.; Lobodziec, W.; Jedynak, T.; Slosarek, K.

    1988-01-01

    Divergences between physical and biological dose distributions were analysed using linear quadratic model. It was found that small variations in physical dose distribution and differences in normal tissue sensitivity for change in dose per fraction, expressed by a α/β value, can cause a high difference between physical and biological doses. This difference significantly increases when one field instead of two fields is daily treated. If there is no enough separation between treated fields, the biological dose may dramatically increase. The use of biological ''isobioGy 2'' isodoses, instead of physical isodoses, can provide an important information on biological effect in tumour or normal tissue and may diminish the risk of giving too high dose to normal tissue and too low dose to the tumour. 6 figs., 13 refs. (author)

  9. Haematological effects of rhG-CSF on dogs exposed to 6.5 Gy uneven γ-radiation

    International Nuclear Information System (INIS)

    Luo Qingliang; Xia Zhenbiao; Dong Bo

    1996-01-01

    The stimulative effects of recombinant human granulocyte colony stimulating factor (rhG-CSF) on hematopoietic regeneration were studied in dogs receiving an uneven γ-irradiation with the pelvis shielded at a dose of 6.5 Gy. In the treated dogs, intravenous administration of rhG-CSF at 5 or 10 μg/kg per day for 16 to 20 days caused significant increases of peripheral blood leucocytes, neutrophils, reticulocytes, and platelets. The nucleated cell and CFU-GM counts of bone marrow also showed an obvious rise, while the hemoglobin level did not significantly change during the course of treatment. In the irradiated dogs treated with rhG-CSF, the severity of neutropenia decreased, and its duration shortened

  10. Residual haematopoietic damage in adult and 8 day-old mice exposed to 7 Gy of x-rays

    International Nuclear Information System (INIS)

    Grande, T.; Bueren, J.A.; Gaitan, S.; Tejero, C.

    1993-01-01

    The authors' experiments have focused on the analysis of residual haematopoietic damage in 8-day-old and 12-week-old mice X-irradiated with a single dose of 7 Gy. In the case of adult mice, analysis of femoral and splenic CFU-S, CFU-GM and BFU-E showed a persistent depletion of these haematopoietic progenitor cells after irradiation. In contrast, in 1-week-old irradiated mice, a progressive recovery of the femoral haematopoietic progenitors was observed, achieving essentially normal values 1 year after irradiation. The spleens of these mice, however, contained significantly less haematopoietic progenitors than the control group, mainly as a consequence of the size reduction of this organ. In the peripheral blood, normal cellularity values were observed in most cases, although in the adult group a decline in numbers or circulating cells was noted after the first year following irradiation. (author)

  11. Phase-changes in cell cycle of wound tissue irradiated with 5.21 Gy soft X-rays

    International Nuclear Information System (INIS)

    Liu Jianzhong; Zhou Yuanguo; Cheng Tianmin; Zhou Ping; Liu Xia; Li Ping

    2002-01-01

    Objective: To study the phase-changes in cell cycle of wound tissue which was locally irradiated with 5.21 Gy soft X-rays. Methods: Flow cytometry and PI staining were used to analyze cell cycle. Cell proliferation was determined with BrdU labeling. Results: During 3-9 days after irradiation, the percentage of the G 0 /G 1 phase cells in wound of the control side decreased while the percentage of S phase cells increased and reached the highest value on day 9. The percentage of G 2 /M phase cells also increased, and reached its peak on day 15. The percentage of G 0 /G 1 phase cell increased in wound of the irradiation side and was higher than that of the control wound, meanwhile the percentages of S and G 2 /M cells were significantly lower than those of the control wound. In the period of 12-22 days after wounding, the percentage of S phase cells increased and reached its peak value on the 22 th day. When most of cells were in S phase and arrested dramatically. Through the whole healing process, the percentage of G 2 /M in wound of the irradiation side was lower than that of the non-irradiated wound. The BrdU-positive cells were fibroblasts, endothelial cells and smooth muscle cells. Conclusion: These results suggest that G 1 block, S phase arrest, and switch of G 2 /M with suppression of mitotic activity of these cells are induced by local 5.21 Gy soft X-ray irradiation. Therefore, wound healing delay is induced partly by cell cycle arrest

  12. A phase II study of localized prostate cancer treated to 75.6 Gy with 3D conformal radiotherapy

    International Nuclear Information System (INIS)

    Nichol, Alan; Chung, Peter; Lockwood, Gina; Rosewall, Tara; Divanbiegi, Lorella; Sweet, Joan; Toi, Ants; Bayley, Andrew; Bristow, Rob; Crook, Juanita; Gospodarowicz, Mary; McLean, Michael; Milosevic, Michael; Warde, Padraig; Catton, Charles

    2005-01-01

    Background and purpose: To prospectively evaluate toxicity, biochemical failure-free survival (bFFS) and biopsy-proven local control for prostate cancer patients treated with 75.6 Gy in 42 fractions using 6-field conformal radiotherapy to prostate alone. Patients and methods: From 1997 to 1999, 140 patients with T1-2NxM0, Gleason score ≤8, and PSA ≤20 ng/ml prostate cancer were assessed using Radiation Therapy Oncology Group acute and late toxicity scores. bFFS was determined for 120 patients treated without hormones. Post-treatment prostate biopsies were performed at a median of 3 years and a late toxicity questionnaire was administered at a median of 5 years. Results: Clinically important acute toxicities were gastrointestinal (GI) grade 2: 22% and 3: 0%, and genitourinary (GU) grade 2: 24% and 3: 2%. Late physician-assessed toxicities were GI ≥grade 2: 2%, and GU ≥grade 2: 1%. The 3-year bFFS of patients failure-free before biopsy was 93% (95% CI: 83-100) from a negative biopsy and 22% (95% CI: 0-56) from a positive biopsy (P=0.001). Patients reported significantly more late toxicity than physicians (GI: P=0.003, GU: P<0.001). At 5.0 years median follow-up, cause-specific survival was 98% (95% CI: 96-100), overall survival was 91% (95% CI: 86-97), and bFFS was 55% (95% CI: 45-64). Conclusions: 75.6 Gy caused modest levels of acute and late toxicity. Three-year biopsies predicted subsequent biochemical outcome

  13. Hyperfractionated radiaton therapy and bis-chlorethyl nitrosourea in the treatment of malignant glioma - possible advantage observed at 72.0 Gy in 1.2 Gy B.I.D. fractions: Report of the radiation therapy oncology group protocol 8302

    International Nuclear Information System (INIS)

    Nelson, D.F.; Curran, W.J.; Powlis, W.D.; Scott, C.; Nelson, J.S.; Weinstein, A.S.; Ahmad, K.; Constine, L.S.; Murray, K.; Mohiuddin, M.; Fischbach, J.

    1993-01-01

    Between January 1983 and November 1987, the Radiation Therapy Oncology Group conducted a prospective, randomized, multi-institutional, dose searching Phase I/II trial to evaluate hyperfractionated radiation therapy in the treatment of supratentorial malignant glioma. Patients with anaplastic astrocytoma, or glioblastoma multiforme, age 18-70 years with a Karnofsky performance status of 40-100 were stratified according to age, Karnofsky performance status, and histology, and were randomized. Initially randomization was to one of three arms: 64.8 Gy, 72.0 Gy, and 76.8 Gy. Fractions of 1.2 Gy were given twice daily, 5 days per week, with intervals of 4 to 8 hr. All patients received bis-chlorethyl nitrosourea (BCNU) 80 mg/m2 on days 3, 4, 5 of radiation therapy and then every 8 weeks for 1 year. After acceptable rates of acute and late effects were found, the randomization was changed to 81.6 Gy and 72.0 Gy with a weighting of 2:1. Out of 466 patients randomized, 435 were analyzed. The distribution of prognostic factors was comparable among the 76.8 Gy arm, 81.6 Gy arm, and the final randomization of the 72 Gy arm. The 64.8 Gy arm and the initial randomization of the 72 Gy arm had somewhat worse prognostic variables. Late radiation toxicity occurred in 1.3-6.8% of the patients, with a modest increase with increasing radiation dose. The best survival occurred in those patients treated with 72 Gy. The Cox proportional hazards model confirmed the prognostic variables of age, histology and Karnofsky performance status. In addition, the longer interval of 4.5-8 hr was associated with a worse prognosis than the 4-4.4 hr interval. The difference in survival between the 81.6 Gy arm and the lower three arms approached significance with inferior survival observed in the 81.6 Gy arm. 72 Gy delivered by 1.2 Gy twice daily is no more toxic than 60 Gy delivered conventionally. 26 refs., 6 figs., 7 tabs

  14. Randomized trial of 8 Gy in 1 versus 20 Gy in 5 fractions of radiotherapy for neuropathic pain due to bone metastases (Trans-Tasman Radiation Oncology Group, TROG 96.05)

    International Nuclear Information System (INIS)

    Roos, Daniel E.; Turner, Sandra L.; O'Brien, Peter C.; Smith, Jennifer G.; Spry, Nigel A.; Burmeister, Bryan H.; Hoskin, Peter J.; Ball, David L.

    2005-01-01

    Background and purpose: Despite numerous randomized trials investigating radiotherapy (RT) fractionation schedules for painful bone metastases, there are very few data on RT for bone metastases causing pain with a neuropathic component. The Trans-Tasman Radiation Oncology Group undertook a randomized trial comparing the efficacy of a single 8 Gy (8/1) with 20 Gy in 5 fractions (20/5) for this type of pain. Materials and methods: Eligible patients had radiological evidence of bone metastases from a known malignancy with no change in systemic therapy within 6 weeks before or anticipated within 4 weeks after RT, no other metastases along the distribution of the neuropathic pain and no clinical or radiological evidence of cord/cauda equina compression. All patients gave written informed consent. Primary endpoints were pain response within 2 months of commencement of RT and time to treatment failure (TTF). The hypothesis was that 8/1 is at least as effective as 20/5 and the planned sample size was 270 patients. Results: Between February 1996 and December 2002, 272 patients were randomized (8/1:20/5=137:135) from 15 centres (Australia 11, New Zealand 3, UK 1). The commonest primary cancers were lung (31%), prostate (29%) and breast (8%); index sites were spine (89%), rib (9%), other (2%); 72% of patients were males and the median age was 67 (range 29-89). The median overall survival (95% CI) for all randomized patients was 4.8 mo (4.2-5.7 mo). The intention-to-treat overall response rates (95% CI) for 8/1 vs 20/5 were 53% (45-62%) vs 61% (53-70%), P=0.18. Corresponding figures for complete response were 26% (18-34%) vs 27% (19-35%), P=0.89. The estimated median TTFs (95% CI) were 2.4 mo (2.0-3.3 mo) vs 3.7 mo (3.1-5.9 mo) respectively. The hazard ratio (95% CI) for the comparison of TTF curves was 1.35 (0.99-1.85), log-rank P=0.056. There were no statistically significant differences in the rates of re-treatment, cord compression or pathological fracture by arm

  15. Expression profiling of murine lung 70 days following exposure to fractionated or acute dose of 1.0 Gy 56Fe- particle irradiation

    Data.gov (United States)

    National Aeronautics and Space Administration — Irradiation of the K-rasLA1 mouse model with a fractionated dose of 1.0Gy 56Fe- particles increases the incidence of invasive carcinoma compared to unirradiated...

  16. 8 Gy single-dose radiotherapy is effective in metastatic spinal cord compression: Results of a phase III randomized multicentre Italian trial

    International Nuclear Information System (INIS)

    Maranzano, Ernesto; Trippa, Fabio; Casale, Michelina; Costantini, Sara; Lupattelli, Marco; Bellavita, Rita; Marafioti, Luigi; Pergolizzi, Stefano; Santacaterina, Anna; Mignogna, Marcello; Silvano, Giovanni; Fusco, Vincenzo

    2009-01-01

    Background and purpose: In a previous randomized trial we showed that the short-course radiotherapy (RT) regimen of 8 Gy x 2 was feasible in patients with metastatic spinal cord compression (MSCC) and short life expectancy. This phase III trial was planned to determine whether in the same category of patients 8 Gy single-dose is as effective as 8 Gy x 2. Materials and methods: Three hundred and twenty-seven patients with MSCC and short life expectancy were randomly assigned to a short-course of 8 Gy x 2 or to 8 Gy single-dose RT. Median follow-up was 31 months (range, 4-58). Results: A total of 303 (93%) patients are assessable, 150 treated with the short-course and 153 with the single-dose RT. No difference in response was found between the two RT schedules adopted. Median duration of response was 5 and 4.5 months for short-course and single-dose RT (p = 0.4), respectively. The median overall survival was 4 months for all cases. Light acute toxicity was registered in a minority of cases. Late toxicity was never recorded. Conclusions: Both RT schedules adopted were effective. As already shown in several trials evaluating RT regimens in uncomplicated painful bone metastases, also MSCC patients may achieve palliation with minimal toxicity and inconvenience with a single-dose of 8 Gy.

  17. Electrokinetic-Enhanced Remediation of Phenanthrene-Contaminated Soil Combined with Sphingomonas sp. GY2B and Biosurfactant.

    Science.gov (United States)

    Lin, Weijia; Guo, Chuling; Zhang, Hui; Liang, Xujun; Wei, Yanfu; Lu, Guining; Dang, Zhi

    2016-04-01

    Electrokinetic-microbial remediation (EMR) has emerged as a promising option for the removal of polycyclic aromatic hydrocarbons (PAHs) from contaminated soils. The aim of this study was to enhance degradation of phenanthrene (Phe)-contaminated soils using EMR combined with biosurfactants. The electrokinetic (EK) remediation, combined with Phe-degrading Sphingomonas sp. GY2B, and biosurfactant obtained by fermentation of Pseudomonas sp. MZ01, degraded Phe in the soil with an efficiency of up to 65.1 % at the anode, 49.9 % at the cathode after 5 days of the treatment. The presence of biosurfactants, electricity, and a neutral electrolyte stimulated the growth of the degrading bacteria as shown by a rapid increase in microbial biomass with time. The electrical conductivity and pH changed little during the course of the treatment, which benefitted the growth of microorganisms and the remediation of Phe-contaminated soil. The EMR system with the addition of biosurfactant had the highest Phe removal, demonstrating the biosurfactant may enhance the bioavailability of Phe and the interaction with the microorganism. This study suggests that the EMR combined with biosurfactants can be used to enhance in situ bioremediation of PAH-contaminated soils.

  18. Changes in hemopoiesis of mice during chronic irradiation with a dose rate of 957 mGy/day

    International Nuclear Information System (INIS)

    Mackova, N.; Marko, L.; Horak, J.

    1982-01-01

    Quantitative and qualitative changes in the blood producing organs and in the peripheral blood of mice were evaluated. The animals have been continually irradiated for 42 days with a daily dosage of 957 mGy. Until the 7th day of irradiation a significant diminution of the cellularity of the bone marrow and of the cellularity as well as the mass of the spleen could be observed. After the 14th day of irradiation a temporary stabilization of the cell number in the bone marrow could be found until the 28th day, after that time there was a moderately strong decrease. The cellularity and the mass of the spleen increased temporarily until the 28th day of irradiation owing to the increase of erythropoiesis and myelopoiesis from 20% to 50%. The most significant changes in the peripheral blood could be observed in agranulocytes as a kind of sudden and permanent decrease. The diminution of the granulocyte and reticulocyte numbers proceeded somewhat more slowly, with a temporarily increasing tendency on the 28th day of irradiation. The erythrocyte numbers as well as the hematocrit and hemoglobin values decreased continually beginning from the 7th day of irradiation until the death of the animals. (author)

  19. Language and Family Dispersion: North Korean Linguist Kim Su-gyŏng and the Korean War

    Directory of Open Access Journals (Sweden)

    Ryuta Itagaki

    2017-03-01

    Full Text Available This article analyzes the unpublished memoir of Kim Su-gyŏng (1918–2000, a linguist who was active in North Korea from the mid-1940s until the late 1960s, and situates his account of his experience of the Korean War within the context of his linguistic essays and correspondence. In doing so, the article considers the role that the personal and the social play in language, utilizing Saussure’s theoretical framework, with which Kim himself was well versed. Kim wrote his memoirs in the 1990s to his family, from whom he had become separated during the Korean War and who now lived in Toronto. In this text, he writes in “personal” language that reveals his uncertainty and his feelings for his family, but then immediately negates these feelings through the use of “social” language, which resonates with his interpretation of the linguistic thesis that Josef Stalin developed during the Korean War on language and national identity. For Kim, the relationship between language and nation was not at all self-evident, but something that he idealized in response to the dispersal of his family. By offering a reflexive reading of a memoir written by a North Korean linguist, this article makes a breakthrough in the investigation of North Korean wartime academic history, which has not risen above the level of analyzing articles in the field of linguistics that were published at the time.

  20. Multidose Stereotactic Radiosurgery (9 Gy × 3) of the Postoperative Resection Cavity for Treatment of Large Brain Metastases

    Energy Technology Data Exchange (ETDEWEB)

    Minniti, Giuseppe, E-mail: gminniti@ospedalesantandrea.it [Radiation Oncology Unit, Sant' Andrea Hospital, University “Sapienza,” Rome (Italy); Department of Neurological Sciences, Scientific Institute IRCCS Neuromed, Pozzilli (Italy); Esposito, Vincenzo [Department of Neurological Sciences, Scientific Institute IRCCS Neuromed, Pozzilli (Italy); Clarke, Enrico; Scaringi, Claudia [Radiation Oncology Unit, Sant' Andrea Hospital, University “Sapienza,” Rome (Italy); Lanzetta, Gaetano [Department of Neurological Sciences, Scientific Institute IRCCS Neuromed, Pozzilli (Italy); Salvati, Maurizio [Department of Neurological Sciences, Scientific Institute IRCCS Neuromed, Pozzilli (Italy); Neurosurgery Unit, Umberto I Hospital, University “Sapienza,” Rome (Italy); Raco, Antonino [Neurosurgery Unit, Sant' Andrea Hospital, University “Sapienza,” Rome (Italy); Bozzao, Alessandro [Neuroradiology Unit, Sant' Andrea Hospital, University “Sapienza,” Rome (Italy); Maurizi Enrici, Riccardo [Radiation Oncology Unit, Sant' Andrea Hospital, University “Sapienza,” Rome (Italy)

    2013-07-15

    Purpose: To evaluate the clinical outcomes with linear accelerator-based multidose stereotactic radiosurgery (SRS) to large postoperative resection cavities in patients with large brain metastases. Methods and Materials: Between March 2005 to May 2012, 101 patients with a single brain metastasis were treated with surgery and multidose SRS (9 Gy × 3) for large resection cavities (>3 cm). The target volume was the resection cavity with the inclusion of a 2-mm margin. The median cavity volume was 17.5 cm{sup 3} (range, 12.6-35.7 cm{sup 3}). The primary endpoint was local control. Secondary endpoints were survival and distant failure rates, cause of death, performance measurements, and toxicity of treatment. Results: With a median follow-up of 16 months (range, 6-44 months), the 1-year and 2-year actuarial survival rates were 69% and 34%, respectively. The 1-year and 2-year local control rates were 93% and 84%, with respective incidences of new distant brain metastases of 50% and 66%. Local control was similar for radiosensitive (non-small cell lung cancer and breast cancer) and radioresistant (melanoma and renal cell cancer) brain metastases. On multivariate Cox analysis stable extracranial disease, breast cancer histology, and Karnofsky performance status >70 were associated with significant survival benefit. Brain radionecrosis occurred in 9 patients (9%), being symptomatic in 5 patients (5%). Conclusions: Adjuvant multidose SRS to resection cavity represents an effective treatment option that achieves excellent local control and defers the use of whole-brain radiation therapy in selected patients with large brain metastases.

  1. p38 MAPK Inhibitor Insufficiently Attenuates HSC Senescence Administered Long-Term after 6 Gy Total Body Irradiation in Mice

    Directory of Open Access Journals (Sweden)

    Lu Lu

    2016-06-01

    Full Text Available Senescent hematopoietic stem cells (HSCs accumulate with age and exposure to stress, such as total-body irradiation (TBI, which may cause long-term myelosuppression in the clinic. However, the methods available for long-term myelosuppression remain limited. Previous studies have demonstrated that sustained p38 mitogen-activated protein kinases (p38 MAPK activation in HSCs following exposure to TBI in mice and the administration of its inhibitor twenty-four hours after TBI may partially prevent long-term myelosuppression. However, long-term myelosuppression is latent and identified long after the administration of radiation. In this study, we investigated the effects of SB203580 (a small molecule inhibitor of p38 MAPK on long-term myelosuppression induced by TBI. Mice with hematopoietic injury were injected intraperitoneally with SB203580 every other day five times beginning 70 days after 6 Gy of 137Cs γ ray TBI. Our results at 80 days demonstrated that SB203580 did not significantly improve the TBI-induced long-term reduction of peripheral blood cell and bone marrow nucleated cell (BMNC counts, or defects in hematopoietic progenitor cells (HPCs and HSC clonogenic function. SB203580 reduced reactive oxygen species (ROS production and p-p38 expression; however, SB203580 had no effect on p16 expression in the HSCs of mice. In conclusion, these findings suggest that treatment with SB203580 70 days after TBI in mice inhibits the ROS-p38 oxidative stress pathway; however, it has no therapeutic effect on long-term myelosuppression induced by TBI.

  2. Development of the Exam of GeoloGy Standards, EGGS, to Measure Students' Conceptual Understanding of Geology Concepts

    Science.gov (United States)

    Guffey, S. K.; Slater, T. F.; Slater, S. J.

    2017-12-01

    Discipline-based geoscience education researchers have considerable need for criterion-referenced, easy-to-administer and easy-to-score, conceptual diagnostic surveys for undergraduates taking introductory science survey courses in order for faculty to better be able to monitor the learning impacts of various interactive teaching approaches. To support ongoing discipline-based science education research to improve teaching and learning across the geosciences, this study establishes the reliability and validity of a 28-item, multiple-choice, pre- and post- Exam of GeoloGy Standards, hereafter simply called EGGS. The content knowledge EGGS addresses is based on 11 consensus concepts derived from a systematic, thematic analysis of the overlapping ideas presented in national science education reform documents including the Next Generation Science Standards, the AAAS Benchmarks for Science Literacy, the Earth Science Literacy Principles, and the NRC National Science Education Standards. Using community agreed upon best-practices for creating, field-testing, and iteratively revising modern multiple-choice test items using classical item analysis techniques, EGGS emphasizes natural student language over technical scientific vocabulary, leverages illustrations over students' reading ability, specifically targets students' misconceptions identified in the scholarly literature, and covers the range of topics most geology educators expect general education students to know at the end of their formal science learning experiences. The current version of EGGS is judged to be valid and reliable with college-level, introductory science survey students based on both standard quantitative and qualitative measures, including extensive clinical interviews with targeted students and systematic expert review.

  3. Comparable effects of 1800- and 2400-rad (18- and 24-Gy) cranial irradiation on height and weight in children treated for acute lymphocytic leukemia

    International Nuclear Information System (INIS)

    Starceski, P.J.; Lee, P.A.; Blatt, J.; Finegold, D.; Brown, D.

    1987-01-01

    To examine the effects of low-dose cranial irradiation on growth and to determine if one can predict patients in whom growth will be most affected, we studied 47 children with acute lymphocytic leukemia who had been treated with 2400 rad (24 Gy), 1800 rad (18 Gy), or no whole-brain irradiation. Serial measurements of height, weight, and weight for height were obtained by retrospective chart review. The effects of 1800 rad (18 Gy) and 2400 rad (24 Gy) treatment were indistinguishable. Height percentiles among irradiated patients decreased by a mean of 12% six months after diagnosis, and growth generally did not catch up. Moreover, although 33 irradiated patients maintained heights within the normal range, In 11 patients (33%) a dramatic falloff occurred such that by three years following diagnosis their height for age was more than 30 percentiles below the original value. These patients were all identifiable at six months since their height percentiles had already decreased by more than 15%. Although weight percentiles did not change following irradiation, the weight-for-height ratio increased and patients were relatively stockier three years after therapy than they had been at diagnosis. In patients who had received chemotherapy alone, the weight-for-height ratio also increased, but this appeared to be due to a disproportionate increase in weight. Longer follow-up and evaluation of larger cohorts of patients treated with 1800 rad (18 Gy) will be needed to confirm these results

  4. Degradation of slime extracellular polymeric substances and inhibited sludge flocs destruction contribute to sludge dewaterability enhancement during fungal treatment of sludge using filamentous fungus Mucor sp. GY-1.

    Science.gov (United States)

    Wang, Zhenyu; Zheng, Guanyu; Zhou, Lixiang

    2015-09-01

    Mechanisms responsible for the sludge dewaterability enhanced by filamentous fungi during fungal treatment of sludge were investigated in the present study. The filamentous fungus Mucor sp. GY-1, isolated from waste activated sludge, enhanced sludge dewaterability by 82.1% to achieve the lowest value of normalized sludge specific resistance to filtration (SRF), 8.18 × 10(10) m · L/kg · g-TSS. During the fungal treatment of sludge, 57.8% of slime extracellular polymeric substances (EPS) and 51.1% of polysaccharide in slime EPS were degraded, respectively, by Mucor sp. GY-1, contributing to the improvement of sludge dewaterability. Slime EPS is much more available for Mucor sp. GY-1 than either LB-EPS or TB-EPS that bound with microbial cells. In addition, filamentous fungus Mucor sp. GY-1 entrapped small sludge particles and inhibited the destruction of sludge flocs larger than 100 μm, thus enhancing sludge dewaterability, during fungal treatment of sludge using Mucor sp. GY-1. Copyright © 2015 Elsevier Ltd. All rights reserved.

  5. Nonmonotonous changes of thymus nuclei lipid metabolism upon chronic gamma-radiation of rats at a dose-rate of 3 c Gy/Day

    International Nuclear Information System (INIS)

    Kulagina, T.P.; Kolomijtseva, I.K.; Moiseeva, S.A.; Kuzin, A.M.

    2000-01-01

    The dynamics of changes in the thymus nuclei lipid metabolism under chronic gamma-radiation in low doses with the dose rate of 3 cGy/day is studied. It is shown, that at the 25 cGy dose rate there takes place activation of exchange in the fatly-acid part of the phospholipid molecule with simultaneous activation of the cholesterol and fatty acids synthesis. The synthesis of cholesterol and fatty acids at 50 cGy remains activated, whereas metabolism of the fatty-acid part of the phospholipids molecule is sharply depressed. The identified changes reveal the similarity with the processes, proceeding by the apoptose induction. At the same time the dynamics of the thymocyte nuclei lipid exchange in the process of adaptation to the long radiation effect as nonmonotonous metabolic response to low dose impact is characterized for the first time [ru

  6. Effect of radioiodine irradiation of thyroid gland in vitro with a dose of 4-5 Gy on iodide transport in thyrocytes

    International Nuclear Information System (INIS)

    Paster, Yi.P.

    2000-01-01

    We study the influence of ouabain on the basal and thyrotropin-stimulated iodide uptake in thyroid gland preliminarily irradiated by radioiodine (absorbed dose: 4-5 Gy) in vitro. Newborn pig thyroid tissue was incubated in a medium, containing 37 kBq/ml of 131-iodine (absorbed dose: 4-5 Gy), washed and achieved by collagenase dissociation. Thyrocytes were incubated with thyrotropin (100.0 mE/ml), ouabain (0.1 mol/l), and 125-iodide (0.4 kBq/ml). Then cells were washed, stored at 4 degree C for 60 days, and the 125-iodide uptake was assessed. Ouabain depressed both the basal and thyrotropin-stimulated iodide uptakes by thyrocytes in vitro. After preliminary radioiodine irradiation of the thyroid tissue (absorbed dose: 4-5 Gy), ouabain stimulated both the basal and thyrotropin-stimulated iodide uptakes by thyrocytes

  7. Effect of gamma irradiation at doses of 5-15 kGy on the quality properties of durum wheat semolina

    International Nuclear Information System (INIS)

    Taha, S.A.

    1990-01-01

    Semolina purified from four durum wheat varieties were gamma-irradiated with doses of 0, 5, 10 and 15 kGy, i.e., dose levels expected to improve the colour of pasta products, suitable for reduction of microbial contamination, and high doses required for insect disinfestation. The irradiation resulted in significant losses in carotenoid content and oxidative enzyme activities. Gamma irradiation slightly affected the mixing properties, greatly reduced the gluten strength and adversely affected firmness of cooked pasta. Consequently, preservative gamma irradiation of durum wheat semolina should be limited to a maximum dose of 5 kGy. (author) 39 refs.; 3 tabs

  8. Implant R100 Predicts Rectal Bleeding in Prostate Cancer Patients Treated with IG-IMRT to 45 Gy and Pd-103 Implant

    OpenAIRE

    Matthew Packard; Vladimir Valakh; Russell Fuhrer

    2014-01-01

    Purpose. To define factors associated with rectal bleeding in patients treated with IG-IMRT followed by Pd-103 seed implant. Methods and Materials. We retrospectively reviewed 61 prostate adenocarcinoma patients from 2002 to 2008. The majority (85.2%) were of NCCN intermediate risk category. All received IG-IMRT to the prostate and seminal vesicles followed by Pd-103 implant delivering a mean D90 of 100.7 Gy. Six patients received 45 Gy to the pelvic nodes and 10 received androgen deprivation...

  9. High Dose Rate Brachytherapy in Two 9 Gy Fractions in the Treatment of Locally Advanced Cervical Cancer - a South Indian Institutional Experience.

    Science.gov (United States)

    Ghosh, Saptarshi; Rao, Pamidimukkala Bramhananda; Kotne, Sivasankar

    2015-01-01

    Although 3D image based brachytherapy is currently the standard of treatment in cervical cancer, most of the centres in developing countries still practice orthogonal intracavitary brachytherapy due to financial constraints. The quest for optimum dose and fractionation schedule in high dose rate (HDR) intracavitary brachytherapy (ICBT) is still ongoing. While the American Brachytherapy Society recommends four to eight fractions of each less than 7.5 Gy, there are some studies demonstrating similar efficacy and comparable toxicity with higher doses per fraction. To assess the treatment efficacy and late complications of HDR ICBT with 9 Gy per fraction in two fractions. This is a prospective institutional study in Southern India carried on from 1st June 2012 to 31st July 2014. In this period, 76 patients of cervical cancer satisfying our inclusion criteria were treated with concurrent chemo-radiation following ICBT with 9 Gy per fraction in two fractions, five to seven days apart. The median follow-up period in the study was 24 months (range 10.6 - 31.2 months). The 2 year actuarial local control rate, disease-free survival and overall survival were 88.1%, 84.2% and 81.8% respectively. Although 38.2% patients suffered from late toxicity, only 3 patients had grade III late toxicity. In our experience, HDR brachytherapy with 9 Gy per fraction in two fractions is an effective dose fractionation for the treatment of cervical cancer with acceptable toxicity.

  10. 3-D conformal treatment of prostate cancer to 74 Gy vs. high-dose-rate brachytherapy boost: A cross-sectional quality-of-life survey

    Energy Technology Data Exchange (ETDEWEB)

    Vordermark, Dirk [Univ. of Wuerzburg (DE). Dept. of Radiation Oncology] (and others)

    2006-09-15

    The effects of two modalities of dose-escalated radiotherapy on health-related quality of life (HRQOL) were compared. Forty-one consecutive patients were treated with a 3-D conformal (3-DC) boost to 74 Gy, and 43 with high-dose rate (HDR) brachytherapy boost (2x9 Gy), following 3-D conformal treatment to 46 Gy. Median age was 70 years in both groups, median initial PSA was 7.9 {mu}g/l in 3-DC boost patients and 8.1 {mu}g/l in HDR boost patients. Stage was 7 in 52% and 47%, respectively. HRQOL was assessed cross-sectionally using EORTC QLQ-C30 and organ-specific PR25 modules 3-32 (median 19) and 4-25 (median 14) months after treatment, respectively. Questionnaires were completed by 93% and 97% of patients, respectively. Diarrhea and insomnia scores were significantly increased in both groups. In the PR25 module, scores of 3-DC boost and HDR boost patients for urinary, bowel and treatment-related symptoms were similar. Among responders, 34% of 3-DC boost patients and 86% of HDR boost patients had severe erectile problems. Dose escalation in prostate cancer by either 3-DC boost to 74 Gy or HDR brachytherapy boost appears to result in similar HRQOL profiles.

  11. Textural gain and subsequent loss in irradiated apples, carrots and potatoes with increase in dose from 0.03 to 1.0 kGy

    International Nuclear Information System (INIS)

    Cathalin, J.; McNulty, P.

    1996-01-01

    Cored samples (16mm X 15mm diameter) of apples, carrots and potatoes were irradiated in an Isomedix Gammacell 1000 irradiator at a dose rate of approximately 9Gy/min. Texture was measured using unrestrained uniaxial compression to microrupture on the JJ Universal Testing Machine. The loading rate was 6mm/min. Texture or firmness was assessed as the force to microrupture; the force required for various microrupture sample deformations (25%, 50% and 75%); the apparent Young's Modulus (ratio of the average stress to the average strain to microrupture); and the microrupture energy (area under the force-deformation curve). As the dose increased from 0.03 up to about 0.1 kGy, a gain in texture generally occurred in all products ranging from 3% to 16%. A transition area from gain to loss occurred within the 0.1 to 0.3 kGy range. Loss of texture occurred in all products as the dose increased from 0.3 to 1.0kGy, the loss ranging from 4% to 30%. The greatest loss of texture occurred in apples and the least loss in carrots. There textural trends may have commercial significance in low dose irradiation processes such as sprout inhibition, senescence delay and disinfestation

  12. Muusikamaailm. Magnus Lindbergi festivali jätk. Jonas Forsell taas ooperijuhiks. Marcello Panni uus ooper. György Kurtagile Sonningi preemia. Peter Gradenwitz lahkunud / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    Soome helilooja Magnus Lindbergi mitmeid teoseid esitatakse Inglismaal. Rootsi heliloojast Jonas Forsellist sai jaanuaris Kopenhaageni trupi Den Anden Opera kunstiline juht. Firenzes tuli esiettekandele Marcello Panni uus ooper "The Banquet ئ Talking about Love". Helilooja György Kurtag pälvis Taani 2003.a. Leonie Sonningi muusikapreemia. 91aastasena suri muusikateadlane Peter Gradenwitz

  13. Preoperative irradiation with 5x5 Gy in a murine isolated colon loop model does not cause anastomotic weakening after colon resection

    NARCIS (Netherlands)

    Karliczek, A.; Zeebregts, C. J.; Benaron, D. A.; Coppes, R. P.; Wiggers, T.; van Dam, G. M.

    2008-01-01

    Introduction There are conflicting studies on the influence of fractionated preoperative 5 days of 5 Gy irradiation on tissue oxygenation and subsequent colonic anastomotic strength. To elucidate the effect of preoperative irradiation on anastomotic strength, an isolated colon loop model was

  14. 2, 4 and 6 kGy effect on the microbiological characteristics of chicken hamburgers stored at 2±2 oC

    International Nuclear Information System (INIS)

    Torres, Z.; Basurto, H.; Silva, M.

    2001-01-01

    Decimal reduction dose (D 10 ) of S. typhimurium irradiated in Casoy broth (TSB) and inoculated in chicken burger was found to be 0,425 and 0,547 kGy respectively being the second value 22,3 % higher than the first one. Then, chicken burger previously radiosterilized at 15 kGy was inoculated with S. typhimurium, irradiated at 2, 4 and 6 kGy and kept under storage for 57 days at 2± 2 o C and HR 90 5%. Another batch of chicken burger without radiosterilization was irradiated at 2, 4 and 6 kGy and stored under the same conditions than the previous one in order to study the natural bacterial flora. It was observed that there is a synergic effect between irradiation dose and time of storage (α=5%) in the counting of S. typhimurium. In unirradiated chicken burger, the number of total coliforms increased from 29 NMP/g at the beginning to 4250 NMP/g at day 22 and fecal coliforms from 4 to 240 NMP/g; subsequently the number of these bacteria dropped again at the end of the storage time, while in irradiated samples no coliforms were found. Mesophilic and psychrotrophic bacteria diminished its ability of growing up and making colonies, proportionally to the applied irradiation doses. However, as the storage time advanced these bacteria recovered its ability to grow up and of cause spoilage. (authors)

  15. Phase I study of intraoperative radiotherapy with photon radiosurgery system in children with recurrent brain tumors: Preliminary report of first dose level (10 Gy)

    International Nuclear Information System (INIS)

    Kalapurakal, John A.; Goldman, Stewart; Stellpflug, Wendy; Curran, John; Sathiaseelan, Vythialingam; Marymont, Maryanne H.; Tomita, Tadanori

    2006-01-01

    Purpose: To describe the preliminary results after intraoperative radiotherapy (IORT) with the photon radiosurgery system in children with recurrent brain tumors treated at the first dose level (10 Gy) of a Phase I protocol. Methods and Materials: A Phase I IORT dose escalation protocol was initiated at Children's Memorial Hospital to determine the maximal tolerated IORT dose in children with recurrent brain tumors. Results: Fourteen children have received IORT thus far. Eight had been previously irradiated. Thirteen children had ependymoma. The median follow-up was 16 months. Three patients (21%) developed radiation necrosis on follow-up MRI scans 6 to 12 months after IORT. They had not been previously irradiated and had received 10 Gy to a depth of 5 mm. One required surgery and the other two had resolution of their lesions without treatment. All 3 patients were asymptomatic at the last follow-up. No other late toxicity was observed at the last follow-up visit. Eight patients (57%) had tumor control within the surgical bed after IORT. Conclusion: Our findings have demonstrated the safety and feasibility of IORT to a dose of 10 Gy to 2 mm in children with previously irradiated brain tumors. IORT to a dose of 10 Gy at 5 mm was associated with a greater complication rate

  16. 3-D conformal treatment of prostate cancer to 74 Gy vs. high-dose-rate brachytherapy boost: A cross-sectional quality-of-life survey

    International Nuclear Information System (INIS)

    Vordermark, Dirk

    2006-01-01

    The effects of two modalities of dose-escalated radiotherapy on health-related quality of life (HRQOL) were compared. Forty-one consecutive patients were treated with a 3-D conformal (3-DC) boost to 74 Gy, and 43 with high-dose rate (HDR) brachytherapy boost (2x9 Gy), following 3-D conformal treatment to 46 Gy. Median age was 70 years in both groups, median initial PSA was 7.9 μg/l in 3-DC boost patients and 8.1 μg/l in HDR boost patients. Stage was 7 in 52% and 47%, respectively. HRQOL was assessed cross-sectionally using EORTC QLQ-C30 and organ-specific PR25 modules 3-32 (median 19) and 4-25 (median 14) months after treatment, respectively. Questionnaires were completed by 93% and 97% of patients, respectively. Diarrhea and insomnia scores were significantly increased in both groups. In the PR25 module, scores of 3-DC boost and HDR boost patients for urinary, bowel and treatment-related symptoms were similar. Among responders, 34% of 3-DC boost patients and 86% of HDR boost patients had severe erectile problems. Dose escalation in prostate cancer by either 3-DC boost to 74 Gy or HDR brachytherapy boost appears to result in similar HRQOL profiles

  17. Radiation dose ≥54 Gy and CA 19–9 response are associated with improved survival for unresectable, non-metastatic pancreatic cancer treated with chemoradiation

    Directory of Open Access Journals (Sweden)

    Golden Daniel W

    2012-09-01

    Full Text Available Abstract Background Unresectable pancreatic cancer (UPC has low survival. With improving staging techniques and systemic therapy, local control in patients without metastatic disease may have increasing importance. We investigated whether the radiation dose used in chemoradiation (CRT as definitive treatment for UPC and the CA 19–9 response to therapy have an impact on overall survival (OS. Methods From 1997–2009 46 patients were treated with CRT for non-metastatic UPC. Median prescribed RT dose was 54 Gy (range 50.4-59.4 Gy. All patients received concurrent chemotherapy (41: 5-fluorouracil, 5: other and 24 received adjuvant chemotherapy. Results 41 patients were inoperable due to T4 disease and 5 patients with T3 disease were medically inoperable. Five patients did not complete CRT due to progressive disease or treatment-related toxicity (median RT dose 43.2 Gy. Overall, 42 patients were dead of disease at the time of last follow-up. The median and 12 month OS were 8.8 months and 35%, respectively. By univariate analysis, minimum CA 19–9 post-CRT Conclusions CRT as definitive treatment for UPC had low survival. However, our retrospective data suggest that patients treated to ≥54 Gy or observed to have a minimum post-CRT CA 19–9

  18. Significant correlation between rectal DVH and late bleeding in patients treated after radical prostatectomy with conformal or conventional radiotherapy (66.6-70.2 Gy)

    International Nuclear Information System (INIS)

    Cozzarini, Cesare; Fiorino, Claudio; Ceresoli, Giovanni Luca; Cattaneo, Giovanni Mauro; Bolognesi, Angelo; Calandrino, Riccardo; Villa, Eugenio

    2003-01-01

    Purpose: Investigating the correlation between dosimetric/clinical parameters and late rectal bleeding in patients treated with adjuvant or salvage radiotherapy after radical prostatectomy. Methods and Materials: Data of 154 consecutive patients, including three-dimensional treatment planning and dose-volume histograms (DVHs) of the rectum (including filling), were retrospectively analyzed. Twenty-six of 154 patients presenting a (full) rectal volume >100 cc were excluded from the analysis. All patients considered for the analysis (n=128) were treated at a nominal dose equal to 66.6-70.2 Gy (ICRU dose 68-72.5 Gy; median 70 Gy) with conformal (n=76) or conventional (n=52) four-field technique (1.8 Gy/fr). Clinical parameters such as diabetes mellitus, acute rectal bleeding, hypertension, age, and hormonal therapy were considered. Late rectal bleeding was scored using a modified Radiation Therapy Oncology Group scale, and patients experiencing ≥Grade 2 were considered bleeders. Median follow-up was 36 months (range 12-72). Mean and median rectal dose were considered, together with rectal volume and the % fraction of rectum receiving more than 50, 55, 60, and 65 Gy (V50, V55, V60, V65, respectively). Median and quartile values of all parameters were taken as cutoff for statistical analysis. Univariate (log-rank) and multivariate (Cox hazard model) analyses were performed. Results: Fourteen of 128 patients experienced ≥Grade 2 late bleeding (3-year actuarial incidence 10.5%). A significant correlation between a number of cutoff values and late rectal bleeding was found. In particular, a mean dose ≥54 Gy, V50 ≥63%, V55 ≥57%, and V60 ≥50% was highly predictive of late bleeding (p≤0.01). A rectal volume <60 cc and type of treatment (conventional vs. conformal) were also significantly predictive of late bleeding (p=0.05). Concerning clinical variables, acute bleeding (p < 0.001) was significantly related to late bleeding, and a trend was found for

  19. Whole-brain radiotherapy with 20 Gy in 5 fractions for brain metastases in patients with cancer of unknown primary (CUP)

    International Nuclear Information System (INIS)

    Rades, D.; Bohlen, G.; Dunst, J.; Lohynska, R.; Veninga, T.; Stalpers, L.J.A.; Schild, S.E.

    2007-01-01

    Background: Whole brain radiotherapy (WBRT) is the most common treatment for brain metastases. Survival of patients with cancer of unknown primary (CUP) presenting with brain metastases is extremely poor. A radiation program with a short overall treatment time (short-course RT) would be preferable to longer programs if it provides similar outcomes. This study compares short-course RT with 20 Gy in 5 fractions (5 x 4 Gy) given over 5 days to longer programs in CUP patients. Patients and Methods: Data regarding 101 CUP patients who received either short course WBRT (n = 34) with 5 x 4 Gy or long-course WBRT (n = 67) with 10 x 3 Gy given over 2 weeks or 20 x 2 Gy given over 4 weeks for brain metastases were analyzed retrospectively. Six additional potential prognostic factors were investigated: age, gender, Karnofsky performance score (KPS), number of brain metastases, extracranial metastases, RPA-(Recursive Partitioning Analysis-)class. Results: On univariate analysis, the radiation program was not associated with survival (p = 0.88) nor intracerebral control (p = 0.36). Improved survival was associated with KPS ≥ 70 (p < 0.001), absence of extracranial metastases (p < 0.001), and RPA-class 1 (p < 0.001). On multivariate analyses, KPS (risk ratio [RR]: 4.55; p < 0.001), extracranial metastases (RR: 1.70; p = 0.018), and RPA-class (RR: 2.86; p < 0.001) maintained significance. On univariate analysis, KPS (p < 0.001) and RPA-class (p < 0.001) were significantly associated with intracerebral control. On multivariate analyses, KPS (RR: 2.72; p < 0.001) and RPA-class (RR: 2.09; p < 0.001) remained significant. Conclusion: Short-course WBRT with 5 x 4 Gy provided similar intracerebral control and survival as longer programs for the treatment of brain metastases in CUP patients. 5 x 4 Gy appears preferable because it is more convenient for patients. (orig.)

  20. Identification of several gy4 nulls from the USDA soybean germplasm collection provides new genetic resources for the development of high-quality tofu cultivars.

    Science.gov (United States)

    Kim, Won-Seok; Ho, Heo Jae; Nelson, Randall L; Krishnan, Hari B

    2008-12-10

    Tofu, a cheese-like food made by curdling soy milk, is a major dietary staple of Asian countries. Consumption of tofu and other soy products is steadily increasing in North America due to its well-known health benefits. Soybean A(5), A(4), and B(3) peptide null lines 'Enrei' and 'Raiden' are commonly utilized in breeding programs to develop high-quality tofu cultivars. To expand the genetic diversity it is desirable to identify and utilize other A(5), A(4), and B(3) null genotypes in the development of improved tofu cultivars that are adapted to North American conditions. In this study were screened diverse soybean accessions from the USDA Soybean Germplasm Collection to identify Gy4 mutants, the locus that controls A(5), A(4), and B(3) peptide production. Analysis of total seed proteins from 485 soybean lines by SDS-PAGE enabled the identification of 38 accessions that lacked the A(5), A(4), and B(3) peptides. These accessions showed marked differences in seed size and seed coat color and represented different maturity groups ranging from 0 to IX. To ascertain the molecular basis for the lack of A(5), A(4), and B(3) peptides in the newly identified Gy4 mutants, the nucleotide sequence of a portion of the Gy4 gene was determined from eight soybean accessions representing different maturity groups. These eight Gy4 mutants revealed a single point mutation that changed the translation initiation codon ATG to ATA, resulting in the A(5), A(4), and B(3) null phenotype. The newly identified Gy4 mutants from this study will enable plant breeders to expand the genetic diversity of North American food-quality soybeans and also aid in the development of hypoallergenic soybeans.

  1. Chest Wall Volume Receiving >30 Gy Predicts Risk of Severe Pain and/or Rib Fracture After Lung Stereotactic Body Radiotherapy

    International Nuclear Information System (INIS)

    Dunlap, Neal E.; Cai, Jing; Biedermann, Gregory B.; Yang, Wensha; Benedict, Stanley H.; Sheng Ke; Schefter, Tracey E.; Kavanagh, Brian D.; Larner, James M.

    2010-01-01

    Purpose: To identify the dose-volume parameters that predict the risk of chest wall (CW) pain and/or rib fracture after lung stereotactic body radiotherapy. Methods and Materials: From a combined, larger multi-institution experience, 60 consecutive patients treated with three to five fractions of stereotactic body radiotherapy for primary or metastatic peripheral lung lesions were reviewed. CW pain was assessed using the Common Toxicity Criteria for pain. Peripheral lung lesions were defined as those located within 2.5 cm of the CW. A minimal point dose of 20 Gy to the CW was required. The CW volume receiving ≥20, ≥30, ≥40, ≥50, and ≥60 Gy was determined and related to the risk of CW toxicity. Results: Of the 60 patients, 17 experienced Grade 3 CW pain and five rib fractures. The median interval to the onset of severe pain and/or fracture was 7.1 months. The risk of CW toxicity was fitted to the median effective concentration dose-response model. The CW volume receiving 30 Gy best predicted the risk of severe CW pain and/or rib fracture (R 2 = 0.9552). A volume threshold of 30 cm 3 was observed before severe pain and/or rib fracture was reported. A 30% risk of developing severe CW toxicity correlated with a CW volume of 35 cm 3 receiving 30 Gy. Conclusion: The development of CW toxicity is clinically relevant, and the CW should be considered an organ at risk in treatment planning. The CW volume receiving 30 Gy in three to five fractions should be limited to 3 , if possible, to reduce the risk of toxicity without compromising tumor coverage.

  2. Dose-rate effects between 0.3 and 30 Gy/h in a normal and a malignant human cell line

    International Nuclear Information System (INIS)

    Amdur, R.J.; Bedford, J.S.

    1994-01-01

    This study used continuous open-quotes intermediateclose quotes dose rate irradiation (0.3-30 Gy/h) to compare the capacity for and repair of sublethal radiation damage in different cell lines growing in tissue culture. Two human cell lines were studied; one was derived from normal human fibroblasts (AG1522) and the other from a squamous cell carcinoma of the uterine cervix (HTB-35). Dose-response curves for clonogenic survival were determined following irradiation of plateau-phase cultures at five different dose rates: 22.6, 6.12, 3.65, 1.04, and 0.38 Gy/h. Subculture following irradiation was delayed for 8-24 h to allow for the full repair of open-quotes potentially lethal damage.close quotes A significant dose-rate effect was seen in both cell lines. For irradiation at the highest dose rate, survival at 2 Gy (SF2) and the α/β ratio were similar for the two cell lines (approximately 0.7 and 8.0 Gy, respectively) but the half-time of repair of sublethal damage was estimated to be approximately five times longer in the normal human fibroblast line (154 min) than in the carcinoma (31 min) cell line. These results indicate that measuring the dose-rate effect between 0.3 and 30 Gy/h is a useful way to identify and quantify differences in sublethal damage repair between cell lines. To the extent that in vitro and in vivo repair parameters are similar, and that representative tumor biopsy specimens can be examined in this way, this approach may provide a prospective way of determining the dose rate (brachytherapy) or fractionation schedule that will optimize the therapeutic ratio. 32 refs., 1 fig

  3. Individual variations in dose response for spatial memory learning among outbred wistar rats exposed from 5 to 20 cGy of (56) Fe particles.

    Science.gov (United States)

    Wyrobek, Andrew J; Britten, Richard A

    2016-06-01

    Exposures of brain tissue to ionizing radiation can lead to persistent deficits in cognitive functions and behaviors. However, little is known about the quantitative relationships between exposure dose and neurological risks, especially for lower doses and among genetically diverse individuals. We investigated the dose relationship for spatial memory learning among genetically outbred male Wistar rats exposed to graded doses of (56) Fe particles (sham, 5, 10, 15, and 20 cGy; 1 GeV/n). Spatial memory learning was assessed on a Barnes maze using REL3 ratios measured at three months after exposure. Irradiated animals showed dose-dependent declines in spatial memory learning that were fit by a linear regression (P for slope learning at 10 cGy exposures, no detectable learning between 10 and 15 cGy, and worsened performances between 15 and 20 cGy. The proportions of poor learners and the magnitude of their impairment were fit by linear regressions with doubling doses of ∼10 cGy. In contrast, there were no detectable deficits in learning among the good learners in this dose range. Our findings suggest that genetically diverse individuals can vary substantially in their spatial memory learning, and that exposures at low doses appear to preferentially impact poor learners. This hypothesis invites future investigations of the genetic and physiological mechanisms of inter-individual variations in brain function related to spatial memory learning after low-dose HZE radiation exposures and to determine whether it also applies to physical trauma to brain tissue and exposures to chemical neurotoxicants. Environ. Mol. Mutagen. 57:331-340, 2016. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  4. Analysis of dose volume histogram parameters to estimate late bladder and rectum complications after high-dose (70-78 Gy) conformal radiotherapy for prostate cancer

    International Nuclear Information System (INIS)

    Boersma, L.J.; Brink, M. van den; Bruce, A.; Gras, L.; Velde, A. te; Lebesque, J.V.

    1997-01-01

    Purpose: To investigate whether Dose Volume Histogram (DVH) parameters can be used to identify risk groups for developing late gastrointestinal (GI) and genitourinary (GU) complications after conformal radiotherapy for prostate cancer, and to examine the effect of using different morbidity scoring systems on the results of these analyses. Materials and Methods: DVH parameters were analyzed for 130 patients with localized prostate cancer, treated with conformal radiotherapy in a dose-escalating protocol (70-78 Gy, 2 Gy per fraction). The incidence of late (> 6 months) GI and GU complications was scored based on questionnaires and classified using the RTOG/EORTC and the SOMA/LENT scoring system. Moreover, patients were classified as being a rectal bleeder or no rectal bleeder and a distinction was made between non-severe and severe (requiring one or more laser treatments) rectal bleeding. The median follow-up time was 22 months. It was investigated whether the relative and absolute rectal wall volumes, irradiated to various dose levels (≥ 60 Gy, ≥ 65 Gy, ≥ 70 Gy and ≥ 75 Gy) were correlated with the observed actuarial incidences of GI complications. First, the analysis was performed using volume as a continuous variable. Subsequently, for each dose level in the DVH the rectal wall volumes were dichotomized using different volumes as cut-off levels. Twenty cut-off levels were tested on their ability to discriminate between high and low risk for developing GI complications (Fig.). The relationship between bladder wall volumes irradiated to various dose levels and observed actuarial GU complications was investigated using the absolute bladder wall volumes, measured as a continuous variable. For both GI and GU complications, the role of the prescribed radiation dose and the maximum radiation dose in the rectal and bladder wall was analyzed as well. Results: None of the DVH parameters of the rectal wall was significantly correlated with the actuarial incidences of

  5. Cardiac Toxicity After Radiotherapy for Stage III Non–Small-Cell Lung Cancer: Pooled Analysis of Dose-Escalation Trials Delivering 70 to 90 Gy

    Science.gov (United States)

    Eblan, Michael J.; Deal, Allison M.; Lipner, Matthew; Zagar, Timothy M.; Wang, Yue; Mavroidis, Panayiotis; Lee, Carrie B.; Jensen, Brian C.; Rosenman, Julian G.; Socinski, Mark A.; Stinchcombe, Thomas E.; Marks, Lawrence B.

    2017-01-01

    Purpose The significance of radiotherapy (RT) –associated cardiac injury for stage III non–small-cell lung cancer (NSCLC) is unclear, but higher heart doses were associated with worse overall survival in the Radiation Therapy Oncology Group (RTOG) 0617 study. We assessed the impact of heart dose in patients treated at our institution on several prospective dose-escalation trials. Patients and Methods From 1996 to 2009, 127 patients with stage III NSCLC (Eastern Cooperative Oncology Group performance status, 0 to 1) received dose-escalated RT to 70 to 90 Gy (median, 74 Gy) in six trials. RT plans and cardiac doses were reviewed. Records were reviewed for the primary end point: symptomatic cardiac events (symptomatic pericardial effusion, acute coronary syndrome, pericarditis, significant arrhythmia, and heart failure). Cardiac risk was assessed by noting baseline coronary artery disease and calculating the WHO/International Society of Hypertension score. Competing risks analysis was used. Results In all, 112 patients were analyzed. Median follow-up for surviving patients was 8.8 years. Twenty-six patients (23%) had one or more events at a median of 26 months to first event (effusion [n = 7], myocardial infarction [n = 5], unstable angina [n = 3], pericarditis [n = 2], arrhythmia [n = 12], and heart failure [n = 1]). Heart doses (eg, heart mean dose; hazard ratio, 1.03/Gy; P = .002,), coronary artery disease (P < .001), and WHO/International Society of Hypertension score (P = .04) were associated with events on univariable analysis. Heart doses remained significant on multivariable analysis that accounted for baseline risk. Two-year competing risk–adjusted event rates for patients with heart mean dose < 10 Gy, 10 to 20 Gy, or ≥ 20 Gy were 4%, 7%, and 21%, respectively. Heart doses were not associated with overall survival. Conclusion Cardiac events were relatively common after high-dose thoracic RT and were independently associated with both heart dose and

  6. Hematological toxicity in radioimmunotherapy is predicted both by the computed absorbed whole body dose (cGy) and by the administered dose (mCi)

    International Nuclear Information System (INIS)

    Marquez, Sheri D.; Knox, Susan J.; Trisler, Kirk D.; Goris, Michael L.

    1997-01-01

    Purpose/Objective: Radioimmunotherapy (RIT) has yielded encouraging response rates in patients with recurrent non-Hodgkin's lymphoma, but myelotoxicity remains the dose limiting factor. Dose optimization is theoretically possible, since a pretreatment biodistribution study with tracer doses allows for a fairly accurate estimate of the whole body (and by implication the bone marrow) dose in patients. It has been shown that the radiation dose as a function of the administered dose varies widely from patient to patient. The pretreatment study could therefore be used to determine the maximum tolerable dose for each individual patient. The purpose of this study was to examine whether the administered dose or the estimated whole body absorbed radiation dose were indeed predictors of bone marrow toxicity. Materials and Methods: We studied two cohorts of patients to determine if the computed integral whole body or marrow dose is predictive of myelotoxicity. The first cohort consisted of 13 patients treated with Yttrium-90 labeled anti-CD20 (2B8) monoclonal antibody. Those patients were treated in a dose escalation protocol, based on the administered dose, without correction for weight or body surface. The computed whole body dose varied from 41 to 129 cGy. The second cohort (6 patients) were treated with Iodine-131 labeled anti-CD20 (B1) antibody. In this group the administered dose was tailored to deliver an estimated 75 cGy whole body dose. The administered dose varied from 54 to 84 mCi of Iodine-131. For each patient, white blood cell count with differential, hemoglobin, hematocrit, and platelet levels were measured before and at regular intervals after RIT was administered. Using linear regression analysis, a relationship between administered dose, absorbed dose and myelotoxicity was determined for each patient cohort. Results: Marrow toxicity was measured by the absolute decrease in white blood cell (DWBC), platelet (DPLAT), and neutrophil (DN) values. In the Yttrium

  7. Field evaluations of the VDmax approach for substantiation of a 25 kGy sterilization dose and its application to other preselected doses

    International Nuclear Information System (INIS)

    Kowalski, John B.; Herring, Craig; Baryschpolec, Lisa; Reger, John; Patel, Jay; Feeney, Mary; Tallentire, Alan

    2002-01-01

    The International and European standards for radiation sterilization require evidence of the effectiveness of a minimum sterilization dose of 25 kGy but do not provide detailed guidance on how this evidence can be generated. An approach, designated VD max , has recently been described and computer evaluated to provide safe and unambiguous substantiation of a 25 kGy sterilization dose. The approach has been further developed into a practical method, which has been subjected to field evaluations at three manufacturing facilities which produce different types of medical devices. The three facilities each used a different overall evaluation strategy: Facility A used VD max for quarterly dose audits; Facility B compared VD max and Method 1 in side-by-side parallel experiments; and Facility C, a new facility at start-up, used VD max for initial substantiation of 25 kGy and subsequent quarterly dose audits. A common element at all three facilities was the use of 10 product units for irradiation in the verification dose experiment. The field evaluations of the VD max method were successful at all three facilities; they included many different types of medical devices/product families with a wide range of average bioburden and sample item portion values used in the verification dose experiments. Overall, around 500 verification dose experiments were performed and no failures were observed. In the side-by-side parallel experiments, the outcomes of the VD max experiments were consistent with the outcomes observed with Method 1. The VD max approach has been extended to sterilization doses >25 and max method for doses other than 25 kGy must await controlled field evaluations and the development of appropriate specifications/standards

  8. Use of the gamma radiation, in a dose of 0,4 kGy, on the storage temperature reduction of the banana nanica

    International Nuclear Information System (INIS)

    Manoel, Luciana; Vieites, Rogerio Lopes

    2009-01-01

    The aim was to evaluate the use of gamma radiation, in a dose of 0,4 kGy, on the storage temperature reduction of the banana 'Nanica'. The bananas 'Nanica' were harvested in the Arm Taperao, Brotas (SP) town, and sent to CBE (Companhia Brasileira de Esterilizacao-Cotia-SP) for irradiation and constitution of the following treatments: T1 (fruits irradiated at 0,4 kGy and stored at 16 ±1 deg C); T2 (fruits irradiated at 0,4 kGy and stored at 14 ±1 deg C); T3 (fruit irradiated ata 0,4 kGy and stored at 12±1 deg C); T4 (fruits non-irradiated and stored at 16±1 deg C); T5 (fruits non-irradiated and stored at 14±1 deg C) and T6 (fruits non-irradiated and stored at 12±1 deg C). The fruits were stored in B.O.Ds. of the Agroindustrial Management and Technology Department, with a relative humidity of 80±5%. The experiment was divided in two groups: control group (post harvest conservation and disease incidence) and parcel group (soluble solids and pulp/peel). The analyses were performed in intervals of five days during a period of 25 days. The experimental design employed was completely randomized (DIC) by applying a factor of 2 x 3 x 6 (irradiation x temperature x time). The Tukey test with 5% of probability was used for comparison between means. The storage temperature of the bananas 'Nanica' was not reduce by irradiation. (author)

  9. Clinical outcomes of a phase I/II study of 48 Gy of stereotactic body radiotherapy in 4 fractions for primary lung cancer using a stereotactic body frame

    International Nuclear Information System (INIS)

    Nagata, Yasushi; Takayama, Kenji; Matsuo, Yukinori; Norihisa, Yoshiki; Mizowaki, Takashi; Sakamoto, Takashi; Sakamoto, Masato; Mitsumori, Michihide; Shibuya, Keiko; Araki, Norio; Yano, Shinsuke; Hiraoka, Masahiro

    2005-01-01

    Purpose: To evaluate the clinical outcomes of 48 Gy of three-dimensional stereotactic radiotherapy in four fractions for treating Stage I lung cancer using a stereotactic body frame. Methods and Materials: Forty-five patients who were treated between September 1998 and February 2004 were included in this study. Thirty-two patients had Stage IA lung cancer, and the other 13 had Stage IB lung cancer where tumor size was less than 4 cm in diameter. Three-dimensional treatment planning using 6-10 noncoplanar beams was performed to maintain the target dose homogeneity and to decrease the irradiated lung volume >20 Gy. All patients were irradiated using a stereotactic body frame and received four single 12 Gy high doses of radiation at the isocenter over 5-13 (median = 12) days. Results: Seven tumors (16%) completely disappeared after treatment (CR) and 38 tumors (84%) decreased in size by 30% or more (PR). Therefore, all tumors showed local response. During the follow-up of 6-71 (median = 30) months, no pulmonary complications greater than an National Cancer Institute-Common Toxicity Criteria of Grade 3 were noted. No other vascular, cardiac, esophageal, or neurologic toxicities were encountered. Forty-four (98%) of 45 tumors were locally controlled during the follow-up period. However, regional recurrences and distant metastases occurred in 3 and 5 of T1 patients and zero and 4 of T2 patients, respectively. For Stage IA lung cancer, the disease-free survival and overall survival rates after 1 and 3 years were 80% and 72%, and 92% and 83%, respectively, whereas for Stage IB lung cancer, the disease-free survival and overall survival rates were 92% and 71%, and 82% and 72%, respectively. Conclusion: Forty-eight Gy of 3D stereotactic radiotherapy in 4 fractions using a stereotactic body frame is useful for the treatment of Stage I lung tumors

  10. Stereotactic hypofractionated accurate radiotherapy of the prostate (SHARP), 33.5 Gy in five fractions for localized disease: First clinical trial results

    International Nuclear Information System (INIS)

    Madsen, Berit L.; Hsi, R. Alex; Pham, Huong T.; Fowler, Jack F.; Esagui, Laura C.; Corman, John

    2007-01-01

    Purpose: To evaluate the feasibility and toxicity of stereotactic hypofractionated accurate radiotherapy (SHARP) for localized prostate cancer. Methods and Materials: A Phase I/II trial of SHARP performed for localized prostate cancer using 33.5 Gy in 5 fractions, calculated to be biologically equivalent to 78 Gy in 2 Gy fractions (α/β ratio of 1.5 Gy). Noncoplanar conformal fields and daily stereotactic localization of implanted fiducials were used for treatment. Genitourinary (GU) and gastrointestinal (GI) toxicity were evaluated by American Urologic Association (AUA) score and Common Toxicity Criteria (CTC). Prostate-specific antigen (PSA) values and self-reported sexual function were recorded at specified follow-up intervals. Results: The study includes 40 patients. The median follow-up is 41 months (range, 21-60 months). Acute toxicity Grade 1-2 was 48.5% (GU) and 39% (GI); 1 acute Grade 3 GU toxicity. Late Grade 1-2 toxicity was 45% (GU) and 37% (GI). No late Grade 3 or higher toxicity was reported. Twenty-six patients reported potency before therapy; 6 (23%) have developed impotence. Median time to PSA nadir was 18 months with the majority of nadirs less than 1.0 ng/mL. The actuarial 48-month biochemical freedom from relapse is 70% for the American Society for Therapeutic Radiology and Oncology definition and 90% by the alternative nadir + 2 ng/mL failure definition. Conclusions: SHARP for localized prostate cancer is feasible with minimal acute or late toxicity. Dose escalation should be possible

  11. Early FDG PET at 10 or 20 Gy under chemoradiotherapy is prognostic for locoregional control and overall survival in patients with head and neck cancer

    International Nuclear Information System (INIS)

    Hentschel, Maria; Appold, Steffen; Baumann, Michael; Schreiber, Andreas; Abolmaali, Nasreddin; Abramyuk, Andrij; Doerr, Wolfgang; Kotzerke, Joerg; Zoephel, Klaus

    2011-01-01

    Our study aimed to explore the optimal timing as well as the most appropriate prognostic parameter of 18 F-fluorodeoxyglucose positron emission tomography (FDG PET) during chemoradiotherapy (CRT) for an early prediction of outcome for patients with head and neck squamous cell carcinoma (HNSCC). Serial PET data (before and three times during CRT) of 37 patients with advanced stage HNSCC, receiving combined CRT between 2005 and 2009, were evaluated. The maximum standardized uptake value (SUV max ), the average SUV (SUV mean ) and the gross tumour volume determined by FDG PET (GTV PET), based on a source to background algorithm, were analysed. Stratified actuarial analysis was performed for overall survival (OS), disease-free survival (DFS) and locoregional control (LRC). The median follow-up time was 26 months (range 8-50). For all patients, OS was 51%, DFS 44% and LRC 55% after 2 years. The 2-year OS (88%) and 2-year LRC (88%) were higher for patients whose SUV max of the primary tumour decreased 50% or more from the beginning (0 Gy) to week 1 or 2 (10 or 20 Gy) of CRT (ΔSUV max10/20 ≥ 50%) than for patients with ΔSUV max20 max from before (0 Gy) to week 1 or 2 (10 or 20 Gy) of CRT is a potential prognostic marker for patients with HNSCC. Because GTV PET depends on the applied method of analysis, we suggest the use of SUV max , especially ΔSUV max10/20 , for an early estimation of therapy outcome. Confirmatory studies are warranted. (orig.)

  12. Late morbidity profiles in prostate cancer patients treated to 79-84 Gy by a simple four-field coplanar beam arrangement

    International Nuclear Information System (INIS)

    Chism, Derek B.; Horwitz, Eric M.; Hanlon, Alexandra L.; Pinover, Wayne H.; Mitra, Raj K.; Hanks, Gerald E.

    2003-01-01

    Purpose: To describe the frequency and magnitude of late GI and GU morbidity in prostate cancer patients treated to high dose levels with a simple three-dimensional conformal technique. Methods and Materials: A total of 156 intermediate- and high-risk patients were treated between January 1, 1992 and February 28, 1999 with a simple four-field three-dimensional conformal technique to 79-84 Gy. All patients were treated with a four-field conformal technique; the prostate received 82 Gy and the seminal vesicles and periprostatic tissue 46 Gy. GI and GU toxicity was scored according to the Radiation Therapy Oncology Group/European Organization for Research and Treatment of Cancer Late Morbidity Grading Scale and compared using Kaplan-Meier estimates. Results: The late Grade 2 GI complication rate was 9% and 38% at 3 years for patients treated with and without rectal blocking, respectively (p=0.0004). No Grade 3 late GI complications developed. The rate of Grade 2 late GU complications was 5%, 8%, and 12% at 12, 24, and 36 months, respectively. The Grade 3 late GU complication rate was 2% at 36 months. These differences were not statistically significant. Conclusion: The treatment method described is a simple four-field conformal technique that can be easily implemented in the general radiation community. A dose of 79-84 Gy can be safely delivered to the prostate, with a 9% rate of late Grade 2 GI, 12% rate of late Grade 2 GU, and 2% rate of late Grade 3 GU complications

  13. Low Dose Radiation Response Curves, Networks and Pathways in Human Lymphoblastoid Cells Exposed from 1 to 10 cGy of Acute Gamma Radiation

    Energy Technology Data Exchange (ETDEWEB)

    Wyrobek, A. J.; Manohar, C. F.; Nelson, D. O.; Furtado, M. R.; Bhattacharya, M. S.; Marchetti, F.; Coleman, M.A.

    2011-04-18

    We investigated the low dose dependency of the transcriptional response of human cells to characterize the shape and biological functions associated with the dose response curve and to identify common and conserved functions of low dose expressed genes across cells and tissues. Human lymphoblastoid (HL) cells from two unrelated individuals were exposed to graded doses of radiation spanning the range of 1-10 cGy were analyzed by transcriptome profiling, qPCR and bioinformatics, in comparison to sham irradiated samples. A set of {approx}80 genes showed consistent responses in both cell lines; these genes were associated with homeostasis mechanisms (e.g., membrane signaling, molecule transport), subcellular locations (e.g., Golgi, and endoplasmic reticulum), and involved diverse signal transduction pathways. The majority of radiation-modulated genes had plateau-like responses across 1-10 cGy, some with suggestive evidence that transcription was modulated at doses below 1 cGy. MYC, FOS and TP53 were the major network nodes of the low-dose response in HL cells. Comparison our low dose expression findings in HL cells with those of prior studies in mouse brain after whole body exposure, in human keratinocyte cultures, and in endothelial cells cultures, indicates that certain components of the low dose radiation response are broadly conserved across cell types and tissues, independent of proliferation status.

  14. Effects of 200 Gy 60Co-γ Radiation on the Regulation of Antioxidant Enzymes, Hsp70 Genes, and Serum Molecules of Plutella xylostella (Linnaeus).

    Science.gov (United States)

    Li, Xiaoxue; Luo, Lingyan; Karthi, Sengodan; Zhang, Ke; Luo, Jianjun; Hu, Qiongbo; Weng, Qunfang

    2018-04-26

    The diamondback moth, Plutella xylostella (Linnaeus), is one of the notorious pests causing substantial loses to many cruciferous vegetables across the nations. The effects of 60 Co-γ radiation on physiology of P. xylostella were investigated and the results displayed that 200 Gy irradiation significantly alters the antioxidant enzyme regulation in six-day-old male pupae of P. xylostella . First, in our research, we detected Oxidase system and stress response mechanism of irradiated pupae, the results displayed that 200 Gy irradiation significantly alters the antioxidant enzyme regulation in six-day-old male pupae of P. xylostella . The levels of superoxide dismutase (SOD) and catalase (CAT) were increased significantly in contrast the level of peroxidase (POD) and glutathione S-transferase (GST) were decreased in 12⁻24 h post-treatment. The heat shock proteins (Hsps) gene expression level was significant increasing, maximum > 2-folds upregulation of genes were observed in peak. However, they also had a trend of gradual recovery with development. Second, we detected the testis lactate dehydrogenase (LDH) and acid phosphatase (ACP) activity found that in male adults testis they increased significantly than control during its development. Thus the present research investigation highlights that the 60 Co-γ radiation treatments alters the physiological development of diamondback moth. The results showed that 200 Gy dosage resulted in stress damage to the body and reproductive system of the diamondback moth.

  15. Effects of 200 Gy 60Co-γ Radiation on the Regulation of Antioxidant Enzymes, Hsp70 Genes, and Serum Molecules of Plutella xylostella (Linnaeus

    Directory of Open Access Journals (Sweden)

    Xiaoxue Li

    2018-04-01

    Full Text Available The diamondback moth, Plutella xylostella (Linnaeus, is one of the notorious pests causing substantial loses to many cruciferous vegetables across the nations. The effects of 60Co-γ radiation on physiology of P. xylostella were investigated and the results displayed that 200 Gy irradiation significantly alters the antioxidant enzyme regulation in six-day-old male pupae of P. xylostella. First, in our research, we detected Oxidase system and stress response mechanism of irradiated pupae, the results displayed that 200 Gy irradiation significantly alters the antioxidant enzyme regulation in six-day-old male pupae of P. xylostella. The levels of superoxide dismutase (SOD and catalase (CAT were increased significantly in contrast the level of peroxidase (POD and glutathione S-transferase (GST were decreased in 12–24 h post-treatment. The heat shock proteins (Hsps gene expression level was significant increasing, maximum > 2-folds upregulation of genes were observed in peak. However, they also had a trend of gradual recovery with development. Second, we detected the testis lactate dehydrogenase (LDH and acid phosphatase (ACP activity found that in male adults testis they increased significantly than control during its development. Thus the present research investigation highlights that the 60Co-γ radiation treatments alters the physiological development of diamondback moth. The results showed that 200 Gy dosage resulted in stress damage to the body and reproductive system of the diamondback moth.

  16. Differential effects of 18- and 24-Gy cranial irradiation on growth rate and growth hormone release in children with prolonged survival after acute lymphocytic leukemia

    International Nuclear Information System (INIS)

    Cicognani, A.; Cacciari, E.; Vecchi, V.; Cau, M.; Balsamo, A.; Pirazzoli, P.; Tosi, M.T.; Rosito, P.; Paolucci, G.

    1988-01-01

    To evaluate the effects of two different doses of cranial irradiation on growth and growth hormone (GH) release, we studied 61 children with acute lymphocytic leukemia who had survived at least five years in continuous complete remission. Forty-three children received 24 Gy (group 1) and 18 children received 18 Gy (group 2). Height was evaluated at diagnosis, at the end of treatment, and 6, 12, and 24 months later. Growth hormone release was evaluated by arginine and levodopa tests after the end of treatment. After diagnosis, the height SD score decreased significantly in both groups; two years after the end of treatment, only group 1 showed an SD score for height that was still significantly lower than at diagnosis. Group 1 showed impaired GH responses to the tests and, compared with controls, group 1 in fact included a percentage of subjects with a normal response to levodopa (ie, greater than 8 micrograms/L) that was significantly lower (56.4% vs 83.3%) and a percentage of nonresponders to both tests that was significantly higher (21.6% vs 0%). These data indicate that only patients treated with lower cranial irradiation dosage (18 Gy) had complete growth recovery and normal GH responses to pharmacologic tests

  17. Clinical outcome of stereotactic body radiotherapy of 54 Gy in nine fractions for patients with localized lung tumor using a custom-made immobilization system

    International Nuclear Information System (INIS)

    Aoki, Masahiko; Abe, Yoshinao; Kondo, Hidehiro

    2007-01-01

    The aim of this study was to investigate the clinical outcome of stereotactic body radiotherapy (SBRT) of 54 Gy in nine fractions for patients with localized lung tumor using a custom-made immobilization system. The subjects were 19 patients who had localized lung tumor (11 primaries, 8 metastases) between May 2003 and October 2005. Treatment was conducted on 19 lung tumors by fixed multiple noncoplanar conformal beams with a standard linear accelerator. The isocentric dose was 54 Gy in nine fractions. The median overall treatment time was 15 days (range 11-22 days). All patients were immobilized by a thermo-shell and a custom-made headrest during the treatment. The crude local tumor control rate was 95% during the follow-up of 9.4-39.5 (median 17.7) months. In-field recurrence was noted in only one patient at the last follow-up. The Kaplan-Meier overall survival rate at 2 years was 89.5%. Grade 1 radiation pneumonia and grade 1 radiation fibrosis were observed in 12 of the 19 patients. Treatment-related severe early and late complications were not observed in this series. The stereotactic body radiotherapy of 54 Gy in nine fractions achieved acceptable tumor control without any severe complications. The results suggest that SBRT can be one of the alternatives for patients with localized lung tumors. (author)

  18. High-dose irradiation: Wholesomeness of food irradiated with doses above 10 kGy. Report of a joint FAO/IAEA/WHO study group

    International Nuclear Information System (INIS)

    1999-01-01

    This report presents the recommendations of an international group of experts convened by the World Health Organization, in association with the Food and Agriculture Organization of the United Nations and the International Atomic Energy Agency, to consider the implications of food irradiated to doses higher than those recommended in 1980 by the Joint Expert Committee on the Wholesomeness of Irradiated Food. Irradiation ensures the hygienic quality of food and extends shelf-life. The public perception of the safety of food irradiation has generally precluded its widespread use. However, current applications of food irradiation to doses over 10 kGy have been in the development of high-quality shelf-stable convenience foods for specific target groups such as immunosuppressed individuals and those under medical care, astronauts and outdoor enthusiasts. The Study Group reviewed data relating to the toxicological, nutritional, radiation chemical and physical aspects of food irradiated to doses above 10kGy from a wide range and number of studies carried out over the last forty years. This report presents a comprehensive summary, along with references, of the effectiveness and safety of the irradiation process. It concludes that foods treated with doses greater than 10kGy can be considered safe and nutritionally adequate when produced under established Good Manufacturing Practice

  19. An elective radiation dose of 46 Gy is feasible in nasopharyngeal carcinoma treated by intensity-modulated radiotherapy: A long-term follow-up result.

    Science.gov (United States)

    Hung, Tsung-Min; Fan, Kang-Hsing; Chen, Eric Yen-Chao; Lin, Chien-Yu; Kang, Chung-Jan; Huang, Shiang-Fu; Liao, Chun-Ta; Ng, Shu-Hang; Wang, Hung-Ming; Chang, Joseph Tung-Chieh

    2017-02-01

    The purpose of this study is to compare the treatment outcome of different radiation doses of elective neck irradiation (ENI) in nasopharyngeal carcinoma (NPC) patients treated with intensity-modulated radiotherapy (IMRT).In total, 504 patients with nondisseminated NPC who underwent magnetic resonance imaging before radical IMRT between 2000 and 2008 were retrospectively reviewed. The patients were classified into 2 groups based on the ENI dose: low ENI when the ENI dose was 46 Gy (n = 446) and high ENI when the ENI doses were 50 to 60 Gy (n = 58). All the patients in both the groups received a median dose of 72 Gy to the gross tumor and involved nodes. The fraction size was 2 Gy per fraction. Matching was performed between low ENI and high ENI in a 2:1 ratio, and the matching criteria were N-stage, T-stage, treatment modality, pathology classification, sex, and age.The median follow-up for all patients was 63.5 months. In all patients, the 5-year progression-free survival (PFS), local control (LC), regional control (RC), distant metastasis-free survival (DMFS), overall survival (OS), and cancer-specific survival (CSS) for low ENI and high ENI patients were 69.0% and 63.2% (P = 0.331), 89.0% and 83.9% (P = 0.235), 90.1% and 85.2% (P = 0.246), 86.8% and 76.6% (P = 0.056), 77.5% and 80.8% (P = 0.926), and 84.4% and 82.5% (P = 0.237), respectively. In the matched-pair analysis, the 5-year PFS, LC, RC, DMFS, OS, and CSS for matched low ENI and high ENI patients were 74.1% and 63.2% (P = 0.134), 92.0% and 83.9% (P = 0.152), 90.1% and 85.2% (P = 0.356), 86.2% and 76.6% (P = 0.125), 87.0% and 80.8% (P = 0.102), and 88.6% and 82.5% (P = 0.080), respectively. In the multivariable analysis for all patients, the ENI group was not a significant factor for PFS, LC, RC, DMFS, OS, and CSS.A low ENI dose of 46 Gy in 23 fractions is feasible in NPC patients treated with IMRT, and this concept should be validated in the

  20. Estimation of the incidence of late bladder and rectum complications after high-dose (70-78 Gy) conformal radiotherapy for prostate cancer, using dose-volume histograms

    International Nuclear Information System (INIS)

    Boersma, Liesbeth J.; Brink, Mandy van den; Bruce, Allison M.; Shouman, Tarek; Gras, Luuk; Velde, Annet te; Lebesque, Joos V.

    1998-01-01

    Purpose: To investigate whether Dose-Volume Histogram (DVH) parameters can be used to identify risk groups for developing late gastrointestinal (GI) and genitourinary (GU) complications after conformal radiotherapy for prostate cancer. Methods and Materials: DVH parameters were analyzed for 130 patients with localized prostate cancer, treated with conformal radiotherapy in a dose-escalating protocol (70-78 Gy, 2 Gy per fraction). The incidence of late (>6 months) GI and GU complications was classified using the RTOG/EORTC and the SOMA/LENT scoring system. In addition, GI complications were divided in nonsevere and severe (requiring one or more laser treatments or blood transfusions) rectal bleeding. The median follow-up time was 24 months. We investigated whether rectal and bladder wall volumes, irradiated to various dose levels, correlated with the observed actuarial incidences of GI and GU complications, using volume as a continuous variable. Subsequently, for each dose level in the DVH, the rectal wall volumes were dichotomized using different volumes as cutoff levels. The impact of the total radiation dose, and the maximum radiation dose in the rectal and bladder wall was analyzed as well. Results: The actuarial incidence at 2 years for GI complications ≥Grade II was 14% (RTOG/EORTC) or 20% (SOMA/LENT); for GU complications ≥Grade III 8% (RTOG/EORTC) or 21% (SOMA/LENT). Neither for GI complications ≥Grade II (RTOG/EORTC or SOMA/LENT), nor for GU complications ≥Grade III (RTOG/EORTC or SOMA/LENT), was a significant correlation found between any of the DVH parameters and the actuarial incidence of complications. For severe rectal bleeding (actuarial incidence at 2 years 3%), four consecutive volume cutoff levels were found, which significantly discriminated between high and low risk. A trend was observed that a total radiation dose ≥ 74 Gy (or a maximum radiation dose in the rectal wall >75 Gy) resulted in a higher incidence of severe rectal bleeding (p

  1. Comparison of 36 Gy, 20 Gy, or No Radiation Therapy After 6 Cycles of EBVP Chemotherapy and Complete Remission in Early-Stage Hodgkin Lymphoma Without Risk Factors: Results of the EORT-GELA H9-F Intergroup Randomized Trial.

    Science.gov (United States)

    Thomas, José; Fermé, Christophe; Noordijk, Evert M; Morschhauser, Franck; Girinsky, Théodore; Gaillard, Isabelle; Lugtenburg, Pieternella J; André, Marc; Lybeert, Marnix L M; Stamatoullas, Aspasia; Beijert, Max; Hélias, Philippe; Eghbali, Houchingue; Gabarre, Jean; van der Maazen, Richard W M; Jaubert, Jérôme; Bouabdallah, Krimo; Boulat, Olivier; Roesink, Judith M; Christian, Bernard; Ong, Francisca; Bordessoule, Dominique; Tertian, Gérard; Gonzalez, Hugo; Vranovsky, Andrej; Quittet, Philippe; Tirelli, Umberto; de Jong, Daphne; Audouin, Josée; Aleman, Berthe M P; Henry-Amar, Michel

    2018-04-01

    While patients with early-stage Hodgkin lymphoma (HL) have an excellent outcome with combined treatment, the radiation therapy (RT) dose and treatment with chemotherapy alone remain questionable. This noninferiority trial evaluates the feasibility of reducing the dose or omitting RT after chemotherapy. Patients with untreated supradiaphragmatic HL without risk factors (age ≥ 50 years, 4 to 5 nodal areas involved, mediastinum-thoracic ratio ≥ 0.35, and erythrocyte sedimentation rate ≥ 50 mm in first hour without B symptoms or erythrocyte sedimentation rate ≥ 30 mm in first hour with B symptoms) were eligible for the trial. Patients in complete remission after chemotherapy were randomized to no RT, low-dose RT (20 Gy in 10 fractions), or standard-dose involved-field RT (36 Gy in 18 fractions). The limit of noninferiority was 10% for the difference between 5-year relapse-free survival (RFS) estimates. From September 1998 to May 2004, 783 patients received 6 cycles of epirubicin, bleomycin, vinblastine, and prednisone; 592 achieved complete remission or unconfirmed complete remission, of whom 578 were randomized to receive 36 Gy (n=239), 20 Gy of involved-field RT (n=209), or no RT (n=130). Randomization to the no-RT arm was prematurely stopped (≥20% rate of inacceptable events: toxicity, treatment modification, early relapse, or death). Results in the 20-Gy arm (5-year RFS, 84.2%) were not inferior to those in the 36-Gy arm (5-year RFS, 88.6%) (difference, 4.4%; 90% confidence interval [CI] -1.2% to 9.9%). A difference of 16.5% (90% CI 8.0%-25.0%) in 5-year RFS estimates was observed between the no-RT arm (69.8%) and the 36-Gy arm (86.3%); the hazard ratio was 2.55 (95% CI 1.44-4.53; P<.001). The 5-year overall survival estimates ranged from 97% to 99%. In adult patients with early-stage HL without risk factors in complete remission after epirubicin, bleomycin, vinblastine, and prednisone chemotherapy, the RT dose may be limited to 20 Gy

  2. Definitive radiotherapy alone over 60 Gy for patients unfit for combined treatment to stage II-III non-small cell lung cancer: retrospective analysis

    International Nuclear Information System (INIS)

    Joo, Ji Hyeon; Song, Si Yeol; Kim, Su Ssan; Jeong, Yuri; Jeong, Seong-Yun; Choi, Wonsik; Choi, Eun Kyung

    2015-01-01

    Elderly patients with non-small cell lung cancer (NSCLC) are frequently treated with radiation therapy (RT) alone, due to poor performance status or underlying disease. We investigated the effectiveness of RT over 60 Gy administered alone to NSCLC patients who were unfit or rejecting for combination treatment. From April 2002 to July 2010, 83 patients with stage II-III NSCLC, aged over 60 years, treated by RT alone with a curative aim were analyzed. Radiation was targeted to the primary tumor and clinically involved lymph nodes. A total dose of 66 Gy in 30 fractions (2.2 Gy/fraction) was delivered once daily (5 fractions weekly). One month after completing RT, initial tumor responses were evaluated. Median age of patients was 73 years (range, 60 – 82 years). The median survival time was 18.6 months (range, 2–135). The actuarial overall survival rates at 2 and 3 years were 39 % and 23 %, and cause-specific survival rate at 2 and 3 years were 57 % and 47 %, respectively. When primary tumor was controlled, the 2- and 3-year CSS were 56 % and 45 %, but 32 % and 23 % in those patients with local failure, respectively (P = 0.017). Additionally, the local control rate was associated with the initial tumor response (P = 0.01). No patient experienced grade 4+ toxicity. For stage II-III NSCLC patients aged over 60 years and unfit or rejecting for combination treatment, RT alone showed promising result. Long-term disease control can be expected if an early tumor response to radiation is achieved, which could result in improved overall survival rates

  3. Implant R100 Predicts Rectal Bleeding in Prostate Cancer Patients Treated with IG-IMRT to 45 Gy and Pd-103 Implant

    International Nuclear Information System (INIS)

    Packard, M.; Fuhrer, R.; Valakh, V.

    2014-01-01

    Purpose. To define factors associated with rectal bleeding in patients treated with IG-IMRT followed by Pd-103 seed implant. Methods and Materials. We retrospectively reviewed 61 prostate adenocarcinoma patients from 2002 to 2008. The majority (85.2%) were of NCCN intermediate risk category. All received IG-IMRT to the prostate and seminal vesicles followed by Pd-103 implant delivering a mean D90 of 100.7 Gy. Six patients received 45 Gy to the pelvic nodes and 10 received androgen deprivation. Results. Ten patients (16.4%) developed rectal bleeding: 4 were CTCAE v.3 grade 1, 5 were grade 2, and 1 was grade 3. By univariate analysis, age, stage, Gleason sum, PSA, hormonal therapy, pelvic radiation, postoperative prostate volume, D9, V100, individual source activity, total implanted activity per cm 3 , and duration of interval before implant did not impact rectal bleeding. Implant R100 was higher in patients with rectal bleeding: on average, 0.885 versus 0.396 cm 3 ,(Ρ =0.02) , odds ratio of 2.26 per .5 cm 3 (95% CI, 1.16–4.82). A trend for significance was seen for prostate V200 and total implanted activity. Conclusion. Higher implant R100 was associated with development of rectal bleeding in patients receiving IG-IMRT to 45 Gy followed by Pd-103 implant. Minimizing implant R100 may reduce the rate of rectal bleeding in similar patients.

  4. 2, 4 and 6 kGy effect on the microbiological characteristics of chicken hamburgers stored at 2{+-}2 {sup o}C; Efecto de 2, 4 y 6 kGy sobre las caracteristicas microbiologicas de hamburguesa de pollo almacenadas a 2{+-}2{sup o}C

    Energy Technology Data Exchange (ETDEWEB)

    Torres, Z [Instituto Peruano de Energia Nuclear, Lima (Peru); Basurto, H; Silva, M [Universidad Nacional Agraria La Molina, Lima (Peru)

    2001-01-01

    Decimal reduction dose (D{sub 10}) of S. typhimurium irradiated in Casoy broth (TSB) and inoculated in chicken burger was found to be 0,425 and 0,547 kGy respectively being the second value 22,3 % higher than the first one. Then, chicken burger previously radiosterilized at 15 kGy was inoculated with S. typhimurium, irradiated at 2, 4 and 6 kGy and kept under storage for 57 days at 2{+-} 2 {sup o}C and HR 90 5%. Another batch of chicken burger without radiosterilization was irradiated at 2, 4 and 6 kGy and stored under the same conditions than the previous one in order to study the natural bacterial flora. It was observed that there is a synergic effect between irradiation dose and time of storage ({alpha}=5%) in the counting of S. typhimurium. In unirradiated chicken burger, the number of total coliforms increased from 29 NMP/g at the beginning to 4250 NMP/g at day 22 and fecal coliforms from 4 to 240 NMP/g; subsequently the number of these bacteria dropped again at the end of the storage time, while in irradiated samples no coliforms were found. Mesophilic and psychrotrophic bacteria diminished its ability of growing up and making colonies, proportionally to the applied irradiation doses. However, as the storage time advanced these bacteria recovered its ability to grow up and of cause spoilage. (authors)

  5. Weekly bi-fractionated 40 Gy three-dimensional conformational accelerated partial irradiation of breast: results of a phase II French pilot study

    International Nuclear Information System (INIS)

    Bourgier, C.; Pichenot, C.; Verstraet, R.; Heymann, S.; Biron, B.; Delaloge, S.; Garbay, J.R.; Marsiglia, H.; Bourhis, J.; Taghian, A.; Marsiglia, H.

    2010-01-01

    The authors report the first French experience of three-dimensional conformational and accelerated partial irradiation of breast. Twenty five patients have been concerned by this phase II trial. The prescribed total dose was 40 Gy, was delivered over 5 days in two daily fractions. Irradiation was performed with two 6 MV tangential mini-beams and a 6-22 MeV front electron beams. The planning target volume coverage was very good. Toxicity has been assessed. Healthy tissues (heart, lungs) are considerably protected. The acute and late toxicity is correct. Short communication

  6. Alanine-EPR dosimetry for measurements of ionizing radiation absorbed doses in the range 0.5-10 kGy

    CERN Document Server

    Peimel-Stuglik, Z

    2001-01-01

    The usefulness of two, easy accessible alanine dosimeters (ALANPOL from IChTJ and foil dosimeter from Gamma Service, Radeberg, Germany) to radiation dose measurement in the range of 0.5-10 kGy, were investigated. In both cases, the result of the test was positive. The foil dosemeter from Gamma Service is recommended for dose distribution measurements in fantoms or products, ALANPOL - for routine measurements. The EPR-alanine method based on the described dosimeters can be successfully used, among others, in the technology of radiation protection of food.

  7. Screening of radiation-induced genes in human lymphoblastoid cells irradiated with 20 cGy of γ-ray by gene chip

    International Nuclear Information System (INIS)

    Wang Huiping; Long Xianhui; Xu Qinzhi; Bai Bei; Sui Jianli; Zhou Pingkun

    2006-01-01

    cDNA gene chip was used to detect the transcriptional profile of human lymphoblasts cells irradiated with 20 cGy of 60 Co γ-ray. The microarray contains 14112 cDNA probing corresponding to 14112 human genes. The results showed that the transcription level of 83 genes changed; among which 21 genes were up-regulated. Most of them were associated with signal transduction, cell cycle regulation, cellular immunity, cytoskeleton and movement, etc. It indicated that low-dose irradiation can modulate the expression of a series of functional genes, which is the primary molecular basis of cellular responses to radiation. (authors)

  8. Early FDG PET at 10 or 20 Gy under chemoradiotherapy is prognostic for locoregional control and overall survival in patients with head and neck cancer

    Energy Technology Data Exchange (ETDEWEB)

    Hentschel, Maria [Medical Faculty and University Hospital Carl Gustav Carus, Dresden University of Technology, Clinic and Polyclinic of Nuclear Medicine, Dresden (Germany); Appold, Steffen; Baumann, Michael [Medical Faculty and University Hospital Carl Gustav Carus, Dresden University of Technology, Clinic and Polyclinic of Radiotherapy and Radiation Oncology, Dresden (Germany); Medical Faculty and University Hospital Carl Gustav Carus, Dresden University of Technology, OncoRay, National Center for Radiation Research in Oncology Dresden, Dresden (Germany); Schreiber, Andreas [Hospital Dresden-Friedrichstadt, Department of Radiotherapy, Dresden (Germany); Abolmaali, Nasreddin [Medical Faculty and University Hospital Carl Gustav Carus, Dresden University of Technology, OncoRay, National Center for Radiation Research in Oncology Dresden, Dresden (Germany); Medical Faculty and University Hospital Carl Gustav Carus, Dresden University of Technology, Institute and Polyclinic of Diagnostic Radiology, Dresden (Germany); Abramyuk, Andrij [Medical Faculty and University Hospital Carl Gustav Carus, Dresden University of Technology, OncoRay, National Center for Radiation Research in Oncology Dresden, Dresden (Germany); Doerr, Wolfgang [Medical Faculty and University Hospital Carl Gustav Carus, Dresden University of Technology, Clinic and Polyclinic of Radiotherapy and Radiation Oncology, Dresden (Germany); Kotzerke, Joerg; Zoephel, Klaus [Medical Faculty and University Hospital Carl Gustav Carus, Dresden University of Technology, Clinic and Polyclinic of Nuclear Medicine, Dresden (Germany); Medical Faculty and University Hospital Carl Gustav Carus, Dresden University of Technology, OncoRay, National Center for Radiation Research in Oncology Dresden, Dresden (Germany)

    2011-07-15

    Our study aimed to explore the optimal timing as well as the most appropriate prognostic parameter of {sup 18}F-fluorodeoxyglucose positron emission tomography (FDG PET) during chemoradiotherapy (CRT) for an early prediction of outcome for patients with head and neck squamous cell carcinoma (HNSCC). Serial PET data (before and three times during CRT) of 37 patients with advanced stage HNSCC, receiving combined CRT between 2005 and 2009, were evaluated. The maximum standardized uptake value (SUV{sub max}), the average SUV (SUV{sub mean}) and the gross tumour volume determined by FDG PET (GTV PET), based on a source to background algorithm, were analysed. Stratified actuarial analysis was performed for overall survival (OS), disease-free survival (DFS) and locoregional control (LRC). The median follow-up time was 26 months (range 8-50). For all patients, OS was 51%, DFS 44% and LRC 55% after 2 years. The 2-year OS (88%) and 2-year LRC (88%) were higher for patients whose SUV{sub max} of the primary tumour decreased 50% or more from the beginning (0 Gy) to week 1 or 2 (10 or 20 Gy) of CRT ({delta}SUV{sub max10/20} {>=} 50%) than for patients with {delta}SUV{sub max20} < 50% (2-year OS = 38%; p = 0.02; 2-year LRC 40%; p = 0.06). A pretreatment GTV PET below the median of 10.2 ml predicted a better 2-year OS (34% for GTV PET {>=} 10.2 ml vs 83% for GTV PET < 10.2 ml; p = 0.02). The decrease of SUV{sub max} from before (0 Gy) to week 1 or 2 (10 or 20 Gy) of CRT is a potential prognostic marker for patients with HNSCC. Because GTV PET depends on the applied method of analysis, we suggest the use of SUV{sub max}, especially {delta}SUV{sub max10/20}, for an early estimation of therapy outcome. Confirmatory studies are warranted. (orig.)

  9. Low-dose (10-Gy) total skin electron beam therapy for cutaneous T-cell lymphoma: an open clinical study and pooled data analysis.

    Science.gov (United States)

    Kamstrup, Maria R; Gniadecki, Robert; Iversen, Lars; Skov, Lone; Petersen, Peter Meidahl; Loft, Annika; Specht, Lena

    2015-05-01

    Cutaneous T-cell lymphomas (CTCLs) are dominated by mycosis fungoides (MF) and Sézary syndrome (SS), and durable disease control is a therapeutic challenge. Standard total skin electron beam therapy (TSEBT) is an effective skin-directed therapy, but the possibility of retreatments is limited to 2 to 3 courses in a lifetime due to skin toxicity. This study aimed to determine the clinical effect of low-dose TSEBT in patients with MF and SS. In an open clinical study, 21 patients with MF/SS stages IB to IV were treated with low-dose TSEBT over dose of 10 Gy in 10 fractions. Data from 10 of these patients were published previously but were included in the current pooled data analysis. Outcome measures were response rate, duration of response, and toxicity. The overall response rate was 95% with a complete cutaneous response or a very good partial response rate (dose (10-Gy) TSEBT offers a high overall response rate and is relatively safe. With this approach, reirradiation at times of relapse or progression is likely to be less toxic than standard dose TSEBT. It remains to be established whether adjuvant and combination treatments can prolong the beneficial effects of low-dose TSEBT. Copyright © 2015 Elsevier Inc. All rights reserved.

  10. Thermoluminescence of Ge- and Al-doped SiO2 optical fibers subjected to 0.2-4.0 Gy external photon radiotherapeutic dose

    International Nuclear Information System (INIS)

    Hossain, I.; Wagiran, H.; Yaakob, N.H.

    2013-01-01

    In this work, we studied the thermoluminescence response of Ge- and Al-doped optical fibers, its linearity, energy dependence, and sensitivity. The Ge-doped optical fibers demonstrate useful TL properties and represent an excellent candidate for use in TL dosimetry of ionizing radiation. The TL response increases monotonically over a wide photon dose range, from 0.2 Gy to 4.0 Gy. The TL results for these fibers have been compared with similar TL data for phosphor TLD-100. Commercially available Al- and Ge-doped optical fibers have both been found to yield a linear dose-TL signal relationship, although the Al-doped fiber provides only 5 % of the sensitivity of the Ge-doped fibers. The TL characteristics of Ge-doped optical fiber, plus its small size (125 μm diameter), high flexibility, ease of handling, and low cost compared with other TL materials, make this commercial optical fiber a very promising TL material for use in medicine, industry, reactor operation, and a variety of other areas. (author)

  11. Thyroxine clearance in rats within the first month after the single whole-body {gamma} - irradiation at a dose of 10Gy

    Energy Technology Data Exchange (ETDEWEB)

    Pryadko, Kirill A. [Institute of Radiobiology, National Academy of Sciences, Minsk (Belarus)

    2002-07-01

    The effects of acute whole-body {gamma} -irradiation at a dose of 10 Gy on thyroxine (T{sub 4}) plasma clearance rate (PCR) and thyroidal and blood T4 concentration ([T{sub 4}]) were examined within one month after exposure. The PCR values were measured using the bolus injection, single-compartmental approach. To eliminate the influence of radiation-induced anorexia animals were fasting for two days before the pharmacokinetic experiments. Hormone concentrations in blood and in thyroid tissue were measured by RIA. Throughout the observation period, PCR was elevated in irradiated rats with maximum at day 4 after exposure (0.56{+-}0.04 vs. 0.36{+-}0.03 ml/h100 gbw, P<0.001). [T{sub 4}] in blood was not significantly different from that in control animals. Thyroidal [T{sub 4}] was significantly decreased in irradiated animals 4 days after exposure (151.8{+-}21.7 vs. 258.8{+-}29.9 pmol/mg protein, P<0.01) and gradually increased after day 9. 10 Gy {gamma} -irradiation causes the intensification of T{sub 4} metabolism without the pronounced changes in concentration. Presumably, at early terms the rising local demand in O{sub 4} can not be compensated with the existing level of production. Alterations in the intensity of T{sub 4} metabolism are evident at least one month after exposure but they may not be detected without taking into account kinetic data.

  12. SAFETY AND TOXICITY OF AN ACCELERATED COARSELY FRACTIONATED RADIATION PROTOCOL FOR TREATMENT OF APPENDICULAR OSTEOSARCOMA IN 14 DOGS: 10 GY × 2 FRACTIONS.

    Science.gov (United States)

    Pagano, Candace; Boudreaux, Bonnie; Shiomitsu, Keijiro

    2016-09-01

    Coarsely fractionated radiation is commonly used as a method for pain control in dogs with appendicular osteosarcoma, however there is little published information on optimal protocols. The aim of this retrospective, descriptive study was to report safety and toxicity findings in a sample of dogs with appendicular osteosarcoma that had been treated with a radiation scheme of 10 Gy delivered over two consecutive days for a total of 20 Gy. Dogs were included in the study if they had osteosarcoma that was treated with the aforementioned protocol. Dogs were excluded if treated with the same protocol for any other bone tumor besides osteosarcoma or inadequate follow-up. Thirteen of the 14 patients received adjuvant therapy with pamidronate and a nonsteroidal anti-inflammatory. Nine dogs received adjuvant chemotherapy with carboplatin after radiation was complete. Within a median of 14 days, 92.8% of dogs subjectively had improved pain control. Median duration of response (DOR) was 80 days (range 20-365). The majority of patients developed VRTOG grade one toxicity, primarily alopecia. Five dogs (35.7%) developed pathologic fracture postradiation treatment. Timing of fracture was variable ranging from 24 to 250 days. This radiation protocol was well tolerated, with minimal toxicity, subjectively improved survival time, and had the benefit of being completed in two consecutive days. © 2016 American College of Veterinary Radiology.

  13. Tachyzoites of Toxoplasma gondii irradiated with 255 Gy induces decrease of cysts and cerebral lesions in mice challenged with cysts of ME-49

    International Nuclear Information System (INIS)

    Hiramoto, Roberto Mitsuyoshi; Galisteo Juniorm Andres Jimenez; Nascimento, Nanci do; Andrade Junior, Heitor Franco de

    2002-01-01

    Toxoplasmosis can cause ocular lesions in normal individuals and several diseases in foetus, HIV infection and transplants. Toxoplasma gondii has a complex life cycle, involving cats, as the definitive host, and warm blood species, as intermediated hosts. The infection occurs by ingestion of food and water contaminated with infected cat faeces, contaminated milk and cheese or raw and undercook meat of the intermediated hosts. To date, there is no commercial vaccine of use in humans. In this work, tachyzoites of T. gondii RH strain were irradiated with 255 Gy and inoculated in C57Bl/6j mice (3 doses, biweekly), after mice were challenged with 1, 5, 10, 20 and 25 cysts of ME-49 by oral gavage. The lesions and cysts in the brain were analyzed in all mice, after 4-week post infection. The mortality was 20% in control mice (ME-49 cysts only) and not one in immunized mice. The number of cysts was high in the control group, but low in immunized 255 Gy mice (n<100). Immunized mice showed less cerebral pathology and necrosis foci. Ionizing radiation is an important tool in the study toxoplasmosis and vaccine development. (author)

  14. Study of L-aspartic acid for its possible use as a dosimeter in the interval of 3.4-20 kGy at different irradiation temperatures

    Science.gov (United States)

    Meléndez-López, Adriana; Negrón-Mendoza, Alicia; Gómez-Vidales, Virginia; Uribe, Roberto M.; Ramos-Bernal, Sergio

    2014-11-01

    Certain commercial applications of radiation processing increase the efficiency of chemical reactions at low temperatures to decrease the free radicals in the bulk material and avoid the synergistic effects of heat. Such applications have motivated the search for a reliable, low-temperature dosimeter for use under the conditions of the irradiation process. For this purpose, polycrystalline samples of L-aspartic acid (2-aminobutanedioic acid) were irradiated with gamma rays at low temperatures and doses in the kiloGray range (3.4-64 kGy). The potential use of the aspartic acid system as a chemical dosimeter is based on the formation of stable free radicals when the amino acid is exposed to ionizing radiation. These radicals can be studied and quantified using electron spin resonance (ESR). The response curves at different temperatures show that the intensity of the ESR spectra (the five characteristic lines) depends on the dose received. The response of the dosimeter increases with increasing temperature, and this relationship is linear up to 20 kGy at 298 K. The decay characteristics show that the change in the ESR signal over time is low and reproducible. In addition, the L-aspartic acid dosimeter is easy to handle and has low cost.

  15. Effect of low-dose (1 kGy) gamma radiation and selected phosphates on the microflora of vacuum-packaged ground pork

    International Nuclear Information System (INIS)

    Ehioba, R.M.

    1987-01-01

    The effects of low-dose (1 kGy) gamma radiation and selected phosphates on the microbiology of refrigerated, vacuum-packaged ground pork were studied. Low-dose gamma radiation reduced the numbers of naturally occurring mesophiles, psychrotrophs, and anaerobes. The effect of low-dose radiation on the populations of lactic acid bacteria was minimal. On storage of the irradiated vacuum-packaged ground pork at 5 0 C, there was a partial bacterial recovery, suggesting sublethal bacterial injury due to irradiation. When 10 7 CFU/g of meat is taken to be the level beyond which the meat would be considered spoiled, uninoculated, vacuum-packaged ground pork treated with 1 kGy (100 krad) of gamma radiation had 3.5 more days of shelf-life in terms of psychrotrophic total counts. In relation to anaerobic bacterial numbers, meat shelf-life was extended 2.5 days, while the shelf-life of meat was extended 1 day in terms of aerobic mesophilic bacteria. Irradiation prolonged shelf-life in inoculated (10 5 CFU/g) meat for 1.0-1.5 days. Addition of 0.4% sodium acid pyrophosphate (SAPP) contributed 2 additional days to inoculated, irradiated vacuum-packaged ground pork shelf-life. However, SAPP had no added effect on naturally occurring microflora. Irradiation greatly decreased the numbers of gram-negative microorganisms, resulting in predominance of the gram-positive, nonsporeforming Lactobacillus and coryneform bacteria

  16. Hypofractionated stereotactic photon radiotherapy of posteriorly located choroidal melanoma with five fractions at ten Gy – Clinical results after six years of experience

    International Nuclear Information System (INIS)

    Dunavoelgyi, Roman; Zehetmayer, Martin; Gleiss, Andreas; Geitzenauer, Wolfgang; Kircher, Karl; Georg, Dietmar; Schmidt-Erfurth, Ursula; Poetter, Richard; Dieckmann, Karin

    2013-01-01

    Purpose: To evaluate long-term safety and efficacy of hypofractionated stereotactic photon radiotherapy with 5 five fractions at 10 Gy each in patients with centrally located choroidal melanoma. Materials and Methods: Ninety-one patients with centrally located choroidal melanoma were treated stereotactically at a linear accelerator with 6 MV photon beams with 5 fractions at 10 Gy each. Examinations were performed at baseline and every 3 months in the first 2 years, then every 6 months until 5 years and yearly thereafter. Median follow-up was 37.8 months (IQR 19.2–49.9). They included visual acuity assessment, routine ophthalmological examinations with fundoscopy, echography for measurement of tumor dimensions, medical examinations and, if necessary, fluorescein angiography. Results: Initial tumor base diameters, height and volume were 11.20 mm (IQR 9.10–13.70), 9.80 mm (IQR 7.80–11.70), 4.53 mm (IQR 3.33–6.43) and 253.8 mm 3 (IQR 127.5–477.0). Local tumor control and eye retention rates were 97.7% and 86.4% after 5 years, respectively. Eight patients developed metastatic disease and 3 of them died due to metastatic disease during the follow-up period. Median visual acuity decreased from 0.67 initially to 0.05 at the last individual follow-up (p < 0.001). The most common toxicities (any grade) were radiation retinopathy (n = 39), optic neuropathy (n = 32), radiogenic cataract (n = 21), neovascular glaucoma (n = 15) and dry eye syndrome (n = 10). The 5 year probabilities to remain free of these side effects (any grade) were 26.0%, 45.4%, 55.4%, 72.6% and 80.5%, respectively. The most important prognostic factors for toxicities were the largest tumor base diameter, tumor height and tumor distance to the optic disk. Conclusion: Hypofractionated stereotactic photon radiotherapy with a total dose of 50 Gy delivered in 5 fractions is a highly effective treatment option in patients with centrally located choroidal melanoma and has a moderate toxicity profile

  17. Repeated 0.5 Gy gamma-ray irradiation attenuates autoimmune disease in MRL-lpr/lpr mice with up-regulation of regulatory T cells

    International Nuclear Information System (INIS)

    Mitsutoshi Tsukimoto; Fumitoshi Tago; Hiroko Nakatsukasa; Shuji Kojima

    2007-01-01

    Complete text of publication follows. MRL-lpr/lpr mice present a single gene mutation on the Fas (CD95) gene that leads to reduced signaling for apoptosis. With aging, these mice spontaneously develop autoimmune disease and are used as a model of systemic lupus erythematosus. We previously reported attenuation of autoimmune disease in MRL-lpr/lpr mice by repeated γ-ray irradiation (0.5 Gy each time). In this study, we investigated the mechanisms of this attenuation focusing the highly activated CD3 + CD4 - CD8 - B220 + T cells, which are characteristically involved in autoimmune pathology in these mice. We measured the weight of the spleen and the population of CD3 + CD4 - CD8 - B220 + T cells. Splenomegaly and increase in percentage of CD3 + CD4 - CD8 - B220 + T cells, which occur with aging in non-irradiated mice, were suppressed in irradiated mice. To investigate the function of CD3 + CD4 - CD8 - B220 + T cells, we isolated these cells from splenocytes by magnetic cell sorting. Isolated CD3 + CD4 - CD8 - B220 + T cells were more resistant to irradiation-induced cell death than isolated CD4 + T cells. Although high proliferation rate and IL-6 production were observed in isolated CD3 + CD4 - CD8 - B220 + T cells, the proliferation rate and IL-6 production were lower in the cells isolated from the irradiated mice. Moreover, the production of autoantibodies (anti-collagen antibody and anti-single strand DNA antibody) was also lowered by irradiation. These results indicate that activation of CD3 + CD4 - CD8 - B220 + T cells and progression of pathology would be suppressed by repeated 0.5 Gy γ-ray irradiation. To uncover the mechanism of the immune suppression, we analyzed population of regulatory T cells (CD4 + CD25 + Foxp3 + ), which suppress activated T cells and excessive autoimmune responses. Intriguingly, significant increase of the percentage of regulatory T cells was observed in irradiated mice. In conclusion, we found that repeated 0.5 Gy γ-ray irradiation

  18. Examination of 2 times 8.5 Gy method as palliative therapy of the case that convalescence is expected for a short term

    International Nuclear Information System (INIS)

    Saito, Akira; Onishi, Hiroshi; Aoki, Shinichi; Araya, Masayuki

    2008-01-01

    The objective of this study was to report on the clinical course of cases in which the 8.5 Gy x 2 method was used as a palliative irradiation method at our hospital. There were 21 cases in which irradiation with 8.5 Gy x 2 was used at our hospital from June 2004 to March 2006. These included 15 male cases and 6 female cases. The ages of the subjects ranged from 49 to 89 years (median value: 65 years of age). Karnofsky performance status (KPS) ranged from 50 to 90% (median value: 70%). The disorders (symptoms) included 7 cases of mediastinal lymph node metastasis (respiratory discomfort, coughing, and hemosputum), 4 cases of esophageal cancer (dysphagia), 5 cases of lung tumors (hemosputum and superior vena cava (SVC) syndrome), 1 case each of bone infiltration by soft tissue tumors in the abdomen and in the extremities (pain), 2 cases of abdominal lymph node metastasis (jaundice and pain), and 1 case of hepatocellular carcinoma (HCC) biliary infiltration (jaundice). Ten MVX was used in all cases. The treatment plan was carried out using CT simulation. Irradiation with 8.5 Gy was used twice. The site attributable to the symptoms was defined as gross tumor volume (GTV), and the region sufficiently containing GTV was defined as planning target volume (PTV). In 2 cases, the general condition of the patients worsened prior to the second irradiation, and therefore irradiation was discontinued. A total of 19 cases were treated with irradiation. A temporary improvement of the symptoms was observed in 12 cases. Early-stage adverse events (NCI-CTC ver. 2, grade 2 or higher) included 2 cases of grade 2 esophagitis, and 1 case of grade 2 nausea. Late-stage adverse events could not be evaluated. A temporary improvement of the symptoms was observed in about half of the cases. There were no grade 3 or higher early-stage adverse events. It is believed that this palliative irradiation method is acceptable if long-term irradiation is impossible. (author)

  19. Use of the gamma radiation, in a dose of 0,4 kGy, on the storage temperature reduction of the banana nanica;Utilizacao da radiacao gama, na dose de 0,4kGy, na reducao da temperatura de armazenamento da banana nanica

    Energy Technology Data Exchange (ETDEWEB)

    Manoel, Luciana, E-mail: luciana_manoel@yahoo.com.b [Universidade Estadual Paulisa (UNESP), Botucatu, SP (Brazil). Fac. de Ciencias Agronomicas. Programa de Pos-graduacao em Energia na Agricultura; Vieites, Rogerio Lopes, E-mail: vieites@fca.unesp.b [Universidade Estadual Paulisa (UNESP), Botucatu, SP (Brazil). Fac. de Ciencias Agronomicas. Dept. de Gestao e Tecnologia Agroindustrial

    2009-07-01

    The aim was to evaluate the use of gamma radiation, in a dose of 0,4 kGy, on the storage temperature reduction of the banana 'Nanica'. The bananas 'Nanica' were harvested in the Arm Taperao, Brotas (SP) town, and sent to CBE (Companhia Brasileira de Esterilizacao-Cotia-SP) for irradiation and constitution of the following treatments: T1 (fruits irradiated at 0,4 kGy and stored at 16 +-1 deg C); T2 (fruits irradiated at 0,4 kGy and stored at 14 +-1 deg C); T3 (fruit irradiated ata 0,4 kGy and stored at 12+-1 deg C); T4 (fruits non-irradiated and stored at 16+-1 deg C); T5 (fruits non-irradiated and stored at 14+-1 deg C) and T6 (fruits non-irradiated and stored at 12+-1 deg C). The fruits were stored in B.O.Ds. of the Agroindustrial Management and Technology Department, with a relative humidity of 80+-5%. The experiment was divided in two groups: control group (post harvest conservation and disease incidence) and parcel group (soluble solids and pulp/peel). The analyses were performed in intervals of five days during a period of 25 days. The experimental design employed was completely randomized (DIC) by applying a factor of 2 x 3 x 6 (irradiation x temperature x time). The Tukey test with 5% of probability was used for comparison between means. The storage temperature of the bananas 'Nanica' was not reduce by irradiation. (author)

  20. The freezing and thawing of water in poultry meat and vegetables irradiated by electrons at doses of 0.1-4 kGy

    International Nuclear Information System (INIS)

    Dubini, B.; Montecchia, F.; Ponzi-Bossi, M.G.; Messina, G.

    1993-01-01

    Poultry meat and some vegetables, irradiated by 5 MeV electrons (0.1-4 kGy), were analysed by differential scanning calorimetry, from 24 h after irradiation. The temperature and enthalpy transitions of the water contained in the irradiated samples were measured and compared with those of unirradiated samples. The authors analysed 18 meat and 10 vegetable samples for each irradiation dose together with a similar number of unirradiated controls. The mean supercooling temperatures of water in the irradiated poultry meat samples and in some vegetables are significantly lower than those of controls. Moreover, the freezing enthalpies of the irradiated poultry breast are significantly lower than those of controls, while they are unchanged in the other cases. The mean ice melting temperatures and enthalpies are similar for all samples. The amount of the lowering of the water-ice transition depends on the nature of the sample and is highest in poultry breast and lowest in vegetables. (author)

  1. Early changes of cortical blood flow, brain temperature and electrical activity after whole-body irradiation of the monkey (Macaca fascicularis) (dose range: 3-20 Gy)

    International Nuclear Information System (INIS)

    Court, L.; Gourmelon, P.; Mestries, J.C.

    1987-02-01

    A polyparametric investigation was carried out on 31 monkeys chronically wearing bioinstrumentation allowing to get and process simultaneously local brain blood flow, cerebral temperature, and energies in various frequency bands of the brain electrical activity. This method, which supplied data during several consecutive days, made it possible to study both the biological rhythms at the level of the various parameters, and their fast variations. The effects of whole-body gamma or neutron-gamma irradiation were studied in the 3-20 Gy dose range. Immediate changes after exposure demonstrated different radiosensitivities at the level of the rhythms of the various parameters, and/or their recovery, as well as dose-effect relationships [fr

  2. Inactivation of contaminated fungi and antioxidant effects of peach (Prunus persica L. Batsch cv Dangeumdo) by 0.5-2 kGy gamma irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Kyoung-Hee; Kim, Mi-Seon [Department of Food and Nutrition, Chungnam National University, Daejeon 305-764 (Korea, Republic of); Kim, Hong-Gi [Department of Applied Biology, Chungnam National University, Daejeon 305-764 (Korea, Republic of); Yook, Hong-Sun, E-mail: yhsuny@naver.co [Department of Food and Nutrition, Chungnam National University, Daejeon 305-764 (Korea, Republic of)

    2010-04-15

    The effect of gamma irradiation (0.5-2 kGy) on the physicochemical properties of peaches was investigated during a 6-day storage at 20+-3 deg. C. Gamma irradiation is able to inactivate the four pathogens, namely Botrytis cinerea, Penicillium expansum, Rhizopus stolonifer var. stolonifer and Monilinia fructicola in peaches. Hardness significantly decreased with the increment of irradiation dose level whereas soluble solid and total polyphenol contents increased with increment of irradiation dose level. 1,1-diphenyl-2-picrylhydrazyl (DPPH) radical-scavenging activity of the irradiated peach was higher than that of control, and its activity increased with increment of irradiation dose level. These results suggest that gamma irradiation of peaches improved antioxidant activity, but dramatically affects the hardness throughout the entire storage time.

  3. Effects of 0.5 - 2 Gy gamma-rays on physical activities and intellectual behavior in dogs and influence of physical exertion on clinical manifestation

    International Nuclear Information System (INIS)

    Zhang Qingxi; Li Chunhai; Jin Cuizhen

    1988-01-01

    A comparison of 88 pre-radiation and 433 post-radiation determinations demonstrated that 0.5∼2.0 Gy gamma irradiated police dogs could keep a good condition in physical performances such as 100-metre dash with or without load and 1.5∼5 km long-distance running with a load of 1/5 body weight. No detectable change could be found in intellectual behavior including performances in response to vocal or gestural command, discrimination of metronomic frequencies, differentiation between handkerchiefs from different persons, trailing, guarding and memory in any one of these dogs. As compared with 6 police dogs and 3 mongrel dogs kept at rest after irradiation, 7 police dogs and 3 mongrel dogs and 3 mongrel dogs undergoing above mentioned physical exertion showed fewer and milder symptoms and higher white

  4. Marguerite Duras/Claude Régy: L’Amante Anglaise, the genesis of a text, the gestation of a theatre

    Directory of Open Access Journals (Sweden)

    Almuth Grésillon

    2013-07-01

    Full Text Available This article focuses on the genesis of the first staging of Margerite Duras’s L’Amante Anglaise, by Claude Régy, a well succeeded genesis, carried out based on the interplay between dramaturgy and the stage. Without any satisfying answer, we are facing an important theoretical issue of genetic criticism applied to theatre: is the work a dramatic text or a spectacle? Depending on the stress on the first or on the second answer, the organizing axis of the genetic dossier can be the author’s writing and all stagings of L’Amante Anglaise,forming a theoretically unified set; or the director’s notes and all of his creations. This study explores a third possibility, stipulating the indispensable intersection between both hypotheses.

  5. Inactivation of contaminated fungi and antioxidant effects of peach (Prunus persica L. Batsch cv Dangeumdo) by 0.5-2 kGy gamma irradiation

    International Nuclear Information System (INIS)

    Kim, Kyoung-Hee; Kim, Mi-Seon; Kim, Hong-Gi; Yook, Hong-Sun

    2010-01-01

    The effect of gamma irradiation (0.5-2 kGy) on the physicochemical properties of peaches was investigated during a 6-day storage at 20±3 deg. C. Gamma irradiation is able to inactivate the four pathogens, namely Botrytis cinerea, Penicillium expansum, Rhizopus stolonifer var. stolonifer and Monilinia fructicola in peaches. Hardness significantly decreased with the increment of irradiation dose level whereas soluble solid and total polyphenol contents increased with increment of irradiation dose level. 1,1-diphenyl-2-picrylhydrazyl (DPPH) radical-scavenging activity of the irradiated peach was higher than that of control, and its activity increased with increment of irradiation dose level. These results suggest that gamma irradiation of peaches improved antioxidant activity, but dramatically affects the hardness throughout the entire storage time.

  6. Low-Dose (10-Gy) Total Skin Electron Beam Therapy for Cutaneous T-Cell Lymphoma: An Open Clinical Study and Pooled Data Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Kamstrup, Maria R., E-mail: mkam0004@bbh.regionh.dk [Department of Dermatology, Bispebjerg Hospital, University of Copenhagen, Copenhagen (Denmark); Gniadecki, Robert [Department of Dermatology, Bispebjerg Hospital, University of Copenhagen, Copenhagen (Denmark); Iversen, Lars [Department of Dermatology, Aarhus University Hospital, Aarhus (Denmark); Skov, Lone [Department of Dermatology, Gentofte Hospital, University of Copenhagen, Copenhagen (Denmark); Petersen, Peter Meidahl [Department of Oncology and Hematology, Rigshospitalet, University of Copenhagen, Copenhagen (Denmark); Loft, Annika [Department of Clinical Physiology, Nuclear Medicine and PET, Rigshospitalet, University of Copenhagen, Copenhagen (Denmark); Specht, Lena [Department of Oncology and Hematology, Rigshospitalet, University of Copenhagen, Copenhagen (Denmark)

    2015-05-01

    Purpose: Cutaneous T-cell lymphomas (CTCLs) are dominated by mycosis fungoides (MF) and Sézary syndrome (SS), and durable disease control is a therapeutic challenge. Standard total skin electron beam therapy (TSEBT) is an effective skin-directed therapy, but the possibility of retreatments is limited to 2 to 3 courses in a lifetime due to skin toxicity. This study aimed to determine the clinical effect of low-dose TSEBT in patients with MF and SS. Methods and Materials: In an open clinical study, 21 patients with MF/SS stages IB to IV were treated with low-dose TSEBT over <2.5 weeks, receiving a total dose of 10 Gy in 10 fractions. Data from 10 of these patients were published previously but were included in the current pooled data analysis. Outcome measures were response rate, duration of response, and toxicity. Results: The overall response rate was 95% with a complete cutaneous response or a very good partial response rate (<1% skin involvement with patches or plaques) documented in 57% of the patients. Median duration of overall cutaneous response was 174 days (5.8 months; range: 60-675 days). TSEBT-related acute adverse events (grade 1 or 2) were observed in 60% of patients. Conclusions: Low-dose (10-Gy) TSEBT offers a high overall response rate and is relatively safe. With this approach, reirradiation at times of relapse or progression is likely to be less toxic than standard dose TSEBT. It remains to be established whether adjuvant and combination treatments can prolong the beneficial effects of low-dose TSEBT.

  7. Favorable Preliminary Outcomes for Men With Low- and Intermediate-risk Prostate Cancer Treated With 19-Gy Single-fraction High-dose-rate Brachytherapy

    Energy Technology Data Exchange (ETDEWEB)

    Krauss, Daniel J., E-mail: dkrauss@beaumont.edu [Oakland University William Beaumont School of Medicine, Royal Oak, Michigan (United States); Ye, Hong [Oakland University William Beaumont School of Medicine, Royal Oak, Michigan (United States); Martinez, Alvaro A. [21st Century Oncology, Farmington Hills, Michigan (United States); Mitchell, Beth; Sebastian, Evelyn; Limbacher, Amy; Gustafson, Gary S. [Oakland University William Beaumont School of Medicine, Royal Oak, Michigan (United States)

    2017-01-01

    Purpose: To report the toxicity and preliminary clinical outcomes of a prospective trial evaluating 19-Gy, single-fraction high-dose-rate (HDR) brachytherapy for men with low- and intermediate-risk prostate cancer. Methods and Materials: A total of 63 patients were treated according to an institutional review board-approved prospective study of single-fraction HDR brachytherapy. Eligible patients had tumor stage ≤T2a, prostate-specific antigen level ≤15 ng/mL, and Gleason score ≤7. Patients with a prostate gland volume >50 cm{sup 3} and baseline American Urologic Association symptom score >12 were ineligible. Patients underwent transrectal ultrasound-guided transperineal implantation of the prostate, followed by single-fraction HDR brachytherapy. Treatment was delivered using {sup 192}Ir to a dose of 19 Gy prescribed to the prostate, with no additional margin applied. Results: Of the 63 patients, 58 had data available for analysis. Five patients had withdrawn consent during the follow-up period. The median follow-up period was 2.9 years (range 0.3-5.2). The median age was 61.4 years. The median gland volume at treatment was 34.8 cm{sup 3}. Of the 58 patients, 91% had T1 disease, 71% had Gleason score ≤6 (29% with Gleason score 7), and the median pretreatment prostate-specific antigen level was 5.1 ng/mL. The acute and chronic grade 2 genitourinary toxicity incidence was 12.1% and 10.3%, respectively. No grade 3 urinary toxicity occurred. No patients experienced acute rectal toxicity grade ≥2, and 2 experienced grade ≥2 chronic gastrointestinal toxicity. Three patients experienced biochemical failure, yielding a 3-year cumulative incidence estimate of 6.8%. Conclusions: Single-fraction HDR brachytherapy is well-tolerated, with favorable preliminary biochemical and clinical disease control rates.

  8. Total body 100-mGy X-irradiation does not induce Alzheimer's disease-like pathogenesis or memory impairment in mice

    International Nuclear Information System (INIS)

    Wang, Bing; Tanaka, Kaoru; Ji, Bin

    2014-01-01

    The cause and progression of Alzheimer's disease (AD) are poorly understood. Possible cognitive and behavioral consequences induced by low-dose radiation are important because humans are exposed to ionizing radiation from various sources. Early transcriptional response in murine brain to low-dose X-rays (100 mGy) has been reported, suggesting alterations of molecular networks and pathways associated with cognitive functions, advanced aging and AD. To investigate acute and late transcriptional, pathological and cognitive consequences of low-dose radiation, we applied an acute dose of 100-mGy total body irradiation (TBI) with X-rays to C57BL/6J Jms mice. We collected hippocampi and analyzed expression of 84 AD-related genes. Mouse learning ability and memory were assessed with the Morris water maze test. We performed in vivo PET scans with 11 C-PIB, a radiolabeled ligand for amyloid imaging, to detect fibrillary amyloid beta peptide (Aβ) accumulation, and examined characteristic AD pathologies with immunohistochemical staining of amyloid precursor protein (APP), Aβ, tau and phosphorylated tau (p-tau). mRNA studies showed significant downregulation of only two of 84 AD-related genes, Apbb1 and Lrp1, at 4 h after irradiation, and of only one gene, Il1α, at 1 year after irradiation. Spatial learning ability and memory were not significantly affected at 1 or 2 years after irradiation. No induction of amyloid fibrillogenesis or changes in APP, Aβ, tau, or p-tau expression was detected at 4 months or 2 years after irradiation. TBI induced early or late transcriptional alteration in only a few AD-related genes but did not significantly affect spatial learning, memory or AD-like pathological change in mice. (author)

  9. The use of discriminant analysis for evaluation of early-response multiple biomarkers of radiation exposure using non-human primate 6-Gy whole-body radiation model

    Energy Technology Data Exchange (ETDEWEB)

    Ossetrova, N.I. [Armed Forces Radiobiology Research Institute, 8901 Wisconsin Avenue, Bethesda, MD 20889-5603 (United States)], E-mail: ossetrova@afrri.usuhs.mil; Farese, A.M.; MacVittie, T.J. [Marlene and Stewart Greenebaum Cancer Center, Bressler Research Building, Room 7-039, University of Maryland-Baltimore, 655 West Baltimore Street, Baltimore, MD 21201 (United States); Manglapus, G.L.; Blakely, W.F. [Armed Forces Radiobiology Research Institute, 8901 Wisconsin Avenue, Bethesda, MD 20889-5603 (United States)

    2007-07-15

    The present need to rapidly identify severely irradiated individuals in mass-casualty and population-monitoring scenarios prompted an evaluation of potential protein biomarkers to provide early diagnostic information after exposure. The level of specific proteins measured using immunodiagnostic technologies may be useful as protein biomarkers to provide early diagnostic information for acute radiation exposures. Herein we present results from on-going studies using a non-human primate (NHP) 6-Gy X-rays ( 0.13Gymin{sup -1}) whole-body radiation model. Protein targets were measured by enzyme-linked immunosorbent assay (ELISA) in blood plasma before, 1, and 2 days after exposure. Exposure of 10 NHPs to 6 Gy resulted in the up-regulation of plasma levels of (a) p21 WAF1/CIP1, (b) interleukin 6 (IL-6), (c) tissue enzyme salivary {alpha}-amylase, and (d) C-reactive protein. Data presented show the potential utility of protein biomarkers selected from distinctly different pathways to detect radiation exposure. A correlation analysis demonstrated strong correlations among different combinations of four candidate radiation-responsive blood protein biomarkers. Data analyzed with use of multivariate discriminant analysis established very successful separation of NHP groups: 100% discrimination power for animals with correct classification for separation between groups before and 1 day after irradiation, and 95% discrimination power for separation between groups before and 2 days after irradiation. These results also demonstrate proof-in-concept that multiple protein biomarkers provide early diagnostic information to the medical community, along with classical biodosimetric methodologies, to effectively manage radiation casualty incidents.

  10. Role of 10-Gy boost radiation after breast-conserving surgery for stage I-II breast cancer with a 5-mm negative margin

    International Nuclear Information System (INIS)

    Notani, Masafumi; Uchida, Nobue; Kitagaki, Hajime

    2007-01-01

    According to the Guidelines for breast-conserving therapy of the Japanese Breast Cancer Society, the surgical margin is ''negative'' when the minimum distance between the tumor edge and the margin of the resected specimen is more than 5 mm. The value of boost radiation for early breast cancer with a 5-mm negative margin remains unclear. A total of 137 patients with stage I-II breast cancer underwent breast-conserving surgery between July 1987 and August 2002. All of the patients had negative margins according to the Japanese guidelines. Their median age was 50 years and the median follow-up period was 62 months. The entire ipsilateral breast was irradiated to a total dose of 50 Gy (25 fractions). Then an additional 10 Gy (5 fractions) was given to 79 patients, using 6- to 12-MeV electrons (boost group), while 58 patients (no-boost group) received no further radiation. Factors influencing local recurrence were evaluated by univariate and multivariate analyses. For the entire population, the 5-year overall survival, cause-specific survival, disease-free survival, and local recurrence rates were 96.0%, 96.8%, 94.2%, and 1.67%, respectively. Boost radiation reduced local recurrence, but the improvement was not significant (P=0.070). Univariate and multivariate analyses failed to detect any factors that were significantly associated with local control. There were no severe complications in either group and there were no differences between the groups in the cosmetic outcome. Boost radiation can be performed for stage I-II breast cancer with negative margins (Japanese guidelines), and showed a tendency to decrease local recurrence. A large randomized controlled study is necessary to establish final conclusions. (author)

  11. Local tumor control and cosmetic outcome following breast-conserving surgery and radiation up to a total dose of 56 Gy without boost in breast cancer patients

    International Nuclear Information System (INIS)

    Bayerl, A.

    2001-01-01

    Purpose: To evaluate overall survival, local tumor control and cosmetic outcome after breast-conserving surgery followed by radiotherapy without boost irradiation. Patients and Methods: In a retrospective study 270 breast cancer patients were treated with breast conserving surgery combined with a homogenous radiation of the tumor bearing breast up to a total dose of 56 Gy without local boost irradiation. Mean follow-up was 48 months. Local tumor control, side effects, cosmetic results and contentment with treatment were assessed using physical examinations and interviews based on a standardized questionnaire. Results: Cause-specific survival at 5 years after treatment was 88.3%, actuarial disease-free survival at 5 years was 76.1%. Within 23 to 78 months after treatment 12 patients suffered from ipsilateral breast recurrence. The actuarial freedom from local recurrence (single tumor manifestation) was 96.8% at 5 years after treatment, 89% at 10 years. The occurrence of local failures was not significantly correlated to tumor size, margins, grading, nodal status, age or lymphangiosis. 15.6% of the patients developed distant metastases. In all patients treatment was performed without interruption. Side effects were predominantly of mild degree, no severe side effects were detected. 73% of physicians and 81% of patients scored their cosmetic outcome as excellent or good. 93% of patients would again decide in favor of this procedure. Whereas, use of adjuvant chemotherapy as well as subcutaneous reconstruction of breast tissue did not significantly affect breast cosmesis, analysis demonstrated impaired cosmetic results related to a larger breast size. Conclusion: The data of this study show that tumor control achieved by breast conserving surgery in combination with a radiation technique up to a total dose of 56 Gy which omits boost irradiation is within the range of literature data. Side effects of the therapy were tolerable. The treatment displayed a good

  12. Simvastatin mitigates increases in risk factors for and the occurrence of cardiac disease following 10 Gy total body irradiation.

    Science.gov (United States)

    Lenarczyk, Marek; Su, Jidong; Haworth, Steven T; Komorowski, Richard; Fish, Brian L; Migrino, Raymond Q; Harmann, Leanne; Hopewell, John W; Kronenberg, Amy; Patel, Shailendra; Moulder, John E; Baker, John E

    2015-06-01

    The ability of simvastatin to mitigate the increases in risk factors for and the occurrence of cardiac disease after 10 Gy total body irradiation (TBI) was determined. This radiation dose is relevant to conditioning for stem cell transplantation and threats from radiological terrorism. Male rats received single dose TBI of 10 Gy. Age-matched, sham-irradiated rats served as controls. Lipid profile, heart and liver morphology and cardiac mechanical function were determined for up to 120 days after irradiation. TBI resulted in a sustained increase in total- and LDL-cholesterol (low-density lipoprotein-cholesterol), and triglycerides. Simvastatin (10 mg/kg body weight/day) administered continuously from 9 days after irradiation mitigated TBI-induced increases in total- and LDL-cholesterol and triglycerides, as well as liver injury. TBI resulted in cellular peri-arterial fibrosis, whereas control hearts had less collagen and fibrosis. Simvastatin mitigated these morphological injuries. TBI resulted in cardiac mechanical dysfunction. Simvastatin mitigated cardiac mechanical dysfunction 20-120 days following TBI. To determine whether simvastatin affects the ability of the heart to withstand stress after TBI, injury from myocardial ischemia/reperfusion was determined in vitro. TBI increased the severity of an induced myocardial infarction at 20 and 80 days after irradiation. Simvastatin mitigated the severity of this myocardial infarction at 20 and 80 days following TBI. It is concluded simvastatin mitigated the increases in risk factors for cardiac disease and the extent of cardiac disease following TBI. This statin may be developed as a medical countermeasure for the mitigation of radiation-induced cardiac disease.

  13. SU-F-T-351: Establishing a Workflow for IMRT Pre-Treatment Reviews for NRG-GY006 Clinical Trial

    Energy Technology Data Exchange (ETDEWEB)

    Giaddui, T [Sidney Kimmel Cancer Center, Thomas Jefferson University, Philadelphia, PA (United States); Li, N; Moore, K; Mell, L [University of California, San Diego, San Diego, CA (United States); Curry, K [MIM Software, Inc., Clevealand, OH (United States); Leath, C [University of Alabama at Birmingham, Birmingham, AL (United States); Kunos, C [Northeastern Ohio University College, Clevealand, OH (United States); Xiao, Y [University of Pennsylvania, Philadelphia, PA (United States)

    2016-06-15

    Purpose: To establish a workflow for NRG-GY006 IMRT pre-treatment reviews, incorporating advanced radiotherapy technologies being evaluated as part of the clinical trial. Methods: Pre-Treatment reviews are required for every IMRT case as part of NRG-GY006 (a randomized phase II trial of radiation therapy and cisplatin alone or in combination with intravenous triapine in women with newly diagnosed bulky stage I B2, stage II, IIIB, or IVA cancer of the uterine cervix or stage II-IVA vaginal cancer. The pretreatment review process includes structures review and generating an active bone marrow(ABM)- to be used as an avoidance structure during IMRT optimization- and evaluating initial IMRT plan quality using knowledgeengineering based planning (KBP). Institutions will initially submit their simulation CT scan, structures file and PET/CT to IROC QA center for generating ABM. The ABM will be returned to the institution for use in planning. Institutions will then submit an initial IMRT plan for review and will receive information back following implementation of a KBP algorithm, for use in re-optimization, before submitting the final IMRT used for treatment. Results: ABM structure is generated using MIM vista software (Version 6.5, MIM corporation, Inc.). Here, the planning CT and the diagnostic PET/CT are fused and a sub threshold structure is auto segmented above the mean value of the SUV of the bone marrow. The generated ABM were compared with those generated with other software system (e.g. Velocity, Varian) and Dice coefficient (reflects the overlap of structures) ranged between 80 – 90% was achieved. A KBP model was built in Varian Eclipse TPS using the RapidPlan KBP software to perform plan quality assurance. Conclusion: The workflow for IMRT pretreatment reviews has been established. It represents a major improvement of NRG Oncology clinical trial quality assurance and incorporates the latest radiotherapy technologies as part of NCI clinical trials. This project

  14. SU-F-T-351: Establishing a Workflow for IMRT Pre-Treatment Reviews for NRG-GY006 Clinical Trial

    International Nuclear Information System (INIS)

    Giaddui, T; Li, N; Moore, K; Mell, L; Curry, K; Leath, C; Kunos, C; Xiao, Y

    2016-01-01

    Purpose: To establish a workflow for NRG-GY006 IMRT pre-treatment reviews, incorporating advanced radiotherapy technologies being evaluated as part of the clinical trial. Methods: Pre-Treatment reviews are required for every IMRT case as part of NRG-GY006 (a randomized phase II trial of radiation therapy and cisplatin alone or in combination with intravenous triapine in women with newly diagnosed bulky stage I B2, stage II, IIIB, or IVA cancer of the uterine cervix or stage II-IVA vaginal cancer. The pretreatment review process includes structures review and generating an active bone marrow(ABM)- to be used as an avoidance structure during IMRT optimization- and evaluating initial IMRT plan quality using knowledgeengineering based planning (KBP). Institutions will initially submit their simulation CT scan, structures file and PET/CT to IROC QA center for generating ABM. The ABM will be returned to the institution for use in planning. Institutions will then submit an initial IMRT plan for review and will receive information back following implementation of a KBP algorithm, for use in re-optimization, before submitting the final IMRT used for treatment. Results: ABM structure is generated using MIM vista software (Version 6.5, MIM corporation, Inc.). Here, the planning CT and the diagnostic PET/CT are fused and a sub threshold structure is auto segmented above the mean value of the SUV of the bone marrow. The generated ABM were compared with those generated with other software system (e.g. Velocity, Varian) and Dice coefficient (reflects the overlap of structures) ranged between 80 – 90% was achieved. A KBP model was built in Varian Eclipse TPS using the RapidPlan KBP software to perform plan quality assurance. Conclusion: The workflow for IMRT pretreatment reviews has been established. It represents a major improvement of NRG Oncology clinical trial quality assurance and incorporates the latest radiotherapy technologies as part of NCI clinical trials. This project

  15. Dose escalation by image-guided intensity-modulated radiotherapy leads to an increase in pain relief for spinal metastases: a comparison study with a regimen of 30 Gy in 10 fractions.

    Science.gov (United States)

    He, Jinlan; Xiao, Jianghong; Peng, Xingchen; Duan, Baofeng; Li, Yan; Ai, Ping; Yao, Min; Chen, Nianyong

    2017-12-22

    Under the existing condition that the optimum radiotherapy regimen for spinal metastases is controversial, this study investigates the benefits of dose escalation by image-guided intensity-modulated radiotherapy (IG-IMRT) with 60-66 Gy in 20-30 fractions for spinal metastases. In the dose-escalation group, each D50 of planning gross tumor volume (PGTV) was above 60 Gy and each Dmax of spinal cord planning organ at risk volume (PRV) was below 48 Gy. The median biological effective dose (BED) of Dmax of spinal cord was lower in the dose-escalation group compared with that in the 30-Gy group (69.70 Gy vs. 83.16 Gy, p pain responses were better in the dose-escalation group than those in the 30-Gy group ( p = 0.005 and p = 0.024), and the complete pain relief rates were respectively 73.69% and 34.29% ( p = 0.006), 73.69% and 41.38% ( p = 0.028) in two compared groups. In the dose-escalation group, there is a trend of a longer duration of pain relief, a longer overall survival and a lower incidence of acute radiation toxicities. No late radiation toxicities were observed in both groups. Dosimetric parameters and clinical outcomes, including pain response, duration of pain relief, radiation toxicities and overall survival, were compared among twenty-five metastatic spinal lesions irradiated with the dose-escalation regimen and among forty-four lesions treated with the 30-Gy regimen. Conventionally-fractionated IG-IMRT for spinal metastases could escalate dose to the vertebral lesions while sparing the spinal cord, achieving a better pain relief without increasing radiation complications.

  16. Hematopoietic effects of early and long terms of rhG-CSF in mice exposed to 6.5 Gy irradiation

    International Nuclear Information System (INIS)

    Cong Yuwen; Mao Bingzhi; Luo Qingliang; Dong Bo; Chen Huipeng

    1996-01-01

    In order to evaluate the long-term protective effect of recombinant human granulocyte colony-stimulating factor (rhG-CSF) on hematopoiesis after a second irradiation, different doses of rhG-CSF were given to 6.5 Gy 60 Co γ-ray irradiated C 57 BL/6 mice. When the peripheral blood cells recovered to normal level, the survived mice were exposed to a second dose of radiation exactly the same as the first one. It was showed that peripheral WBC, RBC and platelet counts recovered much quicker in the mice treated with the factor after irradiation and the effect was dependent on the dose of rhG-CSF. In the survived mice exposed to a second dose of γ-rays 45 days after the first irradiation, as compared with the control, the recovery of peripheral blood cell counts was evidently accelerated and the survival rate was markedly elevated. These results not only demonstrate that the recovery of hematopoiesis in the irradiated mice could be accelerated after the administration of rhG-CSF but also suggest that early administration of the factor could produce a long-term protective effect on the hematopoietic function against a second irradiation given 45 days later

  17. Evaluation of apoptosis and apoptosis proteins as possible markers of radiation at doses 0.1-2 Gy, in comparison to the micronucleus assay in three cell lines

    International Nuclear Information System (INIS)

    Jaworska, A.; Angelis, P. de

    1997-01-01

    In recent years the interest in apoptosis as possible indicator of radiation damage has increased. Studies have been done to examine the induction of apoptosis after ionizing radiation using morphological criteria, characteristic DNA damage pattern(ladders), early DNA damage using flow cytometry and/or expression of the proteins involved in apoptosis. But the picture which emerges from these investigations is unclear. Some researchers suggest that apoptosis studies can be used as potential assays of biological dosimetry, others doubt if apoptosis can be used as a marker of irradiation at all. Most studies have been done using relatively high doses of radiation. In this study we focus on apoptosis induction after relatively small doses (0,1-2 Gy). We detected apoptosis with the in situ terminal deoxynucleotidyl transferase assay by flow cytometry, and measured the expression of proteins that regulate apoptosis (Bcl-2, Bax, P53) with Western blotting. As comparison we used the cytokinesis-block micronucleus assay as a reference. The studies were carried out in three lymphoid cell lines: the mouse lymphoma L5178Y resistant and sensitive cell lines widely used in radiobiological studies, and the human pre-B cell leukemia Reh cells. Our results indicate that we can not consider the examined parameters of apoptosis as markers of radiation in these cell lines. (author)

  18. Influence of SNP Polymorphisms in DNA Repair Genes on the Level of Persistent Damage in Human Lymphocytes After Exposure to 2 Gy of Ionising Radiation

    International Nuclear Information System (INIS)

    Milic, M.; Rozgaj, R.; Kasuba, V.; Kubelka, D.; Angelini, S.; Hrelia, P.

    2011-01-01

    Variation in cell response to ionising radiation could be result of changes in gene expression and/or polymorphisms of DNA repair genes. The aim of the study was to estimate the DNA damage level in human lymphocytes after exposure to 2 Gy of ionising radiation. Medical workers occupationally exposed to low doses of ionising radiation (N = 20) and matched controls (N 20) were genotyped for polymorphic hOGG1, XRCC1, APE1, XPD10, XPD23, XRCC3, PARP1 and MGMT genes. Micronucleus (MN) test was used for the estimation of DNA damage before and after radiation. Incidence of MN in irradiated samples positively correlated with age and negatively with polymorphic variants of XPD23. Significant difference was observed between irradiated homozygotes (HO) and heterozygotes (HE). HO and HE APE1 differed in MN before exposure. HO and polymorphic variants of XPD10 differed in MN after exposure. Gender showed different MN in the exposed group after exposure. Age correlated positively with MN after exposure, working probation and received dose. Multiple regression analysis revealed connection between polymorphic variants of APE1 and XRCC3 with MN before exposure. These results confirm the value of micronucleus assay in DNA damage estimation and suggest possible use of polymorphic genes in monitoring of individuals professionaly exposed to ionising radiation. (author)

  19. Sensitivity difference between anterior and posterior lobes of rat cerebellum to prenatal exposure to 2.5 Gy X-irradiation. A histological study

    International Nuclear Information System (INIS)

    Darmanto, W.; Hayasaka, Shizu; Takagishi, Yoshiko; Aolad, H.M.; Inouye, Minoru

    1997-01-01

    We investigated the histological differences in abnormality between anterior lobes (vermian lobules II, III and culmen IV, V) and posterior lobes (lobules IX, X) of the rat cerebellum following prenatal exposure to X-irradiation. Pregnant rats were exposed to 2.5 Gy X-irradiation at gestation day-21 (GD-21), and pups were sacrificed from birth through 15 days of age. Their cerebella were examined histologically and immunohistochemically for glial fibrillary acidic protein in Bergmann fibers. Extensive cell death was found in the external granular layer (EGL) of the cerebellum on the day of birth. In the anterior lobes, the number of cell deaths was higher than in the posterior lobes. During 5 days after birth, the recovery of EGL was earlier in the posterior lobes than in the anterior lobes. Seven days after birth, Bergmann fibers were more irregular in the anterior lobes than in the posterior lobes. The number of Purkinje cells in ectopic locations was higher in the anterior lobes than in the posterior lobes. The EGL and migrating Purkinje cells showed different responses to X-irradiation in the anterior than in the posterior lobes of the cerebellum. (author)

  20. Magnetoresistance properties of Fe0,2C0,8 composite materials pre and post gamma irradiated at 250 kGy dose

    International Nuclear Information System (INIS)

    Yunasfi; Setyo Purwanto; Wisnu A A

    2009-01-01

    Research about change of, magnetoresistance properties of Fe 0,2 C 0,8 composite materials pre and post gamma irradiation at a dose of 250 kGy was carried out. Fe 0,2 C 0,8 was prepared by mixing of Fe and C powder with the ratio of Fe : C set on 20:80 in weight %. In this research, the phase structure and magnetic properties of Fe 0,2 C 0,8 composite materials after 250 KGy dose of gamma irradiation have been measured and analyzed. The phase structure of Fe 0,2 C 0,8 was analyzed using X-ray diffractometer (XRD), whole the magnetoresistance properties was characterized using Four Point Probe method. The analyzing results showed the decreasing of X-ray diffraction peak intensity, but also in the same time showed the increasing of magnetoresistance properties after gamma irradiation. The enhancement of magnetoresistance value reached 5 times at 7,5 kOe magnetic field. This enhancement was caused due to structure defect within Fe 0,2 C 0,8 composite initiated by interaction between radiation of gamma ray and composite materials that further causes a change of magnetic interaction intensity in this materials. (author)

  1. Tachyzoites of Toxoplasma gondii irradiated with 255 Gy induces decrease of cysts and cerebral lesions in mice challenged with cysts of ME-49; Taquizoitos de Toxoplasma gondii irradiados com 255 Gy induzem diminuicao de cistos e lesoes cerebrais em camundongos desafiados com cistos da cepa ME-49

    Energy Technology Data Exchange (ETDEWEB)

    Hiramoto, Roberto Mitsuyoshi; Galisteo Juniorm Andres Jimenez; Nascimento, Nanci do; Andrade Junior, Heitor Franco de [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil). Lab. de Biologia Molecular]. E-mail: rmhiramoto@bol.com.br; hfandrad@usp.br

    2002-07-01

    Toxoplasmosis can cause ocular lesions in normal individuals and several diseases in foetus, HIV infection and transplants. Toxoplasma gondii has a complex life cycle, involving cats, as the definitive host, and warm blood species, as intermediated hosts. The infection occurs by ingestion of food and water contaminated with infected cat faeces, contaminated milk and cheese or raw and undercook meat of the intermediated hosts. To date, there is no commercial vaccine of use in humans. In this work, tachyzoites of T. gondii RH strain were irradiated with 255 Gy and inoculated in C57Bl/6j mice (3 doses, biweekly), after mice were challenged with 1, 5, 10, 20 and 25 cysts of ME-49 by oral gavage. The lesions and cysts in the brain were analyzed in all mice, after 4-week post infection. The mortality was 20% in control mice (ME-49 cysts only) and not one in immunized mice. The number of cysts was high in the control group, but low in immunized 255 Gy mice (n<100). Immunized mice showed less cerebral pathology and necrosis foci. Ionizing radiation is an important tool in the study toxoplasmosis and vaccine development. (author)

  2. External Beam Accelerated Partial-Breast Irradiation Using 32 Gy in 8 Twice-Daily Fractions: 5-Year Results of a Prospective Study

    International Nuclear Information System (INIS)

    Pashtan, Itai M.; Recht, Abram; Ancukiewicz, Marek; Brachtel, Elena; Abi-Raad, Rita F.; D'Alessandro, Helen A.; Levy, Antonin; Wo, Jennifer Y.; Hirsch, Ariel E.; Kachnic, Lisa A.; Goldberg, Saveli; Specht, Michelle; Gadd, Michelle; Smith, Barbara L.; Powell, Simon N.; Taghian, Alphonse G.

    2012-01-01

    Purpose: External beam accelerated partial breast irradiation (APBI) is an increasingly popular technique for treatment of patients with early stage breast cancer following breast-conserving surgery. Here we present 5-year results of a prospective trial. Methods and Materials: From October 2003 through November 2005, 98 evaluable patients with stage I breast cancer were enrolled in the first dose step (32 Gy delivered in 8 twice-daily fractions) of a prospective, multi-institutional, dose escalation clinical trial of 3-dimensional conformal external beam APBI (3D-APBI). Median age was 61 years; median tumor size was 0.8 cm; 89% of tumors were estrogen receptor positive; 10% had a triple-negative phenotype; and 1% had a HER-2-positive subtype. Median follow-up was 71 months (range, 2-88 months; interquartile range, 64-75 months). Results: Five patients developed ipsilateral breast tumor recurrence (IBTR), for a 5-year actuarial IBTR rate of 5% (95% confidence interval [CI], 1%-10%). Three of these cases occurred in patients with triple-negative disease and 2 in non-triple-negative patients, for 5-year actuarial IBTR rates of 33% (95% CI, 0%-57%) and 2% (95% CI, 0%-6%; P<.0001), respectively. On multivariable analysis, triple-negative phenotype was the only predictor of IBTR, with borderline statistical significance after adjusting for tumor grade (P=.0537). Conclusions: Overall outcomes were excellent, particularly for patients with estrogen receptor-positive disease. Patients in this study with triple-negative breast cancer had a significantly higher IBTR rate than patients with other receptor phenotypes when treated with 3D-APBI. Larger, prospective 3D-APBI clinical trials should continue to evaluate the effect of hormone receptor phenotype on IBTR rates.

  3. External Beam Accelerated Partial-Breast Irradiation Using 32 Gy in 8 Twice-Daily Fractions: 5-Year Results of a Prospective Study

    Energy Technology Data Exchange (ETDEWEB)

    Pashtan, Itai M. [Harvard Radiation Oncology Program, Boston, Massachusetts (United States); Recht, Abram [Department of Radiation Oncology, Beth Israel Deaconess Medical Center, Boston, Massachusetts (United States); Ancukiewicz, Marek [Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States); Brachtel, Elena [Department of Pathology, Massachusetts General Hospital, Boston, Massachusetts (United States); Abi-Raad, Rita F. [Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States); D' Alessandro, Helen A. [Department of Radiology, Massachusetts General Hospital, Boston, Massachusetts (United States); Levy, Antonin; Wo, Jennifer Y. [Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States); Hirsch, Ariel E. [Department of Radiation Oncology, Boston Medical Center, Boston University School of Medicine, Boston, Massachusetts (United States); Kachnic, Lisa A. [Department of Surgery, Massachusetts General Hospital, Boston, Massachusetts (United States); Goldberg, Saveli [Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States); Specht, Michelle; Gadd, Michelle; Smith, Barbara L. [Department of Surgery, Massachusetts General Hospital, Boston, Massachusetts (United States); Powell, Simon N. [Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States); Taghian, Alphonse G., E-mail: ataghian@partners.org [Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States)

    2012-11-01

    Purpose: External beam accelerated partial breast irradiation (APBI) is an increasingly popular technique for treatment of patients with early stage breast cancer following breast-conserving surgery. Here we present 5-year results of a prospective trial. Methods and Materials: From October 2003 through November 2005, 98 evaluable patients with stage I breast cancer were enrolled in the first dose step (32 Gy delivered in 8 twice-daily fractions) of a prospective, multi-institutional, dose escalation clinical trial of 3-dimensional conformal external beam APBI (3D-APBI). Median age was 61 years; median tumor size was 0.8 cm; 89% of tumors were estrogen receptor positive; 10% had a triple-negative phenotype; and 1% had a HER-2-positive subtype. Median follow-up was 71 months (range, 2-88 months; interquartile range, 64-75 months). Results: Five patients developed ipsilateral breast tumor recurrence (IBTR), for a 5-year actuarial IBTR rate of 5% (95% confidence interval [CI], 1%-10%). Three of these cases occurred in patients with triple-negative disease and 2 in non-triple-negative patients, for 5-year actuarial IBTR rates of 33% (95% CI, 0%-57%) and 2% (95% CI, 0%-6%; P<.0001), respectively. On multivariable analysis, triple-negative phenotype was the only predictor of IBTR, with borderline statistical significance after adjusting for tumor grade (P=.0537). Conclusions: Overall outcomes were excellent, particularly for patients with estrogen receptor-positive disease. Patients in this study with triple-negative breast cancer had a significantly higher IBTR rate than patients with other receptor phenotypes when treated with 3D-APBI. Larger, prospective 3D-APBI clinical trials should continue to evaluate the effect of hormone receptor phenotype on IBTR rates.

  4. A case of cardiac cancer diagnosed after 30 Gy radiation therapy for gastric mucosa-associated lymphoid tissue (MALT) lymphoma without helicobacter pylori (H. pylori) infection

    International Nuclear Information System (INIS)

    Ito, Kazuhiro; Akamatsu, Taiji; Shinji, Akihiro

    2005-01-01

    An 80-year-old man was referred to Shinshu University Hospital in April 2001 for treatment of gastric mucosa-associated lymphoid tissue (MALT) lymphoma. He had received anti-biotic therapy in spite of no evidence of H. pylori infection in the former hospital 3 years ago, but no remarkable improvement was recognized and endoscopic findings were progressive. An esophagogastroduodenoscopy (EGD) revealed mucosal redness on the greater curvature and the anterior wall of the body. Biopsy specimens taken from the lesions showed remarkable infiltration of atypical small lymphocytes, and this lesions were diagnosed MALT lymphoma by an immunophenotypic studies. Endoscopic ultrasonography (EUS) showed that MALT lymphoma was limited within the mucosa and submucosa. Staging work up revealed stage I. After written informed consent, he was treated by 30 Gy radiation therapy for gastric MALT lymphoma. Response assessment was performed by EGD, EUS, and biopsy specimens, and a complete remission was confirmed. After that, he was followed up with regular intervals, and EGD was performed every 6 months. He was diagnosed to have O I type cardiac cancer at 21 months after radiation therapy. He underwent proximal partial gastrectomy, and histopathological findings showed as follows: O I type, 17 x 12 mm, tub 2, SM, ly 1, v 1, n 0, PM (-), DM (-), INFγ, stage I A. No residual lesion of gastric MALT lymphoma and no dysplasia of gastric mucosa was recognized. Causal relationship between radiation therapy and carcinogenesis in this case is unclear. However, it might be suggested by the facts that cancer occurred in the radiation field where MALT lymphoma had been presented and gastric cancer was rare in the stomach without H. pylori infection. (author)

  5. 255Gy irradiated tachyzoites of Toxoplasma gondii induce intestinal immune response in C57BL/6J immunized by oral route

    Energy Technology Data Exchange (ETDEWEB)

    Galisteo Junior, Andres Jimenez; Alves, Janaina Baptista [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil). Lab. de Biologia Molecular]. E-mail: galisteo@usp.br; Hiramoto, Roberto Mitsuyoshi [Instituto Adolfo Lutz, Sao Paulo, SP (Brazil). Secao de Parasitoses Sistemicas]. E-mail: hiramoto@usp.br; Carmo, Claudia Villano do; Andrade Junior, Heitor Franco de [Instituto de Medicina Tropical de Sao Paulo, Sao Paulo, SP (Brazil). Lab. de Protozoologia]. E-mail: hfandrad@usp.br

    2005-07-01

    Toxoplasmosis, a prevalent widespread infection in man and animals, occurs mainly through ingestion of water and food contaminated with oocyst from cat feces, causing usually benign disease in humans, except in intrauterine fetal infection or in immunodeficient patients. We study the oral route for the development of a vaccine for toxoplasmosis, using parasites irradiated with 60 Cobalt, as an alternative for vaccine development to this worldwide parasitic infection. We evaluated the development of immunity at serum or mucosal levels, and their efficiency in protect the mice against challenge with oral cysts of the ME-49 strain. C57Bl/6j isogenic mice were immunized by oral route with 10{sup 7} 255 Gy irradiated tachyzoites from RH strain, at several protocols using milk as anti-peptic adjuvant and alum hydroxide as antacid. The preparations of irradiated tachyzoites induced production of serum IgG and IgA in immunized mice, as determined by ELISA, with IgG2a as the dominant subclass, similar to chronic infection. Their use with adjuvant allowed the excretion of significant amounts of IgA in stools also IgG, despite a lesser extent. All oral preparations induced some quantitative protection against challenge, which was similar to the parenteral route only isolated alum hydroxide was used as adjuvant. All these data support the possibility of the development of an oral vaccine against toxoplasmosis, using irradiated tachyzoites, which would be possible tool in near future for use in field baits, for immunizing either domestic or wild felids. (author)

  6. 255Gy irradiated tachyzoites of Toxoplasma gondii induce intestinal immune response in C57BL/6J immunized by oral route

    International Nuclear Information System (INIS)

    Galisteo Junior, Andres Jimenez; Alves, Janaina Baptista; Hiramoto, Roberto Mitsuyoshi; Carmo, Claudia Villano do; Andrade Junior, Heitor Franco de

    2005-01-01

    Toxoplasmosis, a prevalent widespread infection in man and animals, occurs mainly through ingestion of water and food contaminated with oocyst from cat feces, causing usually benign disease in humans, except in intrauterine fetal infection or in immunodeficient patients. We study the oral route for the development of a vaccine for toxoplasmosis, using parasites irradiated with 60 Cobalt, as an alternative for vaccine development to this worldwide parasitic infection. We evaluated the development of immunity at serum or mucosal levels, and their efficiency in protect the mice against challenge with oral cysts of the ME-49 strain. C57Bl/6j isogenic mice were immunized by oral route with 10 7 255 Gy irradiated tachyzoites from RH strain, at several protocols using milk as anti-peptic adjuvant and alum hydroxide as antacid. The preparations of irradiated tachyzoites induced production of serum IgG and IgA in immunized mice, as determined by ELISA, with IgG2a as the dominant subclass, similar to chronic infection. Their use with adjuvant allowed the excretion of significant amounts of IgA in stools also IgG, despite a lesser extent. All oral preparations induced some quantitative protection against challenge, which was similar to the parenteral route only isolated alum hydroxide was used as adjuvant. All these data support the possibility of the development of an oral vaccine against toxoplasmosis, using irradiated tachyzoites, which would be possible tool in near future for use in field baits, for immunizing either domestic or wild felids. (author)

  7. From nGy to MGy - new TL dosimetry of complex radiation at high-energy accelerators and thermonuclear fusion facilities

    International Nuclear Information System (INIS)

    Obryk, B.; Bilski, P.; Budzanowski, M.; Olko, P.

    2011-01-01

    One of the well known advantages of thermoluminescence (TL) detectors made of lithium fluoride doped with magnesium, copper and phosphorus (LiF:Mg,Cu,P) is their very high sensitivity to ionizing radiation. LiF:Mg,Cu,P detectors enable measurements of radiation doses from tens of nano grays up to a few kilo grays, when the total saturation of the signal of the so-called main dosimetric peak (at about 220 C. degrees) occurs. In 2006 for the first time we observed unprecedented high-temperature emission of LiF detectors heated to temperatures up to 600 C. degrees, after exposures to radiation doses ranging from 1 kGy to 1 MGy. For quantification of the glow curve shape changes of LiF:Mg,Cu,P detectors in this range of doses and determination of the absorbed dose, the high temperature coefficient (UHTR) was defined. This newly established dosimetric method was tested in a range of radiation qualities, such as gamma radiation, electron and proton beams, thermal neutron fields and in high-energy mixed fields around the SPS and PS accelerators at CERN. A number of dosimetric sets with LiF:Mg,Cu,P detectors are currently installed around the LHC at CERN. The new method for ultra-high dose range monitoring with a single LiF:Mg,Cu,P detector, which is capable of covering at least twelve orders of magnitude of doses, can be used for dosimetry at high energy accelerators and has great potential for accident dosimetry in particular. (authors)

  8. Evaluation of the cell death mechanisms activated by the radiopharmaceutical 177Lu-DOTA-anti-CD20 in a dose range of 1 to 5 Gy

    International Nuclear Information System (INIS)

    Azorin V, E.P.; Rojas C, E. L.; Martinez V, B. E.; Ramos B, J. C.; Jimenez M, N. P.; Ferro F, G.

    2016-10-01

    The radio immunotherapy with anti-CD20 antibodies significantly increases the remission rate of patients with B-cell lymphomas over expressing the CD20. The radiolabeled antibodies directed to surface antigens allow delivering scaled doses of radiation to specific targets thus limiting the dose to healthy tissue. The anti-CD20 causes cell death by two major pathways; activating the immune system to destroy malignant cells and inducing the activation of cell death pathways. The 177 Lu is a beta particle emitter (max. 0.497 MeV) with a maximum reach on soft tissue of 0.7 mm and a half-life of 6.7 days. Several clinical studies have established a maximum tolerated dose (45 m Ci/m 2 ) for 177 Lu-DOTA-rituximab, which shows a favorable clinical response without hematological toxicity. However, the molecular mechanisms of action by synergistic effect of anti-CD20 and radionuclide have not been studied. In this work was evaluated; by flow cytometry, the activation kinetics of the cell death mechanisms induced by the treatment with 177 Lu-DOTA-Anti-CD20 in non-Hodgkin (Raji) lymphoma cells. The absorbed radiation dose delivered to the cell nucleus was calculated by Monte Carlo simulation, considering the contribution of the beta emissions of the radiopharmaceutical present in the cell membrane and surrounding environment, as well as crossfire. This work shows that the application of radiation doses of 1 to 5 Gy of the radiopharmaceutical 177 Lu-DOTA-anti-CD20, are sufficient to induce cell death by apoptosis and arrest of the cell cycle. The combination of these factors (continuous delivery of radiation, activation of repair mechanisms and increased radio sensitivity) causes the acute activation of the apoptotic program resulting in significant cell death after 96 h of treatment. The temporal analysis of cell death suggests the early activation of apoptosis that is counteracted by the activation of repair processes caused by sustained irradiation, which leads to cell

  9. Cultural Identity Crisis inside Self-Same Culture as Reflected in György Lőrincz’s Novel Sounds of the Heart

    Directory of Open Access Journals (Sweden)

    Dani Erzsébet

    2017-09-01

    Full Text Available After the decisive historical moment of December 1989, the “border” is open for Transylvanian Hungarians and, in the subsequent euphoria, an exodus to the mother country commences. But with the political freedom of crossing national borders, due to globalization (too, new kinds of border problems present themselves for the youth leaving their native land: border issues of small versus large community, of interpersonal relations; the gap between generations; borders between majority versus minority identity and national versus cultural identity as well. This paper is a literary analysis with special focus on contemporary social phenomena, which will examine - through discussing a relevant contemporary Székely-Hungarian novel - how cultural identity can be deformed, damaged, or at least temporarily distorted when a Hungarian from beyond the border, who arrives in mother-country Hungary, will have to redefine herself/himself within a culture which, in this case, is basically one and the same.1 Can the identity-code, which was formed by, and grew strong in, the minority existence of the native land, function when s/he enters a cultural vacuum which turns out or can turn out to be another cultural maze for her or him? Can we talk about assimilation in such cases? What happens when a “rebellious” young individual’s “I” identity, unsteady in the first place, is left without the conserving and protective “We” identity in the confrontation of mother-nation versus beyond-the-border cultures so that, eventually, the young woman’s “I” identity will be damaged by big-city underworld (subculture. Or, will cultural mimicry emerge in this situation too as a strategy to help the individual retain his/her identity? We will seek answers to these questions through discussing a novel - A szív hangjai [Sounds of the Heart] - by a fine representative of contemporary Székely-Hungarian literature, György Lőrincz.

  10. DART-bid: dose-differentiated accelerated radiation therapy, 1.8 Gy twice daily. High local control in early stage (I/II) non-small-cell lung cancer

    Energy Technology Data Exchange (ETDEWEB)

    Zehentmayr, Franz; Wurstbauer, Karl; Deutschmann, Heinz; Sedlmayer, Felix [Landeskrankenhaus Salzburg, Univ.-Klinik fuer Radiotherapie und Radio-Onkologie, Univ.-Klinikum der Paracelsus Medizinischen Privatuniversitaet, Salzburg (Austria); Paracelsus Medizinische Privatuniversitaet, Institute for Research and Development of Advanced Radiation Technologies (radART), Salzburg (Austria); Fussl, Christoph; Kopp, Peter; Dagn, Karin; Fastner, Gerd [Landeskrankenhaus Salzburg, Univ.-Klinik fuer Radiotherapie und Radio-Onkologie, Univ.-Klinikum der Paracelsus Medizinischen Privatuniversitaet, Salzburg (Austria); Porsch, Peter; Studnicka, Michael [Landeskrankenhaus Salzburg, Univ.-Klinik fuer Pneumologie, Univ.-Klinikum der Paracelsus Medizinischen Privatuniversitaet, Salzburg (Austria)

    2014-09-23

    While surgery is considered standard of care for early stage (I/II), non-small-cell lung cancer (NSCLC), radiotherapy is a widely accepted alternative for medically unfit patients or those who refuse surgery. International guidelines recommend several treatment options, comprising stereotactic body radiation therapy (SBRT) for small tumors, conventional radiotherapy ≥ 60 Gy for larger sized especially centrally located lesions or continuous hyperfractionated accelerated RT (CHART). This study presents clinical outcome and toxicity for patients treated with a dose-differentiated accelerated schedule using 1.8 Gy bid (DART-bid). Between April 2002 and December 2010, 54 patients (median age 71 years, median Karnofsky performance score 70 %) were treated for early stage NSCLC. Total doses were applied according to tumor diameter: 73.8 Gy for < 2.5 cm, 79.2 Gy for 2.5-4.5 cm, 84.6 Gy for 4.5-6 cm, 90 Gy for > 6 cm. The median follow-up was 28.5 months (range 2-108 months); actuarial local control (LC) at 2 and 3 years was 88 %, while regional control was 100 %. There were 10 patients (19 %) who died of the tumor, and 18 patients (33 %) died due to cardiovascular or pulmonary causes. A total of 11 patients (20 %) died intercurrently without evidence of progression or treatment-related toxicity at the last follow-up, while 15 patients (28 %) are alive. Acute esophagitis ≤ grade 2 occurred in 7 cases, 2 patients developed grade 2 chronic pulmonary fibrosis. DART-bid yields high LC without significant toxicity. For centrally located and/or large (> 5 cm) early stage tumors, where SBRT is not feasible, this method might serve as radiotherapeutic alternative to present treatment recommendations, with the need of confirmation in larger cohorts. (orig.) [German] Die Standardbehandlung fuer nichtkleinzellige Bronchialkarzinome (NSCLC) im Stadium I/II ist die Operation, wobei Radiotherapie fuer Patienten, die nicht operabel sind oder die Operation ablehnen, als Alternative

  11. The association of rectal equivalent dose in 2 Gy fractions (EQD2) to late rectal toxicity in locally advanced cervical cancer patients who were evaluated by rectosigmoidoscopy in Faculty of Medicine, Chiang Mai University

    Energy Technology Data Exchange (ETDEWEB)

    Tharavichtikul, Ekkasit; Chitapanarux, Taned; Chakrabandhu, Somvilai; Klunklin, Pitchayaponne; Onchan, Wimrak; Wanwilairat, Somsak; Chitapanarux, Imjai [Faculty of Medicine, Chiang Mai University, Chiang Mai (Thailand); Meungwong, Pooriwat [Lampang Cancer Hospital, Lampang (Thailand); Traisathit, Patrinee [Faculty of Science, Chiang Mai University, Chiang Mai (Thailand); Galalae, Razvan [aculty of Medicine, Christian-Albrechts University at Kiel, Kiei (Germany)

    2014-06-15

    To evaluate association between equivalent dose in 2 Gy (EQD2) to rectal point dose and gastrointestinal toxicity from whole pelvic radiotherapy (WPRT) and intracavitary brachytherapy (ICBT) in cervical cancer patients who were evaluated by rectosigmoidoscopy in Faculty of Medicine, Chiang Mai University. Retrospective study was designed for the patients with locally advanced cervical cancer, treated by radical radiotherapy from 2004 to 2009 and were evaluated by rectosigmoidoscopy. The cumulative doses of WPRT and ICBT to the maximally rectal point were calculated to the EQD2 and evaluated the association of toxicities. Thirty-nine patients were evaluated for late rectal toxicity. The mean cumulative dose in term of EQD2 to rectum was 64.2 Gy. Grade 1 toxicities were the most common findings. According to endoscopic exam, the most common toxicities were congested mucosa (36 patients) and telangiectasia (32 patients). In evaluation between rectal dose in EQD2 and toxicities, no association of cumulative rectal dose to rectal toxicity, except the association of cumulative rectal dose in EQD2 >65 Gy to late effects of normal tissue (LENT-SOMA) scale > or = grade 2 (p = 0.022; odds ratio, 5.312; 95% confidence interval, 1.269-22.244). The cumulative rectal dose in EQD2 >65 Gy have association with > or = grade 2 LENT-SOMA scale.

  12. The association of rectal equivalent dose in 2 Gy fractions (EQD2) to late rectal toxicity in locally advanced cervical cancer patients who were evaluated by rectosigmoidoscopy in Faculty of Medicine, Chiang Mai University.

    Science.gov (United States)

    Tharavichtikul, Ekkasit; Meungwong, Pooriwat; Chitapanarux, Taned; Chakrabandhu, Somvilai; Klunklin, Pitchayaponne; Onchan, Wimrak; Wanwilairat, Somsak; Traisathit, Patrinee; Galalae, Razvan; Chitapanarux, Imjai

    2014-06-01

    To evaluate association between equivalent dose in 2 Gy (EQD2) to rectal point dose and gastrointestinal toxicity from whole pelvic radiotherapy (WPRT) and intracavitary brachytherapy (ICBT) in cervical cancer patients who were evaluated by rectosigmoidoscopy in Faculty of Medicine, Chiang Mai University. Retrospective study was designed for the patients with locally advanced cervical cancer, treated by radical radiotherapy from 2004 to 2009 and were evaluated by rectosigmoidoscopy. The cumulative doses of WPRT and ICBT to the maximally rectal point were calculated to the EQD2 and evaluated the association of toxicities. Thirty-nine patients were evaluated for late rectal toxicity. The mean cumulative dose in term of EQD2 to rectum was 64.2 Gy. Grade 1 toxicities were the most common findings. According to endoscopic exam, the most common toxicities were congested mucosa (36 patients) and telangiectasia (32 patients). In evaluation between rectal dose in EQD2 and toxicities, no association of cumulative rectal dose to rectal toxicity, except the association of cumulative rectal dose in EQD2 >65 Gy to late effects of normal tissue (LENT-SOMA) scale ≥ grade 2 (p = 0.022; odds ratio, 5.312; 95% confidence interval, 1.269-22.244). The cumulative rectal dose in EQD2 >65 Gy have association with ≥ grade 2 LENT-SOMA scale.

  13. PeoplePersonality: Chris Clarke - a physicist who studies ice cream Teaching Anecdotes: Annie Jump Cannon Obituary: György Marx 1927-2002 Starting Out: What Katie did next: part 3 Opinions: What is really important?

    Science.gov (United States)

    2003-03-01

    Featuring relationships, personalities, interactions, environments and reputations involved in physics and education PERSONALITY (156) Chris Clarke - a physicist who studies ice cream TEACHING ANECDOTES (157) Annie Jump Cannon OBITUARY (158) György Marx 1927-2002 Steven Chapman STARTING OUT (159) What Katie did next: part 3 Katie Pennicott OPINIONS (160) What is really important? Kerry Parker

  14. Prospective Study Delivering Simultaneous Integrated High-dose Tumor Boost (≤70 Gy) With Image Guided Adaptive Radiation Therapy for Radical Treatment of Localized Muscle-Invasive Bladder Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Hafeez, Shaista, E-mail: Shaista.Hafeez@icr.ac.uk [The Institute of Cancer Research, London (United Kingdom); The Royal Marsden National Health Service Foundation Trust, London (United Kingdom); Warren-Oseni, Karole [The Royal Marsden National Health Service Foundation Trust, London (United Kingdom); McNair, Helen A.; Hansen, Vibeke N.; Jones, Kelly; Tan, Melissa; Khan, Attia [The Institute of Cancer Research, London (United Kingdom); The Royal Marsden National Health Service Foundation Trust, London (United Kingdom); Harris, Victoria; McDonald, Fiona; Lalondrelle, Susan; Mohammed, Kabir; Thomas, Karen; Thompson, Alan; Kumar, Pardeep [The Royal Marsden National Health Service Foundation Trust, London (United Kingdom); Dearnaley, David; Horwich, Alan; Huddart, Robert [The Institute of Cancer Research, London (United Kingdom); The Royal Marsden National Health Service Foundation Trust, London (United Kingdom)

    2016-04-01

    Purpose: Image guided adaptive radiation therapy offers individualized solutions to improve target coverage and reduce normal tissue irradiation, allowing the opportunity to increase the radiation tumor dose and spare normal bladder tissue. Methods and Materials: A library of 3 intensity modulated radiation therapy plans were created (small, medium, and large) from planning computed tomography (CT) scans performed at 30 and 60 minutes; treating the whole bladder to 52 Gy and the tumor to 70 Gy in 32 fractions. A “plan of the day” approach was used for treatment delivery. A post-treatment cone beam CT (CBCT) scan was acquired weekly to assess intrafraction filling and coverage. Results: A total of 18 patients completed treatment to 70 Gy. The plan and treatment for 1 patient was to 68 Gy. Also, 1 patient's plan was to 70 Gy but the patient was treated to a total dose of 65.6 Gy because dose-limiting toxicity occurred before dose escalation. A total of 734 CBCT scans were evaluated. Small, medium, and large plans were used in 36%, 48%, and 16% of cases, respectively. The mean ± standard deviation rate of intrafraction filling at the start of treatment (ie, week 1) was 4.0 ± 4.8 mL/min (range 0.1-19.4) and at end of radiation therapy (ie, week 5 or 6) was 1.1 ± 1.6 mL/min (range 0.01-7.5; P=.002). The mean D{sub 98} (dose received by 98% volume) of the tumor boost and bladder as assessed on the post-treatment CBCT scan was 97.07% ± 2.10% (range 89.0%-104%) and 99.97% ± 2.62% (range 96.4%-112.0%). At a median follow-up period of 19 months (range 4-33), no muscle-invasive recurrences had developed. Two patients experienced late toxicity (both grade 3 cystitis) at 5.3 months (now resolved) and 18 months after radiation therapy. Conclusions: Image guided adaptive radiation therapy using intensity modulated radiation therapy to deliver a simultaneous integrated tumor boost to 70 Gy is feasible, with acceptable toxicity, and will be

  15. Optimal conditions of LDR to protect the kidney from diabetes: exposure to 12.5 mGy X-rays for 8 weeks efficiently protects the kidney from diabetes.

    Science.gov (United States)

    Cheng, Jie; Li, Fengsheng; Cui, Jiuwei; Guo, Weiying; Li, Cai; Li, Wei; Wang, Guixia; Xing, Xiao; Gao, Ying; Ge, Yuanyuan; Wang, Guanjun; Cai, Lu

    2014-05-08

    We reported the attenuation of diabetes-induced renal dysfunction by exposure to multiple low-dose radiation (LDR) at 25 mGy every other day by suppressing renal oxidative damage. We here explored the optimal conditions of LDR to protect the kidney from diabetes. Male C57BL/6J mice with type 1 diabetes were induced with multiple injections of low-dose streptozotocin. Diabetic mice received whole body X-irradiation at a dose of 12.5, 25 or 50 mGy every other day for either 4 or 8 weeks. Age-matched normal mice were similarly irradiated at the dose of 25 mGy for 4 or 8 weeks. The renal function and histopathological changes were examined at the 4th and 8th weeks of the study. Diabetes induced renal dysfunction is shown by the decreased creatinine and increased microalbumin in the urine. Renal oxidative damage, detected by protein nitration and lipid oxidation, and remodeling, reflected by increased expression of connective tissue growth factor, collagen IV and fibronectin, were significantly increased in diabetic mice. All these renal pathological and function changes in diabetic mice were significantly attenuated by exposure to LDR at all regimens, among which, however, exposure to LDR at 12.5 mGy for 8 weeks provided the best protective effect on the kidney of diabetic mice. Our results suggest that whole-body LDR at 12.5 mGy every other day for 8 weeks is the optimal condition of LDR to protect the kidney from diabetes. Copyright © 2014 Elsevier Inc. All rights reserved.

  16. Need for High Radiation Dose (≥70 Gy) in Early Postoperative Irradiation After Radical Prostatectomy: A Single-Institution Analysis of 334 High-Risk, Node-Negative Patients

    International Nuclear Information System (INIS)

    Cozzarini, Cesare; Montorsi, Francesco; Fiorino, Claudio; Alongi, Filippo; Bolognesi, Angelo; Da Pozzo, Luigi Filippo; Guazzoni, Giorgio; Freschi, Massimo; Roscigno, Marco; Scattoni, Vincenzo; Rigatti, Patrizio; Di Muzio, Nadia

    2009-01-01

    Purpose: To determine the clinical benefit of high-dose early adjuvant radiotherapy (EART) in high-risk prostate cancer (hrCaP) patients submitted to radical retropubic prostatectomy plus pelvic lymphadenectomy. Patients and Methods: The clinical outcome of 334 hrCaP (pT3-4 and/or positive resection margins) node-negative patients submitted to radical retropubic prostatectomy plus pelvic lymphadenectomy before 2004 was analyzed according to the EART dose delivered to the prostatic bed, <70.2 Gy (lower dose, median 66.6 Gy, n = 153) or ≥70.2 Gy (median 70.2 Gy, n = 181). Results: The two groups were comparable except for a significant difference in terms of median follow-up (10 vs. 7 years, respectively) owing to the gradual increase of EART doses over time. Nevertheless, median time to prostate-specific antigen (PSA) failure was almost identical, 38 and 36 months, respectively. At univariate analysis, both 5-year biochemical relapse-free survival (bRFS) and disease-free survival (DFS) were significantly higher (83% vs. 71% [p = 0.001] and 94% vs. 88% [p = 0.005], respectively) in the HD group. Multivariate analysis confirmed EART dose ≥70 Gy to be independently related to both bRFS (hazard ratio 2.5, p = 0.04) and DFS (hazard ratio 3.6, p = 0.004). Similar results were obtained after the exclusion of patients receiving any androgen deprivation. After grouping the hormone-naive patients by postoperative PSA level the statistically significant impact of high-dose EART on both 5-year bRFS and DFS was maintained only for those with undetectable values, possibly owing to micrometastatic disease outside the irradiated area in case of detectable postoperative PSA values. Conclusion: This series provides strong support for the use of EART doses ≥70 Gy after radical retropubic prostatectomy in hrCaP patients with undetectable postoperative PSA levels.

  17. Moderate risk-adapted dose escalation with 3D-conformal radiotherapy for prostate cancer from 70 to 74 Gy : long-term morbidity and survival from a prospective phase II trial

    International Nuclear Information System (INIS)

    Bombosch, V. B.

    2015-01-01

    Abstract English Background and Purpose: Evaluation of late side-effects and survival more than 60 months after 3-dimensional conformal radiotherapy with moderate, risk adapted dose escalation from 70 to 74 Gy in patients with localized prostate cancer within a prospective Austrian-German phase II multicenter trial. Material and Methods: Between 03/1999 and 07/2002 486 patients were registered in the prospective Austrian-German multicenter phase II trial. 441 (90.7%) patients were evaluated. Patients in the low and intermediate risk group were treated with 70Gy, patients in the high risk group received 74Gy. Additional hormonal-therapy was recommended for intermediate- and high-risk group patients. Gastrointestinal (GI) and genitourinary (GU) late toxicity according to EORTC/RTOG criteria, initial appearance, prevalence and duration of grade >=2 side-effects were investigated. Furthermore bNED (Phoenix/Nadir + 2), overall and disease specific survival were prospectively assessed. Results: Median follow-up was 90 (2-158) months in all 441 patients and 99 (18-158) months in living patients. 154 patients (35%) had a follow-up of longer or equal 120 months. Distribution among risk groups was 26% (low), 51% (intermediate) and 23% (high). HT was administered in 86% of patients prior to RT. Late gastrointestinal side-effects at 5- and 10 years were 29%/32% (70/74Gy) and 30%/35% (70/74Gy) as actuarial rates; p=0.67. Late genitourinary side-effects at 5- and 10 years were 17%/26% (70/74Gy) and 27%/34% (70/74Gy); p=0.12. No more than 15% (GI) and 15% (GU) of patients suffered from side-effects >=2 at any time after the end of therapy (prevalence). The proportion of patients suffering from severe toxicity was low (Grade 3 GI: 2%, GU: 10%). 10 year actuarial bNED rate was 65%, 70% and 58% in the low-, intermediate- and high risk group according to Phoenix (Nadir +2) criteria. Overall and disease specific survival were 67% and 91% in all patients. Conclusion: Dose escalation

  18. Does initial 45Gy of pelvic intensity-modulated radiotherapy reduce late complications in patients with locally advanced cervical cancer? A cohort control study using definitive chemoradiotherapy with high-dose rate brachytherapy

    International Nuclear Information System (INIS)

    Chen, Shang-Wen; Liang, Ji-An; Hung, Yao-Ching; Yeh, Lian-Shung; Chang, Wei-Chun; Lin, Wu-Chou; Chien, Chun-Ru

    2013-01-01

    Comparing initial 45 Gy of pelvic intensity-modulated radiation therapy (IMRT) and non-IMRT in terms of the late toxicities associated with advanced cervical cancer that has also been treated with definitive concurrent chemoradiotherapy and high-dose rate intracavitary brachytherapy (HDRICB). This retrospective study included 320 stage IB2-IIIB cervical cancer patients treated with CCRT (83 IMRT and 237 non-IMRT). The two groups had similar stage and HDRICB ratings. Following 45 Gy to the pelvis, HDRICB of 24 Gy in four courses was prescribed. Late toxicities, including rectal complications (RC), bladder complications (BC) and non-rectal intestinal injury (NRRII), were scored by the Common Terminology Criteria for Adverse Events. A logistic regression was used to estimate the odds ratio (OR) of the complications. With a median follow-up duration of 33 and 77 months for IMRT and non-IMRT, 33 patients had Grade 2 or higher late RC (7.2% IMRT, 11.4% non-IMRT), whereas that for BC was 40 (9.6% IMRT, 13.5% non-IMRT) and for NRRII was 48 (12.0% IMRT, 16.0% non-IMRT). The cumulative rate for total grade 3 or higher gastrointestinal or genitourinary toxicities was 8.4% and 11.8% (p = 0.33). IMRT did not reduce the OR for all endpoints; however, the ORs for rectum and bladder reference doses to Point A were associated with RC and BC. Locally advanced cervical cancer patients treated with initial 45Gy of pelvic IMRT and HDRICB have similar treatment-related late toxicities as those treated with non-IMRT. Optimization of the brachytherapy scheme is essential to minimize late toxicities

  19. Safety and Palliative Efficacy of Single-Dose 8-Gy Reirradiation for Painful Local Failure in Patients With Stage IV Non-Small Cell Lung Cancer Previously Treated With Radical Chemoradiation Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Topkan, Erkan, E-mail: docdretopkan@gmail.com [Baskent Department of Radiation Oncology, University Adana Medical Faculty, Adana (Turkey); Yildirim, Berna Akkus; Guler, Ozan Cem; Parlak, Cem [Baskent Department of Radiation Oncology, University Adana Medical Faculty, Adana (Turkey); Pehlivan, Berrin [Koc University, School of Medicine, Department of Radiation Oncology, Istanbul, and American Hospital, University of Texas MD Anderson Radiation Treatment Center, Istanbul (Turkey); Selek, Ugur [Medstar Hospital, Department of Radiation Oncology, Antalya (Turkey)

    2015-03-15

    Purpose: To investigate the safety and efficacy of single-dose 8-Gy palliative chest reirradiation (CRI) in metastatic non-small cell lung cancer (M-NSCLC) patients with painful thoracic failures (TF) within the previous radiation portal. Patients and Methods: We retrospectively analyzed the clinical data of 78 M-NSCLC patients who received single-dose 8-Gy CRI for painful TF after concurrent chemoradiation therapy to a total radiation dose of 52 to 66 Gy between 2007 and 2012. Primary endpoints included significant pain relief (SPR) defined as a ≥2 point decrement in the Visual Analogue Scale for Pain inventory (VAS-P), time to pain relief, and duration of pain control. Secondary objectives were survival and prognostic factors. Results: Treatment was well tolerated, with only 5.1% grade 3 pneumonitis and 1.3% grade 2 esophagitis. Pre-CRI median and post-CRI minimum VAS-P were 7 and 3 (P<.001), respectively. SPR was noted in 67 (85.9%) patients, and only 3 (3.9%) scored progressive pain. Median time to lowest VAS-P and duration of pain control were 27 days and 6.1 months, respectively. Median overall survival (OS) was 7.7 months, and the 1-year OS rate was 26.5%. On multivariate analyses, lower Eastern Cooperative Oncology group score (1-2; P<.001), absence of anemia (P=.001), and fewer metastatic sites (1-2; P<.001) were found to be associated with longer OS. Conclusions: Single-dose 8-Gy CRI provides safe, effective, and durable pain palliation for TF in radically irradiated M-NSCLC patients. Because of its convenience, lower cost, and higher comfort, the present protocol can be considered an appropriate option for patients with limited life spans.

  20. International Szent-Györgyi Prize for Progress in Cancer Research: basic and translational research recognition : Mary-Claire King received the 2016 Prize for her pioneering research that demonstrated the first evidence of genetic predisposition to breast cancer.

    Science.gov (United States)

    Hartmann, Hali; Zhao, Jie; Ba, Sujuan

    2017-11-21

    The Szent-Györgyi Prize for Progress in Cancer Research is a prestigious scientific award sponsored by the National Foundation for Cancer Research (NFCR)-a leading cancer research charitable organization in the United States that supports innovative cancer research globally with the ultimate goal to cure cancer. The coveted Szent-Györgyi Prize annually honors a scientist whose seminal discovery or body of work has resulted in, or led toward, notable contributions to cancer prevention, diagnosis, or treatment; and the discovery has had a high direct impact of saving people's lives. In addition, the prize promotes public awareness of the importance of basic cancer research and encourages the sustained investment needed to accelerate the translation of these research discoveries into new cancer treatments. In 2016, NFCR's Szent-Györgyi Prize Selection Committee was unanimous in its decision to recognize an icon in human disease genetics, Dr. Mary-Claire King, for her pioneering research that demonstrated the first evidence of genetic predisposition to breast cancer. Her proof of existence of BRCA1 gene and its location has made genetic screening for breast and ovarian cancers possible, saving lives of many people who are at high risk with inherited BRCA1 mutations.

  1. Evaluation of cell death mechanisms activated by the administration of the theranostics radiopharmaceutical {sup 177}Lu-DOTA-anti-CD20 in a dose range of 1-5 Gy; Evaluacion de los mecanismos de muerte celular activados por la administracion del radiofarmaco teranostico {sup 177}Lu-DOTA-anti-CD20 en un rango de dosis de 1-5 Gy

    Energy Technology Data Exchange (ETDEWEB)

    Martinez V, B. E.

    2016-07-01

    Radio-immunotherapy with anti-CD20 antibodies significantly increases the rate of remission in patients with CD20 over expressing B-cell lymphomas. Radio-labeled antibodies directed to surface antigens allow delivering scaled doses of radiation to specific targets thus limiting the dose to healthy tissue. Anti-CD20 causes cell death by two major pathways; activating the immune system to destroy malignant cells and inducing the activation of cell death pathways. The {sup 177}Lu is a beta particle emitter (max. 0.497 MeV) with a maximum soft tissue reach of 0.7 mm and a half-life of 6.7 days. Several clinical studies have established a maximum tolerated dose (45m Ci/m{sup 2}) for {sup 177}Lu-DOTA-rituximab, which shows a favorable clinical response without hematological toxicity. However, the molecular mechanisms of synergistic activation of anti-CD20 and radionuclide have not been studied. In this work we evaluated by flow cytometry, the activation kinetics of the cell death mechanisms induced by the treatment with {sup 177}Lu-DOTA-anti-CD20 from non-Hod king lymphoma cells (Raji). The absorbed radiation dose delivered to the cell nucleus was calculated by Monte Carlo simulation, considering the contribution of the beta emissions of the radiopharmaceutical present in the cell membrane and surrounding environment, as well as crossfire. This work shows that the application of radiation doses of 1 to 5 Gy of the radiopharmaceutical {sup 177}Lu-DOTA-anti-CD20 are sufficient to induce cell death by apoptosis and arrest of the cell cycle. The combination of these factors (continuous delivery of radiation activation of repair mechanisms and increased radio-sensitivity) causes acute activation of the apoptotic program resulting in significant cell death after 96 h of treatment. The temporal analysis of cell death suggests the early activation of apoptosis that is counteracted by the activation of repair processes caused by sustained irradiation, which leads to cell arrest

  2. Evaluation of the cell death mechanisms activated by the radiopharmaceutical {sup 177}Lu-DOTA-anti-CD20 in a dose range of 1 to 5 Gy; Evaluacion de los mecanismos de muerte celular activados por el radiofarmaco {sup 177}Lu-DOTA-anti-CD20 en un intervalo de dosis de 1 a 5 Gy

    Energy Technology Data Exchange (ETDEWEB)

    Azorin V, E.P.; Rojas C, E. L.; Martinez V, B. E.; Ramos B, J. C.; Jimenez M, N. P.; Ferro F, G., E-mail: erica.azorin@inin.gob.mx [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico)

    2016-10-15

    The radio immunotherapy with anti-CD20 antibodies significantly increases the remission rate of patients with B-cell lymphomas over expressing the CD20. The radiolabeled antibodies directed to surface antigens allow delivering scaled doses of radiation to specific targets thus limiting the dose to healthy tissue. The anti-CD20 causes cell death by two major pathways; activating the immune system to destroy malignant cells and inducing the activation of cell death pathways. The {sup 177}Lu is a beta particle emitter (max. 0.497 MeV) with a maximum reach on soft tissue of 0.7 mm and a half-life of 6.7 days. Several clinical studies have established a maximum tolerated dose (45 m Ci/m{sup 2}) for {sup 177}Lu-DOTA-rituximab, which shows a favorable clinical response without hematological toxicity. However, the molecular mechanisms of action by synergistic effect of anti-CD20 and radionuclide have not been studied. In this work was evaluated; by flow cytometry, the activation kinetics of the cell death mechanisms induced by the treatment with {sup 177}Lu-DOTA-Anti-CD20 in non-Hodgkin (Raji) lymphoma cells. The absorbed radiation dose delivered to the cell nucleus was calculated by Monte Carlo simulation, considering the contribution of the beta emissions of the radiopharmaceutical present in the cell membrane and surrounding environment, as well as crossfire. This work shows that the application of radiation doses of 1 to 5 Gy of the radiopharmaceutical {sup 177}Lu-DOTA-anti-CD20, are sufficient to induce cell death by apoptosis and arrest of the cell cycle. The combination of these factors (continuous delivery of radiation, activation of repair mechanisms and increased radio sensitivity) causes the acute activation of the apoptotic program resulting in significant cell death after 96 h of treatment. The temporal analysis of cell death suggests the early activation of apoptosis that is counteracted by the activation of repair processes caused by sustained irradiation

  3. High-dose (70-78 GY) conformal radiotherapy for prostate cancer; the relation between observed late bladder and rectum complications and parameters derived from the dose volume histograms

    International Nuclear Information System (INIS)

    Lebesque, J.V.; Bruce, A.; Boersma, L.J.; Velde, A. te

    1996-01-01

    Purpose: To determine the incidence of late gastrointestinal (GI) and genitourinary (GU) complications after conformal radiotherapy for prostate cancer, and to investigate the relation between these observed incidences and parameters derived from the Dose Volume Histograms (DVHs) of rectum and bladder wall. Patients and Methods: Hundred and thirty patients with T 2-4 G 1-3 N 0 M 0 prostate cancer were treated with conformal radiotherapy with the simultaneous boost technique in a dose-escalating protocol; 78 patients received a total dose of 70 Gy, 11 patients 74 - 76 Gy and 41 patients 78 Gy, each with a dose of 2 Gy per fraction. DVHs of the rectal wall were used to calculate NTCPs according to the model of Kutcher et al. with the estimated parameter values (n = 0.12, m = 0.15, TD 50 = 80 Gy) according to Burman et al. The median follow-up was 17 months (range 6 - 72 months). The crude and actuarial incidence of late (> 6 months) GI and GU complications were determined using the RTOG/EORTC morbidity scoring system (Grade I to IV). Results: Neither for late GI nor for GU complaints, a grade IV complication was observed. GU complaints occurred in 90 patients (69%): 54 patients (42%) only experienced grade I toxicity, 26 patients (20%) had grade II toxicity, and 10 patients (8%) had grade III complications, of which 8 patients (6%) developed a urethral (7 pts) or ureteric stenosis (1 pt). The actuarial incidence of grade III GU complications was 10% at 2 years. Since bladder wall DVHs are unreliable and most grade III complications were not related to the bladder, the grade II and/or III complications were analyzed in terms of the total prescribed dose only, but no correlation could be demonstrated. GI complications occurred in 71 patients (55%): 59 patients (45%) developed a grade I complication, 11 a grade II complication and only 1 patient required laser treatment twice and blood transfusion because of rectal bleeding (grade III). The actuarial incidence of GI

  4. Radiation-induced rib fracture after stereotactic body radiotherapy with a total dose of 54-56 Gy given in 9-7 fractions for patients with peripheral lung tumor: impact of maximum dose and fraction size.

    Science.gov (United States)

    Aoki, Masahiko; Sato, Mariko; Hirose, Katsumi; Akimoto, Hiroyoshi; Kawaguchi, Hideo; Hatayama, Yoshiomi; Ono, Shuichi; Takai, Yoshihiro

    2015-04-22

    Radiation-induced rib fracture after stereotactic body radiotherapy (SBRT) for lung cancer has been recently reported. However, incidence of radiation-induced rib fracture after SBRT using moderate fraction sizes with a long-term follow-up time are not clarified. We examined incidence and risk factors of radiation-induced rib fracture after SBRT using moderate fraction sizes for the patients with peripherally located lung tumor. During 2003-2008, 41 patients with 42 lung tumors were treated with SBRT to 54-56 Gy in 9-7 fractions. The endpoint in the study was radiation-induced rib fracture detected by CT scan after the treatment. All ribs where the irradiated doses were more than 80% of prescribed dose were selected and contoured to build the dose-volume histograms (DVHs). Comparisons of the several factors obtained from the DVHs and the probabilities of rib fracture calculated by Kaplan-Meier method were performed in the study. Median follow-up time was 68 months. Among 75 contoured ribs, 23 rib fractures were observed in 34% of the patients during 16-48 months after SBRT, however, no patients complained of chest wall pain. The 4-year probabilities of rib fracture for maximum dose of ribs (Dmax) more than and less than 54 Gy were 47.7% and 12.9% (p = 0.0184), and for fraction size of 6, 7 and 8 Gy were 19.5%, 31.2% and 55.7% (p = 0.0458), respectively. Other factors, such as D2cc, mean dose of ribs, V10-55, age, sex, and planning target volume were not significantly different. The doses and fractionations used in this study resulted in no clinically significant rib fractures for this population, but that higher Dmax and dose per fraction treatments resulted in an increase in asymptomatic grade 1 rib fractures.

  5. Radiation-induced rib fracture after stereotactic body radiotherapy with a total dose of 54–56 Gy given in 9–7 fractions for patients with peripheral lung tumor: impact of maximum dose and fraction size

    International Nuclear Information System (INIS)

    Aoki, Masahiko; Sato, Mariko; Hirose, Katsumi; Akimoto, Hiroyoshi; Kawaguchi, Hideo; Hatayama, Yoshiomi; Ono, Shuichi; Takai, Yoshihiro

    2015-01-01

    Radiation-induced rib fracture after stereotactic body radiotherapy (SBRT) for lung cancer has been recently reported. However, incidence of radiation-induced rib fracture after SBRT using moderate fraction sizes with a long-term follow-up time are not clarified. We examined incidence and risk factors of radiation-induced rib fracture after SBRT using moderate fraction sizes for the patients with peripherally located lung tumor. During 2003–2008, 41 patients with 42 lung tumors were treated with SBRT to 54–56 Gy in 9–7 fractions. The endpoint in the study was radiation-induced rib fracture detected by CT scan after the treatment. All ribs where the irradiated doses were more than 80% of prescribed dose were selected and contoured to build the dose-volume histograms (DVHs). Comparisons of the several factors obtained from the DVHs and the probabilities of rib fracture calculated by Kaplan-Meier method were performed in the study. Median follow-up time was 68 months. Among 75 contoured ribs, 23 rib fractures were observed in 34% of the patients during 16–48 months after SBRT, however, no patients complained of chest wall pain. The 4-year probabilities of rib fracture for maximum dose of ribs (Dmax) more than and less than 54 Gy were 47.7% and 12.9% (p = 0.0184), and for fraction size of 6, 7 and 8 Gy were 19.5%, 31.2% and 55.7% (p = 0.0458), respectively. Other factors, such as D2cc, mean dose of ribs, V10–55, age, sex, and planning target volume were not significantly different. The doses and fractionations used in this study resulted in no clinically significant rib fractures for this population, but that higher Dmax and dose per fraction treatments resulted in an increase in asymptomatic grade 1 rib fractures

  6. Predictors of pulmonary toxicity in limited stage small cell lung cancer patients treated with induction chemotherapy followed by concurrent platinum-based chemotherapy and 70 Gy daily radiotherapy: CALGB 30904.

    Science.gov (United States)

    Salama, Joseph K; Pang, Herbert; Bogart, Jeffrey A; Blackstock, A William; Urbanic, James J; Hogson, Lydia; Crawford, Jeffrey; Vokes, Everett E

    2013-12-01

    Standard therapy for limited stage small cell lung cancer (L-SCLC) is concurrent chemotherapy and radiotherapy followed by prophylactic cranial radiotherapy. Predictors of post chemoradiotherapy pulmonary toxicity in limited stage (LS) small cell lung cancer (SCLC) patients are not well defined. Current guidelines are derived from non-small cell lung cancer regimens, and do not account for the unique biology of this disease. Therefore, we analyzed patients on three consecutive CALGB LS-SCLC trials treated with concurrent chemotherapy and daily high dose radiotherapy (70 Gy) to determine patient and treatment related factors predicting for post-treatment pulmonary toxicity. Patients treated on CALGB protocols 39808, 30002, 30206 investigating two cycles of chemotherapy followed by concurrent chemotherapy and 70 Gy daily thoracic radiation therapy were pooled. Patient, tumor, and treatment related factors were evaluated to determine predictors of grade 3–5 pulmonary toxicities after concurrent chemoradiotherapy. 100 patients were included. No patient experienced grade 4–5 post-treatment pulmonary toxicity. Patients who experienced post-treatment pulmonary toxicity were more likely to be older (median age 69 vs 60, p = 0.09) and have smaller total lung volumes (2565 cc vs 3530 cc, p = 0.05).). Furthermore,exposure of larger volumes of lung to lower (median V5 = 70%, p = 0.09, median V10 = 63%, p = 0.07), inter-mediate (median V20 = 50, p = 0.04) and high (median V60 = 25%, p = 0.01) doses of radiation were all associated with post-treatment grade 3 pulmonary toxicity, as was a larger mean lung radiation dose(median 31 Gy) p = 0.019. Post-treatment pulmonary toxicity following the completion of 2 cycles of chemotherapy followed by concurrent chemotherapy and high dose daily radiation therapy was uncommon. Care should be taken to minimize mean lung radiation exposure, as well as volumes of low, intermediate and high doses of radiation.

  7. Studies on mechanism of treatment of granulocyte colony-stimulating factor, recombinant human interleukin-11 and recombinant human interleukin-2 on hematopoietic injuries induced by 4.5 Gy γ-rays irradiation in beagles

    International Nuclear Information System (INIS)

    Li Ming; Ou Hongling; Xing Shuang; Huang Haixiao; Xiong Guolin; Xie Ling; Zhao Yanfang; Zhao Zhenhu; Wang Ning; Wang Jinxiang; Miao Jingcheng; Zhu Nankang; Luo Qingliang; Cong Yuwen; Zhang Xueguang

    2010-01-01

    Objective: To investigate the mechanism of treatment of granulocyte colony-stimulating factor (rhG-CSF), recombinant human interleukin-11 (rhIL-11) and recombinant human interleukin-2 (rhIL-2) on hematopoietic injuries induced by 4.5 Gy 60 Co γ-ray irradiation in beagles, and to provide experimental evidence for the clinical treatment of extremely severe myeloid acute radiation sickness (ARS). Methods: Sixteen beagle dogs were given 4.5 Gy 60 Co γ-ray total body irradiation (TBI), then randomly assigned into irradiation control group, supportive care group or cytokines + supportive care (abbreviated as cytokines) group. In addition to supportive care, rhG-CSF, rhIL-11 and rhIL-2 were administered subcutaneously to treat dogs in cytokines group. The percentage of CD34 + cells, cell cycle and apoptosis of nucleated cells in peripheral blood were examined by Flow cytometry. Results: After 4.5 Gy 60 Co γ-ray irradiation, the CD34 + cells in peripheral blood declined obviously (61.3% and 52.1% of baseline for irradiation control and supportive care group separately). The cell proportion of nucleated cells in G 0 /G 1 phase was increased notably notably (99.27% and 99.49% respectively). The rate of apoptosis (26.93% and 21.29% separately) and necrosis (3.27% and 4.14%, respectively) of nucleated cells were elevated significantly when compared with values before irradiation (P 0 /G 1 phase blockage of nucleated cells became more serious (99.71%). The rate of apoptosis (5.66%) and necrosis (1.60%) of nucleated cells were significantly lower than that of irradiation control and supportive care groups 1 d after exposure. Conclusions: Cytokines maybe mobilize CD34 + cells in bone marrow to peripheral blood, indce cell block at G 0 /G 1 phase and reduce apoptosis, and eventually cure hematopoietic injuries induced by irradiation. (authors)

  8. DART-bid: dose-differentiated accelerated radiation therapy, 1.8 Gy twice daily. High local control in early stage (I/II) non-small-cell lung cancer

    International Nuclear Information System (INIS)

    Zehentmayr, Franz; Wurstbauer, Karl; Deutschmann, Heinz; Sedlmayer, Felix; Fussl, Christoph; Kopp, Peter; Dagn, Karin; Fastner, Gerd; Porsch, Peter; Studnicka, Michael

    2015-01-01

    While surgery is considered standard of care for early stage (I/II), non-small-cell lung cancer (NSCLC), radiotherapy is a widely accepted alternative for medically unfit patients or those who refuse surgery. International guidelines recommend several treatment options, comprising stereotactic body radiation therapy (SBRT) for small tumors, conventional radiotherapy ≥ 60 Gy for larger sized especially centrally located lesions or continuous hyperfractionated accelerated RT (CHART). This study presents clinical outcome and toxicity for patients treated with a dose-differentiated accelerated schedule using 1.8 Gy bid (DART-bid). Between April 2002 and December 2010, 54 patients (median age 71 years, median Karnofsky performance score 70 %) were treated for early stage NSCLC. Total doses were applied according to tumor diameter: 73.8 Gy for 6 cm. The median follow-up was 28.5 months (range 2-108 months); actuarial local control (LC) at 2 and 3 years was 88 %, while regional control was 100 %. There were 10 patients (19 %) who died of the tumor, and 18 patients (33 %) died due to cardiovascular or pulmonary causes. A total of 11 patients (20 %) died intercurrently without evidence of progression or treatment-related toxicity at the last follow-up, while 15 patients (28 %) are alive. Acute esophagitis ≤ grade 2 occurred in 7 cases, 2 patients developed grade 2 chronic pulmonary fibrosis. DART-bid yields high LC without significant toxicity. For centrally located and/or large (> 5 cm) early stage tumors, where SBRT is not feasible, this method might serve as radiotherapeutic alternative to present treatment recommendations, with the need of confirmation in larger cohorts. (orig.) [de

  9. Radioprotective effects of melanin-glucan complex from Fomes Fomentarius and indralin at irradiation of mice BALB/C by dose of 5,95 Gy/8,5 min

    Directory of Open Access Journals (Sweden)

    O. F. Seniuk

    2014-06-01

    Full Text Available Protective effect of melanin-glucan complex from F. fomentarius (MGC and Russian armed forces radiopro-tector indralin in the model of acute exposure by dose of 5.95 Gy/8.5min care is compared. Obtained results indi-cate availabi¬lity at MGC and indralin both direct and indirect "bystander effect” of DNA-protective properties, as well as severe anxiolytic activity. Thus for indralin protection factor was 0.33 when in MGC it was 2.3 times higher (0.75.

  10. Phase II-trial of radiation therapy with 45 Gy, 5-fluorouracil (5-FU) and mitomycin C (MMC) in patients with anal cancer - a rationale to add regional hyperthermia?

    International Nuclear Information System (INIS)

    Graf, R.; Wust, P.; Gellermann, J.; Mohr, B.; Goegler, H.; Riess, H.; Felix, R.

    1996-01-01

    Purpose: To evaluate the effect of standard regimen of chemoradiation for anal cancer with a radiation dose of 45 Gy on survival, local control and toxicity with respect to the discussion about intensification of therapy. Assessment of prognostic factors and designing improved treatment strategies for certain risk groups. Materials and Methods: From 1987 to 1995 46 patients with localized anal cancer were eligible. Thirty-five women and 11 men with a median age of 54 years were treated according to the protocoll. Thirty-two (70%) patients had histologically a squamous cell carcinoma, 12 (26%) a cloacogenic carcinoma. Thirty-one patients (68%) had T1, T2 tumors, 15 patients (33%) had locally advanced primary tumors (T3, T4), 9 patients (20%) had N1-3 disease. Radiotherapy consisted of 30 Gy to the primary tumor and pelvic lymph nodes, followed by one week treatment break and boost to the primary tumor to a total dose of 45 Gy with a single dose of 2 Gy, mean duration of radiotherapy 44 days. 5-FU was given on days 1-5 and 29-33 as continuous infusion (800 mg/m 2 /day), MMC (10 mg/m 2 ) was given intravenously as bolus on day 1 and 29. Patients were followed for survival and local control. Toxicity was assessed using Common Toxicity Criteria and the LENT score (late effects normal tissues). The mean follow-up time was 34,4 months. Results: The cancer specific actuarial 5-year survival rate was 69%: 79% in T1, T2 and 41% in T3, T4 tumors (p = 0,03). The 5-year actuarial local control rate was 74%: 89% in T1, T2 tumors, 42% ind T3, T4 tumors (p 5 cm): p 4 cm): p = 0,04, depth of infiltration: p < 0,00, response: p < 0,00. No local control was achievable for tumors greater than 6 cm, whereas all local failures occurred when there was extrasphincteric infiltration. Conclusions: Colostomy-free survival was unsatisfactory. Depth of infiltration (extrasphincteric involvement) as well as tumor size (≥ 5 cm) has been shown as negative prognostic factor for local control

  11. Tri-LORE-gy

    DEFF Research Database (Denmark)

    Mun, Terry

    . This thesis presents the work behind the establishment of Lotus Base, which has seen wide use across the legume research community since its launch. The modular construction and scalable design of this online resource will also hopefully inspire and maybe benefit ongoing efforts to establish specialised...... secretion system (T4SS), but dependent on pathogen-encoded T3SS. Furthermore, LjEin2b was found in a symbiotic phenotyping screen to be required for negative regulation of symbiosis, but also confers susceptibility towards microbial wilt agents. In addition, a whole transcriptome sequencing experiment......, comprehensive online portal providing a user-friendly interface to access all Lotus data. The creation of Lotus Base (https://lotus.au.dk) is a response to a fragmented data landscape, helping to unify and integrated various datasets, and to provide simple yet powerful data visualisation and analysis tools...

  12. High frequencies of chromatid aberrations produced during G/sub 2/ in human lymphocytes by very low doses (0. 025-0. 4 Gy) of X-rays in combination with inhibitors of DNA synthesis

    Energy Technology Data Exchange (ETDEWEB)

    Andersson, H.C.; Kihlman, B.A. (Uppsala Univ. (Sweden). Dept. of Genetics)

    1984-09-01

    Whole-blood cultures of human lymphocytes were exposed in the G/sub 2/-phase (3.5 h before harvesting) to various doses of X-rays and post-treated for 3 h with inhibitors of DNA synthesis. The inhibitors used were 2'-deoxyadenosine (dAdo), hydroxyurea (HU) and 1-..beta..-D-arabinofuranosylcytosine (ara-C). To prevent deamination of dAdo by adenosine deaminase (ADA), the dAdo treatments were carried out in the presence of the ADA inhibitor coformycin. HU and ara-C were used either alone or in combination. After the 3-h inhibitor treatments, the cultures were harvested and slides prepared and analyzed for chromatid aberrations in metaphase. When the inhibitors were used at concentrations high enough to cause marked chromosome damage by themselves, very low doses of X-rays (0.025-0.2 Gy) were sufficient to produce a dramatic increase in the frequency of chromatid aberrations. High frequencies of chromatid aberrations were also obtained when cultures that had received moderate doses of X-rays (0.4-0.8 Gy) were post-treated with low inhibitor concentrations that produce no or only a few aberrations by themselves.

  13. Very low-dose (0.15 mGy) chest CT protocols using the COPDGene 2 test object and a third-generation dual-source CT scanner with corresponding third-generation iterative reconstruction software.

    Science.gov (United States)

    Newell, John D; Fuld, Matthew K; Allmendinger, Thomas; Sieren, Jered P; Chan, Kung-Sik; Guo, Junfeng; Hoffman, Eric A

    2015-01-01

    The purpose of this study was to evaluate the impact of ultralow radiation dose single-energy computed tomographic (CT) acquisitions with Sn prefiltration and third-generation iterative reconstruction on density-based quantitative measures of growing interest in phenotyping pulmonary disease. The effects of both decreasing dose and different body habitus on the accuracy of the mean CT attenuation measurements and the level of image noise (SD) were evaluated using the COPDGene 2 test object, containing 8 different materials of interest ranging from air to acrylic and including various density foams. A third-generation dual-source multidetector CT scanner (Siemens SOMATOM FORCE; Siemens Healthcare AG, Erlangen, Germany) running advanced modeled iterative reconstruction (ADMIRE) software (Siemens Healthcare AG) was used.We used normal and very large body habitus rings at dose levels varying from 1.5 to 0.15 mGy using a spectral-shaped (0.6-mm Sn) tube output of 100 kV(p). Three CT scans were obtained at each dose level using both rings. Regions of interest for each material in the test object scans were automatically extracted. The Hounsfield unit values of each material using weighted filtered back projection (WFBP) at 1.5 mGy was used as the reference value to evaluate shifts in CT attenuation at lower dose levels using either WFBP or ADMIRE. Statistical analysis included basic statistics, Welch t tests, multivariable covariant model using the F test to assess the significance of the explanatory (independent) variables on the response (dependent) variable, and CT mean attenuation, in the multivariable covariant model including reconstruction method. Multivariable regression analysis of the mean CT attenuation values showed a significant difference with decreasing dose between ADMIRE and WFBP. The ADMIRE has reduced noise and more stable CT attenuation compared with WFBP. There was a strong effect on the mean CT attenuation values of the scanned materials for ring

  14. Induction chemotherapy with carboplatin, irinotecan, and paclitaxel followed by high dose three-dimension conformal thoracic radiotherapy (74 Gy) with concurrent carboplatin, paclitaxel, and gefitinib in unresectable stage IIIA and stage IIIB non-small cell lung cancer.

    Science.gov (United States)

    Stinchcombe, Thomas E; Morris, David E; Lee, Carrie B; Moore, Dominic T; Hayes, D Neil; Halle, Jan S; Rivera, M Patricia; Rosenman, Julian G; Socinski, Mark A

    2008-03-01

    Combined modality therapy is a standard therapy for patients with unresectable stage III non-small cell lung cancer (NSCLC). Gefitinib is active in advanced NSCLC, and in preclinical models, it potentiates the activity of radiation therapy. We investigate the tolerability of gefitinib in combined modality therapy in combination with three-dimensional thoracic conformal radiation therapy (3-dimensional TCRT). Stage III patients with a good performance status were treated with induction chemotherapy (carboplatin area under the curve [AUC] of 5, irinotecan 100 mg/m(2), and paclitaxel 175 mg/m(2) days 1 and 22) with pegfilgrastim support followed by concurrent chemotherapy (carboplatin AUC 2, and paclitaxel 45 mg/m(2) weekly) and gefitinib 250 mg daily beginning on day 43 with 3-dimensional TCRT to 74 Gy. Between March 2004 and January 2006, 23 patients received treatment on the trial: median age 62 years (range 44-82), 52% female, 61% stage IIIA, 61% performance status 0, 17% > or =5% weight loss, and 91% underwent positron emission tomography staging. Induction chemotherapy with pegfilgrastim support was well tolerated and active (partial response rate, 24%; stable disease, 76%; and early progression, 0%). Twenty-one patients initiated the concurrent chemoradiation, and 20 patients completed therapy to 74 Gy. The primary toxicities of concurrent chemoradiation were grade 3 esophagitis (19.5%) and cardiac arrhythmia (atrial fibrillation) (9.5%). The median progression-free survival and overall survival were 9 months (95% confidence intervals [CI]: 7-13 months) and 16 months (95% CI: 10-20 months), respectively. Treatment with induction chemotherapy and gefitinib concurrent with 3-dimensional TCRT has an acceptable toxicity and tolerability, but the survival results were disappointing.

  15. O tema da morte trágica de Liev Tolstói e seu impacto em Max Weber e György Lukács: sobre a autonomia nas ciências e na arte * Leo Tolstoy´s tragic death and his impacts on Max Weber and György Lukács: on autonomy of arts and science

    Directory of Open Access Journals (Sweden)

    LUIS FELIPE DE SALLES ROSELINO

    2014-04-01

    Full Text Available Resumo: O tema da morte trágica, presente nos escritos de Liev Tolstói, auxiliou tanto a Max Weber como a György Lukács a caracterizarem o pathos moderno de pressentimento da morte como uma contemplação do vazio. Weber e Lukács encontraram, através das leituras de Tolstói, uma interessante maneira de questionar a autonomia da arte e da ciência moderna, considerando pela esfera estética, como se mostra sem sentido a recente realidade imanente. Ambos assumiram o tema central das obras de Tolstói segundo uma mesma imagem, derivada do contraste entre o mundo antigo e o moderno. Max Weber adequou esse tema a sua teoria do desencantamento do mundo e Lukács, de modo muito semelhante, seguindo seu conceito do paradoxo da necessidade religiosa.Palavras-chave: Tolstói – Weber – Lukács – Desencantamento – Necessidade Religiosa – L’Art Pour l’Art. Abstract: The tragic death in Tolstoy's writings has helped both Max Weber and György Lukács in characterizing the modern pathos as a tragic contemplation of the emptiness of life. Through Tolstoy's readings, Weber and Lukács found an interesting source of denying arts and modern sciences autonomy, considering, from the aesthetics sphere, the meaningless of this new immanent reality. Both has assumed Tolstoy main theme from the same perspective, contrasting ancient and modern worldviews. Max Weber presented this theme in his disenchantment of world theory and Lukács, in a very similar way, following the paradox of religious needing as a mainline.Keywords: Tolstoy – Weber – Lukács – Disenchantment – Religious Needing – L’Art Pour l’Art.

  16. Survival Fraction at 2 Gy and γH2AX Expression Kinetics in Peripheral Blood Lymphocytes From Cancer Patients: Relationship With Acute Radiation-Induced Toxicities

    Energy Technology Data Exchange (ETDEWEB)

    Pouliliou, Stamatia E. [Department of Radiotherapy/Oncology, Radiobiology and Radiopathology Unit, School of Health Sciences, Democritus University of Thrace, Alexandroupolis (Greece); Lialiaris, Theodoros S. [Department of Medical Genetics, School of Health Sciences, Democritus University of Thrace, Alexandroupolis (Greece); Dimitriou, Thespis [Department of Anatomy, School of Health Sciences, Democritus University of Thrace, Alexandroupolis (Greece); Giatromanolaki, Alexandra [Department of Pathology, School of Health Sciences, Democritus University of Thrace, Alexandroupolis (Greece); Papazoglou, Dimitrios [Department of Internal Medicine, School of Health Sciences, Democritus University of Thrace, Alexandroupolis (Greece); Pappa, Aglaia [Department of Molecular Biology and Genetics, School of Health Sciences, Democritus University of Thrace, Alexandroupolis (Greece); Pistevou, Kyriaki [Department of Radiotherapy/Oncology, Aristotle University of Thessalonica, Thessalonica (Greece); Kalamida, Dimitra [Department of Radiotherapy/Oncology, Radiobiology and Radiopathology Unit, School of Health Sciences, Democritus University of Thrace, Alexandroupolis (Greece); Koukourakis, Michael I., E-mail: targ@her.forthnet.gr [Department of Radiotherapy/Oncology, Radiobiology and Radiopathology Unit, School of Health Sciences, Democritus University of Thrace, Alexandroupolis (Greece)

    2015-07-01

    Purpose: Predictive assays for acute radiation toxicities would be clinically relevant in radiation oncology. We prospectively examined the predictive role of the survival fraction at 2 Gy (SF2) and of γH2AX (double-strand break [DSB] DNA marker) expression kinetics in peripheral blood mononuclear cells (PBMCs) from cancer patients before radiation therapy. Methods and Materials: SF2 was measured with Trypan Blue assay in the PBMCs from 89 cancer patients undergoing radiation therapy at 4 hours (SF2{sub [4h]}) and 24 hours (SF2{sub [24h]}) after ex vivo irradiation. Using Western blot analysis and band densitometry, we further assessed the expression of γH2AX in PBMC DNA at 0 hours, 30 minutes, and 4 hours (33 patients) and 0 hour, 4 hours, and 24 hours (56 patients), following ex vivo irradiation with 2 Gy. Appropriate ratios were used to characterize each patient, and these were retrospectively correlated with early radiation therapy toxicity grade. Results: The SF2{sub (4h)} was inversely correlated with the toxicity grade (P=.006). The γH2AX-ratio{sub (30min)} (band density of irradiated/non-irradiated cells at 30 minutes) revealed, similarly, a significant inverse association (P=.0001). The DSB DNA repair rate from 30 minutes to 4 hours, calculated as the relative RγH2AX-ratio (γH2AX-ratio{sub (4h)}/γH2AX-ratio{sub (30min)}) showed a significant direct association with high toxicity grade (P=.01). Conclusions: Our results suggest that SF2 is a significant radiation sensitivity index for patients undergoing radiation therapy. γH2AX Western blot densitometry analysis provided 2 important markers of normal tissue radiation sensitivity. Low γH2AX expression at 30 minutes was linked with high toxicity grade, suggesting that poor γH2AX repair activity within a time frame of 30 minutes after irradiation predicts for poor radiation tolerance. On the other hand, rapid γH2AX content restoration at 4 hours after irradiation, compatible with

  17. Survival Fraction at 2 Gy and γH2AX Expression Kinetics in Peripheral Blood Lymphocytes From Cancer Patients: Relationship With Acute Radiation-Induced Toxicities

    International Nuclear Information System (INIS)

    Pouliliou, Stamatia E.; Lialiaris, Theodoros S.; Dimitriou, Thespis; Giatromanolaki, Alexandra; Papazoglou, Dimitrios; Pappa, Aglaia; Pistevou, Kyriaki; Kalamida, Dimitra; Koukourakis, Michael I.

    2015-01-01

    Purpose: Predictive assays for acute radiation toxicities would be clinically relevant in radiation oncology. We prospectively examined the predictive role of the survival fraction at 2 Gy (SF2) and of γH2AX (double-strand break [DSB] DNA marker) expression kinetics in peripheral blood mononuclear cells (PBMCs) from cancer patients before radiation therapy. Methods and Materials: SF2 was measured with Trypan Blue assay in the PBMCs from 89 cancer patients undergoing radiation therapy at 4 hours (SF2 [4h] ) and 24 hours (SF2 [24h] ) after ex vivo irradiation. Using Western blot analysis and band densitometry, we further assessed the expression of γH2AX in PBMC DNA at 0 hours, 30 minutes, and 4 hours (33 patients) and 0 hour, 4 hours, and 24 hours (56 patients), following ex vivo irradiation with 2 Gy. Appropriate ratios were used to characterize each patient, and these were retrospectively correlated with early radiation therapy toxicity grade. Results: The SF2 (4h) was inversely correlated with the toxicity grade (P=.006). The γH2AX-ratio (30min) (band density of irradiated/non-irradiated cells at 30 minutes) revealed, similarly, a significant inverse association (P=.0001). The DSB DNA repair rate from 30 minutes to 4 hours, calculated as the relative RγH2AX-ratio (γH2AX-ratio (4h) /γH2AX-ratio (30min) ) showed a significant direct association with high toxicity grade (P=.01). Conclusions: Our results suggest that SF2 is a significant radiation sensitivity index for patients undergoing radiation therapy. γH2AX Western blot densitometry analysis provided 2 important markers of normal tissue radiation sensitivity. Low γH2AX expression at 30 minutes was linked with high toxicity grade, suggesting that poor γH2AX repair activity within a time frame of 30 minutes after irradiation predicts for poor radiation tolerance. On the other hand, rapid γH2AX content restoration at 4 hours after irradiation, compatible with efficient DSB repair ability

  18. Performance in hippocampus- and PFC-dependent cognitive domains are not concomitantly impaired in rats exposed to 20 cGy of 1 GeV/n 56Fe particles

    Science.gov (United States)

    Britten, Richard A.; Miller, Vania D.; Hadley, Melissa M.; Jewell, Jessica S.; Macadat, Evangeline

    2016-08-01

    NASA is currently conducting ground based experiments to determine whether the radiation environment that astronauts will encounter on deep space missions will have an impact on their long-term health and their ability to complete the various tasks during the mission. Emerging data suggest that exposure of rodents to mission-relevant HZE radiation doses does result in the impairment of various neurocognitive processes. An essential part of mission planning is a probabilistic risk assessment process that takes into account the likely incidence and severity of a problem. To date few studies have reported the impact of space radiation in a format that is amenable to PRA, and those that have only reported data for a single cognitive process. This study has established the ability of individual male Wistar rats to conduct a hippocampus-dependent (spatial memory) task and a cortex-dependent (attentional set shifting task) 90 days after exposure to 20 cGy 1 GeV/n 56Fe particles. Radiation-induced impairment of performance in one cognitive domain was not consistently associated with impaired performance in the other domain. Thus sole reliance upon a single measure of cognitive performance may substantially under-estimate the risk of cognitive impairment, and ultimately it may be necessary to establish the likelihood that mission-relevant HZE doses will impair performance in the three or four cognitive domains that NASA considers to be most critical for mission success, and build a PRA using the composite data from such studies.

  19. Influence of age on radioinduced cognitive disorders: Experimental studies with cerebral irradiation of 30 Gy in 10 sessions and 12 days in the Wistar rat at 1.5, 4 and 18 months

    International Nuclear Information System (INIS)

    Lamproglou, I.; Baillet, F.; Boisserie, G.; Mazeron, J.J.; Delattre, J.Y.

    2002-01-01

    The objective of this study was to determine the influence of age on the learning and memory dysfunction induced by cranial radiation in the male Wistar rat. Ninety-six 45-day-old, 70 4-month-old, and 78 18-month-old male rats were divided in two equal groups: (i) irradiated and (ii) control. A course of whole-brain radiation therapy (30 Gy in 10 fractions over 12 days) was administered to the irradiated group, while the control group received sham irradiation. Sequential behavioral studies including one and two-way avoidance tests were undertaken before and after the 7 months following radiation. The results suggest that radiation induced progressive and irreversible memory dysfunction in elderly (18-month-old) rats, but this effect was partial or almost reversible in the 4-month-old and 45-day-old rats, respectively. In return, the learning dysfunction was age non-dependent despite the fact that is occurs more rapidly in the young (45 days, 4 months) rats. (author)

  20. Rózsa Ignácz’s Torockói gyász [‘Torockó Mourning’]: Identity Beyond the Borders of Time and Space

    Directory of Open Access Journals (Sweden)

    Zoltán Abádi-Nagy

    2016-10-01

    Full Text Available Rózsa Ignácz’s historical novel Torockói gyász [‘Torockó Mourning’] (1958 deals with the staggering tragedy of Transylvanian Torockó in 1702. But the referential pattern that emerges from the dramatic plot clearly points beyond eighteenth-century time and space in partly overt and mostly covert ways: to the early twentieth-century post-Trianon fate of the Hungarians in Transylvania, and beyond, to the destructive post-1945 totalitarian communist regime in Hungary, as well as to the backlash of the 1956 anticommunist and anti-Soviet revolution and war of independence. The narrative techniques of expanding early eighteenth-century time and space will be examined through the ways in which thematic threads of collective identity are woven in the novel in general, and the customs, habits, and the religious affiliation of the community are handled in particular. Theories of Jan Assmann, Michael Bamberg, David Herman, Erving Goffman, Fritz Heider and Anselm L. Strauss as well as observations of Ignácz researchers such as Lajos Kántor, Gabriella F. Komáromi, and Erzsébet Dani will be used.

  1. Influence of age on radioinduced cognitive disorders: Experimental studies with cerebral irradiation of 30 Gy in 10 sessions and 12 days in the Wistar rat at 1.5, 4 and 18 months; Influence de l'age sur les troubles cognitifs radioinduits : etudes experimentales avec irradiation cerebrale de 30 Gy en 10 seances et 12 jours chez le rat Wistar de 1 1/2, 4 et 18 mois

    Energy Technology Data Exchange (ETDEWEB)

    Lamproglou, I. [Lab. de Chimie et Biophysique des Traceurs, Faculte de Medecine Xavier Bichat, Paris (France); Baillet, F.; Boisserie, G.; Mazeron, J.J. [Service de Radiotherapie, Hopital de la Pitie-Salpetriere, Paris (France); Delattre, J.Y. [Dept. of Neurology and Inst. National de la Sante et de la Recherche Medicale, INSERM, Hopital de la Pitie-Salpetriere, Paris (France)

    2002-07-01

    The objective of this study was to determine the influence of age on the learning and memory dysfunction induced by cranial radiation in the male Wistar rat. Ninety-six 45-day-old, 70 4-month-old, and 78 18-month-old male rats were divided in two equal groups: (i) irradiated and (ii) control. A course of whole-brain radiation therapy (30 Gy in 10 fractions over 12 days) was administered to the irradiated group, while the control group received sham irradiation. Sequential behavioral studies including one and two-way avoidance tests were undertaken before and after the 7 months following radiation. The results suggest that radiation induced progressive and irreversible memory dysfunction in elderly (18-month-old) rats, but this effect was partial or almost reversible in the 4-month-old and 45-day-old rats, respectively. In return, the learning dysfunction was age non-dependent despite the fact that is occurs more rapidly in the young (45 days, 4 months) rats. (author)

  2. 90Y microsphere (TheraSphere) treatment for unresectable colorectal cancer metastases of the liver: response to treatment at targeted doses of 135-150 Gy as measured by [18F]fluorodeoxyglucose positron emission tomography and computed tomographic imaging.

    Science.gov (United States)

    Lewandowski, Robert J; Thurston, Kenneth G; Goin, James E; Wong, Ching-Yee O; Gates, Vanessa L; Van Buskirk, Mark; Geschwind, Jean-Francois H; Salem, Riad

    2005-12-01

    The purpose of this phase II study was to determine the safety and efficacy of TheraSphere treatment (90Y microspheres) in patients with liver-dominant colorectal metastases in whom standard therapies had failed or were judged to be inappropriate. Twenty-seven patients with unresectable hepatic colorectal metastases were treated at a targeted absorbed dose of 135-150 Gy. Safety and toxicity were assessed according to the National Cancer Institute's Common Toxicity Criteria, version 3.0. Response was assessed with use of computed tomography (CT) and was correlated with response on [18F]fluorodeoxyglucose (FDG) positron emission tomography (PET). Survival from first treatment was estimated with use of the Kaplan-Meier method. Tumor response measured by FDG PET imaging exceeded that measured by CT imaging for the first (88% vs 35%) and second (73% vs 36%) treated lobes. Tumor replacement of 25% or less (vs >25%) was associated with a statistically significant increase in median survival (339 days vs 162 days; P = .002). Treatment-related toxicities included mild fatigue (n = 13; 48%), nausea (n = 4; 15%), and vague abdominal pain (n = 5; 19%). There was one case of radiation-induced gastritis from inadvertent deposition of microspheres to the gastrointestinal tract (n = 1; 4%). Three patients (11%) experienced ascites/pleural effusion after treatment with TheraSphere as a consequence of liver failure in advanced-stage metastatic disease. With the exception of these three patients whose sequelae were not considered to be related to treatment, all observed toxicities were transient and resolved without medical intervention. TheraSphere administration appears to provide stabilization of liver disease with minimal toxicity in patients in whom standard systemic chemotherapy regimens have failed.

  3. Evaluation of cell death mechanisms activated by the administration of the theranostics radiopharmaceutical "1"7"7Lu-DOTA-anti-CD20 in a dose range of 1-5 Gy

    International Nuclear Information System (INIS)

    Martinez V, B. E.

    2016-01-01

    Radio-immunotherapy with anti-CD20 antibodies significantly increases the rate of remission in patients with CD20 over expressing B-cell lymphomas. Radio-labeled antibodies directed to surface antigens allow delivering scaled doses of radiation to specific targets thus limiting the dose to healthy tissue. Anti-CD20 causes cell death by two major pathways; activating the immune system to destroy malignant cells and inducing the activation of cell death pathways. The "1"7"7Lu is a beta particle emitter (max. 0.497 MeV) with a maximum soft tissue reach of 0.7 mm and a half-life of 6.7 days. Several clinical studies have established a maximum tolerated dose (45m Ci/m"2) for "1"7"7Lu-DOTA-rituximab, which shows a favorable clinical response without hematological toxicity. However, the molecular mechanisms of synergistic activation of anti-CD20 and radionuclide have not been studied. In this work we evaluated by flow cytometry, the activation kinetics of the cell death mechanisms induced by the treatment with "1"7"7Lu-DOTA-anti-CD20 from non-Hod king lymphoma cells (Raji). The absorbed radiation dose delivered to the cell nucleus was calculated by Monte Carlo simulation, considering the contribution of the beta emissions of the radiopharmaceutical present in the cell membrane and surrounding environment, as well as crossfire. This work shows that the application of radiation doses of 1 to 5 Gy of the radiopharmaceutical "1"7"7Lu-DOTA-anti-CD20 are sufficient to induce cell death by apoptosis and arrest of the cell cycle. The combination of these factors (continuous delivery of radiation activation of repair mechanisms and increased radio-sensitivity) causes acute activation of the apoptotic program resulting in significant cell death after 96 h of treatment. The temporal analysis of cell death suggests the early activation of apoptosis that is counteracted by the activation of repair processes caused by sustained irradiation, which leads to cell arrest and increases

  4. Seasonal Variations in Heart Rate Variability as an Indicator of Stress in Free-Ranging Pregnant Przewalski's Horses (E. ferus przewalskii within the Hortobágy National Park in Hungary

    Directory of Open Access Journals (Sweden)

    Friederike Pohlin

    2017-09-01

    Full Text Available Background: Ecosystems with seasonal fluctuations in climate and food availability present physiological challenges to resident mammals and may cause “stress.” The two predominant physiological responses to stressors are (1 the activation of the hypothalamic-pituitary-adrenal axis and (2 the modulation of the autonomic nervous system. To date, the primary indicator for “stress” in wildlife- and zoo animal research are glucocorticoid levels. By measuring the autonomic regulation of cardiac activity, particularly the vagal tone, heart rate variability (HRV is presently emerging as a suitable indicator of “stress” in farm- and domestic animal research.Objective: The aim of this study was to use HRV, a novel method in wildlife research, to assess seasonal patterns of “stress” in a group of free-ranging Przewalski's horses (Equus ferus przewalskii.Methods: Six pregnant Przewalski's horses from one harem within the Hortobágy National Park in Hungary were subjected to the study. We used a dedicated telemetry system consisting of a subcutaneously implanted transmitter and a receiver and storage unit in a collar to record HRV, heart rate (HR, subcutaneous body temperature, and activity throughout a one-year study period—climate data was also collected. We defined “stress” as a decrease in parasympathetic nervous system tone and calculated RMSSD (root mean square of successive differences as a measure of HRV. Linear mixed effects models with random intercept per individual were used for statistical analysis.Results: HRV and HR varied considerably throughout the year. Similar to temperate ruminants and hibernating mammals, Przewalski's horses experienced lower HR and HRV during winter, when resources are limited indicating decreased metabolic rates coupled with “stress.” In spring, we observed a drop of HRV along with a peak in HR indicating an increase of allostatic load that is most likely associated with increased energy

  5. Phase II, two-arm RTOG trial (94-11) of bischloroethyl-nitrosourea plus accelerated hyperfractionated radiotherapy (64.0 or 70.4 Gy) based on tumor volume (> 20 or ≤ 20 cm2, respectively) in the treatment of newly-diagnosed radiosurgery-ineligible glioblastoma multiforme patients

    International Nuclear Information System (INIS)

    Coughlin, C.; Scott, C.; Langer, C.; Coia, L.; Curran, W.; Rubin, P.

    2000-01-01

    Purpose: To compare survivorship, and acute and delayed toxicities following radiation therapy (RT) of radiosurgery-ineligible glioblastoma multiforme (GBM) patients treated with tumor volume-influenced, high-dose accelerated, hyperfractionated RT plus bischloroethyl-nitrosourea (BCNU), using prior RTOG malignant glioblastoma patients as historical controls. Methods and Materials: One hundred four of 108 patients accrued from June 1994 through May 1995 from 26 institutions were analyzable. Patients were histologically confirmed with GBM, and previously untreated. Treatment assignment (52 patients/arm) was based on tumor mass (TM), defined as the product of the maximum diameter and greatest perpendicular dimension of the titanium-gadolinium-enhanced postoperative MRI: Arm A, 64 Gy, TM > 20 cm 2 ; or Arm B, 70.4 Gy, TM ≤ 20 cm 2 . Both Arms A and B received BCNU (80 mg/m 2 , under hyperhydration) days 1-3, 56-58, then 4 cycles, each 8 weeks, for a total of 6 treatment series. Results: During the 24 months immediately post-treatment, the overall median survival was 9.1 months in Arm A (64 Gy) and 11.0 months in Arm B (70.4 Gy). Median survival in recursive partitioning analysis (RPA) Class III/IV was 10.4 months in Arm A and 12.2 months in Arm B, while RPA Class V/VI was 7.6 months in Arm A and 6.1 months in Arm B. There were no grade 4 neurological toxicities in Arm A; 2 grade 4 neurological toxicities were observed in Arm B (1 motor deficit, 1 necrosis at 157 days post-treatment). Conclusion: This strategy of high-dose, accelerated hyperfractionated radiotherapy shortens overall RT treatment times while allowing dose escalation, and it provides the potential for combination with currently available, as well as newer, chemotherapy agents. Survival is comparable with previously published RTOG data, and toxicities are within acceptable limits.

  6. A combination of high dose rate (10X FFF/2400 MU/min/10 MV X-rays) and total low dose (0.5 Gy) induces a higher rate of apoptosis in melanoma cells in vitro and superior preservation of normal melanocytes.

    Science.gov (United States)

    Sarojini, Sreeja; Pecora, Andrew; Milinovikj, Natasha; Barbiere, Joseph; Gupta, Saakshi; Hussain, Zeenathual M; Tuna, Mehmet; Jiang, Jennifer; Adrianzen, Laura; Jun, Jaewook; Catello, Laurice; Sanchez, Diana; Agarwal, Neha; Jeong, Stephanie; Jin, Youngjin; Remache, Yvonne; Goy, Andre; Ndlovu, Alois; Ingenito, Anthony; Suh, K Stephen

    2015-10-01

    The aim of this study was to determine the apoptotic effects, toxicity, and radiosensitization of total low dose irradiation delivered at a high dose rate in vitro to melanoma cells, normal human epidermal melanocytes (HEM), or normal human dermal fibroblasts (HDF) and to study the effect of mitochondrial inhibition in combination with radiation to enhance apoptosis in melanoma cells. Cells irradiated using 10X flattening filter-free (FFF) 10 MV X-rays at a dose rate of 400 or 2400 MU/min and a total dose of 0.25-8 Gy were analyzed by cell/colony counting, MitoTracker, MTT, and DNA-damage assays, as well as by quantitative real-time reverse transcriptase PCR in the presence or absence of mitochondrial respiration inhibitors. A dose rate of 2400 MU/min killed on average five-fold more melanoma cells than a dose rate 400 MU/min at a total dose of 0.5 Gy and preserved 80% survival of HEM and 90% survival of HDF. Increased apoptosis at the 2400 MU/min dose rate is mediated by greater DNA damage, reduced cell proliferation, upregulation of apoptotic genes, and downregulation of cell cycle genes. HEM and HDF were relatively unharmed at 2400 MU/min. Radiation induced upregulation of mitochondrial respiration in both normal and cancer cells, and blocking the respiration with inhibitors enhanced apoptosis only in melanoma cells. A high dose rate with a low total dose (2400 MU/min, 0.5 Gy/10X FFF 10 MV X-rays) enhances radiosensitivity of melanoma cells while reducing radiotoxicity toward HEM and HDF. Selective cytotoxicity of melanoma cells is increased by blocking mitochondrial respiration.

  7. Examination of GyE system for HIMAC carbon therapy

    International Nuclear Information System (INIS)

    Kanai, Tatsuaki; Matsufuji, Naruhiro; Miyamoto, Tadaaki; Mizoe, Junetsu; Kamada, Tadashi; Tsuji, Hiroshi; Kato, Hirotoshi; Baba, Masayuki; Tsujii, Hirohiko

    2006-01-01

    Purpose: A retrospective analysis was made to examine appropriateness in the estimation of the biologic effectiveness of carbon-ion radiotherapy using resultant data from clinical trials at the heavy-ion medical accelerator complex (HIMAC) at the National Institute of Radiological Sciences in Chiba, Japan. Methods and Materials: At HIMAC, relative biologic effectiveness (RBE) values of therapeutic carbon beams were determined based on experimental results of cell responses, on values expected with the linear-quadratic model, and based on experiences with neutron therapy. We use fixed RBE values independent of dose levels, although this apparently contradicts radiobiologic observations. Our RBE system depends only on LET of the heavy-ion radiation fields. With this RBE system, over 2,000 patients have been treated by carbon beams. With data from these patients, the local control rate of non-small-cell lung cancer was analyzed to verify the clinical RBE of the carbon beam. The local control rate was compared with rates published by groups from Gunma University and Massachusetts General Hospital. Using a simplified tumor control probability (TCP) model, clinical RBE values were obtained for different levels of TCP. Results: For the 50% level of the clinical TCP, the RBE values nearly coincide with those for in vitro human salivary gland cell survival at 10%. For the higher levels of clinical TCP, the RBE values approach closer to those adapted in clinical trials at HIMAC

  8. GY SAMPLING THEORY IN ENVIRONMENTAL STUDIES 2: SUBSAMPLING ERROR MEASUREMENTS

    Science.gov (United States)

    Sampling can be a significant source of error in the measurement process. The characterization and cleanup of hazardous waste sites require data that meet site-specific levels of acceptable quality if scientifically supportable decisions are to be made. In support of this effort,...

  9. ROYAL COLLEGE OF OBSTETRICIANS AND GY TAECOLOGISTS I

    African Journals Online (AJOL)

    Obstetricians and Gynaecologists to inaugurate the new South. African Regional .... steady advance in' scientific knowledge and clinical treatment. Note that of the three great discoveries I mentioned two, viz. anaes- thesia and antisepsis ...

  10. Trace-element geochemistry of metabasaltic rocks from the Yukon-Tanana Upland and implications for the origin of tectonic assemblages in east-central Alaska

    Science.gov (United States)

    Dusel-Bacon, C.; Cooper, K.M.

    1999-01-01

    We present major- and trace- element geochemical data for 27 amphibolites and six greenstones from three structural packages in the Yukon-Tanana Upland of east-central Alaska: the Lake George assemblage (LG) of Devono-Mississippian augen gneiss, quartz-mica schist, quartzite, and amphibolite; the Taylor Mountain assemblage (TM) of mafic schist and gneiss, marble, quartzite, and metachert; and the Seventymile terrane of greenstone, serpentinized peridotite, and Mississippian to Late Triassic metasedimentary rocks. Most LG amphibolites have relatively high Nb, TiO2, Zr, and light rare earth element contents, indicative of an alkalic to tholeiitic, within-plate basalt origin. The within-plate affinities of the LG amphibolites suggest that their basaltic parent magmas developed in an extensional setting and support a correlation of these metamorphosed continental-margin rocks with less metamorphosed counterparts across the Tintina fault in the Selwyn Basin of the Canadian Cordillera. TM amphibolites have a tholeiitic or calc-alkalic composition, low normalized abundances of Nb and Ta relative to Th and La, and Ti/V values of the proximity of the arc and marginal basin to continental crust. The arc geochemistry of TM amphibolites is consistent with a model in which the TM assemblage includes arc rocks generated above a west-dipping subduction zone outboard of the North American continental margin in mid-Paleozoic through Triassic time. The ocean-floor or within-plate basalt geochemistry of the Seventymile greenstones supports the correlation of the Seventymile terrane with the Slide Mountain terrane in Canada and the hypothesis that these oceanic rocks originated in a basin between the continental margin and an arc to the west.

  11. Pulmonary Toxicity in Stage III Non-Small Cell Lung Cancer Patients Treated With High-Dose (74 Gy) 3-Dimensional Conformal Thoracic Radiotherapy and Concurrent Chemotherapy Following Induction Chemotherapy: A Secondary Analysis of Cancer and Leukemia Group B (CALGB) Trial 30105

    International Nuclear Information System (INIS)

    Salama, Joseph K.; Stinchcombe, Thomas E.; Gu Lin; Wang Xiaofei; Morano, Karen; Bogart, Jeffrey A.; Crawford, Jeffrey C.; Socinski, Mark A.; Blackstock, A. William; Vokes, Everett E.

    2011-01-01

    Purpose: Cancer and Leukemia Group B (CALGB) 30105 tested two different concurrent chemoradiotherapy platforms with high-dose (74 Gy) three-dimensional conformal radiotherapy (3D-CRT) after two cycles of induction chemotherapy for Stage IIIA/IIIB non–small cell lung cancer (NSCLC) patients to determine if either could achieve a primary endpoint of >18-month median survival. Final results of 30105 demonstrated that induction carboplatin and gemcitabine and concurrent gemcitabine 3D-CRT was not feasible because of treatment-related toxicity. However, induction and concurrent carboplatin/paclitaxel with 74 Gy 3D-CRT had a median survival of 24 months, and is the basis for the experimental arm in CALGB 30610/RTOG 0617/N0628. We conducted a secondary analysis of all patients to determine predictors of treatment-related pulmonary toxicity. Methods and Materials: Patient, tumor, and treatment-related variables were analyzed to determine their relation with treatment-related pulmonary toxicity. Results: Older age, higher N stage, larger planning target volume (PTV)1, smaller total lung volume/PTV1 ratio, larger V20, and larger mean lung dose were associated with increasing pulmonary toxicity on univariate analysis. Multivariate analysis confirmed that V20 and nodal stage as well as treatment with concurrent gemcitabine were associated with treatment-related toxicity. A high-risk group comprising patients with N3 disease and V20 >38% was associated with 80% of Grades 3-5 pulmonary toxicity cases. Conclusions: Elevated V20 and N3 disease status are important predictors of treatment related pulmonary toxicity in patients treated with high-dose 3D-CRT and concurrent chemotherapy. Further studies may use these metrics in considering patients for these treatments.

  12. Pulmonary Toxicity in Stage III Non-Small Cell Lung Cancer Patients Treated With High-Dose (74 Gy) 3-Dimensional Conformal Thoracic Radiotherapy and Concurrent Chemotherapy Following Induction Chemotherapy: A Secondary Analysis of Cancer and Leukemia Group B (CALGB) Trial 30105

    Energy Technology Data Exchange (ETDEWEB)

    Salama, Joseph K., E-mail: joseph.salama@duke.edu [Duke University Medical Center, Durham, NC (United States); Stinchcombe, Thomas E. [University of North Carolina at Chapel Hill, Chapel Hill, NC (United States); Gu Lin; Wang Xiaofei [CALGB Statistical Center, Duke University Medical Center, Durham, NC (United States); Morano, Karen [Quality Assurance Review Center, Lincoln, RI (United States); Bogart, Jeffrey A. [State University of New York Upstate Medical University, Syracuse, NY (United States); Crawford, Jeffrey C. [Duke University Medical Center, Durham, NC (United States); Socinski, Mark A. [University of North Carolina at Chapel Hill, Chapel Hill, NC (United States); Blackstock, A. William [Wake Forest University School of Medicine, Winston-Salem, NC (United States); Vokes, Everett E. [University of Chicago, Chicago, IL (United States)

    2011-11-15

    Purpose: Cancer and Leukemia Group B (CALGB) 30105 tested two different concurrent chemoradiotherapy platforms with high-dose (74 Gy) three-dimensional conformal radiotherapy (3D-CRT) after two cycles of induction chemotherapy for Stage IIIA/IIIB non-small cell lung cancer (NSCLC) patients to determine if either could achieve a primary endpoint of >18-month median survival. Final results of 30105 demonstrated that induction carboplatin and gemcitabine and concurrent gemcitabine 3D-CRT was not feasible because of treatment-related toxicity. However, induction and concurrent carboplatin/paclitaxel with 74 Gy 3D-CRT had a median survival of 24 months, and is the basis for the experimental arm in CALGB 30610/RTOG 0617/N0628. We conducted a secondary analysis of all patients to determine predictors of treatment-related pulmonary toxicity. Methods and Materials: Patient, tumor, and treatment-related variables were analyzed to determine their relation with treatment-related pulmonary toxicity. Results: Older age, higher N stage, larger planning target volume (PTV)1, smaller total lung volume/PTV1 ratio, larger V20, and larger mean lung dose were associated with increasing pulmonary toxicity on univariate analysis. Multivariate analysis confirmed that V20 and nodal stage as well as treatment with concurrent gemcitabine were associated with treatment-related toxicity. A high-risk group comprising patients with N3 disease and V20 >38% was associated with 80% of Grades 3-5 pulmonary toxicity cases. Conclusions: Elevated V20 and N3 disease status are important predictors of treatment related pulmonary toxicity in patients treated with high-dose 3D-CRT and concurrent chemotherapy. Further studies may use these metrics in considering patients for these treatments.

  13. Fresh old news from Ferenczi about the function of dreams: the dream as a Kur, as a treatment and as a Gyógyászat.

    Science.gov (United States)

    Canesin Dal Molin, Eugênio

    2012-10-01

    This article discusses a text on the function of dreams and their relation to trauma. Ferenczi intended to present this material as a talk at the 12th International Congress of Psychoanalysis, which was to take place in Interlaken, Switzerland the same year that he wrote it (1931). The entire conference, however, was postponed, and parts of this communication's content appeared in other texts in which Ferenczi rethinks the concept of trauma and its clinical significance. In the present article the author makes use of the Freud/Ferenczi correspondence to contextualize Freud's Hungarian follower's originality regarding his theorizations about different aspects of the function of dreams. In the 1931 speech, as well as in this article, Ferenczi used a patient's dream work as a clinical example of a process in which traumatic experiences and unmastered sensory impressions can be repeated to achieve a better working-through for the dreamer. The process Ferenczi describes resembles an effort of self-treatment, of self-Kur. Copyright © 2012 Institute of Psychoanalysis.

  14. A randomized phase II trial of concurrent chemo-RT of oral vinorelbine and 60 Gy or 66 Gy, in locally advanced NSCLC

    DEFF Research Database (Denmark)

    Hansen, O.; Knap, M.; Khalil, A.

    2015-01-01

    eligible. The two arms were well balanced. The minimum and median potential follow-up was 14.5 and 32.6 m, respectively. The median number of Nav was 18 x in arm A and 20 x in arm B. Of the patients, 10% had 20%). A late effect esophageal stricture/ulceration G3 or more occurred in 3 (5%) of the patients...

  15. c Intes compo on die stine h osition ets wit istolog of Nile th both gy ...

    African Journals Online (AJOL)

    SAM

    plicates. Fish estigated. Tr had six rep ermined. Th hey were s the most e tein was e .... recommends the use of up to 20% sunflower in the diet of ... to improve the quality of feed. .... Trial 1 was run for a period of 120 days in a pond with a water.

  16. SPONGY (SPam ONtoloGY: Email Classification Using Two-Level Dynamic Ontology

    Directory of Open Access Journals (Sweden)

    Seongwook Youn

    2014-01-01

    Full Text Available Email is one of common communication methods between people on the Internet. However, the increase of email misuse/abuse has resulted in an increasing volume of spam emails over recent years. An experimental system has been designed and implemented with the hypothesis that this method would outperform existing techniques, and the experimental results showed that indeed the proposed ontology-based approach improves spam filtering accuracy significantly. In this paper, two levels of ontology spam filters were implemented: a first level global ontology filter and a second level user-customized ontology filter. The use of the global ontology filter showed about 91% of spam filtered, which is comparable with other methods. The user-customized ontology filter was created based on the specific user’s background as well as the filtering mechanism used in the global ontology filter creation. The main contributions of the paper are (1 to introduce an ontology-based multilevel filtering technique that uses both a global ontology and an individual filter for each user to increase spam filtering accuracy and (2 to create a spam filter in the form of ontology, which is user-customized, scalable, and modularized, so that it can be embedded to many other systems for better performance.

  17. Late changes in lungs of rats irradiated with 6.5 Gy of X-rays

    International Nuclear Information System (INIS)

    Mazanowska, A.M.; Jelenska, M.M.; Dancewicz, A.M.

    1978-01-01

    1, 3, 6 and 9 months after exposure of mature male rats to 650 rads of X-rays, the composition of isolated lung collagen has been estimated and the distribution of fatty acids in lipids of lung wash analyzed. The results obtained indicate that during the development of lung fibrosis proportion of type I to type III collagen in this organ increases. At the same period increases proportion of saturated fatty acids in lipids isolated from lung wash. Thus, radiation-induced fibrosis is accompanied not only by collagen accumulation but also by an essential change in the type of collagen produced. It seems that also the increased saturation of fatty acids in lung surfactant contributes to the impairment of function of fibrotic lung. (orig./AJ) [de

  18. O lirismo em György Lukács

    Directory of Open Access Journals (Sweden)

    Arlenice Almeida da Silva

    2009-06-01

    Full Text Available O artigo visa a examinar o tratamento dado ao lírico na obra estética do jovem Lukács. Em A alma e as formas o autor examina a poesia de Stefan George, encontrando nela elementos formais que apontam para o surgimento de um novo lirismo. Tal "forma significativa" possibilita ao autor introduzir uma abordagem do conceito de modernidade, em viés crítico e fenomenológico. Empreendimento que será completado em A teoria do romance, quando a tendência lírica se apresentará exacerbada, contaminando e alterando as configurações dos demais gêneros.The paper aims to examine the treatment of lyrical in the aesthetics work of the young Lukács. In The Soul and the Forms the author examines the poetry of Stefan George, finding on it formal elements that point out to the emergence of a new lyricism. This "significant form" allows the author to introduce an approach of the concept of modernity, in critical and phenomenological bias. Work that will be completed in The theory of Love, when the lyric trend will be exacerbated, contaminating and altering the settings of the other genera.

  19. Evaluation of the Effects of Variable Helmet Weight on Human Response During Lateral +Gy Impact

    National Research Council Canada - National Science Library

    Perry, Chris

    2003-01-01

    .... A series of tests was conducted by AFRL/HEPA on a horizontal impulse accelerator using human subjects to investigate the effects of helmet inertial properties on human response to short duration...

  20. The Effects of Gx, Gy and Gz Forces on Cone Mesopic Vision

    Science.gov (United States)

    1983-10-01

    of duration less than 1.0 seconds (time frame may vary depending on the source referred to). macular degeneration - Atrophy of the macula of the...rela- 7 tive number of cones itrcreases. In the macula , the visual center of the eye, there is virtually only cones. There are other anatomic...the cones in the center of the macula having a 1:1 synaptic ratio). These features allow small stimuli with minimal separated distances to activate

  1. Growt var. h, phy Punch ysiolog h as af gy and ffected hy flower d by ...

    African Journals Online (AJOL)

    SAM

    cell division ions of dam ... are able to physiology ..... ber of cells in stem and complete suppression of apical dominance which ... the ability of the compound to be translocated to the ... ear rec dar noz influ. The che tran. 34. Afr. J orophyll at pe wering stage ..... farinose by cycocel and evaluation regenerates using RADP and.

  2. Diagenetic paleo-conditions of the 'Francevillien A' (2.4-2.1 Gy) in Gabon

    International Nuclear Information System (INIS)

    Ossa Ossa, F.; El Albani, A.; Beaufort, D.; Meunier, A.; Fontaine, C.; Gauthier-Lafaye, F.

    2009-01-01

    The authors report a precise analysis of the geological structure and paleo-conditions of different parts of the Franceville paleo-proterozoic basin where manganese and uranium can be found, and where the presence of natural nuclear reactors in some geological formations make the Franceville basin a place of interest for the exploration of natural resources and for the paleo-migrations of 'radioactive wastes'. They tried to see whether clayey transformations are related to burying diagenesis or to hot fluid circulations induced by natural nuclear reactors

  3. SPONGY (SPam ONtoloGY): email classification using two-level dynamic ontology.

    Science.gov (United States)

    Youn, Seongwook

    2014-01-01

    Email is one of common communication methods between people on the Internet. However, the increase of email misuse/abuse has resulted in an increasing volume of spam emails over recent years. An experimental system has been designed and implemented with the hypothesis that this method would outperform existing techniques, and the experimental results showed that indeed the proposed ontology-based approach improves spam filtering accuracy significantly. In this paper, two levels of ontology spam filters were implemented: a first level global ontology filter and a second level user-customized ontology filter. The use of the global ontology filter showed about 91% of spam filtered, which is comparable with other methods. The user-customized ontology filter was created based on the specific user's background as well as the filtering mechanism used in the global ontology filter creation. The main contributions of the paper are (1) to introduce an ontology-based multilevel filtering technique that uses both a global ontology and an individual filter for each user to increase spam filtering accuracy and (2) to create a spam filter in the form of ontology, which is user-customized, scalable, and modularized, so that it can be embedded to many other systems for better performance.

  4. SPONGY (SPam ONtoloGY): Email Classification Using Two-Level Dynamic Ontology

    Science.gov (United States)

    2014-01-01

    Email is one of common communication methods between people on the Internet. However, the increase of email misuse/abuse has resulted in an increasing volume of spam emails over recent years. An experimental system has been designed and implemented with the hypothesis that this method would outperform existing techniques, and the experimental results showed that indeed the proposed ontology-based approach improves spam filtering accuracy significantly. In this paper, two levels of ontology spam filters were implemented: a first level global ontology filter and a second level user-customized ontology filter. The use of the global ontology filter showed about 91% of spam filtered, which is comparable with other methods. The user-customized ontology filter was created based on the specific user's background as well as the filtering mechanism used in the global ontology filter creation. The main contributions of the paper are (1) to introduce an ontology-based multilevel filtering technique that uses both a global ontology and an individual filter for each user to increase spam filtering accuracy and (2) to create a spam filter in the form of ontology, which is user-customized, scalable, and modularized, so that it can be embedded to many other systems for better performance. PMID:25254240

  5. Vegetation pattern and heavy metal accumulation at a mine tailing at Gyöngyösoroszi, hungary.

    Science.gov (United States)

    Tamás, János; Kovács, Alza

    2005-01-01

    Vegetation at an abandoned heavy metal bearing mine tailing may have multifunctional roles such as modification of water balance, erosion control and landscape rehabilitation. Research on the vegetation of mine tailings can provide useful information on tolerance, accumulation and translocation properties of species potentially applicable at moderately contaminated sites. Analyses of the relationship between heavy metal content (Pb, Zn and Cu) and vegetation in a mine tailing were carried out. These analyses included: (1) spatial analysis of relationship among heavy metal distribution, pH and vegetation patterns, and (2) analysis of heavy metal accumulation and translocation in some plant species. Presence of vegetation was found to be significantly dependent on pH value, which confirms that phytotoxicity is a function of element concentration in solution, which is primarily controlled by pH value in mine tailings. Among the most abundant plant species, dewberry (Rubus caesius), vipersbugloss (Echium vulgare), scarlet pimpernel (Anagallis arvensis) and narrowleaf plantain (Plantago lanceolata) accumulate significant amounts of Pb, Cu and Zn, while in the case of annual bluegrass (Poa annua) only Pb can be measured in elevated contents. Considering the translocation features, scarlet pimpernel, narrowleaf plantain, and dewberry accumulate heavy metals primarily in their roots, while heavy metal concentration in vipersbugloss and annual bluegrass is higher in the shoots.

  6. Development of the EGGS "Exam of GeoloGy Standards" to Measure Students' Understanding of Common Geology Concepts

    Science.gov (United States)

    Guffey, Sarah Katie; Slater, Timothy F.; Slater, Stephanie J.

    2017-01-01

    Geoscience education researchers have considerable need for criterion-referenced, easy-to-administer, easy-to-score, conceptual surveys for undergraduates taking introductory science survey courses in order for faculty to monitor the learning impacts of innovative teaching. In response, this study establishes the reliability and validity of a…

  7. Gyöngyi Szabó Földesi as Scientist and University Teacher in Hungarian and International Perspective

    Directory of Open Access Journals (Sweden)

    Földesi Gyöngyi Szabó

    2017-03-01

    Full Text Available This is the third article of the cycle of portraits of the members of the Editorial Board and Editorial Advisory Board of the journal Physical Culture and Sport. Studies and Research, who are eminent social scientists researching the issue of sport. Among them, there are many world-class professors, rectors and deans of excellent universities, founders, presidents and secretaries-general of continental and international scientific societies and editors of high-scoring journals related to social sciences focusing on sport. The journal Physical Culture and Sport. Studies and Research started its activities in 2008 and gathered many readers, distinguished authors and outstanding reviewers. It is worth taking a moment to present the profiles of the individual editors, thanks to whom the journal keeps getting better and better. The journal is increasingly appreciated internationally particular among the scientists from the humanist and social areas of investigations. The rapidly increasing number of its readers and its surprisingly wide reception, indicated by the number of visits and downloads in English-speaking countries, including hundreds of universities (up to 791 were interested in the content of issue 62 of our magazine, research institutes and related libraries, as well as academics, researchers and students, should be celebrated. These data are derived only from one bibliographic data base (EBSCO. It must be noted that the journal is indexed in 41 bases.

  8. Helical Magnetic Fields in AGN Jets Y. J. Chen1,2,∗ , G.-Y. Zhao1,2 ...

    Indian Academy of Sciences (India)

    Abstract. We establish a simple model to describe the helical mag- netic fields in AGN jets projected on the sky plane and the line-of-sight. This kind of profile has been detected in the polarimetric VLBI observa- tion of many blazar objects, suggesting the existence of helical magnetic fields in these sources. Key words.

  9. Experimental infection with Klebsiella pneumoniae and its gentamicin therapy in guinea pigs 60Co irradiated with 4 Gy

    International Nuclear Information System (INIS)

    Kallay, Z.; Trnovec, T.; Durisova, M.; Mazurova, E.; Navarova, J.; Plskova, M.; Kettner, M.

    1982-01-01

    Sublethal irradiation was used to suppress the immunity response of the organism. Following the development of infection with Klebsiella pneumoniae the therapeutical effect was compared of intramuscular administration and of inhalation of gentamicin. Intramuscular administration was statistically significant for reducing the mortality of infected guinea pigs as against non-treated animals at days 7 to 10 after irradiation. Administration by inhalation had the same effect between days 12 and 25 after irradiation. The weight and blood counts of the animals were observed during the experiment. (M.D.)

  10. The relationship between dose rate and transformation induction in C3H/10T1/2 cells by TRIGA reactor fission neutrons at 0.3 Gy

    International Nuclear Information System (INIS)

    Balcer-Kubiczek, E.K.; Harrison, G.H.

    1989-01-01

    The authors present their own and other data showing dose-effect relations for cell survival and the induction of transformations in C3H/IOT 1/2 cells in exponential or stationary cultures after a range of high dose-rate irradiations with X-rays or AFRRI neutrons. (UK)

  11. Bystander response to 2.5 Gy of protons in a human 3-dimensional skin model in 16 h after exposure

    Data.gov (United States)

    National Aeronautics and Space Administration — Bystander mechanisms that originate in the areas surrounding a tissue damage presumably play an important role participating in wound healing and tissue remodeling....

  12. Comparison of phototoxic effects of pregnant rats exposure in Chernobyl NPP site and external prolonged exposure in the dose of 0.5 Gy

    International Nuclear Information System (INIS)

    Grigor'eva, E.E.; Rogov, Yu.I.

    2007-01-01

    The morphometric study showed that within the 10-kilometre zone of the Chernobyl NPP delay of the rat fetus cerebral cortex maturation occurred, whereas used in the experiment prolonged low-dose irradiation did not cause essential disorders of cortical ontogenesis.(authors)

  13. Phase 1/2 Trials of Temozolomide, Motexafin Gadolinium, and 60-Gy Fractionated Radiation for Newly Diagnosed Supratentorial Glioblastoma Multiforme: Final Results of RTOG 0513

    Energy Technology Data Exchange (ETDEWEB)

    Brachman, David G., E-mail: david.brachman@dignityhealth.org [Arizona Oncology Services Foundation, Scottsdale, Arizona (United States); Barrow Neurological Institute, St. Joseph' s Hospital and Medical Center, Phoenix, Arizona (United States); Pugh, Stephanie L. [Radiation Therapy Oncology Group Statistical Center, Philadelphia, Pennsylvania (United States); Ashby, Lynn S. [Barrow Neurological Institute, St. Joseph' s Hospital and Medical Center, Phoenix, Arizona (United States); Thomas, Theresa A. [Arizona Oncology Services Foundation, Scottsdale, Arizona (United States); Dunbar, Erin M. [University of Florida College of Medicine, Gainesville, Florida (United States); Narayan, Samir [St. Joseph Mercy Hospital, Ann Arbor, Michigan (United States); Robins, H. Ian [University of Wisconsin Hospital, Madison, Wisconsin (United States); Bovi, Joseph A. [Medical College of Wisconsin, Milwaukee, Wisconsin (United States); Rockhill, Jason K. [University of Washington Medical Center, Seattle, Washington (United States); Won, Minhee [Barrow Neurological Institute, St. Joseph' s Hospital and Medical Center, Phoenix, Arizona (United States); Curran, Walter P. [Emory University, Atlanta, Georgia (United States)

    2015-04-01

    Purpose: The purpose of phase 1 was to determine the maximum tolerated dose (MTD) of motexafin gadolinium (MGd) given concurrently with temozolomide (TMZ) and radiation therapy (RT) in patients with newly diagnosed supratentorial glioblastoma multiforme (GBM). Phase 2 determined whether this combination improved overall survival (OS) and progression-free survival (PFS) in GBM recursive partitioning analysis class III to V patients compared to therapies for recently published historical controls. Methods and Materials: Dose escalation in phase 1 progressed through 3 cohorts until 2 of 6 patients experienced dose-limiting toxicity or a dose of 5 mg/kg was reached. Once MTD was established, a 1-sided 1-sample log-rank test at significance level of .1 had 85% power to detect a median survival difference (13.69 vs 18.48 months) with 60 deaths over a 12-month accrual period and an additional 18 months of follow-up. OS and PFS were estimated using the Kaplan-Meier method. Results: In phase 1, 24 patients were enrolled. The MTD established was 5 mg/kg, given intravenously 5 days a week for the first 10 RT fractions, then 3 times a week for the duration of RT. The 7 patients enrolled in the third dose level and the 94 enrolled in phase 2 received this dose. Of these 101 patients, 87 were eligible and evaluable. Median survival time was 15.6 months (95% confidence interval [CI]: 12.9-17.6 months), not significantly different from that of the historical control (P=.36). Median PFS was 7.6 months (95% CI: 5.7-9.6 months). One patient (1%) experienced a grade 5 adverse event possibly related to therapy during the concurrent phase, and none experience toxicity during adjuvant TMZ therapy. Conclusions: Treatment was well tolerated, but median OS did not reach improvement specified by protocol compared to historical control, indicating that the combination of standard RT with TMZ and MGd did not achieve a significant survival advantage.

  14. Muusikamaailm : Helsingi pidunädalad tänasest. Rossini festival Pesaros. Soome nädal "Promenaadisarjas". Preemia György Kurtagile / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    Soome muusikafestivalist Helsingin Juhlaviikot. Rossini festivalist Pesaros. Soome muusikute esinemisest "Promenaadikontsertidel" Londoni Royal Albert Hallis. G. Kurtagile määrati Saksamaal Tübingenis välja antav Friedrich Hölderlini preemia

  15. Influence of He and Ar injection on ammonia production in N2/D2 plasma in the medium flux GyM device

    Directory of Open Access Journals (Sweden)

    L. Laguardia

    2017-08-01

    Mass-spectrometry results showed that ND3 is formed only during the plasma phase of the experiment while LIC showed that ammonia production increases with Te and with the total neutral pressure. Optical Emission Spectroscopy confirms the presence of ND species in all the cases studied. The addition of He and Ar in the N2/D2 plasma, not modifing Te and ne, causes a reduction of ammonia formation, that is negligible in the case of Ar addition, while in the case of He reaches 80%. This suggests that He modifies the physical chemical process occurring at the wall, where the adsorbed He inhibits the reactions leading to ammonia formation at the metallic surface of the vessel. These results confirm the active role of a metallic surface in ammonia production and indicate He injection as a promising solution to limit the formation of the tritiated ammonia in the N seeded plasma of ITER.

  16. Muusikamaailm : Gergievi festival Rotterdamis. Los Angelese Ooper alustas. Luzerni festival tänaseni. Yaltah Menuhin lahkunud. Kyoto auhind György Ligetile / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    Rotterdami Filharmoonikute peadirigendi V. Gergijevi korraldatud muusikafestivalist. Los Angelese Ooperi hooaja algusest. Luzerni festivalist šveitsis. Lühidalt Yaltah Menuhinist. G. Ligeti pälvis Kyoto elutöö-auhinna

  17. Egy fénykép ürügyén : Minni Nurme / Károly Árpás

    Index Scriptorium Estoniae

    Árpás, Károly

    2003-01-01

    Luulenäited tekstis: "Éjszaka árnyék vagyok..."; "A felhőkönnyek csÍraszálai..."; Őszi esten; "Fekete szivárványt..."; Folyosók; Szeptember; "eső esik hervasztja..."; Életöröm; "gyerekek alusznak..." (tõlkinud Károly Árpás)

  18. Recent mortality statistics for distally exposed A-bomb survivors: The lifetime cancer risk for exposure under 50 cGy (rad)

    International Nuclear Information System (INIS)

    Nussbaum, R.H.; Belsey, R.E.; Koehnlein, W.

    1990-01-01

    An analysis of mortality statistics from the most recent Life Span Study reports of Hiroshima and Nagasaki survivors (covering both the 1950-1982 and the 1950-1985 follow-up periods) indicates a significant difference (p < 0.001) in cancer mortality rates between two distally exposed groups of survivors with organ-absorbed radiation doses under 40 cSv. This implies a mean incremental lifetime cancer risk (exclusive of leukemias) of about 25 excess fatal cancers per 10,000 persons exposed to one additional cSv (rem) of ionizing radiation for persons who had been exposed to doses in the range 1-40 cSv above background levels. This risk value is independent of whether the original (T65DR) dosimetry assignments (choosing a value of 10 for the relative biological effectiveness of neutrons) or the new dosimetry estimates (DS86) are used. The present estimate of A-bomb survivor radiogenic cancer risk associated with low dose exposure was obtained directly from the observed cancer deaths in the low-dose exposure groups without reliance on model-dependent extrapolation from high-dose data. This low-dose risk estimate is about ten times larger than the risk estimates adopted previously by national and international radiation commissions as a basis for current radiation safety guidelines for workers and the general public. (author)

  19. György Lukács, otázky marxistické ortodoxie a český marxismus

    Czech Academy of Sciences Publication Activity Database

    Landa, Ivan

    2017-01-01

    Roč. 1, č. 1 (2017), s. 39-48 ISSN 2570-7485 Institutional support: RVO:67985955 Keywords : Lukács * Dialetical Method * Totality * Kosík * Sochor * Dubský Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology

  20. High-dose radiotherapy (60 Gy) with oral UFT/folinic acid and escalating doses of oxaliplatin in patients with non-resectable locally advanced rectal cancer (LARC)

    DEFF Research Database (Denmark)

    Weber Vestermark, Lene; Jensen, Helle A; Pfeiffer, Per

    2012-01-01

    Consensus is that patients with locally advanced rectal cancer (LARC) should receive long-term chemoradiotherapy (CRT) before surgery. With the intent to offer the patients intensified concomitant chemotherapy (CT) to improve outcome and to assess tolerability and toxicity of oxaliplatin (Ox...

  1. A Survey of Learning Motivation among Junior and Senior English Ma?jors in Non-governmental Universities—A Case Study in Ningbo Dahon?gying University

    Institute of Scientific and Technical Information of China (English)

    GU Qian-qian

    2017-01-01

    Motivation is an important factor to English learning, it plays an important role. In this thesis, the instrument used in the study is a questionnaire, and this thesis was conducted on December 5th, 2016 at Ningbo Dahongying University involving 182 students. Based on the questionnaire investigation, this thesis discusses the learning motivation of English major juniors and seniors in Ningbo Dahongying University from the motivation types, factors and strategies...

  2. PYROXENITE VEINS WITHIN SSZ PERIDOTITES – EVIDENCE OF MELT-ROCK INTERACTION (EGIINGOL MASSIF, MAJOR AND TRACE ELEMENT COMPOSITION OF MINERALS

    Directory of Open Access Journals (Sweden)

    A. A. Karimov

    2017-01-01

    Full Text Available Evidence of melt-rock reaction between suprasubduction zone (SSZ peridotites and island arc boninititc and tholeiitic melts are identified. This process is the cause of replacive dunites and pyroxenite veins forming, which are represent the ways of island-arc melts migration. The peridotite-melt interaction is confirmed by compositional features of rocks and minerals. Influence of boninitic melt in peridotites of South Sandwich island arc leads to increasing of TiO2 and Cr-number (Cr# in spinels [Pearce et al., 2000] e.g. REE patterns of clinopyroxene from Voykar are equilibrium to boninitic melts [Belousov et al., 2009]. We show that pyroxenites are formed sequential, orthopyroxenites are originated firstly, websterites – after, and the main forming process is interaction of SSZ peridotites with percolating boninite-like melts.

  3. Long-term brain structural magnetic resonance imaging and cognitive functioning in children treated for acute lymphoblastic leukemia with high-dose methotrexate chemotherapy alone or combined with CNS radiotherapy at reduced total dose to 12 Gy

    Energy Technology Data Exchange (ETDEWEB)

    Zajac-Spychala, Olga; Pilarczyk, Jakub; Derwich, Katarzyna; Wachowiak, Jacek [Poznan University of Medical Sciences, Department of Pediatric Oncology, Hematology and Transplantology, Poznan (Poland); Pawlak, Mikolaj A. [Poznan University of Medical Sciences, Department of Neurology and Cerebrovascular Disorders, Poznan (Poland); Karmelita-Katulska, Katarzyna [Poznan University of Medical Sciences, Department of Neuroradiology, Poznan (Poland)

    2017-02-15

    The aim of this study was to assess the long-term side effects of central nervous system prophylaxis (high-dose chemotherapy alone vs chemotherapy and CNS radiotherapy) according to the ALL IC-BFM 2002. Thirty-tree children aged 6.7-19.9 years have been studied. The control group consisted of 12 children newly diagnosed with acute lymphoblastic leukemia. We assessed subcortical gray matter volume using automatic MRI segmentation and cognitive performance to identify differences between two therapeutic schemes and patients prior to treatment. Patients treated with chemotherapy and CNS radiotherapy had smaller hippocampi than two other subgroups and lower IQ score than patients treated with chemotherapy alone. Both treated groups, whether with chemotherapy only or in combination with CNS radiotherapy, had significantly lower volumes of caudate nucleus and performed significantly worse on measures of verbal fluency in comparison with patients prior to treatment. There were no differences in the mean volumes of total white matter, total gray matter, thalamus, putamen, and amygdala between the studied groups. In all children treated according to the ALL IC-BFM 2002 with high-dose chemotherapy, both decreased volume of selected subcortical structures and cognitive impairment was observed, especially in children who received chemotherapy in combination with reduced dose CNS radiotherapy. In all children treated according to the ALL IC-BFM 2002 with high-dose chemotherapy, both decreased volume of selected subcortical structures and cognitive impairment were observed, especially in children who received chemotherapy in combination with CNS radiotherapy. (orig.)

  4. Difference in the craniocaudal gradient of the maximum pixel value change rate between chronic obstructive pulmonary disease patients and normal subjects using sub-mGy dynamic chest radiography with a flat panel detector system.

    Science.gov (United States)

    Yamada, Yoshitake; Ueyama, Masako; Abe, Takehiko; Araki, Tetsuro; Abe, Takayuki; Nishino, Mizuki; Jinzaki, Masahiro; Hatabu, Hiroto; Kudoh, Shoji

    2017-07-01

    To compare the craniocaudal gradients of the maximum pixel value change rate (MPCR) during tidal breathing between chronic obstructive pulmonary disease (COPD) patients and normal subjects using dynamic chest radiography. This prospective study was approved by the institutional review board and all participants provided written informed consent. Forty-three COPD patients (mean age, 71.6±8.7 years) and 47 normal subjects (non-smoker healthy volunteers) (mean age, 54.8±9.8 years) underwent sequential chest radiographs during tidal breathing in a standing position using dynamic chest radiography with a flat panel detector system. We evaluated the craniocaudal gradient of MPCR. The results were analyzed using an unpaired t-test and the Tukey-Kramer method. The craniocaudal gradients of MPCR in COPD patients were significantly lower than those in normal subjects (right inspiratory phase, 75.5±48.1 vs. 108.9±42.0s -1 cm -1 , P<0.001; right expiratory phase, 66.4±40.6 vs. 89.8±31.6s -1 cm -1 , P=0.003; left inspiratory phase, 75.5±48.2 vs. 108.2±47.2s -1 cm -1 , P=0.002; left expiratory phase, 60.9±38.2 vs. 84.3±29.5s -1 cm -1 , P=0.002). No significant differences in height, weight, or BMI were observed between COPD and normal groups. In the sub-analysis, the gradients in severe COPD patients (global initiative for chronic obstructive lung disease [GOLD] 3 or 4, n=26) were significantly lower than those in mild COPD patients (GOLD 1 or 2, n=17) for both right and left inspiratory/expiratory phases (all P≤0.005). A decrease of the craniocaudal gradient of MPCR was observed in COPD patients. The craniocaudal gradient was lower in severe COPD patients than in mild COPD patients. Copyright © 2017 The Author(s). Published by Elsevier B.V. All rights reserved.

  5. Oncological outcomes from trimodality therapy receiving definitive doses of neoadjuvant chemoradiation (≥60 Gy and factors influencing consideration for surgery in stage III non-small cell lung cancer

    Directory of Open Access Journals (Sweden)

    Melissa A.L. Vyfhuis, MD PhD

    2017-07-01

    Conclusions: Trimodality treatment significantly improves survival and FFR in patients with LA-NSCLC when definitive doses of radiation with neoadjuvant chemotherapy are employed. We identified important demographic features that predict the use of surgical intervention in patients with stage III NSCLC.

  6. Моrрhоlоgy of inflorescensce and bluming peculiarities of Baptisia australis (L. R.Br. (Fabaceae introduced in М.М. Grishko National Botanical Garden NAS of Ukraine

    Directory of Open Access Journals (Sweden)

    Vira G. Mikolajchuk

    2014-04-01

    Full Text Available The structure of inflorescence in Baptisia australis introduced in conditions of M.M. Grishko National Botanical Garden in Kyiv has been studied. The dynamics of blooming and inflorescence development were analyzed.

  7. Long-term brain structural magnetic resonance imaging and cognitive functioning in children treated for acute lymphoblastic leukemia with high-dose methotrexate chemotherapy alone or combined with CNS radiotherapy at reduced total dose to 12 Gy

    International Nuclear Information System (INIS)

    Zajac-Spychala, Olga; Pilarczyk, Jakub; Derwich, Katarzyna; Wachowiak, Jacek; Pawlak, Mikolaj A.; Karmelita-Katulska, Katarzyna

    2017-01-01

    The aim of this study was to assess the long-term side effects of central nervous system prophylaxis (high-dose chemotherapy alone vs chemotherapy and CNS radiotherapy) according to the ALL IC-BFM 2002. Thirty-tree children aged 6.7-19.9 years have been studied. The control group consisted of 12 children newly diagnosed with acute lymphoblastic leukemia. We assessed subcortical gray matter volume using automatic MRI segmentation and cognitive performance to identify differences between two therapeutic schemes and patients prior to treatment. Patients treated with chemotherapy and CNS radiotherapy had smaller hippocampi than two other subgroups and lower IQ score than patients treated with chemotherapy alone. Both treated groups, whether with chemotherapy only or in combination with CNS radiotherapy, had significantly lower volumes of caudate nucleus and performed significantly worse on measures of verbal fluency in comparison with patients prior to treatment. There were no differences in the mean volumes of total white matter, total gray matter, thalamus, putamen, and amygdala between the studied groups. In all children treated according to the ALL IC-BFM 2002 with high-dose chemotherapy, both decreased volume of selected subcortical structures and cognitive impairment was observed, especially in children who received chemotherapy in combination with reduced dose CNS radiotherapy. In all children treated according to the ALL IC-BFM 2002 with high-dose chemotherapy, both decreased volume of selected subcortical structures and cognitive impairment were observed, especially in children who received chemotherapy in combination with CNS radiotherapy. (orig.)

  8. Nuclear Weapon Effect Research at PSR (Pacific-Sierra Research Corporation) - 1983. Symptomatology of Acute Radiation Effects in Humans after Exposure to Doses of 75 to 4500 Rads (cGy) Free-in-Air

    Science.gov (United States)

    1984-08-31

    David L. Auton and Cyrus P. Knowles supervised the research, and the IDP Core Group provided advisory support. Related reports include: George H. Anno...Cruiser-Destroyer Group 8 ATTN: Dir of Libraries I ATTN: Commander USA Military Academy David Taylor Naval Ship R&D Ctr ATTN: Doc Library ATTN.: Code... Shrier ATTN: V. Jackson 2 cys ATTN: Security & Subnation Conflict Horizons Technology, Inc ATTN: J. Palmer Rand CorpATTN: B. Bennett lIT Research

  9. Thermal effects of massive CO2 emissions associated with subduction volcanism

    NARCIS (Netherlands)

    Schuiling, R.D.

    2004-01-01

    Large volumes of CO₂ are emitted during volcanic activity at convergent plate boundaries, not only from volcanic centers. Their C isotopic signature indicates that this CO₂ is mainly derived from the decarbonation of subducted limestones or carbonated metabasalts, not as often admitted from magma

  10. Trace-element and multi-isotope geochemistry of Late-Archean black shales in the Carajas iron-ore district, Brazil

    DEFF Research Database (Denmark)

    Cabral, A. R.; Creaser, R. A.; Naegler, T.

    2013-01-01

    The 250-300-m-thick Carajas Formation in the Carajas mineral province, northern Brazil, consists of banded iron formation (including giant high-grade iron-ore deposits) and minor black shale, overlying a thick pile (2-3 km) of about 2.75-Ga-old metabasalt. Carbonaceous shale with pyrite-and local...

  11. Flow banding in basaltic pillow lavas from the Early Archean Hooggenoeg Formation, Barberton Greenstone Belt, South Africa

    Science.gov (United States)

    Robins, Brian; Sandstå, Nils Rune; Furnes, Harald; de Wit, Maarten

    2010-07-01

    Well-preserved pillow lavas in the uppermost part of the Early Archean volcanic sequence of the Hooggenoeg Formation in the Barberton Greenstone Belt exhibit pronounced flow banding. The banding is defined by mm to several cm thick alternations of pale green and a dark green, conspicuously variolitic variety of aphyric metabasalt. Concentrations of relatively immobile TiO2, Al2O3 and Cr in both varieties of lava are basaltic. Compositional differences between bands and variations in the lavas in general have been modified by alteration, but indicate mingling of two different basalts, one richer in TiO2, Al2O3, MgO, FeOt and probably Ni and Cr than the other, as the cause of the banding. The occurrence in certain pillows of blebs of dark metabasalt enclosed in pale green metabasalt, as well as cores of faintly banded or massive dark metabasalt, suggest that breakup into drops and slugs in the feeder channel to the lava flow initiated mingling. The inhomogeneous mixture was subsequently stretched and folded together during laminar shear flow through tubular pillows, while diffusion between bands led to partial homogenisation. The most common internal pattern defined by the flow banding in pillows is concentric. In some pillows the banding defines curious mushroom-like structures, commonly cored by dark, variolitic metabasalt, which we interpret as the result of secondary lateral flow due to counter-rotating, transverse (Dean) vortices induced by the axial flow of lava towards the flow front through bends, generally downward, in the tubular pillows. Other pillows exhibit weakly-banded or massive, dark, variolitic cores that are continuous with wedge-shaped apophyses and veins that intrude the flow banded carapace. These cores represent the flow of hotter and less viscous slugs of the dark lava type into cooled and stiffened pillows.

  12. Study design and rationale of a comparison of prasugrel and clopidogrel in medically managed patients with unstable angina/non-ST-segment elevation myocardial infarction: the TaRgeted platelet Inhibition to cLarify the Optimal strateGy to medicallY manage Acute Coronary Syndromes (TRILOGY ACS

    DEFF Research Database (Denmark)

    Chin, Chee Tang; Roe, Matthew T; Fox, Keith A A

    2010-01-01

    Practice guidelines recommend dual antiplatelet therapy with aspirin and clopidogrel for patients with non-ST-segment elevation acute coronary syndromes (NSTE ACS) regardless of in-hospital management strategy. Prasugrel-a thienopyridine adenosine diphosphate receptor antagonist that provides...... higher and less variable levels of platelet inhibition than clopidogrel-has demonstrated benefit when used to treat ACS patients undergoing percutaneous coronary intervention. However, the optimal approach to antiplatelet therapy for high-risk, medically managed NSTE ACS patients remains uncertain...... revascularization procedures for their index event. Patients will be randomly allocated to prasugrel + aspirin versus clopidogrel + aspirin for a median duration of 18 months. A reduction in the maintenance dose of prasugrel for elderly patients (age >or=75 years) and those with body weight or=75 years). TRILOGY...

  13. Stopping the greenhouse effect - recommendations submitted by the Bundestag Enquete Commission. - Why nuclear energy cannot solve the global-warming problem - on the urgency of a low-risk, efficient future energy economy. - The latest cancer statistics of the Hiroshima/Nagasaki A-bomb survivors - a higher radiation risk at dose rates below 50cGy (rad) - consequences for radiation protection

    International Nuclear Information System (INIS)

    Bach, W.; Kohler, S.; Koehnlein, W.

    1991-01-01

    The report compiles three contributions two of which discuss the issues of global warming, trace gases and ozone depletion. The measures proposed by a German enquete commision to stop the greenhouse effect, i.e. utilization of renewable energy sources, nuclear phaseout because nuclear power is not supposed to solve the global-warming problem, are described. The third contribution gives the latest cancer statistics of the Hiroshima/Nagasaki a-bomb survivors while taking into account the higher radiation risk due to low dose rates. (DG) [de

  14. Total reference air kerma can accurately predict isodose surface volumes in cervix cancer brachytherapy. A multicenter study

    DEFF Research Database (Denmark)

    Nkiwane, Karen S; Andersen, Else; Champoudry, Jerome

    2017-01-01

    PURPOSE: To demonstrate that V60 Gy, V75 Gy, and V85 Gy isodose surface volumes can be accurately estimated from total reference air kerma (TRAK) in cervix cancer MRI-guided brachytherapy (BT). METHODS AND MATERIALS: 60 Gy, 75 Gy, and 85 Gy isodose surface volumes levels were obtained from treatm...

  15. Assessing the origin of old apparent ages derived by Pb stepwise leaching of vein-hosted epidote from Mount Isa, northwest Queensland, Australia

    Science.gov (United States)

    Duncan, Robert J.; Maas, Roland

    2014-12-01

    Epidote metasomatism affected large areas of tholeiitic metabasalts of the ~1,780 Ma Eastern Creek Volcanics in the Western Fold Belt of the Proterozoic Mount Isa inlier. Hydrothermal epidote generally occurs in quartz veins parallel to or boudinaged within the dominant S2 fabrics which formed during the regional metamorphic peak at ~1,570 Ma associated with the Isan orogeny. Previously published stable isotopic and halogen data suggest that the fluids responsible for epidote formation are metamorphic in origin (with an evaporitic component). Application of the Pb stepwise leaching technique to the epidote does not separate radiogenic Pb4+ and common Pb2+, generating little spread in 206Pb/204Pb (between 16.0 and 30.5). The causes for this relatively low range are twofold: There is little radiogenic Pb in the epidotes (the most radiogenic steps account for leaching data give ages between 150 and 1,500 myrs older than the host rocks and over 450 myrs older than the thermal metamorphic peak. These old ages are attributed to chemical inheritance from the host metabasalts, via radiogenic Pb release by breakdown of phases such as zircon, monazite, titanomagnetite, and ilmenite during metamorphism. This idea is supported by trace element data and chrondrite-normalized rare earth element patterns that are similar to both the metabasalts and epidotes (except for a variable Eu anomaly in the latter). Relatively high fO2 during vein formation (Fe3+ dominates in the epidote crystal lattice) would allow the incorporation of Th4+ and exclusion of U6+ and would explain elevated Th/U ratios (up to 12) in epidote compared with the host metabasalts. Non-incorporation of U would explain the relatively low U/Pb ratios and non-radiogenic character of the epidote. This process may provide a source of metal for the small U deposits around Mount Isa and may also suggest a relationship between U mineralization and regional Cu mobilization during the Isan orogeny. Our work suggests that

  16. Mineralogy and geochemistry of two metamorphosed sedimentary manganese deposits, Sierra Nevada, California, USA

    Science.gov (United States)

    Flohr, M.J.K.; Huebner, J.S.

    1992-01-01

    Laminated to massive rhodochrosite, hausmannite, and Mn-silicates from the Smith prospect and Manga-Chrome mine, Sierra Nevada, California were deposited as ocean floor sediments associated with chert and shale. The principal lithologies at Smith are chert, argillite, rhodochrosite-, hausmannite- and chlorite-rich layers, and relatively uncommon layers of jacobsite. The Manga-Chrome mine also contains layers rich in manganoan calcite and caryopilite. Tephroite, rhodonite, spessartine, and accessory alleghanyite and sonolite formed during metamorphism. Volcaniclastic components are present at Manga-Chrome as metavolcanic clasts and as Mn-poor, red, garnet- and hematite-rich layers. There is no evidence, such as relict lithologies, that Mn was introduced into Mn-poor lithologies such as chert, limestone or mudstone. Replacement of Mn-poor phases by Mn-rich phases is observed only in the groundmass of volcanic clasts that appear to have fallen into soft Mn-rich mud. Manganiferous samples from the Smith prospect and Manga-Chrome mine have high Mn Fe and low concentrations of Ni, Cu, Zn, Co, U, Th and the rare-earth elements that are similar to concentrations reported from other ancient Mn deposits found in chert-greenstone complexes and from manganiferous sediments and crusts that are forming near modern sea floor vents. The Sierra Nevada deposits formed as precipitates of Mn-rich sediments on the sea floor, probably from mixtures of circulating hydrothermal fluids and seawater. The composition of a metabasalt from the Smith prospect is consistent with those of island-arc tholeiites. Metavolcanic clasts from the Manga-Chrome mine are compositionally distinct from the Smith metabasalt and have alkaline to calc-alkaline affinities. A back-arc basin is considered to be the most likely paleoenvironment for the formation of the Mn-rich lenses at the Manga-Chrome mine and, by association, the Smith prospect. Layers of rhodochrosite, hausmannite and chert preserve the

  17. Lead isotope evolution across the Neoproterozoic boundary between craton and juvenile crust, Bayuda Desert, Sudan

    Science.gov (United States)

    Evuk, David; Lucassen, Friedrich; Franz, Gerhard

    2017-11-01

    Metaigneous mafic and ultramafic rocks from the juvenile Neoproterozoic Arabian Nubian Shield (ANS) and the Proterozoic, reworked Saharan Metacraton (SMC) have been analysed for major- and trace elements and Sr, Nd, and Pb isotopes. Most of the rocks are amphibolites metamorphosed at amphibolite facies conditions, some with relicts of a granulite facies stage. The other rocks are metapyroxenites, metagabbros, and some ultramafic rocks. Trace element compositions of the metabasaltic (dominantly tholeiitic) rocks resemble the patterns of island arcs and primitive lavas from continental arcs. Variable Sr and Nd isotope ratios indicate depleted mantle dominance for most of the samples. 207Pb/204Pb signatures distinguish between the influence of high 207Pb/204Pb old SMC crust and depleted mantle signatures of the juvenile ANS crust. The Pb isotope signatures for most metabasaltic rocks, metapyroxenites and metagabbros from SMC indicate an autochthonous formation. The interpretation of the new data together with published evidence from mafic xenoliths on SMC and ophiolite from ANS allows an extrapolation of mantle evolution in time. There are two lines of evolution in the regional mantle, one, which incorporates potential upper crust material during Neoproterozoic, and a second one with a depleted mantle signature since pre-Neoproterozoic that still is present in the Red Sea and Gulf of Aden spreading centres.

  18. Supracrustal suite of the Precambrian crystalline crust in the Ghor Province of Central Afghanistan

    Directory of Open Access Journals (Sweden)

    Gediminas Motuza

    2017-01-01

    Full Text Available The Proterozoic pre-Ediacaran metamorphic basement of the southern Tajik (North Afghanistan continental block and the adjacent Band-e-Bayan zone is exposed in the Ghor Province of Central Afghanistan. It is predominantly composed of the EW-striking supracrustal succession consisting of interbedded felsic schists and gneisses (metapsammites, amphibolites (metabasalts, calcite and dolomite marbles. The metamorphic facies changes from greenschist in the Band-e-Bayan zone to amphibolite facies in the Tajik block. The supracrustal rocks of the Band-e-Bayan zone and Tajik block possess common features suggesting that the former represents a tectonized part of the latter. The geochemical characteristics of metapsammites indicate derivation of the clastic material from a continental arc and, partly from a passive continental margin, whereas the composition of metabasalts suggests their possible formation in a continental rift basin. The tectonic setting of supracrustal unit could be interpreted as a back-arc type basin. We presume that the Tajik microcontinent split off the Gondwana supercontinent along an ancient rift zone during the late Paleozoic.

  19. Response of mammary tissue to high-LET HZE particle (Silicon ions) radiation or low-LET gamma-rays

    Data.gov (United States)

    National Aeronautics and Space Administration — Transcriptional profiling of mammary tissue irradiated at 10 weeks of age with either 100 cGy sparsely ionizing gamma-rays or 10 cGy or 30 cGy densely ionizing...

  20. Two distinct origins for Archean greenstone belts

    Science.gov (United States)

    Smithies, R. Hugh; Ivanic, Tim J.; Lowrey, Jack R.; Morris, Paul A.; Barnes, Stephen J.; Wyche, Stephen; Lu, Yong-Jun

    2018-04-01

    Applying the Th/Yb-Nb/Yb plot of Pearce (2008) to the well-studied Archean greenstone sequences of Western Australia shows that individual volcanic sequences evolved through one of two distinct processes reflecting different modes of crust-mantle interaction. In the Yilgarn Craton, the volcanic stratigraphy of the 2.99-2.71 Ga Youanmi Terrane mainly evolved through processes leading to Th/Yb-Nb/Yb trends with a narrow range of Th/Nb ('constant-Th/Nb' greenstones). In contrast, the 2.71-2.66 Ga volcanic stratigraphy of the Eastern Goldfields Superterrane evolved through processes leading to Th/Yb-Nb/Yb trends showing a continuous range in Th/Nb ('variable-Th/Nb' greenstones). Greenstone sequences of the Pilbara Craton show a similar evolution, with constant-Th/Nb greenstone evolution between 3.13 and 2.95 Ga and variable-Th/Nb greenstone evolution between 3.49 and 3.23 Ga and between 2.77 and 2.68 Ga. The variable-Th/Nb trends dominate greenstone sequences in Australia and worldwide, and are temporally associated with peaks in granite magmatism, which promoted crustal preservation. The increasing Th/Nb in basalts correlates with decreasing εNd, reflecting variable amounts of crustal assimilation during emplacement of mantle-derived magmas. These greenstones are typically accompanied in the early stages by komatiite, and can probably be linked to mantle plume activity. Thus, regions such as the Eastern Goldfields Superterrane simply developed as plume-related rifts over existing granite-greenstone crust - in this case the Youanmi Terrane. Their Th/Nb trends are difficult to reconcile with modern-style subduction processes. The constant-Th/Nb trends may reflect derivation from a mantle source already with a high and constant Th/Nb ratio. This, and a lithological association including boninite-like lavas, basalts, and calc-alkaline andesites, all within a narrow Th/Nb range, resembles compositions typical of modern-style subduction settings. These greenstones are very

  1. Lawsonite Microstructures and Fabric Development at the Slab-Mantle Interface

    Science.gov (United States)

    Fornash, K.; Whitney, D.; Teyssier, C. P.; Seaton, N. C.

    2016-12-01

    Lawsonite is of critical importance to element and water cycling in subduction zones because it has a high H2O content, is stable at high pressures, and is a significant reservoir for trace elements in HP/LT rocks. In addition, the presence, abundance, and crystallographic orientation of lawsonite can affect the deformation and rheological behavior of subducted oceanic crust and sediments, and may influence the seismic properties of subducted slabs. The scarcity of unaltered lawsonite in HP/LT rocks exhumed to the Earth's surface, particularly in eclogite, however, has prevented an understanding of the deformation behavior of lawsonite and the factors controlling the development of fabrics in lawsonite, which are important for understanding the effects of lawsonite on the physical properties of subducted slabs. One of the few places in the world with unaltered lawsonite in eclogite and blueschist facies rocks is the Sivrihisar Massif, Turkey, which contains a coherent sequence of lawsonite-bearing metabasaltic and metasedimentary rocks that were metamorphosed and deformed at the slab-mantle interface (45 - 80 km), and therefore provide an opportunity to systematically compare lawsonite fabrics in rocks with different modal amounts of rheologically significant minerals (e.g., glaucophane, omphacite, quartz), integrated with information about lawsonite crystal size, compositional zoning patterns, shape, and twinning. Studies to date of lawsonite CPO from natural lawsonite-bearing rocks have resulted in two patterns: one is characterized by a concentration of [001] axes parallel to lineation and the other is characterized by a concentration of [001] axes perpendicular to foliation. We have documented the first type in metabasalt and the second in quartzite, but other researchers have documented both types in metabasalt. Regardless of variations in lawsonite CPO or rock type, omphacite and glaucophane CPO remain consistent. Quartz c-axis patterns vary in eclogite- and

  2. Dose Response for Monokaryon mycelium of Pleurotus pulmonarius After Acute Gamma Radiation

    International Nuclear Information System (INIS)

    Wan Safina Wan Abdul Razak; Azhar Mohamad; Nie, H.J.

    2016-01-01

    Pleurotus pulmonarius is locally known as Grey oyster. The species is popular and widely cultivated throughout the world mostly in Asia Europe as their simple and low cost production technology and higher biological efficiency. Mutation induction is an alternative ways for improving available commercial strain for better quality traits. Dose response is important in evaluating effects of mutagenesis via acute gamma radiation. Monokaryon mycelium of Pleurotus pulmonarius was exposed to acute gamma radiation ranged from 0 Gy, 0.1 kGy, 0.2 kGy, 0.3 kGy, 0.4 kGy, 0.5 kGy, 0.6 kGy, 0.7 kGy, 0.8 kGy, 0.9 kGy, 1.0 kGy, 1.5 Gy, 2.0 kGy, 3.0 kGy and 4.0 kGy at dose rate 0.013 kGy/ min. growth performance was measured at 2 days interval to get the LD_5_0. Increasing of the irradiation dose found to decrease the growth performance of the monokaryon mycelium. LD_5_0 was revealed at 1.56 kGy for mono karyon mycelium. Discoveries of the works are important for the improvement of Pleurotus species via acute gamma radiation and benefiting to growers and mushroom industries. (author)

  3. Induction of materials for mutation breeding of strawberry (FragariaxAnanassa) by gamma irradiation (Phase 2)

    International Nuclear Information System (INIS)

    Le Tien Thanh; Huynh Thi Trung; Pham Van Nhi; Vu Thi Trac

    2016-01-01

    In this study, New Zaeland strawberry runners was propagated in vitro to create clump of buds for Gamma irradiation. The experimental result showed that LD_5_0 was 52 Gy. Basing on the LD_5_0, we selected the 5 doses of 20, 40, 60, 80 and 100 Gy to irradiate in vitro materials for creating the potential mutants. Irradiated materials were propagated continuously in vitro to complete 300 in vitro plants per dose. On farm, ex vitro plants were planted on the spout (from the ground) by hydroponic method with the number of 200 plants per dose. Some mutant characteristics increased gradually toward the increasing of gamma doses as dwarf plants (in the dose of 60 Gy, 80 Gy and 100 Gy), plants had small fruits (in the dose of 60 Gy, 80 Gy, 100 Gy), plants had deformed fruits (in the dose of 20 Gy, 40 Gy, 60 Gy, 80 Gy and 100 Gy). In this study, we selected four mutants with 2 mutation fruits were changed to fruit heart-shape with symbol DT 1 (dose 60 Gy) and DT 2 (dose 80 Gy); 2 mutants were dwarf plants, the ungrown bud, wrinkled leaf, deformed fruits, high sweetness with symbol DN 1 (dose 60 Gy) and DN 2 (dose 80 Gy). (author)

  4. Geochemical variability in the green stone belts of Goias (Brazil): the Hidrolina and Crixas sequences

    International Nuclear Information System (INIS)

    Rivalenti, G.; Mazzucchelli, M.; Finatti, C.; Girardi, V.A.V.; Candia, M.A.F.; Correia, C.T.; Coltorti, M.; Siena, F.

    1990-01-01

    The greenstone belts of Crixas and Hidrolina of Goias, Brazil are dismembered components of the same body or of originally adjacent belts. Their tectono-metamorphic history and stratigraphy is similar, as well as their igneous components (meta-komatiites, meta-basalts and felsic meta-volcanics). Chemically, they differ for the CaO and Al 2 O 3 versus MgO trends and for the behaviour of many incompatible and compatible trace elements (Cr, Ni, Ti, Sc, Y, Zr, P). The difference in the trace element behaviour has been mainly attributed to a compositional and modal heterogeneity of the mantle source, which was probably spinel-richer at Crixas than at Hidrolina. The X-ray fluorescence analytical methods employed for major and trace elements determinations on the 120 Crixas samples were the same as used at Hidrolina. (author)

  5. Sources and Transportation of Bulk, Low-Cost Lunar Simulant Materials

    Science.gov (United States)

    Rickman, D. L.

    2013-01-01

    Marshall Space Flight Center (MSFC) has built the Lunar Surface Testbed using 200 tons of volcanic cinder and ash from the same source used for the simulant series JSC-1. This Technical Memorandum examines the alternatives examined for transportation and source. The cost of low-cost lunar simulant is driven by the cost of transportation, which is controlled by distance and, to a lesser extent, quantity. Metabasalts in the eastern United States were evaluated due to their proximity to MSFC. Volcanic cinder deposits in New Mexico, Colorado, and Arizona were recognized as preferred sources. In addition to having fewer green, secondary minerals, they contain vesicular glass, both of which are desirable. Transportation costs were more than 90% of the total procurement costs for the simulant material.

  6. Apports des phyllosilicates dans la différenciation entre altération hypogène et altération supergène dans le basalte triasique du Moyen Atlas (Maroc)Contribution of phyllosilicates to distinguish between hypogene alteration and weathering in Triassic basalt from Middle Atlas (Morocco)

    Science.gov (United States)

    Dekayir, Abdelilah; Danot, Michel; Allali, Nabil

    2002-09-01

    Triassic basalt of the Middle Atlas has been subject to metamorphic transformation then weathering. Occurrence in both metabasalt and saprolite of ubiquitous clay minerals, such as smectite and mixed layers chlorite-smectite, makes it difficult to distinguish between the two alteration facies and explains the interest of complementary sources of information. In the Bhallil weathering profile, petrographical and mineralogical analyses of primary igneous minerals and their alteration products coupled with Fe oxidation state determination in clay fractions allow to identify three alteration facies: ( i) metamorphic basalt, where iron occurs mainly as the ferrous form; ( ii) the lower part of saprolite, where iron is partially oxidized to its ferric form; ( iii) the upper part of saprolite, where iron is completely oxidized. To cite this article: A. Dekayir et al., C. R. Geoscience 334 (2002) 877-884.

  7. Radon risk map of the city Brno

    International Nuclear Information System (INIS)

    Jansky, J.

    2000-01-01

    Data of radon risk mapping of the city Brno area from 1992 to 1999 were collected from databases of six private companies measuring radon risk there. The data sets are completed now. The first results are presented in this paper. In the city Brno area only low (385 measured sites) and medium (300) radon risk categories were found. The largest number of measured areas were situated in places with loess and loess loam (total quantity 344 sites, with medium radon risk category 158 sites), recent fluvial sediments (64, 32) and anthropogenous deposits (61, 23). High values of radon volume activity in soil gas were found predominantly in Quaternary sediments and in granodiorite, type Veverska Bityska, low values in leucotonalite and metabasalt. (author)

  8. Petrology of blueschist facies metamorphic rocks of the Meliata Unit

    Directory of Open Access Journals (Sweden)

    Faryad Shah Wali

    1997-06-01

    Full Text Available Meliata blueschists originated from basalts, limestones, pelites, psammitic and amphibolite facies basement rocks. Compositionally, the metabasalts have a geochemical signature mostly indicative of a transitional arc-MORB origin, but some mafic rocks having affinity with within plate basalts also present. The mafic blueschists consist of blue amphibole, epidote and albite, rarely also garnet, Na-pyroxene and chloritoid. Apart from phengite and quartz the metapelites and metapsammites contain one or more of the minerals: chloritoid, paragonite, glaucophane, albite, chlorite, occasionally also Na-pyroxene and garnet. Amphibolite facies rocks contain relic garnet, plagioclase and hornblende, the latter two replaced by albite and blue amphibole, respectively. The zoning patterns of blue amphibole, garnet and chloritoid suggest their formation during prograde stage of metamorphism. P-T conditions of meta-morphism are estimated to be about 350-460 oC and 10-12 kbar.

  9. 87Sr enrichment of ophiolitic sulphide deposits in Cyprus confirms ore formation by circulating seawater

    International Nuclear Information System (INIS)

    Chapman, H.J.; Spooner, E.T.C.

    1977-01-01

    The hypothesis that seawater was the source of the hydrothermal fluid which formed the Upper Cretaceous ophiolitic cupriferous pyrite ore deposits of the Troodos Massif (Cyprus) has been tested by analysing the strontium isotopic composition of thirteen mineralized samples from four mines. Initial 87 Sr/ 86 Sr ratios range from 0.7052+-0.0001 to 0.7075+-0.00002, the latter value being indistinguishable from that of Upper Cretaceous seawater at 0.7076+-0.0006 (2 sigma). Hence, the mineralized metabasalt samples have been contaminated with 87 Sr, relative to initial magmatic strontium isotope ratios of the Troodos ophiolitic complex (0.70338+-0.00010 to 0.70365+-0.00005). Since seawater was the only source of strontium available during formation of the Troodos Complex which was isotopically relatively enriched in 87 Sr, the data confirm that seawater was the source of the hydrothermal oreforming fluid. (Auth.)

  10. Geodynamic control of the chemical composition of Tertiary continental arc magmas of Ecuador?

    International Nuclear Information System (INIS)

    Chiaradia, M.; Fontbote, L

    2001-01-01

    Whereas an abundant literature has been produced on the Tertiary magmatism of the Central Andes, no comparable studies exist for the Tertiary continental magmatism of the Northern Andes in general and of Ecuador in particular. In this contribution we present the first extensive data on lead and strontium isotopes of Paleocene to Pliocene magmatic rocks of Ecuador together with their major, trace and rare earth element geochemistry. The main interest of carrying out a geochemical and isotopic investigation on the magmatism of Ecuador is that, different from the Central Andes, Ecuador consists of several accreted terranes both of continental and oceanic affinity. The fragmented nature of the recently assembled crust of Ecuador, composed of lithologies such as Paleozoic schists, Triassic anatexites, and Jurassic metabasalts, could have variably affected the chemistry of the Ecuadorian magmas (au)

  11. Lithological architecture and petrography of the Mako Birimian greenstone belt, Kédougou-Kéniéba Inlier, eastern Senegal

    Science.gov (United States)

    Dabo, Moussa; Aïfa, Tahar; Gning, Ibrahima; Faye, Malick; Ba, Mamadou Fallou; Ngom, Papa Malick

    2017-07-01

    The new lithological and petrographic data obtained in the Mako sector are analyzed in the light of the geochemical data available in the literature. It consists of ultramaic, mafic rocks of tholeiitic affinities associated with intermediate and felsic rocks of calc-alkaline affinities and with intercalations of sedimentary rocks. The whole unit is intruded by Eburnean granitoids and affected by a greenschist to amphibolite facies metamorphism related to a high grade hydrothermalism. It consists of: (i) ultramafic rocks composed of a fractional crystallization succession of lherzolites, wehrlites and pyroxenites with mafic rock inclusions; (ii) layered, isotropic and pegmatitic metagabbros which gradually pass to metabasalts occur at the top; (iii) massive and in pillow metabasalts with locally tapered vesicles, completely or partially filled with quartzo-feldspathic minerals; (iv) quarzites locally overlying the mafic rocks and thus forming the top of the lower unit. This ultramafic-mafic lower unit presents a tholeiitic affinity near to the OIB or N-MORB. It represents the Mako Ophiolitic Complex (MOC), a lithospheric fragment of Birimian lithospheric crust. The upper unit is a mixed volcanic complex arranged in the tectonic corridors. From bottom to top it comprises the following: (i) andesitic, and (ii) rhyodacitic and rhyolitic lava flows and tuffs, respectively. They present a calc-alkaline affinity of the active margins. Three generations of Eburnean granitoids are recognized: (i) early (2215-2160 Ma); (ii) syn-tectonics (2150-2100 Ma) and post-tectonics (2090-2040 Ma). The lithological succession, geochemical and metamorphic characteristics of these units point to an ophiolitic supra-subduction zone.

  12. A preliminary study on doses of 60Co-γ ray for mutation breeding of Roegneria

    International Nuclear Information System (INIS)

    Jiang Yun; Lin Yang; Xuan Pu; Luo Xiaomei; Zhang Haiqin

    2011-01-01

    Six groups from three species of Roegneria were radiated with eight ladders of 60 Co-γ ray for finding the most suitable absorbed dose. The dose ladders were CK (0 Gy), 50 Gy, 100 Gy, 150 Gy, 200 Gy, 250 Gy, 300 Gy and 400 Gy. The half-lethal dose of six gourps, generated by multi-Target Single Hit Model Equation, were from 59.6 Gy to 172.8 Gy. Germination percentage of seeds, height of seeding, plant survival percentage and setting percentage were investigated. The most suitable absorbed doses of each species primerly were deduced from these data. The research provide a valuable reference for Roegneria mutation breeding on chousing the absorbed does. (authors)

  13. Anti-inflammation of the oral mucous after radiotherapy of side effect to the propolis combined effect

    Energy Technology Data Exchange (ETDEWEB)

    Takenori, Yamashita; Gu, Yeunhwa; Park, Sangrae [Suzuka Univ. of Medical Science, Suzuka (Japan)] [and others

    2002-07-01

    Recently, allege acid sodium (AL-G) that affect is proved in the bleeding digestion pipe tumor, the effect on treatment for wound such as a radiation esophagus flame because of the inflammation reduction inside such a mouth is used. Because a tumor and an inflammation are effective, propolis to use for this research is the purpose of examining the anti-inflammation action of the mucous membrane flame in the mouth. The inside of the mouth was made to contain each medicine, and effect on organization repair was examined from the viewpoint of study of the organization. An ICR mail mice used at age of seven weeks. Feed and water were taken freely. As for the experiment group, 2Gy, 4Gy, 8Gy irradiated each of the control group, the oral part separately. Two times gave it 2Gy, 4Gy and 8Gy group, AL-G, a physiology solution of salt, propolis combination thing (Propolis + royal jelly (RJ) +EF2001), PVP in the morning. We used in each groups of 10 mail mice AL-G+2G, AL-G+4GyAL-G+8Gy, Saline+2Gy, Saline+4Gy, Saline+8Gy,Propolis+(RJ+EF2001)+2Gy,Propolis+ (RJ+EF2001)+4Gy,Propolis+(RJ+EF2001)+8Gy, PVP+2Gy, PVP+4Gy and PVP+8Gy groups. It was divided into each group of 2Gy, 4Gy and 8Gy groups from the bottom part of the ear of the ICR mice by the nose head, and it irradiated it once.

  14. Anti-inflammation of the oral mucous after radiotherapy of side effect to the propolis combined effect

    International Nuclear Information System (INIS)

    Takenori, Yamashita; Gu, Yeunhwa; Park, Sangrae

    2002-01-01

    Recently, allege acid sodium (AL-G) that affect is proved in the bleeding digestion pipe tumor, the effect on treatment for wound such as a radiation esophagus flame because of the inflammation reduction inside such a mouth is used. Because a tumor and an inflammation are effective, propolis to use for this research is the purpose of examining the anti-inflammation action of the mucous membrane flame in the mouth. The inside of the mouth was made to contain each medicine, and effect on organization repair was examined from the viewpoint of study of the organization. An ICR mail mice used at age of seven weeks. Feed and water were taken freely. As for the experiment group, 2Gy, 4Gy, 8Gy irradiated each of the control group, the oral part separately. Two times gave it 2Gy, 4Gy and 8Gy group, AL-G, a physiology solution of salt, propolis combination thing (Propolis + royal jelly (RJ) +EF2001), PVP in the morning. We used in each groups of 10 mail mice AL-G+2G, AL-G+4GyAL-G+8Gy, Saline+2Gy, Saline+4Gy, Saline+8Gy,Propolis+(RJ+EF2001)+2Gy,Propolis+ (RJ+EF2001)+4Gy,Propolis+(RJ+EF2001)+8Gy, PVP+2Gy, PVP+4Gy and PVP+8Gy groups. It was divided into each group of 2Gy, 4Gy and 8Gy groups from the bottom part of the ear of the ICR mice by the nose head, and it irradiated it once

  15. Comparison of Different Fractionation Schedules Toward a Single Fraction in High-Dose-Rate Brachytherapy as Monotherapy for Low-Risk Prostate Cancer Using 3-Dimensional Radiobiological Models

    Energy Technology Data Exchange (ETDEWEB)

    Mavroidis, Panayiotis, E-mail: mavroidis@uthscsa.edu [Department of Radiation Oncology, University of Texas Health Sciences Center, San Antonio, Texas (United States); Department of Medical Radiation Physics, Karolinska Institutet and Stockholm University, Stockholm (Sweden); Milickovic, Natasa [Department of Medical Physics and Engineering, Strahlenklinik, Klinikum Offenbach GmbH, Offenbach (Germany); Cruz, Wilbert F. [Department of Radiation Oncology, University of Texas Health Sciences Center, San Antonio, Texas (United States); Tselis, Nikolaos [Strahlenklinik, Klinikum Offenbach GmbH, Offenbach (Germany); Karabis, Andreas [Pi-Medical Ltd., Athens (Greece); Stathakis, Sotirios; Papanikolaou, Nikos [Department of Radiation Oncology, University of Texas Health Sciences Center, San Antonio, Texas (United States); Zamboglou, Nikolaos [Strahlenklinik, Klinikum Offenbach GmbH, Offenbach (Germany); Baltas, Dimos [Department of Medical Physics and Engineering, Strahlenklinik, Klinikum Offenbach GmbH, Offenbach (Germany); Nuclear and Particle Physics Section, Physics Department, University of Athens, Athens (Greece)

    2014-01-01

    Purpose: The aim of the present study was the investigation of different fractionation schemes to estimate their clinical impact. For this purpose, widely applied radiobiological models and dosimetric measures were used to associate their results with clinical findings. Methods and Materials: The dose distributions of 12 clinical high-dose-rate brachytherapy implants for prostate were evaluated in relation to different fractionation schemes. The fractionation schemes compared were: (1) 1 fraction of 20 Gy; (2) 2 fractions of 14 Gy; (3) 3 fractions of 11 Gy; and (4) 4 fractions of 9.5 Gy. The clinical effectiveness of the different fractionation schemes was estimated through the complication-free tumor control probability (P{sub +}), the biologically effective uniform dose, and the generalized equivalent uniform dose index. Results: For the different fractionation schemes, the tumor control probabilities were 98.5% in 1 × 20 Gy, 98.6% in 2 × 14 Gy, 97.5% in 3 × 11 Gy, and 97.8% in 4 × 9.5 Gy. The corresponding P{sub +} values were 88.8% in 1 × 20 Gy, 83.9% in 2 × 14 Gy, 86.0% in 3 × 11 Gy, and 82.3% in 4 × 9.5 Gy. With use of the fractionation scheme 4 × 9.5 Gy as reference, the isoeffective schemes regarding tumor control for 1, 2, and 3 fractions were 1 × 19.68 Gy, 2 × 13.75 Gy, and 3 × 11.05 Gy. The optimum fractionation schemes for 1, 2, 3, and 4 fractions were 1 × 19.16 Gy with a P{sub +} of 91.8%, 2 × 13.2 Gy with a P{sub +} of 89.6%, 3 × 10.6 Gy with a P{sub +} of 88.4%, and 4 × 9.02 Gy with a P{sub +} of 86.9%. Conclusions: Among the fractionation schemes 1 × 20 Gy, 2 × 14 Gy, 3 × 11 Gy, and 4 × 9.5 Gy, the first scheme was more effective in terms of P{sub +}. After performance of a radiobiological optimization, it was shown that a single fraction of 19.2 to 19.7 Gy (average 19.5 Gy) should produce at least the same benefit as that given by the 4 × 9.5 Gy scheme, and it should reduce the expected total complication probability by

  16. High energy (42-66 MeV reactions) fast neutron dose optimization studies in the head and neck, thorax, upper abdomen, pelvis and extremities

    International Nuclear Information System (INIS)

    Griffin, T.W.; Laramore, G.E.; Maor, M.H.; Hendrickson, F.R.; Parker, R.G.; Davis, L.W.

    1990-01-01

    550 Patients were entered into a set of dose-searching studies designed to determine normal tissue tolerances to high energy (42-66 MeV reactions) fast neutrons delivered in 12 equal fractions over 4 weeks. Patients were stratified by treatment facility and then randomized to receive 16, 18 or 20 Gy for tumors located in the upper abdomen or pelvis, and 18, 20 or 22 Gy for tumors located in the head and neck, thorax or extremities. Following completion of the randomized protocols, additional patients were studied at the 20.4 Gy level in the head and neck, thorax and pelvis. Normal tissue effect scoring was accomplished using the RTOG-EORTC acute and late normal tissue effect scales. Acute Grade 3+ toxicity rates in the head and neck were 19 per cent for 20/20.4 Gy and 20 per cent for 22 Gy. Time adjusted late toxicity rates in the head and neck at 12 months were 15 per cent for 20/20.4 Gy and 0 per cent for 22 Gy. The 18 Gy treatment arm of the head and neck protocol was dropped early in the study after only two patients were accrued. For cases treated in the thorax, acute Grade 3+ toxicity rates were 6 per cent for 18 Gy, 15 per cent for 20/20.4 Gy and 7 per cent for 22 Gy. Late toxicity rates at 12 months were 0 per cent for 18 Gy, 11 per cent for 20/20.4 Gy and 18 per cent for 22 Gy. Acute Grade 3+ toxicity rates in the upper abdomen were 0 per cent for 16 Gy, 18 per cent for 18 Gy and 12 per cent for 20 Gy. There were no Grade 3+ late toxicities in the upper abdomen. In the pelvis acute Grade 3+ toxicity rates were 0 per cent for 16 Gy, 3 per cent for 18 Gy and 3 per cent for 20/20.4 Gy. Late Grade 3+ toxicities at 24 months were 20 per cent for 16 Gy, 5 per cent for 18 Gy and 24 per cent for 20/20.4 Gy. In the extremities, acute Grade 3+ toxicity rates were 7 per cent for 20 Gy and 21 per cent for 22 Gy, while at 12 months, late Grade 3+ toxicity rates were 14 and 35 per cent respectively. The 18 Gy treatment arm of the extremities protocol was dropped early

  17. Dose–Response for Stereotactic Body Radiotherapy in Early-Stage Non–Small-Cell Lung Cancer

    International Nuclear Information System (INIS)

    Olsen, Jeffrey R.; Robinson, Clifford G.; El Naqa, Issam; Creach, Kimberly M.; Drzymala, Robert E.; Bloch, Charles; Parikh, Parag J.; Bradley, Jeffrey D.

    2011-01-01

    Purpose: To compare the efficacy of three lung stereotactic body radiotherapy (SBRT) regimens in a large institutional cohort. Methods: Between 2004 and 2009, 130 patients underwent definitive lung cancer SBRT to a single lesion at the Mallinckrodt Institute of Radiology. We delivered 18 Gy × 3 fractions for peripheral tumors (n = 111) and either 9 Gy × 5 fractions (n = 8) or 10 Gy × 5 fractions (n = 11) for tumors that were central or near critical structures. Univariate and multivariate analysis of prognostic factors was performed using the Cox proportional hazard model. Results: Median follow-up was 11, 16, and 13 months for the 9 Gy × 5, 10 Gy × 5, and 18 Gy × 3 groups, respectively. Local control statistics for Years 1 and 2 were, respectively, 75% and 50% for 9 Gy × 5, 100% and 100% for 10 Gy × 5, and 99% and 91% for 18 Gy × 3. Median overall survival was 14 months, not reached, and 34 months for the 9 Gy × 5, 10 Gy × 5, and 18 Gy × 3 treatments, respectively. No difference in local control or overall survival was found between the 10 Gy × 5 and 18 Gy × 3 groups on log–rank test, but both groups had improved local control and overall survival compared with 9 Gy × 5. Treatment with 9 Gy × 5 was the only independent prognostic factor for reduced local control on multivariate analysis, and increasing age, increasing tumor volume, and poor performance status predicted independently for reduced overall survival. Conclusion: Treatment regimens of 10 Gy × 5 and 18 Gy × 3 seem to be efficacious for lung cancer SBRT and provide superior local control and overall survival compared with 9 Gy × 5.

  18. Diagnostic x-ray in use in federal medical centre, case study Makurdi metropolis

    International Nuclear Information System (INIS)

    Onoja, R.A.; Fiase, J.O.

    2009-01-01

    Every year more than two thousand patients go for routine medical check-up at the Federal Medical Centre using diagnostic x-rays. This paper is based on a study to determine the entrance surface doses per radiograph of 108 patients that had diagnostic examinations at the Federal Medical Centre Makurdi. The examinations considered in this study are chest x-ray examinations, abdomen, skull and other extremities, for both adults and children. The results show that the mean entrance surface doses of PA chest x-ray for female range between 237-275μGy, for male is between 1183-297μGy, and for children range between 47-237μGy. The AP chest x-ray for female range between 1943-3440μGy, for male is between 1583-3484μGy and for children it ranges between 177-451μGy. The PA examination of the skull for adult female ranged between 117-787μGy, for male it ranged between 117-532μGy and children from 472-948μGy. Also for the AP examination for skull the adult female mean entrance surface doses range from 129-798μGy, for the male it range from 145-178μGy and for children 138-650μGy. The AP abdomen for adult female produces a mean entrance surface doses range between 620-682μGy, for the male is between 105-930μGy, and children it range between 144-398μGy. In the case of extremities AP examination are between the range of 173-468μGy for adult female, 300-595μGy for adult male and between 254-887μGy for the children. In the case of extremities PA examination mean entrance surface doses are between the range of 145-517μGy for adult female, 363-517μGy for adult male and between 130-566μGy for the children. The data shows that the entrance surface doses due to the x-ray examination for adult and children are within the ICRP guidance levels. These guidance levels of dose for diagnostic radiography for a typical adult patient are 10 mGy for AP abdomen, 0.4 mGy PA chest, 7 mGy for AP chest and 5 mGy for PA skull

  19. Dose-rate effects and chronological changes of chromosome aberration rates in spleen cells from mice that are chronically exposed to gamma-ray at low dose rates

    International Nuclear Information System (INIS)

    Tanaka, Kimio; Kohda, Atsushi; Ichinohe, Kazuaki; Matsumoto, Tsuneya; Oghiso, Yoichi

    2006-01-01

    Dose-rate effects have not been examined in the low dose-rate regions of less than 60-600 mGy/h. Mice were chronically exposed to gamma-ray at 20 mGy/day (approximately 1 mGy/h) up to 700 days and at 1 mGy/day (approximately 0.05 mGy/h) for 500 days under SPF conditions. Chronological changes of chromosome aberration rates in spleen cells were observed along with accumulated doses at both low dose-rates. Unstable aberrations increased in a biphasic manner within 0-2 Gy and 4-14 Gy in 20 mGy/day irradiation. They slightly increased up to 0.5 Gy in 1 mGy/day irradiation. Chromosome aberration rates at 20 mGy/day and 1 mGy/day were compared at the same total doses of 0.5 Gy and 0.25 Gy. They were 2.0 vs. 0.53, and 1.0 vs. 0.47 respectively. Thus, dose-rate effects were observed in these low dose-rate regions. (author)

  20. Radiation-induced hypopituitarism is dose-dependent

    International Nuclear Information System (INIS)

    Littley, M.D.; Shalet, S.M.; Beardwell, C.G.; Robinson, E.L.; Sutton, M.L.

    1989-01-01

    Radiation-induced hypopituitarism has been studies prospectively for up to 12 years in 251 adult patients treated for pituitary disease with external radiotherapy, ranging in dose from 20 Gy in eight fractions over 11 days to 45 Gy in 15 fractions over 21 days. Ten further patients were studied 2-4 years after whole-body irradiation for haematological malignancies using 12 Gy in six fractions over 3 days and seven patients were studied 3-11 years after whole-brain radiotherapy for a primary brain tumour (30 Gy, eight fractions, 11 days). Five years after treatment, patients who received 20 Gy had an incidence of TSH deficiency of 9% and in patients treated with 35-37 Gy, 40 Gy and 42-45 Gy, the incidence of TSH deficiency increased significantly with increasing dose. A similar relationship was observed for both ACTH and gonadotrophin deficiencies when the 20 Gy group was compared to patients treated with 35-45 Gy. Growth hormone deficiency was universal by 5 years over the dose range 35-45 Gy. In seven patients who were treated with 30 Gy in eight fractions over 11 days, deficiencies were observed at a similar frequency to the 40 Gy group (15 fractions, 21 days). No evidence of pituitary dysfunction was detected in the ten patients who received 12 Gy (six fractions, 3 days). (author)

  1. The effect of radiation dose on mouse skeletal muscle remodeling

    International Nuclear Information System (INIS)

    Hardee, Justin P.; Puppa, Melissa J.; Fix, Dennis K.; Gao, Song; Hetzler, Kimbell L.; Bateman, Ted A.; Carson, James A.

    2014-01-01

    The purpose of this study was to determine the effect of two clinically relevant radiation doses on the susceptibility of mouse skeletal muscle to remodeling. Alterations in muscle morphology and regulatory signaling were examined in tibialis anterior and gastrocnemius muscles after radiation doses that differed in total biological effective dose (BED). Female C57BL/6 (8-wk) mice were randomly assigned to non-irradiated control, four fractionated doses of 4 Gy (4x4 Gy; BED 37 Gy), or a single 16 Gy dose (16 Gy; BED 100 Gy). Mice were sacrificed 2 weeks after the initial radiation exposure. The 16 Gy, but not 4x4 Gy, decreased total muscle protein and RNA content. Related to muscle regeneration, both 16 Gy and 4x4 Gy increased the incidence of central nuclei containing myofibers, but only 16 Gy increased the extracellular matrix volume. However, only 4x4 Gy increased muscle 4-hydroxynonenal expression. While both 16 Gy and 4x4 Gy decreased IIB myofiber mean cross-sectional area (CSA), only 16 Gy decreased IIA myofiber CSA. 16 Gy increased the incidence of small diameter IIA and IIB myofibers, while 4x4 Gy only increased the incidence of small diameter IIB myofibers. Both treatments decreased the frequency and CSA of low succinate dehydrogenase activity (SDH) fibers. Only 16 Gy increased the incidence of small diameter myofibers having high SDH activity. Neither treatment altered muscle signaling related to protein turnover or oxidative metabolism. Collectively, these results demonstrate that radiation dose differentially affects muscle remodeling, and these effects appear to be related to fiber type and oxidative metabolism

  2. Effect of Sucralfate on Radiation-induced Esophageal Changes in Rat

    Energy Technology Data Exchange (ETDEWEB)

    Kang, Ki Mun; Chai, Gyu Young [Gyeongsang National Univ., Jinju (Korea, Republic of); Yoon, Sei Chul [The Catholic Univ. of Korea, Seoul (Korea, Republic of)

    2001-12-15

    The study was designed to evaluate the response of sucralfate against the esophageal damage of rat by irradiation. Sixty Sprague-Dawley rats weighing 200-250 gm were divided into six groups including only sucralfate group, the group of 10 Gy or 20 Gy radiation alone, the groups of 10 Gy or 20 Gy radiation-sucralfate combination, and control. Each group was sacrificed at 3, 7, 14 and 28 days after irradiation. For evaluation of the radiation-induced esophageal lesions, there were examined the change of body weight, barium-esophagogram and histopathologic findings. Mean body weight gain was decreased in the groups with 10 Gy or 20 Gy radiation alone and 10 Gy or 20 Gy radiation-sucralfate combination as comparing with control (p=0.03, p=0.02, p=0.04, p=0.02), but there was no difference between the groups of 10 Gy or 20 Gy radiation alone and the groups of 10 Gy or 20 Gy radiation-sucralfate combination. In the 20 Gy and 20 Gy radiation alone groups, barium esophagograms showed diffuse narrowing and stiffness through the entire esophagus from 7 days after irradiation, but there was similar pattern of esophagograms between the groups of 10 Gy radiation-sucralfate combination and the control. Histopathologic lesion scores of 10 Gy and 20 Gy radiation groups were significantly higher than the control (p=0.03, p=0.008). In the 10 Gy radiation group, there were significantly higher lesion scores ar 3 and 7 days after irradiation as comparing with those in the group of radiation-sucralfate combination (p=0.04, p=0.03). These results suggest that sucralfate might be played as a role of protection from acute radiation-induced esophagitis within the limit of tolerable radiation doses.

  3. Effect of Sucralfate on Radiation-induced Esophageal Changes in Rat

    International Nuclear Information System (INIS)

    Kang, Ki Mun; Chai, Gyu Young; Yoon, Sei Chul

    2001-01-01

    The study was designed to evaluate the response of sucralfate against the esophageal damage of rat by irradiation. Sixty Sprague-Dawley rats weighing 200-250 gm were divided into six groups including only sucralfate group, the group of 10 Gy or 20 Gy radiation alone, the groups of 10 Gy or 20 Gy radiation-sucralfate combination, and control. Each group was sacrificed at 3, 7, 14 and 28 days after irradiation. For evaluation of the radiation-induced esophageal lesions, there were examined the change of body weight, barium-esophagogram and histopathologic findings. Mean body weight gain was decreased in the groups with 10 Gy or 20 Gy radiation alone and 10 Gy or 20 Gy radiation-sucralfate combination as comparing with control (p=0.03, p=0.02, p=0.04, p=0.02), but there was no difference between the groups of 10 Gy or 20 Gy radiation alone and the groups of 10 Gy or 20 Gy radiation-sucralfate combination. In the 20 Gy and 20 Gy radiation alone groups, barium esophagograms showed diffuse narrowing and stiffness through the entire esophagus from 7 days after irradiation, but there was similar pattern of esophagograms between the groups of 10 Gy radiation-sucralfate combination and the control. Histopathologic lesion scores of 10 Gy and 20 Gy radiation groups were significantly higher than the control (p=0.03, p=0.008). In the 10 Gy radiation group, there were significantly higher lesion scores ar 3 and 7 days after irradiation as comparing with those in the group of radiation-sucralfate combination (p=0.04, p=0.03). These results suggest that sucralfate might be played as a role of protection from acute radiation-induced esophagitis within the limit of tolerable radiation doses

  4. Second Study of Hyper-Fractionated Radiotherapy

    Directory of Open Access Journals (Sweden)

    R. Jacob

    1999-01-01

    Full Text Available Purpose and Method. Hyper-fractionated radiotherapy for treatment of soft tissue sarcomas is designed to deliver a higher total dose of radiation without an increase in late normal tissue damage. In a previous study at the Royal Marsden Hospital, a total dose of 75 Gy using twice daily 1.25 Gy fractions resulted in a higher incidence of late damage than conventional radiotherapy using 2 Gy daily fractions treating to a total of 60 Gy. The current trial therefore used a lower dose per fraction of 1.2 Gy and lower total dose of 72 Gy, with 60 fractions given over a period of 6 weeks.

  5. Radiobiological effect of different irradiation fractionated regimens in human brain glioma

    International Nuclear Information System (INIS)

    Gai Xue; Yang Weizhi; Gao Li; Jiang Heng; Wang Mianrong; Shi Huizhen

    2010-01-01

    Objective: To evaluate the radiobiological effect of different irradiation fractionated regimens in human glioma cells (BT 325 cell line). Methods: The xenografts in Balb/c-nude mice were irradiated with different single and fractionated regimens. The single fraction dose was 10, 20, 30, 40 and 60 Gy, respectively. The fractionated regimens were 2 Gy x 5 fractions ( irradiated every day), and 3 Gy x 3 fractions (irradiated every other day), 3 Gy x 5 fractions (irradiated every day) and 4 Gy x 3 fractions (irradiated every other day), with total doses of 125 Gy, 114 Gy, 126 Gy and 112 Gy, respectively. The growth curve was used to evaluate the tumor doubling time. clonogenic assays was performed to draw the cell survival curve and analyze the radiobiological parameters with doses of 1, 2, 4, 6, 8 and 10 Gy. T 1/2 was measured by comet assay. Results: Tumor regression were not observed by single fraction irradiation, 2 Gy x 5 fractions and 3 Gy x 3 fractions irradiation regimens. The tumor regress was more significant with the increas of fraction dose. The 4 Gy x 3 fractions inhibited tumor more though not curing tumor. The cell doubling time of the BT 325 cell was 30. 16 h and the tumor doubling time of the xenograft was 43 days.When fitted with L-Q model, α was 0. 36 Gy -1 and β was 0. 057 Gy -2 . When fitted with the single-hit multi target model, D 0 was 1. 394 Gy, Dq was 2. 127 Gy and SF 2 was 0.714, respectively. The T 1/2 was 9.999 min. Conclusions: Glioma is a radioresistant tumor. Increase of the fraction dose improves recent effect.Further study is needed to control the tumor stem cells. (authors)

  6. The role and strategy of IMRT in radiotherapy of pelvic tumors: Dose escalation and critical organ sparing in prostate cancer

    International Nuclear Information System (INIS)

    Liu, Y.-M.; Shiau, C.-Y.; Lee, M.-L.; Huang, P.-I.; Hsieh, C.-M.; Chen, P.-H.; Lin, Y.-H.; Wang, L.-W.; Yen, S.-H.

    2007-01-01

    Purpose: To investigate the intensity-modulated radiotherapy (IMRT) strategy in dose escalation of prostate and pelvic lymph nodes. Methods and Materials: Plan dosimetric data of 10 prostate cancer patients were compared with two-dimensional (2D) or IMRT techniques for pelvis (two-dimensional whole pelvic radiation therapy [2D-WPRT] or IM-WPRT) to receive 50 Gy or 54 Gy and additional prostate boost by three-dimensional conformal radiation therapy or IMRT (3D-PBRT or IM-PBRT) techniques up to 72 Gy or 78 Gy. Dose-volume histograms (DVHs), normal tissue complication probabilities (NTCP) of critical organ, and conformity of target volume in various combinations were calculated. Results: In DVH analysis, the plans with IM-WPRT (54 Gy) and additional boost up to 78 Gy had lower rectal and bladder volume percentage at 50 Gy and 60 Gy, compared with those with 2D-WPRT (50 Gy) and additional boost up to 72 Gy or 78 Gy. Those with IM-WPRT (54 Gy) also had better small bowel sparing at 30 Gy and 50 Gy, compared with those with 2D-WPRT (50 Gy). In NTCP, those with IM-WPRT and total dose of 78 Gy achieved lower complication rates in rectum and small bowel, compared with those of 2D-WPRT with total dose of 72 Gy. In conformity, those with IM-WPRT had better conformity compared with those with 2D-WPRT with significance (p < 0.005). No significant difference in DVHs, NTCP, or conformity was found between IM-PBRT and 3D-PBRT after IM-WPRT. Conclusions: Initial pelvic IMRT is the most important strategy in dose escalation and critical organ sparing. IM-WPRT is recommended for patients requiring WPRT. There is not much benefit for critical organ sparing by IMRT after 2D-WPRT

  7. Comparison of X-ray radiation exposure during digital subtraction angiography (DSA) and multislice CT angiography (CTA)

    International Nuclear Information System (INIS)

    Bai, Mei; Liu, Bin; Zheng, Junzheng

    2008-01-01

    Full text: Purpose: To compare radiation risk during digital subtraction angiography (DSA) and CT angiography (CTA). Materials and methods: Eighty patients randomly divided into two groups of 40 patients each, were evaluated for coronary atherosclerotic heart disease with 64-slice spiral CT angiography and DSA respectively. For CTA group we divided patients into two subgroups: regular mode and ECG modulation mode. Matix of thermoluminescent dosimeters (TLDs) were placed on patients' skin surface during each examination to access peak skin dose (PSD). A male ART phantom was equipped with TLDs in six different positions to assess achievable organ dose. Effective dose was calculated by commercially available computer programs. Results: For DSA, PSD was 64mGy. Phantom organ dose for lung, heart, stomach, liver, kidney and brain were 11.07mGy, 5.87mGy, 1.42mGy, 2.11mGy, 6.76mGy and 0.001mGy respectively, and effective dose was 4mSv. For regular mode CTA, PSD was 74.5mGy, and CTD vol was 37.9mGy. Phantom organ dose for lung, heart, stomach, liver, kidney and brain were 58mGy, 64.2mGy, 6.6mGy, 9.9mGy, 2.7mGy, 0.072mGy respectively, and effective dose was 16mSv. For ECG modulation mode, PSD was 50.9mGy, and CTD vol was 26.3mGy. Conclusion: According to measured PSD value, deterministic radiation risk for regular mode CTA was little higher than DSA. However for stochastic radiation risk which can be indicated by organ dose and effective dose, regular mode CTA was much higher than DSA. Comparing with regular mode, ECG modulation mode can effectively reduce both stochastic and deterministic radiation risk. (author)

  8. Electron beam processing of sugar cane bagasse to cellulose hydrolysis

    International Nuclear Information System (INIS)

    Ribeiro, Marcia A.; Cardoso, Vanessa M.; Mori, Manoel N.; Duarte, Celina L.

    2009-01-01

    Sugarcane bagasse has been considered as a substrate for single cell protein, animal feed, and renewable energy production. Sugarcane bagasse generally contain up to 45% glucose polymer cellulose, 40% hemicelluloses, and 20% lignin. Pure cellulose is readily depolymerised by radiation, but in biomass, the cellulose is intimately bonded with lignin, that protect it from radiation effects. The objective of this study is the evaluation of the electron beam irradiation as a pre-treatment to enzymatic hydrolysis of cellulose in order to facilitate its fermentation and improves the production of ethanol biofuel. Samples of sugarcane bagasse were obtained in sugar/ethanol Iracema Mill sited in Piracicaba, Brazil, and were irradiated using Radiation Dynamics Electron Beam Accelerator with 1.5 MeV energy and 37kW, in batch systems. The applied absorbed doses of the fist sampling, Bagasse A, were 20 kGy, 50 kGy, 100 kGy and 200 kGy. After the evaluation the preliminary obtained results, it was applied lower absorbed doses in the second assay: 5 kGy, 10 kGy, 20 kGy, 30 kGy, 50 kGy, 70 kGy, 100 kGy and 150 kGy. The electron beam processing took to changes in the sugarcane bagasse structure and composition, lignin and cellulose cleavage. The yield of enzymatic hydrolyzes of cellulose increase about 40 % with 30 kGy of absorbed dose. (author)

  9. Ionizing Radiation Conversion of Lignocellulosic Biomass from Sugarcane Bagasse to Production Ethanol Biofuel

    International Nuclear Information System (INIS)

    Duarte, C.L.; Mori, M.N.; Oikawa, H.; Finguerut, J.; Galvão, A.; Nagatomi, H.R.; Célia, M.

    2010-01-01

    Sugarcane bagasse has been considered as a substrate for single cell protein, animal feed, and renewable energy production. Sugarcane bagasse generally contain up to 45% glucose polymer cellulose, 40% hemicelluloses, and 20% lignin. Pure cellulose is readily depolymerised by radiation, but in biomass, the cellulose is intimately bonded with lignin, that protect it from radiation effects. The objective of this study is the evaluation of the electron beam irradiation as a pre-treatment to enzymatic hydrolysis of cellulose in order to facilitate its fermentation and improves the production of ethanol biofuel. Samples of sugarcane bagasse were obtained in sugar/ethanol Iracema Mill sited in Piracicaba, Brazil, and were irradiated using Radiation Dynamics Electron Beam Accelerator with 1.5 MeV energy and 37kW, in batch systems. The applied absorbed doses of the fist sampling, Bagasse A, were 20 kGy, 50 kGy, 100 kGy and 200 kGy. After the evaluation the preliminary obtained results, it was applied lower absorbed doses in the second assay: 5 kGy, 10 kGy, 20 kGy, 30 kGy, 50 kGy, 70 kGy, 100 kGy and 150 kGy. The electron beam processing took to changes in the sugarcane bagasse structure and composition, lignin and cellulose cleavage. The yield of enzymatic hydrolyzes of cellulose increase about 75 % with 30 kGy of absorbed dose. (author)

  10. Interstitial brachytherapy for stage I and II squamous cell carcinoma of the oral tongue: factors influencing local control and soft tissue complications

    International Nuclear Information System (INIS)

    Fujita, Minoru; Hirokawa, Yutaka; Kashiwado, Kouzo; Akagi, Yukio; Kashimoto, Kazuki; Kiriu, Hiroshi; Matsuura, Kanji; Ito, Katsuhide

    1999-01-01

    Purpose: Our aim was to study the treatment parameters that influence local control and soft tissue complications (STC) in a series of 207 Stage I and II squamous cell carcinomas of the oral tongue treated by interstitial brachytherapy (BRT) alone (127 patients), or by a combination using external beam irradiation (EBI) (80 patients) between 1980 and 1993. Methods and Materials: The patient distribution was 93 T1, 72 T2a, and 42 T2b. The prescribed BRT dose at the plane 5 mm from the plane of the radioactive sources was 65-70 Gy in BRT alone, and 50-60 Gy in the combined treatment using EBI. Generally, an EBI dose of 30 Gy was used. No prophylactic neck treatment was performed. Results: The 5-year local recurrence-free rate for T1, T2a, and T2b was 92.9%, 81.9%, and 71.8%, respectively (p 85 Gy (p = 0.01), BRT dose > 55 Gy (p = 0.04), and a dose rate = 0.6 Gy/h was significantly related to more STC in BRT alone (p = 0.03), and that a dose rate > = 0.55 Gy/h (p 70 Gy (p 100 Gy (p 85 Gy and 55 Gy and < = 70 Gy, and < 0.55 Gy/h, respectively. We also recommend longer follow-up periods; more than 5 years might be necessary for late local recurrences and for secondary cancers

  11. Stereotactic radiosurgery for newly diagnosed brain metastases. Comparison of three dose levels

    Energy Technology Data Exchange (ETDEWEB)

    Rades, Dirk [University of Luebeck, Department of Radiation Oncology, Luebeck (Germany); Hornung, Dagmar [University Medical Center Hamburg-Eppendorf, Department of Radiation Oncology, Hamburg (Germany); Blanck, Oliver [University of Luebeck, Department of Radiation Oncology, Luebeck (Germany); CyberKnife Center Northern Germany, Guestrow (Germany); Martens, Kristina [University of Luebeck, Department of Radiation Oncology, Luebeck (Germany); University of Luebeck, Center for Integrative Psychiatry, Luebeck (Germany); Khoa, Mai Trong [Hanoi Medical University, Department of Nuclear Medicine, Hanoi (Viet Nam); Bach Mai Hospital, Nuclear Medicine and Oncology Center, Hanoi (Viet Nam); Trang, Ngo Thuy [Bach Mai Hospital, Nuclear Medicine and Oncology Center, Hanoi (Viet Nam); Hueppe, Michael [University of Luebeck, Department of Anesthesiology, Luebeck (Germany); Terheyden, Patrick [University of Luebeck, Department of Dermatology, Luebeck (Germany); Gliemroth, Jan [University of Luebeck, Department of Neurosurgery, Luebeck (Germany); Schild, Steven E. [Mayo Clinic Scottsdale, Department of Radiation Oncology, Scottsdale (United States)

    2014-09-15

    Three doses were compared for local control of irradiated metastases, freedom from new brain metastases, and survival in patients receiving stereotactic radiosurgery (SRS) alone for one to three newly diagnosed brain metastases. In all, 134 patients were assigned to three groups according to the SRS dose given to the margins of the lesions: 13-16 Gy (n = 33), 18 Gy (n = 18), and 20 Gy (n = 83). Additional potential prognostic factors were evaluated: age (≤ 60 vs. > 60 years), gender, Karnofsky Performance Scale score (70-80 vs. 90-100), tumor type (non-small-cell lung cancer vs. melanoma vs. others), number of brain metastases (1 vs. 2-3), lesion size (< 15 vs. ≥ 15 mm), extracranial metastases (no vs. yes), RPA class (1 vs. 2), and interval of cancer diagnosis to SRS (≤ 24 vs. > 24 months). For 13-16 Gy, 18 Gy, and 20 Gy, the 1-year local control rates were 31, 65, and 79 %, respectively (p < 0.001). The SRS dose maintained significance on multivariate analysis (risk ratio: 2.25; 95 % confidence interval: 1.56-3.29; p < 0.001). On intergroup comparisons of local control, 20 Gy was superior to 13-16 Gy (p < 0.001) but not to 18 Gy (p = 0.12); 18 Gy showed a strong trend toward better local control when compared with 13-16 Gy (p = 0.059). Freedom from new brain metastases (p = 0.57) and survival (p = 0.15) were not associated with SRS dose in the univariate analysis. SRS doses of 18 Gy and 20 Gy resulted in better local control than 13-16 Gy. However, 20 Gy and 18 Gy must be compared again in a larger cohort of patients. Freedom from new brain metastases and survival were not associated with SRS dose. (orig.) [German] Drei Dosislevel bei der alleinigen stereotaktischen Radiochirurgie (SRS) von 1 bis 3 neu diagnostizierten Hirnmetastasen wurden hinsichtlich lokaler Kontrolle der bestrahlten Metastasen, Nichtauftreten neuer Hirnmetastasen und Gesamtueberleben verglichen. Nach der am Rand der Metastasen applizierten SRS-Dosis wurden 134 Patienten den Gruppen 13

  12. THE PALEOPROTEROZOIC IMANDRA-VARZUGA RIFTING STRUCTURE (KOLA PENINSULA: INTRUSIVE MAGMATISM AND MINERAGENY

    Directory of Open Access Journals (Sweden)

    V. V. Chashchin

    2014-01-01

    Full Text Available The article provides data on the structure of the Paleoproterozoic intercontinental Imandra-Varzuga rifting structure (IVS and compositions of intrusive formations typical of the early stage of the IVS development and associated mineral resources. IVS is located in the central part of the Kola region. Its length is about 350 km, and its width varies from 10 km at the flanks to 50 km in the central part. IVS contains an association of the sedimentary-volcanic, intrusive and dyke complexes. It is a part of a large igneous Paleoproterozoic province of the Fennoscandian Shield spreading for a huge area (about 1 million km2, which probably reflects the settings of the head part of the mantle plume. Two age groups of layered intrusions were associated with the initial stage of the IVS development. The layered intrusions of the Fedorovo-Pansky and Monchegorsk complexes (about 2.50 Ga are confined to the northern flank and the western closure of IVS, while intrusions of the Imandra complex (about 2.45 Ga are located at the southern flank of IVS. Intrusions of older complexes are composed of rock series from dunite to gabbro and anorthosites (Monchegorsk complex and from orthopyroxenite to gabbro and anorthosites (Fedorovo-Pansky complex. Some intrusions of this complexes reveal features of multiphase ones. The younger Imandra complex intrusions (about 2.45 Ga are stratified from orthopyroxenite to ferrogabbro. Their important feature is comagmatical connection with volcanites. All the intrusive complexes have the boninite-like mantle origin enriched by lithophyle components. Rocks of these two complexеs with different age have specific geochemical characteristics. In the rocks of the Monchegorsk and Fedorovo-Pansky complexes, the accumulation of REE clearly depends on the basicity of the rocks, the spectrum of REE is non-fractionated and ‘flat’, and the Eu positive anomaly is slightly manifested. In the rocks of the Imandra complex, the level of

  13. Biological effect of plutonium 239 on Salmonella typhimurium

    International Nuclear Information System (INIS)

    Gafieva, Z.A.; Chudin, V.A.

    1988-01-01

    Salmonella typhimurium cells were exposed in a 239 Pu citrate solution. Cell death and induction of gene mutations were an exponential fucntion of γ-radiation dose. LD 37 was 34.8 Gy; mutation doubling dose, 19 Gy

  14. The morphological study of age-dependent effects in rat thyroids after γ-ray irradiation

    International Nuclear Information System (INIS)

    Zhang Xuefeng; Guo Lisheng; Tu Kaicheng; Xian Guoliang; Shi Feiman

    1993-01-01

    The purpose of this paper is to identify the differences in age-related harmful effects of the thyroid gland to ionizing radiation. The infant (0.5 month) and adult rats (2.5,6 and 15 months, respectively) were exposed to single γ-ray neck irradiation (0 Gy, as control, 0.5 Gy, 2 Gy, 4 Gy, 8 Gy, 16 Gy). The structure of irradiated thyroid gland under light and transmission electron microscope were observed at 6 weeks after partial irradiation. Some morphometric parameters were measured under light microscope. The results showed that the infant rat thyroids changed significantly after 0.5 Gy, but the adult thyroids expressed similar response after more than 2 Gy. Analyses of these data and information on pathology suggested that the infant thyroids were more radiosensitive than the adult ones

  15. Radiation Dose Measurements in Routine X Ray Examinations

    International Nuclear Information System (INIS)

    Osman, H.; Sulieman, A.; Suliman, I.I.; Sam, A.K.

    2011-01-01

    The aim of current study was to evaluate patients radiation dose in routine X-ray examinations in Omdurman teaching hospital Sudan.110 patients was examined (134) radiographs in two X-ray rooms. Entrance surface doses (ESDs) were calculated from patient exposure parameters using DosCal software. The mean ESD for the chest, AP abdomen, AP pelvis, thoracic spine AP, lateral lumber spine, anteroposterior lumber spine, lower limb and for the upper limb were; 231±44 Gy,453± 29 Gy, 567±22 Gy, 311±33 Gy,716±39 Gy, 611±55 Gy,311±23 Gy, and 158±57 Gy, respectively. Data shows asymmetry in distribution. The results of were comparable with previous study in Sudan.

  16. Studies on the bactericidal effect of ionizing radiation on pig manure

    Energy Technology Data Exchange (ETDEWEB)

    Kleiner, U; Trenner, P [Ministerium fuer Land-, Forst- und Nahrungsgueterwirtschaft der DDR, Eberswalde. Inst. fuer Angewandte Tierhygiene

    1983-03-01

    Pig manure was treated with electrons and gamma rays at radiation doses of 4, 8, 15 and 30 kGy, resp. The mesophile bacteria were significantly reduced by all electron doses, but with repropagation at the 7. post-irradiation day. Gamma radiation at 4 and 8 kGy resulted also in not lasting reduction of mesophile bacteria. 15 kGy caused a significant and persistent elimination of the germs. 15 kGy electron irradiation and 8 kGy gamma irradiation killed the proteolytic bacteria. Euterococci and lactose-splitting bacteria were killed at 4 kGy irradiation of both kinds. Lasting elimination of manure specific germs was reached with 15 kGy ..gamma..-rays and more than 30 kGy electrons, resp. All the treatments are expensive and cannot be recommended.

  17. Histopathological changes in the irradiated normal organs of guinea pigs with conventional fractionation and hyperfractionation

    International Nuclear Information System (INIS)

    Inomata, Taisuke; Itoh, Satoshi; Tsuboi, Nobuaki

    1998-01-01

    Guinea pigs were divided into groups according to four irradiation schedules : 2 Gy/3 Gy x 1/day, five fractions/week, total 80 Gy/81 Gy (A/C group) and 1.0 Gy/1.5 Gy x 2/day, ten fractions/week, total 80 Gy/81 Gy (B/D group). The A group and the C group pathologically caused severe damage in the kidney six and three months after irradiation, respectively. In the B group pathological analysis suggested that only slight-to-moderate changes were occurred in the Bowman's capsule. The D group caused slight damage in the kidney six months after irradiation. Hyperfractionation (B/D group) used in this protocol can clearly reduce radiation damage in the kidney of guinea pigs as compared with conventional fractionation (A/C group). (author)

  18. Dose rate-dependent marrow toxicity of TBI in dogs and marrow sparing effect at high dose rate by dose fractionation.

    Science.gov (United States)

    Storb, R; Raff, R F; Graham, T; Appelbaum, F R; Deeg, H J; Schuening, F G; Sale, G; Seidel, K

    1999-01-01

    We evaluated the marrow toxicity of 200 and 300 cGy total-body irradiation (TBI) delivered at 10 and 60 cGy/min, respectively, in dogs not rescued by marrow transplant. Additionally, we compared toxicities after 300 cGy fractionated TBI (100 cGy fractions) to that after single-dose TBI at 10 and 60 cGy/min. Marrow toxicities were assessed on the basis of peripheral blood cell count changes and mortality from radiation-induced pancytopenia. TBI doses studied were just below the dose at which all dogs die despite optimal support. Specifically, 18 dogs were given single doses of 200 cGy TBI, delivered at either 10 (n=13) or 60 (n=5) cGy/min. Thirty-one dogs received 300 cGy TBI at 10 cGy/min, delivered as either single doses (n=21) or three fractions of 100 cGy each (n=10). Seventeen dogs were given 300 cGy TBI at 60 cGy/min, administered either as single doses (n=5) or three fractions of 100 cGy each (n=10). Within the limitations of the experimental design, three conclusions were drawn: 1) with 200 and 300 cGy single-dose TBI, an increase of dose rate from 10 to 60 cGy/min, respectively, caused significant increases in marrow toxicity; 2) at 60 cGy/min, dose fractionation resulted in a significant decrease in marrow toxicities, whereas such a protective effect was not seen at 10 cGy/min; and 3) with fractionated TBI, no significant differences in marrow toxicity were seen between dogs irradiated at 60 and 10 cGy/min. The reduced effectiveness of TBI when a dose of 300 cGy was divided into three fractions of 100 cGy or when dose rate was reduced from 60 cGy/min to 10 cGy/min was consistent with models of radiation toxicity that allow for repair of sublethal injury in DNA.

  19. Biological dose assessment by cytogenetic dosimetry in the Goianian radiation accident

    International Nuclear Information System (INIS)

    Ramalho, A.T.; Nascimento, A.C.H.; Bellido, P.

    1989-01-01

    During the recent Goianian radiation accident, 112 exposed or potentially exposed individuals were analyzed for the frequencies of chromosomal aberrations (dicentrics and rings) in their lymphocytes, for estimation of the absorbed radiation dose. Of these, 29 subjects had dose estimates exceeding 0.5 Gy, 21 exceeded 1.0 Gy and eight exceeded 4.0 Gy. None of the estimates exceeded 7.0 Gy. (author)

  20. Reaction of the hematopoietic system under long-term emotional stress developed after preliminary gamma-irradiation with low doses

    International Nuclear Information System (INIS)

    Moroz, B.B.; Deshevoj, Yu.B.; Lebedev, V.G.; Lyrshchikova, A.V.; Vorotnikova, T.V.

    1997-01-01

    In experiments on rats and mice it was shown that the preliminary protected gamma-irradiation with cumulative dose of 0.9 Gy (dose rate - 0.03 Gy/day) or single short-term gamma-irradiation with dose of 0.9 Gy (dose rate - 1.61 Gy/min) inhibited development of adaptive reactions and compensatory abilities of the hematopoietic system under long-term emotional stress

  1. Late radiation effect on the eye

    International Nuclear Information System (INIS)

    Morita, Kozo; Uchiyama, Yukio; Horiuchi, Junichi; Masaki, Norie; Nishio, Masamichi.

    1987-01-01

    In order to analyze the chronic radiation injury onothe eye, 264 cases with carcinoma of the paranasal sinuses were accumulated from the four large hospitals. 50 % appearance dose of the chronic radiation injury, chiefly the radiation cataract, in 3, 5, 7 and 10 years after radiotherapy was 51.6 Gy, 28.3 Gy, 23.9 Gy and 21.6 Gy, respectively. (author)

  2. SU-F-T-659: Nanoparticle-Aided Eye Plaque Radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Chin, J [University of Masschusetts-Lowell, Lowell, Massachusetts (United States); Ngwa, W [Harvard Medical School, Boston, MA (United States)

    2016-06-15

    Purpose: Eye plaque brachytherapy is one of the approaches for radiotherapy treatment for ocular cancers: retinoblastoma and choroidal melanoma. This study, investigates the potential benefits of using gold nanoparticles to enhance therapeutic efficacy during eye plaque brachytherapy. Methods: The EYE PHYSICS Inc. Plaque Simulator program distributed by IsoAid, LLC, Port Richey, Florida was used. It is based on the superposition of dose contributions from individual seeds following the TG–43 formalism. Dose enhancement factor (DEF) values for feasible nanoparticle concentrations from previous studies was used to investigate the benefit of using nanoparticles to enhance dose to tumour or reduce dose to healthy tissue. The dose enhancement factor (DEF) represents the ratio of the dose deposited in tumour with nanoparticles divided by dose deposited in the tumour without nanoparticles. The investigation was done for I–125 and Pd–103 typical sources employed for eye plaque brachytherapy. The prescription dose used is 85 Gy. Results: Lower dose enhancement values were obtained for Pd–103. With DEF of 2 due to gold nanoparticles, critical structure doses reduce by a factor of 2. Optic disc dose is 6.69 Gy and 4.571 Gy, opposite retina dose is 4.064 and 2.484 Gy, lens dose is 12.66 Gy and 9.870 Gy, and fovea dose is 9.85 Gy and 7.275 Gy. With DEF of 3 due to gold nanoparticles, critical structure doses reduce by a factor of 3. Optic disc dose is 4.352 Gy and 2.975 Gy, opposite retina dose is 2.644 Gy and 1.618 Gy, lens dose is 8.322 Gy and 6.427 Gy, and fovea dose is 4.815 Gy and 4.737 Gy. Conclusion: The results of this research predict that using gold nanoparticles will lead to major sparing of dose to critical structures. The finding provides more impetus for the development of nanoparticle–aided brachytherapy.

  3. Adult exposures from MDCT including multiphase studies: first Italian nationwide survey

    Energy Technology Data Exchange (ETDEWEB)

    Palorini, Federica; Origgi, Daniela [Fisica Sanitaria Istituto Europeo di Oncologia, Milan (Italy); Granata, Claudio [UOC di Radiologia Istituto Giannina Gaslini, Genoa (Italy); Matranga, Domenica [Universita degli Studi di Palermo, Dipartimento di Scienze per la Promozione della Salute e Materno-infantile ' ' G. D' Alessandro' ' , Palermo (Italy); Salerno, Sergio [Policlinico Universita di Palermo, Dipartimento di Scienze Radiologiche, Palermo (Italy)

    2014-02-15

    To evaluate the radiation dose in routine multidetector computed tomography (MDCT) examinations in Italian population. This was a retrospective multicentre study included 5,668 patients from 65 radiology departments who had undergone common CT protocols: head, chest, abdomen, chest-abdomen-pelvis (CAP), spine and cardiac. Data included patient characteristics, CT parameters, volumetric CT dose index (CTDI{sub vol}) and dose length product (DLP) for each CT acquisition phase. Descriptive statistics were calculated, and a multi-regression analysis was used to outline the main factors affecting exposure. The 75th percentiles of CTDI{sub vol} (mGy) and DLP (mGy cm) for whole head were 69 mGy and 1,312 mGy cm, respectively; for chest, 15 mGy and 569 mGy cm; spine, 42 mGy and 888 mGy cm; cardiac, 7 mGy and 131 mGy cm for calcium score, and 61 mGy and 1,208 mGy cm for angiographic CT studies. High variability was present in the DLP of abdomen and CAP protocols, where multiphase examinations dominated (71 % and 73 % respectively): for abdomen, 18 mGy, with 555 and 920 mGy cm in abdomen and abdomen-pelvis acquisitions respectively; for CAP, 17 mGy, with 508, 850 and 1,200 mGy cm in abdomen, abdomen-pelvis and CAP acquisitions respectively. The results of this survey could help in the definition of updated diagnostic reference levels (DRL). (orig.)

  4. Dicty_cDB: SLF305 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ilaanql qklkngesitsigssssssssslasspltfsaggggggsyspmfnfsaisiraptgiddm vskqkghlynyygqqqhshyhhgyqhhnihqtygshpndvi...ghlynyygqqqhshyhhgyqhhnihqtygshpndvitydpnlclldpnnskiydy yrqqysdl*yrwgsfrkesrgieiyst*gsr*gy*fln*mykmq*kvk*lll

  5. Effect of radiation on bacterial cells pathogenesis

    International Nuclear Information System (INIS)

    Szulc, M.; Tropilo, J.; Zajaczkowska, E.

    1983-01-01

    In order to determine the effect of X rays on the pathogeny of Erysipelothrix rhusiopathiae and Pasteurella multocida 334 mice were infected subcutaneously with the germs exposed to 10 Gy and D 10 . It was found that a single exposition of E. rhusiopathiae and P. multocida to 10 Gy and D 10 did not change pathogenic properties of these cells. P. multocida showed higher sensitivity to X rays: D 10 for that species was 94 Gy and for E. rhusiopathiae - 156 Gy. (author)

  6. Phenomenon of hormesis on γ-irradiated developing rat pups

    International Nuclear Information System (INIS)

    Ruda, V.P.; Kuzin, A.M.

    1991-01-01

    Development of rat pups was shown to accelerate body mass up 121% of control) afetr γ-irradiation on day 21 of the postnatal development (2.88 cGy, dose-rate of 0.12 cGy/h). Higher cumulative doses (14.4 and 144 cGy) did not influence the body mass growth, and inhibition was only caused by doses exceeding 150 cGy

  7. Effect of gamma ray irradiation on seed germination of Ardisia crenata

    International Nuclear Information System (INIS)

    Huang Donghua; Xu Hong; Huang Yanping; Song Xiaomin

    2011-01-01

    The seeds of Ardisia crenata were used as experimental material and treated with gamma ray under the irradiative doses ranging from 50 to 500 Gy. The results showed that the seed germination rates were not affected under the irradiative dose of 150 Gy and below. The germination potentiality turned to reduce while the irradiative dose was higher than 250 Gy. And in the range of 300 to 500 Gy the germination rates were decreased with the increase of the irradiative dose. (authors)

  8. Sterilizing effect of irradiation for Zuogui power with electron beam and γ-rays

    International Nuclear Information System (INIS)

    Yue Ling; Kong Qiulian; Qi Wenyuan; Bao Yingzi; Chen Zhijun; Yuan Zhongyi

    2011-01-01

    The sterilizing effect of irradiation for Zuogui powder with accelerator (electron beam) and a cobalt unit (γ-rays) was studied. The results indicated that the D 10 values of E-beam irradiation and γ-rays irradiation were 2.602 kGy and 2.597 kGy for aerobic bacterial count, while those were 3.112 kGy and 3.208 kGy for mould and yeasts. (authors)

  9. SU-F-T-659: Nanoparticle-Aided Eye Plaque Radiotherapy

    International Nuclear Information System (INIS)

    Chin, J; Ngwa, W

    2016-01-01

    Purpose: Eye plaque brachytherapy is one of the approaches for radiotherapy treatment for ocular cancers: retinoblastoma and choroidal melanoma. This study, investigates the potential benefits of using gold nanoparticles to enhance therapeutic efficacy during eye plaque brachytherapy. Methods: The EYE PHYSICS Inc. Plaque Simulator program distributed by IsoAid, LLC, Port Richey, Florida was used. It is based on the superposition of dose contributions from individual seeds following the TG–43 formalism. Dose enhancement factor (DEF) values for feasible nanoparticle concentrations from previous studies was used to investigate the benefit of using nanoparticles to enhance dose to tumour or reduce dose to healthy tissue. The dose enhancement factor (DEF) represents the ratio of the dose deposited in tumour with nanoparticles divided by dose deposited in the tumour without nanoparticles. The investigation was done for I–125 and Pd–103 typical sources employed for eye plaque brachytherapy. The prescription dose used is 85 Gy. Results: Lower dose enhancement values were obtained for Pd–103. With DEF of 2 due to gold nanoparticles, critical structure doses reduce by a factor of 2. Optic disc dose is 6.69 Gy and 4.571 Gy, opposite retina dose is 4.064 and 2.484 Gy, lens dose is 12.66 Gy and 9.870 Gy, and fovea dose is 9.85 Gy and 7.275 Gy. With DEF of 3 due to gold nanoparticles, critical structure doses reduce by a factor of 3. Optic disc dose is 4.352 Gy and 2.975 Gy, opposite retina dose is 2.644 Gy and 1.618 Gy, lens dose is 8.322 Gy and 6.427 Gy, and fovea dose is 4.815 Gy and 4.737 Gy. Conclusion: The results of this research predict that using gold nanoparticles will lead to major sparing of dose to critical structures. The finding provides more impetus for the development of nanoparticle–aided brachytherapy.

  10. The effects of chemical and physical mutagens on morphological ...

    African Journals Online (AJOL)

    The lowest germination percentage belonged to ethyl methane sulfanate (0.7%). Mean comparison of radical length trait showed that the highest radical length belonged to gamma ray control, 200 Gy and sodium azide (SA) 0.5 mM and treatments of gamma ray 700 Gy, 1200 Gy and ethylmethane sulphonate (EMS) 0.7% ...

  11. The two types of a loss of sight (blindness) exhibited by cats and dogs after local irradiation of heat

    International Nuclear Information System (INIS)

    Ushakov, I.B.; Razgovorov, B.L.

    1985-01-01

    After local irradiation of heads with doses of 50 to 100 Gy cats and dogs exhibited two types of a loss of sight: early blindness (during the first two hours) noted only in cats after a dose of 100 Gy, and delayed blindness in cats after a dose of 50 Gy, and in dogs after all doses under study

  12. A dose-response analysis for classical Kaposi's sarcoma management by radiotherapy

    International Nuclear Information System (INIS)

    Oysul, K.; Beyzadeoglu, M.; Surenkok, S.; Ozyigit, G.; Dirican, B.

    2008-01-01

    Objective was to evaluate the dose-response relationship in classical Kaposi's sarcoma CKS patients treated with external beam radiotherapy. Between 1993 and 2004, patients with CKS treated at the Department of Radiation Oncology, Gulhane Military Medical School, Ankara, Turkey were evaluated in this retrospective study. The median age at initial presentation was 60 years. First we analyzed the overall response rates for normalized total dose2Gy NTD2Gy of 20Gy. Secondly we searched for whether better response rates could be obtained with the NTD2Gy of >/=20Gy compared to the NTD2Gy of /20Gy and 64% and 24%for NDT2Gyof 20< Gy and these were statistically different p=0.001. Late side effects of radiation therapy were acceptable in all but 4 patients with fibrosis and edema. This retrospective analysis showed that radiotherapy schedules with an NDT2Gy of 20 Gy and above by using local irradiation fields are effective in terms of complete response rates in the management of CKS compared to NDT2Gy of < 20 Gy. (author)

  13. Low-Dose Radiation Exposure and Atherosclerosis in ApoE(-/-) Mice

    NARCIS (Netherlands)

    Mitchel, R. E. J.; Hasu, M.; Bugden, M.; Wyatt, H.; Little, M. P.; Gola, A.; Hildebrandt, G.; Priest, N. D.; Whitman, S. C.

    The hypothesis that single low-dose exposures (0.025-0.5 Gy) to low-LET radiation given at either high (about 150 mGy/min) or low (1 mGy/min) dose rate would promote aortic atherosclerosis was tested in female C57BL/6J mice genetically predisposed to this disease (ApoE(-/-)). Mice were exposed

  14. Effect of gamma irradiation on the cigarette beetles reared on cayenne pepper

    International Nuclear Information System (INIS)

    Imamura, Taro; Miyanoshita, Akihiro; Todoriki, Setsuko

    2009-01-01

    Effect of gamma irradiation on the survival of the cigarette beetles reared on cayenne pepper was investigated. Gamma ray at a dose of 62 Gy completely killed eggs and larvae of the beetles. Some pupae survived at 540 Gy, but all pupae were killed at 1076 Gy. (author)

  15. Sterilizing effects and lethal effects of gamma radiation on different phases of life cycle of the sitotroga cerealella (Olivier) in rice and maize

    International Nuclear Information System (INIS)

    Arthur, V.

    1985-01-01

    The objective of this research to verify the effects of the gamma radiation on different phases of the life cycle of the gamma radiation on different phases of the life cycle of the moth grain Angoumois, Sitotroga cerealella (Olivier, 1819). For all the treatment with gamma radiation a Cobalt-60 source type Gammabeam-650 was used and the activity was approximately 3.1 x 10 sup(14) Bq., with dose rate of 3.01 kGy per hour. The LD sub(100) of gamma radiation for eggs of insects reared in rice and maize were respectively 100 Gy and 125 Gy. The sterilizing doses in adults which were irradiated at immature phases (larvae and pupae) were 100 Gy and 200 Gy in rice and 150 Gy and 250 Gy in maize, respectively. The sterilizing doses for females and males in maize were respectively 350 Gy and 500 Gy. The LD sub(100) for adult females were 4500 Gy and 4750 Gy for males, both in rice. The LD sub(100), for adult reared on maize was 4750 Gy for both sexes. (author)

  16. Evaluation of the toxicity of the methanolic extract of Caesalpinia Pyramidalis, subjected to gamma radiation, compared to saline artemias; Avaliacao da toxicidade do extrato metanolico de Caesalpinia Pyramidalis, submetido a radiacao gama, frente a artemias salinas

    Energy Technology Data Exchange (ETDEWEB)

    Pessoa, Juanna G.; Santos, Mariana L.O.; Costa, Michelle C.A.; Siqueira, Williams N.; Silva, Luanna R.S.; Cabral, Daniela L.V.; Amancio, Francisco F.; Melo, Ana M.M.A., E-mail: marianasantos_ufpe@hotmail.com [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil)

    2013-07-01

    The present study aimed to investigate the possible effect of irradiation of 60 Co in methanol extract of Caesalpinia pyramidalis (catingueira) with function of reducing the toxicity of the extract at concentrations of 1000, 500, 250 and 125 ppm irradiating them with doses of 5 kGy 7 kGy and 10 kGy, using lethality tests with saline Artemias.

  17. Nutritional and chemical alteration of raw, irradiated and cooked chickpea (Cicer arietinum L.)

    International Nuclear Information System (INIS)

    Ferreira, Andrea C. Penati; Arthur, Valter; Brazzaca, Solange Guidolin Canniatti

    2007-01-01

    The work objective was analyzing the centesimal and mineral composition to verifying the alterations on the nutritional characteristics caused by the cooking process. Also were carried out analysis of the iron availability in vitro, protein digestibility in vitro and the profile of amino acids in the raw and cooked in the control and irradiated seeds (doses of 2 kGy, 4 kGy, 6 kGy, 8 kGy and 10 kGy). The results of the mineral analysis showed that only phosphorus decrease with cooking process and it decreased ash and carbohydrates available. In the control and in the doses of 4 kGy and 6 kGy the cooking has not influenced the digestibility of the protein, but the treatments that received radiation doses of 2 kGy, 8 kGy and 10 kGy were influenced. The cooked chickpea has shown better digestibility in higher doses of radiation although the treatments have shown low digestibility. The raw chickpea presented a better dialysis of iron in the control and in the doses 2 kGy and 4 kGy and the cooked chickpea presented improvement according to the increase of radiation doses. In relation to the essential amino acids, the chickpea has presented an adequate nutritional value, except for the methionine. (author)

  18. A study of the synergetic effect of strawberry γ-ray radiation

    International Nuclear Information System (INIS)

    Xu Shihong; Zhu Zhaodi

    1990-01-01

    The change of commerical strawberry quality during storage period was studied. The shelf lifetimes of irradiated strawberries by the single radiation means using 1 kGy, 2 kGy or 3 kGy doses are not longer than that of the storage in icebox. However, the study indicated taht the synergetic effect could be produced by combine radiation means with icebox

  19. The effect of gamma irradiation on the degree of ripening of mango by comparing the parameter of colour index, texture firmness and pH value

    International Nuclear Information System (INIS)

    Muhammad Hafiz Hanafi

    2012-01-01

    This study was carried out to determine the effect of low dose gamma irradiation on the ripening degree of cv Chokanan mangoes through the comparison of colour index changes, texture firmness and pH value. Harvested mature mango was studied through the storage period for 14 days. Dose level used were 0.00 kGy (control), 0.25 kGy, 0.50 kGy, 0.75 kGy and 1.00 kGy of gamma cell 220. All fruits were wrapped using plastic after irradiated. There was no change in 0 day. However, there are changes in colour index, firmness and pH value of fruits in after 3 days. Dose of 0.75 kGy and 1.00 kGy gave positive effect to storage extension period and rate deceleration compared to 0.00 kGy (control), 0.25 kGy and 0.50 kGy. After 10 days storage, 0.00, 0.25 and 0.50 kGy of fruits became rot which affects quality of organoleptic. Whereas 0.75 and 1.00 kGy still retained organoleptic quality . When the ripening rate of fruit was fast, this would lead to faster of the colour change. The firmness value of fruit became decrease and the value of pH was increase. (author)

  20. Influence of ionizing radiation on agressiveness of mice

    International Nuclear Information System (INIS)

    Mogil'ner, A.A.

    1988-01-01

    Changes in the aggressiveness of mice were studied after exposure thereof to 5, 10, 30, 60 and 100 Gy radiation. With doses of 5, 10, and 30 Gy no stable effect on the aggresive behaviour of mice was observed, while doses of 60 and 100 Gy suppressed it drastically. Stress at the time of exposure can enhance the antiagressive effect of radiation

  1. Determination of gonad, eye and bone marrow doses with EMI-5005 head and whole body scans

    International Nuclear Information System (INIS)

    Nishizawa, Kanae; Iwata, Takeo; Furuya, Yoshiro; Maruyama, Takashi; Hashizume, Tadashi.

    1979-01-01

    Dose determinations of tissues and organs during head and whole body scanning with an EMI computed tomographic equipment have been carried out using a Rando woman phantom. The surface dose on the phantom was measured with a Sakura lith Contact film dosimeter system. The absorbed doses in the eyes, thyroids, ovaries and the bone marrow were measured with a thermoluminescent dosimeter. The resultant surface doses for head scanning were 2.8 rad (28 mGy) per scan at maximum and 0.26 rad (2.6 mGy) per scan at minimum, and the doses for whole body scanning were 2.7 rad (27 mGy) per scan at maximum and 0.1 rad (1.0 mGy) per scan at minimum. For the complete gynecological scanning consisting of 8 slices, the eye, thyroid, ovary and the bone marrow dose was 2.4 mrad (24 μGy), 3.5 mrad (35 μGy), 500 mrad (5 mGy) and 225 mrad (2.25 mGy), respectively. And, for a typical head scanning consisting of 5 slices, the eye, thyroid, ovary and the bone marrow dose was 1400 mrad (14 mGy), 46 mrad (460 μGy), 0.60 mrad (6 μGy) and 73 mrad (730 μGy), respectively. (author)

  2. Calibration and testing of the DMG gamma dosimeter

    International Nuclear Information System (INIS)

    Dolgirev, E.I.

    1987-01-01

    25-1000 nGy/h (2.5-1000 μrad/h) absorbed dose gamma dosimeter for measuring the efficient equivalent irradiation dose for population is developed. It has two subranges 1000 nGy/h and 250 nGy/h. Results of dosimeter calibration and testing are presented. The dosimeter error for both subranges is less than 10%

  3. Nutritional and chemical alteration of raw, irradiated and cooked chickpea (Cicer arietinum L.)

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira, Andrea C. Penati; Arthur, Valter [Centro de Energia Nuclear na Agricultura (CENA/USP), Piracicaba, SP (Brazil)]. E-mails: andrea@dtr.com.br; acpferre@cena.usp.br; arthur@cena.usp.br; Brazzaca, Solange Guidolin Canniatti [Escola Superior de Agricultura Luis de Queiroz (ESALQ/USP), Piracicaba, SP (Brazil)]. E-mail: sgcbraza@esalq.usp.br

    2007-07-01

    The work objective was analyzing the centesimal and mineral composition to verifying the alterations on the nutritional characteristics caused by the cooking process. Also were carried out analysis of the iron availability in vitro, protein digestibility in vitro and the profile of amino acids in the raw and cooked in the control and irradiated seeds (doses of 2 kGy, 4 kGy, 6 kGy, 8 kGy and 10 kGy). The results of the mineral analysis showed that only phosphorus decrease with cooking process and it decreased ash and carbohydrates available. In the control and in the doses of 4 kGy and 6 kGy the cooking has not influenced the digestibility of the protein, but the treatments that received radiation doses of 2 kGy, 8 kGy and 10 kGy were influenced. The cooked chickpea has shown better digestibility in higher doses of radiation although the treatments have shown low digestibility. The raw chickpea presented a better dialysis of iron in the control and in the doses 2 kGy and 4 kGy and the cooked chickpea presented improvement according to the increase of radiation doses. In relation to the essential amino acids, the chickpea has presented an adequate nutritional value, except for the methionine. (author)

  4. Geologic Map of the Shenandoah National Park Region, Virginia

    Science.gov (United States)

    Southworth, Scott; Aleinikoff, John N.; Bailey, Christopher M.; Burton, William C.; Crider, E.A.; Hackley, Paul C.; Smoot, Joseph P.; Tollo, Richard P.

    2009-01-01

    The geology of the Shenandoah National Park region of Virginia was studied from 1995 to 2008. The focus of the study was the park and surrounding areas to provide the National Park Service with modern geologic data for resource management. Additional geologic data of the adjacent areas are included to provide regional context. The geologic map can be used to support activities such as ecosystem delineation, land-use planning, soil mapping, groundwater availability and quality studies, aggregate resources assessment, and engineering and environmental studies. The study area is centered on the Shenandoah National Park, which is mostly situated in the western part of the Blue Ridge province. The map covers the central section and western limb of the Blue Ridge-South Mountain anticlinorium. The Skyline Drive and Appalachian National Scenic Trail straddle the drainage divide of the Blue Ridge highlands. Water drains northwestward to the South Fork of the Shenandoah River and southeastward to the James and Rappahannock Rivers. East of the park, the Blue Ridge is an area of low relief similar to the physiography of the Piedmont province. The Great Valley section of the Valley and Ridge province is west of Blue Ridge and consists of Page Valley and Massanutten Mountain. The distribution and types of surficial deposits and landforms closely correspond to the different physiographic provinces and their respective bedrock. The Shenandoah National Park is underlain by three general groups of rock units: (1) Mesoproterozoic granitic gneisses and granitoids, (2) Neoproterozoic metasedimentary rocks of the Swift Run Formation and metabasalt of the Catoctin Formation, and (3) siliciclastic rocks of the Lower Cambrian Chilhowee Group. The gneisses and granitoids mostly underlie the lowlands east of Blue Ridge but also rugged peaks like Old Rag Mountain (996 meter). Metabasalt underlies much of the highlands, like Stony Man (1,200 meters). The siliciclastic rocks underlie linear

  5. Length Scales and Types of Heterogeneities Along the Deep Subduction Interface: Insights From an Exhumed Subduction Complex on Syros Island, Greece

    Science.gov (United States)

    Kotowski, A. J.; Behr, W. M.; Tong, X.; Lavier, L.

    2017-12-01

    The rheology of the deep subduction interface strongly influences the occurrence, recurrence, and migration of episodic tremor and slow slip (ETS) events. To better understand the environment of deep ETS, we characterize the length scales and types of rheological heterogeneities that decorate the deep interface using an exhumed subduction complex. The Cycladic Blueschist Unit on Syros, Greece, records Eocene subduction to 60 km, partial exhumation along the top of the slab, and final exhumation along Miocene detachment faults. The CBU reached 450-580˚C and 14-16 kbar, PT conditions similar to where ETS occurs in several modern subduction zones. Rheological heterogeneity is preserved in a range of rock types on Syros, with the most prominent type being brittle pods embedded within a viscous matrix. Prograde, blueschist-facies metabasalts show strong deformation fabrics characteristic of viscous flow; cm- to m-scale eclogitic lenses are embedded within them as massive, veined pods, foliated pods rotated with respect to the blueschist fabric, and attenuated, foliation-parallel lenses. Similar relationships are observed in blueschist-facies metasediments interpreted to have deformed during early exhumation. In these rocks, metabasalts form lenses ranging in size from m- to 10s of m and are distributed at the m-scale throughout the metasedimentary matrix. Several of the metamafic lenses, and the matrix rocks immediately adjacent to them, preserve multiple generations of dilational veins and shear fractures filled with quartz and high pressure minerals. These observations suggest that coupled brittle-viscous deformation under high fluid pressures may characterize the subduction interface in the deep tremor source region. To test this further, we modeled the behavior of an elasto-plastic pod in a viscous shear zone under high fluid pressures. Our models show that local stress concentrations around the pod are large enough to generate transient dilational shear at seismic

  6. Drilling the leading edge of the mantle wedge and the underlying metamorphic sole of the Samail Ophiolite: Hole BT1B, Oman Drilling Project

    Science.gov (United States)

    Morishita, T.; Kelemen, P. B.; Coggon, J. A.; Harris, M.; Matter, J. M.; Michibayashi, K.; Takazawa, E.; Teagle, D. A. H.

    2017-12-01

    metasediments and metabasalts. Metasediments have qtz + plag and mica + amphibole layers, with minor epidote, and become less abundant and poorer in K downhole. Metabasalts are massive, epidote-rich with less qtz and mica. Actinolite and possible pumpellyite needles in quartz suggest low T/P. Sediment and basalt compositions resemble alkali basalt.

  7. Structures and microfabrics of the Franciscan Complex (California): Inferences on the rheology and kinematics of a subduction channel

    Science.gov (United States)

    Krohe, A.; Wassmann, S.; Trepmann, C.; Stoeckhert, B.

    2009-12-01

    The characteristic feature of the Franciscan Subduction Complex (FSC) is a chaotic mélange structure with centimeter- to about one kilometer-sized tectonic blocks composed of metabasalts, floating in a matrix of oceanic meta-sediments or, locally, serpentinites. Investigating map scale structures, microfabrics, and P-T-histories of the FSC, we try to gain information on the mechanical properties of rocks and their influence on the kinematics of material transport in a subduction channel. Structures and microfabrics indicate that metabasalts from the oceanic crust as well as mantle-derived ultramafic rocks (i) underwent fragmentation and sealing under high pore fluid pressure, (ii) remaining internally undeformed, or (iii) deform by dissolution precipitation creep. Importantly, microfabrics which would indicate crystal plastic deformation or dislocation creep are systematically absent. This means that, during the entire P-T history, differential stresses generally remained too low to activate crystal plastic deformation or dislocation creep. Hence the material in the subduction channel is characterized by a low strength, being either limited by brittle failure at high pore fluid pressure, or a Newton viscosity, which is expected for dissolution precipitation creep. We interpret the characteristic mélange structure as to reflect this mechanical state of the system: Brittle failure at quasi-lithostatic fluid pressures down to great depths is recorded in the tectonic blocks by the widespread occurrence of aragonite-bearing veins. This leads to fragmentation into the blocks of variable size and moderate aspect ratios, which behave as rigid inclusions in a flowing matrix with distributed deformation by dissolution precipitation creep. In contrast, a power law rheology characteristic for dislocation creep, would favor strain localization into shear zones at sites of stress concentration. However, such shear zones formed at high-P metamorphic conditions are not

  8. Neoarchean granite-greenstone belts and related ore mineralization in the North China Craton: An overview

    Directory of Open Access Journals (Sweden)

    Li Tang

    2018-05-01

    Full Text Available Tectonic processes involving amalgamations of microblocks along zones of ocean closure represented by granite-greenstone belts (GGB were fundamental in building the Earth's early continents. The crustal growth and cratonization of the North China Craton (NCC are correlated to the amalgamation of microblocks welded by 2.75–2.6 Ga and ∼2.5 Ga GGBs. The lithological assemblages in the GGBs are broadly represented by volcano-sedimentary sequences, subduction-collision related granitoids and bimodal volcanic rocks (basalt and dacite interlayered with minor komatiites and calc-alkalic volcanic rocks (basalt, andesite and felsic rock. The geochemical features of meta-basalts in the major GGBs of the NCC display affinity with N-MORB, E-MORB, OIB and calc-alkaline basalt, suggesting that the microblocks were separated by oceanic realm. The granitoid rocks display arc signature with enrichment of LILE (K, Rb, Sr, Ba and LREE, and depletion of HFSE (Nb, Ta, Th, U, Ti and HREE, and fall in the VAG field. The major mineralization includes Neoarchean BIF-type iron and VMS-type Cu-Zb deposits and these, together with the associated supracrustal rocks possibly formed in back-arc basins or arc-related oceanic slab subduction setting with or without input from mantle plumes. The 2.75–2.60 Ga TTG rocks, komatiites, meta-basalts and metasedimentary rocks in the Yanlingguan GGB are correlated to the upwelling mantle plume with eruption close to the continental margin within an ocean basin. The volcano-sedimentary rocks and granitoid rocks in the late Neoarchean GGBs display formation ages of 2.60–2.48 Ga, followed by metamorphism at 2.52–2.47 Ga, corresponding to a typical modern-style subduction-collision system operating at the dawn of Proterozoic. The late Neoarchean komatiite (Dongwufenzi GGB, sanukitoid (Dongwufenzi GGB and Western Shandong GGB, BIF (Zunhua GGB and VMS deposit (Hongtoushan-Qingyuan-Helong GGB have closer connection to a combined

  9. Density characterization of radiochromic film through source axis distance (SAD) technique in linac with slab phantom for radiotherapy applications

    Science.gov (United States)

    Hariani, Yousida; Haris, Bambang

    2017-05-01

    Characterization of radiochromic film density is accomplished through Source Axis Distance (SAD) technique in a slab phantom Linac with various depths and breadths of field. Type of the film used is gafchromic RTQA2. The dose of radiation exposure of the film may cause changes in the film density. This research aims to determine the relation between the density and the dose depth through the characteristic of curves to identify the depth of the dose and particular breadth of the field as a reference for the dose of radiotherapy patients. The result shows that the higher the dose is absorbed, the darker the film will be, yet the lower the density is obtained. The dose depth is determined by measuring the amount of dose received at various depths and breadths of field using film that is placed on the slab phantom with 6 MV linac radiation and dose of 300 cGy. The variation of the depth at 1.5 cm; 4 cm; 6 cm; 8 cm; 10 cm, the field size at 4 × 4 cm2, and the dose depth at 359.7 cGy; 315.3 cGy; 281.4 cGy; 241.2 cGy; 220.5 cGy were settled. The field size 6 × 6 cm2 takes the dose depth 354.6 cGy; 314.1 cGy; 282.6 cGy; 244.5 cGy; 224.7 cGy. The field size 8 × 8 cm2 takes the dose depth 351.6 cGy; 313 cGy; 283.8 cGy; 247.2 cGy; 228 cGy. The field size 10 × 10 cm2 takes the dose depth 348.9 cGy; 342.6 cGy; 248.4 cGy; 249.6 cGy; 231 cGy.

  10. Density characterization of radiochromic film through source axis distance (SAD) technique in linac with slab phantom for radiotherapy applications

    International Nuclear Information System (INIS)

    Hariani, Yousida; Haris, Bambang

    2017-01-01

    Characterization of radiochromic film density is accomplished through Source Axis Distance (SAD) technique in a slab phantom Linac with various depths and breadths of field. Type of the film used is gafchromic RTQA2. The dose of radiation exposure of the film may cause changes in the film density. This research aims to determine the relation between the density and the dose depth through the characteristic of curves to identify the depth of the dose and particular breadth of the field as a reference for the dose of radiotherapy patients. The result shows that the higher the dose is absorbed, the darker the film will be, yet the lower the density is obtained. The dose depth is determined by measuring the amount of dose received at various depths and breadths of field using film that is placed on the slab phantom with 6 MV linac radiation and dose of 300 cGy. The variation of the depth at 1.5 cm; 4 cm; 6 cm; 8 cm; 10 cm, the field size at 4 × 4 cm 2 , and the dose depth at 359.7 cGy; 315.3 cGy; 281.4 cGy; 241.2 cGy; 220.5 cGy were settled. The field size 6 × 6 cm 2 takes the dose depth 354.6 cGy; 314.1 cGy; 282.6 cGy; 244.5 cGy; 224.7 cGy. The field size 8 × 8 cm 2 takes the dose depth 351.6 cGy; 313 cGy; 283.8 cGy; 247.2 cGy; 228 cGy. The field size 10 × 10 cm 2 takes the dose depth 348.9 cGy; 342.6 cGy; 248.4 cGy; 249.6 cGy; 231 cGy. (paper)

  11. Identification of QTLs for root characteristics in maize grown in hydroponics and analysis of their overlap with QTLs for grain yield in the field at two water regimes.

    Science.gov (United States)

    Tuberosa, Roberto; Sanguineti, Maria Corinna; Landi, Pierangelo; Giuliani, Marcella Michela; Salvi, Silvio; Conti, Sergio

    2002-01-01

    We investigated the overlap among quantitative trait loci (QTLs) in maize for seminal root traits measured in hydroponics with QTLs for grain yield under well-watered (GY-WW) and water-stressed (GY-WS) field conditions as well as for a drought tolerance index (DTI) computed as GY-WS/GY-WW. In hydroponics, 11, 7, 9, and 10 QTLs were identified for primary root length (R1L), primary root diameter (R1D), primary root weight (R1W), and for the weight of the adventitious seminal roots (R2W), respectively. In the field, 7, 8, and 9 QTLs were identified for GY-WW, GY-WS, and DTI, respectively. Despite the weak correlation of root traits in hydroponics with GY-WW, GY-WS, and DTI, a noticeable overlap between the corresponding QTLs was observed. QTLs for R2W most frequently and consistently overlapped with QTLs for GY-WW, GY-WS, and/or DTI. At four QTL regions, an increase in R2W was positively associated with GY-WW, GY-WS, and/or DTI. A 10 cM interval on chromosome 1 between PGAMCTA205 and php20644 showed the strongest effect on R1L, R1D, R2W, GY-WW, GY-WS, and DTI. These results indicate the feasibility of using hydroponics in maize to identify QTL regions controlling root traits at an early growth stage and also influencing GY in the field. A comparative analysis of the QTL regions herein identified with those described in previous studies investigating root traits in different maize populations revealed a number of QTLs in common.

  12. Mutagenesis of Jatropha curcas - Exploring new traits in the breeding of a biofuel plant

    International Nuclear Information System (INIS)

    Azhar Mohamad; Sobri Hussein; Abdul Rahim Harun

    2010-01-01

    Mutagenesis in plant species is considered effective in recovering and producing useful mutants as it leads to a high degree of chimerism and produces high degree of somaclonal variations for further selection in breeding programmes. Jatropha curcas is a species with many attributes and considerable potential, especially as bio diesel. Narrow genetic background of Jatropha spp. gives less selection to growers for better quality plant materials. In this study, a new method through nuclear technology was used to increase the genetic variability of Jatropha towards novel superior potential mutant lines. The objective of the study is to generate new mutant varieties of Jatropha curcas through the mutagenesis approach in getting new sustainable mutants for high oil yield and improved plant characteristics. Seeds of a Jatropha cultivar were from selected materials from Lembaga Kenaf and Tembakau Negara, Kelantan. Radiosensitivity test was done by irradiating a total of each 60 seeds at multiple doses (0 Gy, 20 Gy, 40 Gy, 60 Gy, 80 Gy, 100 Gy, 200 Gy, 300 Gy, 400 Gy, 600 Gy and 700 Gy). After getting the LD 50 , three doses i.e. 250 Gy, 300 Gy and 350 Gy were selected for mutagenesis, where a total of 1000 seeds were exposed to gamma radiation. The seeds were hardened and field planted at close distance of 1 m x 1 m. Pruning was conducted three times at two months interval prior to screening for early flowering, short stature and high branching mutant lines. Radiosensitivity of seeds to acute gamma irradiation revealed that the LD 50 was at 320 Gy. At nursery stage, somatic mutations related to chlorophyll changes were observed on leaves with certain shapes. Screening of Jatropha via seed mutagenesis bore 6 early flowering mutants, 7 dwarf mutants and, 17 high branching plants. In narrowing the mutant lines, cuttings from each selected trait were collected and re-planted for further evaluation. (author)

  13. Availability of iron in grains common beans (Phaseolus vulgaris l.) irradiated;Disponibilidade de ferro em graos de feijao comum (Phaseolus vulgaris L.) irradiados

    Energy Technology Data Exchange (ETDEWEB)

    Brigide, Priscila

    2002-07-01

    Common bean is the legume more consuming in Brazil, however, the average income of the farming in Brazil is low must the infestation of the grains, to fight these losses the irradiation process is an alternative healthful if compared the chemical handling. The objective of this research was evaluate the iron availability in irradiated raw and cooked beans (doses of 0, 2, 6 and 10 kGy). It was carried through the centesimal composition, anti nutritional factors (tannins and phytate) and iron dialyses for the method 'in vitro'. Cooking diminished the mainly components of the composition with exception of available carbohydrates, the protein content of 27.4 and 23.9; fat 1.2 and 1.1; fibre 23.7 and 18.6, carbohydrates 43.3 and 52.5; respectively for raw grains and cooked. It also had reduction in the amount of tannin which if correlated reversely with the applied doses, with exception of the dose of 2 kGy, varying of 1.56 (10 kGy) to 2.49 (2 kGy) to the for raw grains and traces (10 kGy) to 0.103 (2 kGy ) for grains cooked. The phytate varied of 4.63 (2 kGy) to 8.28 (0 kGy) and 5.29 (6 kGy) to the 9.55 (0 kGy), respectively for raw grains and cooked. In relation to the dialysed iron, the content varied of 1.16 (0 kGy) to 2.39 (6 kGy) and 5.33 (0 kGy) to the 8.02 (6 kGy), respectively for raw grains and cooked The dose of 6 kGy showed positive effect availability such as raw as cooked grain, it being recommended for the utilization. (author)

  14. Availability of iron in grains common beans (Phaseolus vulgaris l.) irradiated

    International Nuclear Information System (INIS)

    Brigide, Priscila

    2002-01-01

    Common bean is the legume more consuming in Brazil, however, the average income of the farming in Brazil is low must the infestation of the grains, to fight these losses the irradiation process is an alternative healthful if compared the chemical handling. The objective of this research was evaluate the iron availability in irradiated raw and cooked beans (doses of 0, 2, 6 and 10 kGy). It was carried through the centesimal composition, anti nutritional factors (tannins and phytate) and iron dialyses for the method 'in vitro'. Cooking diminished the mainly components of the composition with exception of available carbohydrates, the protein content of 27.4 and 23.9; fat 1.2 and 1.1; fibre 23.7 and 18.6, carbohydrates 43.3 and 52.5; respectively for raw grains and cooked. It also had reduction in the amount of tannin which if correlated reversely with the applied doses, with exception of the dose of 2 kGy, varying of 1.56 (10 kGy) to 2.49 (2 kGy) to the for raw grains and traces (10 kGy) to 0.103 (2 kGy ) for grains cooked. The phytate varied of 4.63 (2 kGy) to 8.28 (0 kGy) and 5.29 (6 kGy) to the 9.55 (0 kGy), respectively for raw grains and cooked. In relation to the dialysed iron, the content varied of 1.16 (0 kGy) to 2.39 (6 kGy) and 5.33 (0 kGy) to the 8.02 (6 kGy), respectively for raw grains and cooked The dose of 6 kGy showed positive effect availability such as raw as cooked grain, it being recommended for the utilization. (author)

  15. Putative radioresistant bacterial isolate from sewage water

    International Nuclear Information System (INIS)

    Ang, April; Chua, Patricia; Perez, Kristine; Rey, April; Rivor Kristel; San Pablo, Czarina; Santos, Ernestine

    2001-01-01

    Sewage water was collected from a stagnant body of water in Balara, Quezon City. approximately 150 ml was aseptically transferred into eight Erlenmeyer flasks. Seven flasks were then subjected to different doses of radiation at the 60 Co irradiation facility, PNRI (Philippine Nuclear Research Institute) which are as follows: 0.01 kGy, 0.1 kGy, 0.5 kGy, 1 kGy, 5 kGy, 10 kGy, and 15 kGy. The remaining flask was used as the control. After irradiation, all the different treatments were subjected to colony count at the culture collection laboratory, NSRI. Results showed that the colonies from sewage water treatments irradiated at 0.01 kGy (treatment A), 0.10 kGy (treatment B), and 0.50 kGy (treatment C) exhibited a decreasing trend with colony counts 4.60 x 10 3 CFU/ml, and 1.30 x 10 3 CFU/ml, and 26 CFU/ml, respectively. Contrastingly, at 1 kGy (treatment D), high colony count of 2.95 x 10 3 CFU/ml was observed which is even higher compared to the control (1.02 x 10 3 CFU/ml). Treatment E that was irradiated at 5 kGy manifested low survival rate (25 CFU/ml) indicating the presence of few putative intermediate radioresistant bacteria. Radiation dose treatments higher than 5 kGy (i.e., 10 kGy and 15 kGy) exhibited no bacterial survival. (Author)

  16. Putative radioresistant bacterial isolate from sewage water

    Energy Technology Data Exchange (ETDEWEB)

    Ang, April; Chua, Patricia; Perez, Kristine; Rey, April; Kristel, Rivor; San Pablo, Czarina; Santos, Ernestine

    2001-01-29

    Sewage water was collected from a stagnant body of water in Balara, Quezon City. approximately 150 ml was aseptically transferred into eight Erlenmeyer flasks. Seven flasks were then subjected to different doses of radiation at the {sup 60}Co irradiation facility, PNRI (Philippine Nuclear Research Institute) which are as follows: 0.01 kGy, 0.1 kGy, 0.5 kGy, 1 kGy, 5 kGy, 10 kGy, and 15 kGy. The remaining flask was used as the control. After irradiation, all the different treatments were subjected to colony count at the culture collection laboratory, NSRI. Results showed that the colonies from sewage water treatments irradiated at 0.01 kGy (treatment A), 0.10 kGy (treatment B), and 0.50 kGy (treatment C) exhibited a decreasing trend with colony counts 4.60 x 10{sup 3} CFU/ml, and 1.30 x 10{sup 3} CFU/ml, and 26 CFU/ml, respectively. Contrastingly, at 1 kGy (treatment D), high colony count of 2.95 x 10{sup 3} CFU/ml was observed which is even higher compared to the control (1.02 x 10{sup 3} CFU/ml). Treatment E that was irradiated at 5 kGy manifested low survival rate (25 CFU/ml) indicating the presence of few putative intermediate radioresistant bacteria. Radiation dose treatments higher than 5 kGy (i.e., 10 kGy and 15 kGy) exhibited no bacterial survival. (Author)

  17. THE EFFECT OF IRRADIATION ON ENAMEL MICRO-STRUCTURE CHANGES

    Directory of Open Access Journals (Sweden)

    Harun Gunawan

    2015-06-01

    Full Text Available Radiotherapy plays an important role in the management of head and neck carcinoma therapy. The radiation dose ranges from 40 – 70 Gy, depends on the severity and location of the malignancy. Many patients experience an increased dental caries or sensitivity occurrence following radiotherapy. The objective of this study is to analyze the enamel micro-structure changes after irradiation. Nine polished enamel slabs were prepared from impacted 3rd molars. The slabs were flushed in non-ionic distilled water and dried by using air spray and divided into 3 groups, the control, 20 Gy and 40 Gy irradiation group. Irradiations were performed from Co60 using Gammacell-220E, with duration variables to produce the irradiation doses of 20 and 40 Gy. Philips pW370-XRD was used to examine specimen microstructure changes after irradiation. 1-way ANOVA was used for statistics analysis. It was revealed that grain size after 40 Gy irradiation was 66.29±2.7 nm, and after 20 Gy was 51.64±15.8 whilst 43.95±11.1 nm for the control group. The micro-stain deviation of the 40 Gy group was 0.594±0.15 N/m, and 0.45±2.6 N/m for the 20 Gy group, and 0.378±0.27 N/m for control group. Statistic analysis showed significant grain size differences between 40 Gy compared to both 20 Gy and control groups, but not between 20 Gy compared to the control group. Similarly, there were micro-stain differences between 40 Gy compared to 20 Gy and control groups, but not between 20 Gy compared to control group. It was concluded that irradiation with 40 Gy caused elevation of the enamel microstrain and apaite grainsize. Elevation of the enamel microstrain could lead to enamel crack and gave hypersensitive sensation.

  18. Impact of drug permeability of blood-brain barrier after whole brain conventional fractionation irradiation

    International Nuclear Information System (INIS)

    Zhang Longzhen; Cao Yuandong; Chen Yong; Yu Changzhou; Zhuang Ming

    2006-01-01

    Objective: To explore the effect of drug permeability in rat blood-brain barrier(BBB) after different doses of whole brain conventional fractionation irradiation in rats and provide the experimental basis for the optimum time of clinical chemotherapy. Methods: According to different irradiation doses, 100 adult Sprague-Dowley rats were divided randomly into 5 groups: the normal control group(0 Gy); 10 Gy; 20 Gy; 30 Gy; and 40 Gy group. All rats were exposed to conventional fractionation(2 Gy/d, 5 d/w) with 60 Co γ-ray. MTX(25 mg/kg) was injected through the tail mainline 16 hours after whole brain irradiation. Cerebrospinal fluid(CSF) and blood were collected 2 hours later. Those samples were used to assay MTX concentration using RP-HPLC. Results: MTX mean concentrations in CSF was 0.07, 0.08, 0.12, 0.24, 0.23 mg/L in the control, 10 Gy, 20 Gy, 30 Gy, 40 Gy groups, respectively. All the data was analyzed with rank test of transform. MTX concentration of CSF was significantly different except the control and 10 Gy, 30 Gy and 40 Gy group. MTX concentration of blood was not significantly different in all groups (P>0.05). Conclusions: Irradiation can directly damage the function of BBB. BBB would be opened gradually following the increase of irradiation dose. It could be considered as the optimum time of chemotherapy when the whole brain irradiation ranges from 20 Gy to 30 Gy. (authors)

  19. Antioxidant Activity and Quality Characteristics of Yogurt Added Green Olive Powder during Storage

    Science.gov (United States)

    Tsend-Ayush, Chuluunbat

    2017-01-01

    The objective of this study was to determine the antioxidant and quality characteristics of yogurt added green olive powder stored at 4°С for 15 d. The following four groups were used in this study: Control group (GY0), Yogurt added with 1% green olive (GY1), with 3% green olive (GY3), and with 5% green olive (GY5). The more time of titratable acidity went by, the more it increased. Except GY0, viscosity tended to decrease in other groups (p>0.05), and the more time of syneresis went by, the more it increased, but GY3 of them showed the lowest syneresis. Lactic acid bacteria showed no significant with GY0 until 5 d, but after that, GY1, GY3 and GY5 showed lower than GY0. Yogurt added green olive showed darker color than GY0 (low L* and high a*). The antioxidant activity of GY5 was found to be the highest among the four groups at day 1 of storage. Total phenolic content, 2,2-diphenyl-1-picrylhydrazyl (DPPH) radical scavenging activity, and reducing power of GY5 was found to be the highest among the four groups at day 1 of storage which were 6.96 mg GAE/kg, 47.53%, and 0.57, respectively. In the sensory evaluation sweet and overall of GY3 indicated the highest score among the four groups. Results of this study demonstrated that green olive powder might be used to improve the antioxidant capacity and sensory characteristics of yogurt. PMID:29725208

  20. Antioxidant Activity and Quality Characteristics of Yogurt Added Green Olive Powder during Storage.

    Science.gov (United States)

    Cho, Won-Young; Yeon, Su-Jung; Hong, Go-Eun; Kim, Ji-Han; Tsend-Ayush, Chuluunbat; Lee, Chi-Ho

    2017-01-01

    The objective of this study was to determine the antioxidant and quality characteristics of yogurt added green olive powder stored at 4°С for 15 d. The following four groups were used in this study: Control group (GY0), Yogurt added with 1% green olive (GY1), with 3% green olive (GY3), and with 5% green olive (GY5). The more time of titratable acidity went by, the more it increased. Except GY0, viscosity tended to decrease in other groups ( p >0.05), and the more time of syneresis went by, the more it increased, but GY3 of them showed the lowest syneresis. Lactic acid bacteria showed no significant with GY0 until 5 d, but after that, GY1, GY3 and GY5 showed lower than GY0. Yogurt added green olive showed darker color than GY0 (low L* and high a*). The antioxidant activity of GY5 was found to be the highest among the four groups at day 1 of storage. Total phenolic content, 2,2-diphenyl-1-picrylhydrazyl (DPPH) radical scavenging activity, and reducing power of GY5 was found to be the highest among the four groups at day 1 of storage which were 6.96 mg GAE/kg, 47.53%, and 0.57, respectively. In the sensory evaluation sweet and overall of GY3 indicated the highest score among the four groups. Results of this study demonstrated that green olive powder might be used to improve the antioxidant capacity and sensory characteristics of yogurt.

  1. Gamma radiation tolerance in different life stages of the fruit fly Drosophila melanogaster.

    Science.gov (United States)

    Paithankar, Jagdish Gopal; Deeksha, K; Patil, Rajashekhar K

    2017-04-01

    Insects are known to have higher levels of radiation tolerance than mammals. The fruit fly Drosophila provides opportunities for genetic analysis of radiation tolerance in insects. A knowledge of stage-specific sensitivity is required to understand the mechanisms and test the existing hypothesis of insect radiation tolerance. Drosophila melanogaster were irradiated using gamma rays at different life stages. Irradiation doses were chosen to start from 100-2200 Gy with increments of 100 Gy, with a dose rate of 12.5 and 25 Gy/min. The threshold of mortality, LD 50 and LD 100 1 h post-irradiation was recorded for larvae and adults and 24 h post-irradiation for eggs and after 2-3 days for early and late pupae. Total antioxidant capacity for all the life stages was measured using the phosphomolybdenum method. Twenty-four hours post-irradiation, 100% mortality was recorded for eggs at 1000 Gy. One hour post irradiation 100% mortality was recorded at 1300 Gy for first instar larvae, 1700 Gy for second instar larvae, 1900 Gy for feeding third instar larvae and 2200 Gy for non-feeding third instar larvae. Post-irradiation complete failure of emergence (100% mortality) was observed at 130 Gy for early pupae and 1500 Gy for late pupae; 100% mortality was observed at 1500 Gy for adults. The values of LD 50 were recorded as 452 Gy for eggs, 1049 Gy for first instar larvae, 1350 Gy for second instar larvae, 1265 Gy for feeding third instar larvae, 1590 Gy for non-feeding third instar larvae, 50 Gy for early pupae, 969 Gy for late pupae, 1228 Gy for adult males and 1250 Gy for adult females. Early pupae were found to be prone to radiation, whereas the non-feeding third instar larvae were most resistant among all stages. The chromosome number being constant and total antioxidant capacity being nearly constant in all stages, we suggest that high rate of cell division during early pupae makes this stage sensitive to radiation.

  2. 60Co γ-ray irradiation effect on germination and seedling growth of dry Buchloe dactyloides seeds

    International Nuclear Information System (INIS)

    Wang Wen'en; Zhang Junwei; Bao Manzhu

    2005-01-01

    The dry seeds of Buchloe dactyloides were irradiated by γ-ray at dose of 25-300 Gy. Seed germination and seedling characters were surveyed in laboratory and field. The results indicated that radiation could promote seed germination, and the optimum dose was 100 Gy. The dose of 150 Gy was the up limit to germination rate, root length and seedling height in field. When the radiation dose was bellow 100 Gy, the fresh weight of stems, leaves and roots of seedlings were increased. From this study, the recommended radiation does for Buchloe dactyloides dry seeds treatment was between 100-150 Gy for the purpose of promoting germination. (authors)

  3. Gamma irradiation as a quarantine treatment for carambolas infested with Caribbean fruit flies

    International Nuclear Information System (INIS)

    Gould, W.P.; Windeguth, D.L. von

    1991-01-01

    Carambolas infested with the Caribbean fruit fly Anastrepha suspensa (Loew), eggs and larvae were exposed to ionizing gamma radiation. Probit 9 was estimated to be 22.95 Gy (95% fiducial limits 16.68 Gy - 49.73 Gy). Over 100,000 immature A. suspensa infesting carambolas were treated at 50 Gy with no adult survivors. This dose did not cause any observable damage to the fruit. The 50 Gy dose satisfies quarantine requirements for treatment of fruits exposed from fruit fly infested areas. (author) [es

  4. Effect of gamma radiation on growth, productivity and protein content of Chlorella Pyrenoidosa; Efecto de la radiacion gamma sobre el crecimiento, productividad y contenido proteico de Chlorella Pyrenoidosa

    Energy Technology Data Exchange (ETDEWEB)

    Martin, C; Fernandez, J

    1983-07-01

    The effect of five doses of gamma radiation: 10, 100, 500, 1000 and 5000 Gy at a dose rate of 4.500 Gy/h on growth, productivity and protein content of Chlorella pyroneidosa has been studied. High doses of gamma radiation have been observed to inhibit cellular division of Chlorella pyrenoidosa. Culture growth stopped 48 hours after irradiation at 5.000 Gy and 72 hours after irradiation at 500 and 1000 Gy. The lowest dose (10 Gy) produced a little growth stimulation that not statistically significative. Protein and aminoacid content did not show any change for gamma radiation doses studied. (Author) 32 refs.

  5. Effect of gamma radiation on growth, productivity and protein content of chlorella pyrenoidosa

    International Nuclear Information System (INIS)

    Fernandez Gonzalez, J.; Martin Moreno, C.

    1983-01-01

    The effect of five doses of gamma radiation: 10, 100, 500, 1000 and 5000 Gy at a dose rate of 4.500 Gy/h on growth, productivity and protein content of Chlorella Pyroneidosa has been studied. High doses of gamma radiation have been observed to inhibit cellular division of Chlorella Pyrenoidosa. Culture growth stopped 48 hours after irradiation at 5.000 Gy and 72 hours after irradiation at 500 and 1000 Gy. The lowest dose (10 Gy) produced a little growth stimulation that as not statistically significative. Protein and aminoacid content did not show any change for gamma radiation doses studied. (author)

  6. Cardiac dosimetric evaluation of deep inspiration breath-hold level variances using computed tomography scans generated from deformable image registration displacement vectors

    International Nuclear Information System (INIS)

    Harry, Taylor; Rahn, Doug; Semenov, Denis; Gu, Xuejun; Yashar, Catheryn; Einck, John; Jiang, Steve; Cerviño, Laura

    2016-01-01

    There is a reduction in cardiac dose for left-sided breast radiotherapy during treatment with deep inspiration breath-hold (DIBH) when compared with treatment with free breathing (FB). Various levels of DIBH may occur for different treatment fractions. Dosimetric effects due to this and other motions are a major component of uncertainty in radiotherapy in this setting. Recent developments in deformable registration techniques allow displacement vectors between various temporal and spatial patient representations to be digitally quantified. We propose a method to evaluate the dosimetric effect to the heart from variable reproducibility of DIBH by using deformable registration to create new anatomical computed tomography (CT) scans. From deformable registration, 3-dimensional deformation vectors are generated with FB and DIBH. The obtained deformation vectors are scaled to 75%, 90%, and 110% and are applied to the reference image to create new CT scans at these inspirational levels. The scans are then imported into the treatment planning system and dose calculations are performed. The average mean dose to the heart was 2.5 Gy (0.7 to 9.6 Gy) at FB, 1.2 Gy (0.6 to 3.8 Gy, p < 0.001) at 75% inspiration, 1.1 Gy (0.6 to 3.1 Gy, p = 0.004) at 90% inspiration, 1.0 Gy (0.6 to 3.0 Gy) at 100% inspiration or DIBH, and 1.0 Gy (0.6 to 2.8 Gy, p = 0.019) at 110% inspiration. The average mean dose to the left anterior descending artery (LAD) was 19.9 Gy (2.4 to 46.4 Gy), 8.6 Gy (2.0 to 43.8 Gy, p < 0.001), 7.2 Gy (1.9 to 40.1 Gy, p = 0.035), 6.5 Gy (1.8 to 34.7 Gy), and 5.3 Gy (1.5 to 31.5 Gy, p < 0.001), correspondingly. This novel method enables numerous anatomical situations to be mimicked and quantifies the dosimetric effect they have on a treatment plan.

  7. A survey of patients dose management in computed tomography with special emphasis to paetriatric patients in Ghana

    International Nuclear Information System (INIS)

    Inkoon, S.; Emi-Reynolds, G.; Boadu, M.; Schandorf, C.

    2010-01-01

    A survey of the frequency of common computed tomography (CT) examinations and the doses of six (6) CT facilities in Ghana has been undertaken. The technique factors for both adult and paediatric examinations were assessed. The dosimetric parameter used was the weighted computerized tomography dose index (CTDIw) for a single slice and the dose length product (DLP) for complete CT examinations of chest, chest high resolution (HR), lumbar spine, abdomen and pelvis. The effective dose (E) was estimated to give the stochastic radiation risk of a non-uniform exposure in terms of a whole body exposure. It was observed that some facilities used the same adult CT technique factors for paediatric patients. Mean values of adult CTDIw ranged as: chest (7.1-29.7 mGy), chest HR (7.1-30.0 mGy), lumbar spine (13.4-42.4 mGy), abdomen (7.8-42.4 mGy) and pelvis (8.9-42.4 mGy). Mean paediatric CTDIw values ranged as: chest (6.4-29.7 mGy), chest HR (6.4-30.0 mGy), lumbar spine (10.1-42.4 mGy), abdomen (10.1-42.4 mGy) and pelvis (10.1-42.4 mGy). The mean adult DLP values ranged as: chest (178-594 mGy cm), chest HR (168-594 mGy cm), lumbar spine (287-848 mGy cm), abdomen (233-848 mGy cm) and pelvis (228-848 mGy cm). However the mean paediatric DLP values ranged as: chest (128-594 mGy cm), chest HR (113-594 mGy cm), lumbar spine (253-848 mGy cm), abdomen (146-848 mGy cm) and pelvis (202-848 mGy cm). The E values for adults ranged as follows: chest (3.0-10.1 mSv), chest HR (2.9-10.1 mSv), lumbar spine (4.3-12.7 mSv), abdomen (3.5-12.7 mSv) and pelvis (4.3-12.7 mSv). The results show some agreement with diagnostic reference levels of CTDIw DLP and E values from literature. Nevertheless, further optimisation studies are needed to further reduce patient doses and modifications of technique factors especially for paediatrics (author)

  8. Study in radiation tolerance of damaged liver induced by dimethylaminoazobenzene. Histological study using Wistar rats

    International Nuclear Information System (INIS)

    Izumiyama, Kazutaka; Kodama, Akihisa; Kono, Michio

    1997-01-01

    We studied to determine the tolerable dose of radiation in damaged liver using Wistar male rats aged 4 weeks. A damaged liver group fed on low-protein animal chow containing 0.07% dimethylaminoazobenzene (DAB) ad libitum. Rats feeding on the chow without DAB served as the normal liver group. In both groups, two rats each underwent irradiation of the right half of the liver with doses of 5 Gy, 10 Gy, 15 Gy, or 20 Gy using a 15 MeV electron beam. The animals were sacrificed 2 or 4 weeks after irradiation, and the irradiated and non-irradiated parts of the liver were compared histologically with respect to hepatocellular necrosis, the extent of degeneration, and the degree of inflammatory cell infiltration, as well as the degree of inflammatory cell infiltration and fibrosis in Glisson's capsule. Secondly, in the normal liver group, 6 rats were irradiated with dose of 20 Gy, and in the damaged liver group, 6 rats each were irradiated with doses of 10 Gy, 12 Gy, 15 Gy or 20 Gy, and the same study was performed. In the normal liver group, no histological differences were seen between the irradiated and non-irradiated parts of the liver even when irradiated with 20 Gy dose. In the damaged liver group, there were no differences between the irradiated and non-irradiated parts of the liver in animals given 15 Gy or 10 Gy. In the 12 Gy group, however, one out of three rats each showed more severe changes in the irradiated part at 2 and 4 weeks after irradiation. One out of six rats in the 15 Gy group and four out of six rats in the 20 Gy group died in the first week after irradiation. In the damaged liver group, a single irradiation of up to 10 Gy delivered to one half of the liver was tolerable. At doses of 12 Gy or higher, however, irreversible changes occurred in some animals, and deaths occurred at 15 Gy or 20 Gy. Since even 20 Gy was tolerated in the normal liver group, damaged liver showed a lower tolerance than normal liver. (author)

  9. Survival of Listeria monocytogenes in mozzarella cheese and ice cream exposed to gamma irradiation

    International Nuclear Information System (INIS)

    Hashisaka, A.E.; Weagant, S.D.; Dong, F.M.

    1989-01-01

    The survival of Listeria monocytogenes preinoculated into ice cream and mozzarella cheese prior to gamma-irradiation treatment was determined. Samples were maintained at -78 degrees C and exposed to targeted doses of 2, 4, 8, 16, and 32 kGy of gamma-irradiation. The calculated D10 values were 1.4 kGy for mozzarella cheese and 2.0 kGy for ice cream. The effective level of irradiation (12D) for inactivating L. monocytogenes was 16.8 kGy for mozzarella cheese and 24.4 kGy for ice cream

  10. Effect of low dose irradiation of 60Co γ-rays on seed germination, seedling growth and enzymes activity of Lactuca sativa

    International Nuclear Information System (INIS)

    Liu Xiuqing; Zhang Tie

    2012-01-01

    The seeds of Lactuca sativa were irradiated by different doses (10, 20, 30, 40, 50 Gy) of 60 Co γ-rays. The effects of low dose irradiation on seed germination, seedling growth and enzymes activity were investigated. The results indicated that low dose irradiation could promote germination rate, germinating viability, germination rate in the field, root length and height of seedling. The suitable dosage for low dose irradiation for Lactuca sativa was 30 Gy. POD activity after irradiation treatment in the range of 10 to 50 Gy and CAT activity after irradiation treatment in the range of 20 Gy to 40 Gy was lower than that of control. (authors)

  11. Cardiac dosimetric evaluation of deep inspiration breath-hold level variances using computed tomography scans generated from deformable image registration displacement vectors

    Energy Technology Data Exchange (ETDEWEB)

    Harry, Taylor [Department of Radiation Medicine and Applied Sciences, University of California San Diego, La Jolla, CA (United States); Department of Radiation Medicine, Oregon Health and Science University, Portland, OR (United States); Department of Nuclear Engineering and Radiation Health Physics, Oregon State University, Corvallis, OR (United States); Rahn, Doug; Semenov, Denis [Department of Radiation Medicine and Applied Sciences, University of California San Diego, La Jolla, CA (United States); Gu, Xuejun [Department of Radiation Oncology, University of Texas Southwestern Medical Center, Dallas, TX (United States); Yashar, Catheryn; Einck, John [Department of Radiation Medicine and Applied Sciences, University of California San Diego, La Jolla, CA (United States); Jiang, Steve [Department of Radiation Oncology, University of Texas Southwestern Medical Center, Dallas, TX (United States); Cerviño, Laura, E-mail: lcervino@ucsd.edu [Department of Radiation Medicine and Applied Sciences, University of California San Diego, La Jolla, CA (United States)

    2016-04-01

    There is a reduction in cardiac dose for left-sided breast radiotherapy during treatment with deep inspiration breath-hold (DIBH) when compared with treatment with free breathing (FB). Various levels of DIBH may occur for different treatment fractions. Dosimetric effects due to this and other motions are a major component of uncertainty in radiotherapy in this setting. Recent developments in deformable registration techniques allow displacement vectors between various temporal and spatial patient representations to be digitally quantified. We propose a method to evaluate the dosimetric effect to the heart from variable reproducibility of DIBH by using deformable registration to create new anatomical computed tomography (CT) scans. From deformable registration, 3-dimensional deformation vectors are generated with FB and DIBH. The obtained deformation vectors are scaled to 75%, 90%, and 110% and are applied to the reference image to create new CT scans at these inspirational levels. The scans are then imported into the treatment planning system and dose calculations are performed. The average mean dose to the heart was 2.5 Gy (0.7 to 9.6 Gy) at FB, 1.2 Gy (0.6 to 3.8 Gy, p < 0.001) at 75% inspiration, 1.1 Gy (0.6 to 3.1 Gy, p = 0.004) at 90% inspiration, 1.0 Gy (0.6 to 3.0 Gy) at 100% inspiration or DIBH, and 1.0 Gy (0.6 to 2.8 Gy, p = 0.019) at 110% inspiration. The average mean dose to the left anterior descending artery (LAD) was 19.9 Gy (2.4 to 46.4 Gy), 8.6 Gy (2.0 to 43.8 Gy, p < 0.001), 7.2 Gy (1.9 to 40.1 Gy, p = 0.035), 6.5 Gy (1.8 to 34.7 Gy), and 5.3 Gy (1.5 to 31.5 Gy, p < 0.001), correspondingly. This novel method enables numerous anatomical situations to be mimicked and quantifies the dosimetric effect they have on a treatment plan.

  12. Serial histopathological changes in irradiated guinea pig lung receiving conventional fractionated and hyperfractionated irradiation

    International Nuclear Information System (INIS)

    Itoh, Satoshi; Inomata, Taisuke; Ogawa, Yasuhiro; Yoshida, Shoji; Sonobe, Hiroshi; Ohtsuki, Yuji

    1999-01-01

    The purpose of this study is to determine serial histopathological differences in guinea pig lungs receiving the same total dose as clinically used between conventional fractionated and hyperfractionated irradiation. The guinea pigs received 80 Gy in 40 daily fractions of 2 Gy each (conventional fractionation), 80 Gy in 80 fractions of 1 Gy each twice a day (hyperfractionation), 81 Gy in 27 daily fractions of 3 Gy each (conventional fractionation), or 81 Gy in 54 fractions of 1.5 Gy each twice a day (hyperfractionation). We evaluated the histopathological changes of irradiated guinea pig lungs at 1, 2, 3, 6, 9, and 12 months after irradiation. The guinea pig lungs that received 81 Gy in 27 daily fractions showed histopathological changes of inflammation including formation of lymph follicles after 6 months. The lungs which received 81 Gy in 54 fractions showed similar but slightly less pronounced changes than those that received 81 Gy in 27 daily fractions. The guinea pig lungs of other groups showed no histopathological changes during the observation period. In hyperfractionated irradiation the damage to the guinea pig lung is quantitatively less than that occurring as a result of conventional fractionated irradiation of the same total dose. (author)

  13. Development of a Modelling to Correlate Site and Diameter of Brain Metastases with Hippocampal Sparing Using Volumetric Modulated Arc Therapy

    Directory of Open Access Journals (Sweden)

    Silvia Chiesa

    2013-01-01

    Full Text Available Purpose. To correlate site and diameter of brain metastases with hippocampal sparing in patients treated by RapidArc (RA technique on whole brain with simultaneously integrated boost (SIB. Methods and Materials. An RA plan was calculated for brain metastases of 1-2-3 cm of diameter. The whole brain dose was 32.25 Gy (15 fractions, and SIB doses to brain metastases were 63 Gy (2 and 3 cm or 70.8 Gy (1 cm. Plans were optimized and evaluated for conformity, target coverage, prescription isodose to target volume, homogeneity index, and hippocampal sparing. Results. Fifteen brain lesions and RA plan were generated. Hippocampal volume was 4.09 cm3, and hippocampal avoidance volume was 17.50 cm3. Related to site of metastases, the mean hippocampal dose was 9.68 Gy2 for occipital lobe, 10.56 Gy2 for frontal lobe, 10.56 Gy2 for parietal lobe, 10.94 Gy2 for deep brain structures, and 40.44 Gy2 for temporal lobe. The mean hippocampal dose was 9.45 Gy2, 10.15 Gy2, and 11.70 Gy2 for diameter’s metastases of 1.2 and 3 cm, respectively, excluding results relative to temporal brain lesions. Conclusions. Location more than size of metastases can adversely influence the hippocampus sparing. Further investigation is necessary to meet definitive considerations.

  14. Adaptive response of apoptosis in EL-4 lymphoma cells induced by low dose radiation and its mechanism

    International Nuclear Information System (INIS)

    Liu Shuchun; Gong Pingsheng; Wang Zhicheng; Sun Liguang; Gong Shouliang

    2008-01-01

    EL-4 lymphoma cells were irradiated with the inductive doses (D1: 25-200 mGy, dose rate: 12.5mGy/min) and the challenging dose (D2:0.5-3.0 Gy, dose rate: 287 mGy/min), and the time interval between D1 and D2 was 6 h. The percentage of cell apoptosis and the expressive levels of cell apoptosis-associated gene pro- reins were measured with flow cytometry. The percentages of cell apoptosis in the D1 + D2 group with 25-100 mGy (D1) and 1.5 Gy (D2) or 75 mGy (D1) and 25-200 mGy (D2) were significantly lower than those in the D2 group. As compared with the D2 group, the positive percentage of cell Bcl-2 protein expression increased somewhat, and Bax decreased significantly, meanwhile the ratio of Bcl-2/Bax increased significantly and p53 decreased somewhat in D1 + D2 group with 25-100 mGy (D1) and 1.5 Gy (D2). The adaptive response of EL-4 lymphoma cell apoptosis could be induced by pre-irradiation with 25-100 mGy. Meantime, the expressive levels of cell apoptosis-associated gene Bcl-2, Bax and p53 proteins could change accordingly with cell apoptosis. These gene protein changes may play an important role in the mechanism of the adaptive response. (authors)

  15. The effects of gamma-ray irradiation to strawberry (Fragaria x ananassa Duch.) calli on shoot regeneration, achene formation and morphological variations of regenerants

    International Nuclear Information System (INIS)

    Kasumi, Masakazu

    2002-01-01

    Strawberry (Fragaria x ananassa 'Nyoho') calli, derived from anthers, were irradiated with gamma -ray at dosages from 100 to 1,600 Gy (10 Gy · hr - 1) and their effects on callus growth, plant regeneration, and somaclonal variation were analyzed. The growth of callus and percentage of plant regeneration from the callus were reduced slightly at dosages less than 200 Gy, moderately at 400 Gy, and markedly above 800 Gy. Fruit growth associated with seed fertility (>50 % ) was morphologically normal at less than 100 Gy, whereas achene formation was significantly inhibited above 200 Gy. The percentages of morphological variation in regenerants formed from the irradiated callus were:13.7 (no irradiation), 18.6 (100 Gy), 66.0 (200 Gy), 75.7 (400 Gy), and 97.0 (800 Gy). Furthermore, higher dosages yielded wider variations, e.g., thick and small leaf, light leaf color, white flesh, and long fruit. In some regenerants, more than one morphological aberrations developed, some of which were transmissible to daughter plants. These results revealed that the irradiating strawberry callus with gamma - ray resulted in a higher degree and wider spectrum of somaclonal variation than did simple callus culture. (author)

  16. Serial histopathological changes in irradiated guinea pig lung receiving conventional fractionated and hyperfractionated irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Itoh, Satoshi; Inomata, Taisuke; Ogawa, Yasuhiro; Yoshida, Shoji; Sonobe, Hiroshi; Ohtsuki, Yuji [Kochi Medical School, Nankoku (Japan)

    1999-05-01

    The purpose of this study is to determine serial histopathological differences in guinea pig lungs receiving the same total dose as clinically used between conventional fractionated and hyperfractionated irradiation. The guinea pigs received 80 Gy in 40 daily fractions of 2 Gy each (conventional fractionation), 80 Gy in 80 fractions of 1 Gy each twice a day (hyperfractionation), 81 Gy in 27 daily fractions of 3 Gy each (conventional fractionation), or 81 Gy in 54 fractions of 1.5 Gy each twice a day (hyperfractionation). We evaluated the histopathological changes of irradiated guinea pig lungs at 1, 2, 3, 6, 9, and 12 months after irradiation. The guinea pig lungs that received 81 Gy in 27 daily fractions showed histopathological changes of inflammation including formation of lymph follicles after 6 months. The lungs which received 81 Gy in 54 fractions showed similar but slightly less pronounced changes than those that received 81 Gy in 27 daily fractions. The guinea pig lungs of other groups showed no histopathological changes during the observation period. In hyperfractionated irradiation the damage to the guinea pig lung is quantitatively less than that occurring as a result of conventional fractionated irradiation of the same total dose. (author)

  17. The effect of gamma radiation from sources "6"0Co of soybean for shade tolerant

    International Nuclear Information System (INIS)

    Lilik Harsanti; Yulidar

    2016-01-01

    Gamma rays are electromagnetic waves that have a very strong penetrating power. One of the sources of gamma rays is from "6"0Co. The gamma rays have strong penetration power can be used of plant breeding to create new genetic diversity in the make of high-yielding varieties. Irradiation of gamma rays at a dose of 300 gray and 400 gray on soybean Denna 1 seed varieties has been done, then it was planted as M.1 the plants look healthy and robust and strong stems. The parameters observed plant height, sum book leaf, sum seed, sum pod and Percentage plant to live shade tolerant. The parameters observed were good: plant height doze 300 Gy (37.76 cm) and 400 gray (33.03 cm) The number of branches with doze 300 Gy (1.75) and 400 Gy (1.95), number of pod with doze 300 Gy (26.25) and 400 Gy (24.72), number of seed with doze 300 Gy (35.55 kg) and 400 Gy (33.65 kg), number of Naut with doze 300 Gy (9.28) and 400 Gy (8.53) and the percentage of plants capable of shade tolerant with doze 300 Gy (85) and 400 Gy(75). In conclusion, selection mutant lines of soybeans shade tolerant at generation M1 and next generation. (author)

  18. Effects of heavy-ion exposure to rat's hypothalamus on the copulatory behavior

    International Nuclear Information System (INIS)

    Saito, Masayoshi; Kawata, Tetsuya; Liu, C.; Kan'o, Momoe; Ito, Hisao; Takai, Nobuhiko; Ando, Koichi

    2005-01-01

    The effect of heavy-ion irradiation to brain on sexual behavior is not yet known. The present study was designed to determine whether irradiation (carbon particles 290 MeV/nucleon, Mono peak 15∼120 Gy, irradiation field 5-millimeter cube in hypothalamus) to rat's hypothalamus modifies the copulatory behavior of male rats. For the first year, we planned to estimate the short-term effects of carbon-irradiation on the copulatory behavior using a relatively high doses, and observation of sexual behavior was conducted for 30 min after 1, 2 or 3 months following irradiation. Results obtained in the first year are as follows. At dosages of 15 Gy, 30 Gy, 45 Gy and 60 Gy these were no changes in copulatory behavior after one month following irradiation; however, the intromission and ejaculation was found to decrease after 3-month follow-up in rats exposed to 60 Gy. At higher doses such as 90 Gy, 120 Gy, the number of mounting, intromission (120 Gy alone) and ejaculation (90 Gy, 120 Gy) were decreased. It may be possible to describe that carbon irradiation to hypothalamus does not inhibit the activity of copulatory behavior after short-term. Further experiments after long-term follow-up after irradiation are necessary to determine the chronic effects of heavy ions on the copulatory behavior. (author)

  19. Gamma irradiation of pupae and adults of Tribolium castaneum (Herbst)

    International Nuclear Information System (INIS)

    Mehta, V.K.; Sethi, G.R.; Garg, A.K.

    1990-01-01

    Studies on the effect of gamma irradiation of 2 to 3 day old pupae and 10 day old adults of Tribolium castaneum (Herbst) revealed that adult emergence from irradiated pupae was negatively correlated with the radiation doses upto 10 Krad (100 Gy). At higher doses of 10 Krad to 50 Krad (100 Gy to 500 Gy), there was no further decrease in adult emergence. Mortality of adults emerging from the irradiated pupae, however, increased rapidly at doses of 10 Krad (100 Gy) and above and irradiation at 15 Krad to 50 Krad (150 Gy to 500 Gy) caused 100 per cent mortality of the adults within 15 days of exposure. Irradiation of 10 day old adults with doses upto 6 Krad (60 Gy) had no significant effect on mortality but this effect was quite pronounced at 8 Krad to 20 Krad (80 Gy to 200 Gy). The LD 50 value recorded 12 days after irradiation was 10.3 Krad (103 GY). Irradiation of adults with doses of 12 Krad (120 Gy) and above also decreased the longevity of the irradiated adults. (author). 14 refs., 1 tab

  20. Effects of low dose gamma-ray radiation on the seed germination and physiological activity of vegetable crops

    Energy Technology Data Exchange (ETDEWEB)

    Kim, J. S.; Baek, M. H.; Lee, Y. G. [KAERI, Taejon (Korea, Republic of); Jung, K. H. [Kyunghee Univ., Yongin (Korea, Republic of)

    2000-10-01

    To determine the effect of low dose gamma-ray radiation on the germination rate and physiology of germinative seeds of Chinese cabbage(Brassica campestris L. cv. Hanyoreum) and radish(Raphanus sativus L. cv. Chungsukoungzoung). The germination rate of irradiation group was higher than that of the control. Especially it was highest at the early stage of induction. The germination rate of Chinese cabbage increased at 4 Gy-, 10 Gy- and 50 Gy irradiation group and that of radish increased at 2 Gy-, 6 Gy- and 10 Gy irradiation group. The seedling height of Chinese cabbage and radish increased positively in low dose irradiation group. The seedling height of Chinese cabbage was noticeably higher at 4 Gy and 10 Gy irradiation group and that of radish at 6 Gy irradiation group. The protein contents of seeds irradiated with low dose gamma-ray radiation was increased compared to that of the control especially at the early stage of induction. The enzyme activity of seeds irradiated with low dose of gamma-ray radiation was increased at 4 Gy and 10 Gy irradiation group. These results suggest that the germination and physiological activity of old seeds could be stimulated promisingly by the low dose gamma-ray radiation.

  1. Kinetics of the early adaptive response and adaptation threshold dose

    International Nuclear Information System (INIS)

    Mendiola C, M.T.; Morales R, P.

    2003-01-01

    The expression kinetics of the adaptive response (RA) in mouse leukocytes in vivo and the minimum dose of gamma radiation that induces it was determined. The mice were exposed 0.005 or 0.02 Gy of 137 Cs like adaptation and 1h later to the challenge dose (1.0 Gy), another group was only exposed at 1.0 Gy and the damage is evaluated in the DNA with the rehearsal it makes. The treatment with 0. 005 Gy didn't induce RA and 0. 02 Gy causes a similar effect to the one obtained with 0.01 Gy. The RA was show from an interval of 0.5 h being obtained the maximum expression with 5.0 h. The threshold dose to induce the RA is 0.01 Gy and in 5.0 h the biggest quantity in molecules is presented presumably that are related with the protection of the DNA. (Author)

  2. Evaluation of γ-radiation on green tea odor volatiles

    International Nuclear Information System (INIS)

    Fanaro, G.B.; Duarte, R.C.; Araujo, M.M.; Purgatto, E.; Villavicencio, A.L.C.H.

    2011-01-01

    The aim of this study was to evaluate the gamma radiation effects on green tea odor volatiles in green tea at doses of 0, 5, 10, 15 and 20 kGy. The volatile organic compounds were extracted by hydrodistillation and analyzed by GC/MS. The green tea had a large influence on radiation effects, increasing the identified volatiles in relation to control samples. The dose of 10 kGy was responsible to form the majority of new odor compounds following by 5 and 20 kGy. However, the dose of 5 kGy was the dose that degraded the majority of volatiles in non-irradiated samples, following by 20 kGy. The dose of 15 kGy showed has no effect on odor volatiles. The gamma radiation, at dose up to 20 kGy, showed statistically no difference between irradiated and non irradiated green tea on odors compounds.

  3. Effects of read-out light sources and ambient light on radiochromic film

    International Nuclear Information System (INIS)

    Butson, Martin J.; Yu, Peter K.N.; Metcalfe, Peter E.

    1998-01-01

    Both read-out light sources and ambient light sources can produce a marked effect on coloration of radiochromic film. Fluorescent, helium neon laser, light emitting diode (LED) and incandescent read-out light sources produce an equivalent dose coloration of 660 cGy h -1 , 4.3 cGy h -1 , 1.7 cGy h -1 and 2.6 cGy h -1 respectively. Direct sunlight, fluorescent light and incandescent ambient light produce an equivalent dose coloration of 30 cGy h -1 , 18 cGy h -1 and 0 cGy h -1 respectively. Continuously on, fluorescent light sources should not be used for film optical density evaluation and minimal exposure to any light source will increase the accuracy of results. (author)

  4. Effects of low dose gamma radiation on the early growth of red pepper and the resistance to subsquent high dose of radiation

    Energy Technology Data Exchange (ETDEWEB)

    Kim, J. S.; Baek, M. H.; Kim, D. H.; Lee, Y. K. [KAERI, Taejon (Korea, Republic of); Lee, Y. B. [Chungnam National Univ., Taejon (Korea, Republic of)

    2001-05-01

    Red pepper (capsicum annuum L. cv. Jokwang and cv. Johong) seeds were irradiated with the dose of 0{approx}50 Gy to investigated the effect of the low dose gamma radiation on the early growth and resistance to subsequent high dose of radiation. The effect of the low dose gamma radiation on the early growth and resistance to subsequenct high dose of radiation were enhanced in Johong cultivar but not in Jokwang cultivar. Germination rate and early growth of Johong cultivar were noticeably increased at 4 Gy-, 8 Gy- and 20 Gy irradiation group. Resistance to subsequent high dose of radiation of Johong cultivar were increased at almost all of the low dose irradiation group. Especially it was highest at 4 Gy irradiation group. The carotenoid contents and enzyme activity on the resistance to subsequent high dose of radiation of Johong cultivar were increased at the 4 Gy and 8 Gy irradiation group.

  5. Intraoperative radiation in the canine para-aortic abdomen

    International Nuclear Information System (INIS)

    Hoopes, P.J.; Gillette, E.L.

    1984-01-01

    Twenty adult beagle dogs received intraoperatively delivered 6 MeV electrons to the para-aortic abdomen and bladder. The dogs were equally divided into 4 dose groups receiving 22 Gy, 30 Gy, 38.5 Gy and 47 Gy. The 5 cm x 8 cm radiation field included a variable portion of the left kidney, the left ureter, the abdominal aorta and vena cava, the base of the bladder and the left sciatic and femoral nerves. The lesions observed were fibroelastic proliferation of the aortic intima, severe renal atrophy and fibrosis, ureteral stenosis, bladder fibrosis and demyelinating peripheral neuropathies. Histologic, morphometric and dose response analyses are compared with responses of dogs receiving more conventional fractionated doses to a total of 60 Gy, 70 Gy or 80 Gy x-ray in 6 weeks

  6. Effect of gamma irradiation on Callus formation and regeneration of wheat immature embryos

    International Nuclear Information System (INIS)

    Saleh, O.M.

    2007-01-01

    Four Egyptian bread wheat cultivars; G164, G168, SK61 and Sids1, were tested for their response to six gamma irradiation treatments; 1, 2, 3 Gy (as low doses) and 10, 20, 30 Gy (as high doses) in addition to 0 Gy (as a control) in terms of callus formation and regeneration of immature embryos. Low doses of gamma irradiations ( 1, 2 and 3 Gy) showed favourable effects on both traits; number of regenerated calli and number of shoots per callus comparing with the control (0 Gy), while high doses; 10, 20 and 30 Gy, had the worst effect comparing with the control (0 Gy). G164 cultivar was shown to get the best response in terms of callus formation and regeneration when exposed to low doses of gamma irradiation. In conclusion, gamma irradiation can serve in increasing regeneration efficiency of Egyptian bread wheat cells when used in low doses

  7. Diagnosis of moderate acute radiation sickness

    International Nuclear Information System (INIS)

    Yu Shoucheng; Chen Zhijian; Chen Youxin

    1989-01-01

    Forty patients with malignant lymphoma were given 60 Co TLI. 21 cases received 6 Gy and 19 received 8 Gy. It was estimated that a single TLI of 6 and 8 Gy would correspond to TBI of 3.55 Gy and 4.25 Gy (average values) by analysing peripheral blood cell chromosome aberrations and 1.85-2.37 Gy by measuring red bone marrow stem cells clinically. Moderate acute radiation sickness with digestive tract reaction and hemopoietic and immunologic depression was observed. WBC and platelets decreased rapidly. Lymphocytes showed quantitative and qualitative changes even at early stage. All these indexes are significant for diagnosis. Besides, the degree of labial stimulation response, levels of C-reactive protein, corticoid, and urinal nucleoside and alkaloid base presented great changes both pre-and post-irradiation. Early diagnosis of moderate acute radiation sickness could be made in cancer patients subjected to 6-8 Gy TLI

  8. Radiation-induced blood pathology in chick erythrocytes and related parameters

    International Nuclear Information System (INIS)

    Malhotra, N.; Rani, N.; Rana, K.; Malhotra, R.K.

    1990-01-01

    White leghorn male chicks at 15 days post-hatching were subjected to acute (2.10 Gy and 6.60 Gy) and fractionated (2 x 2.10 Gy) whole-body gamma radiation exposure at the high dose rate of 0.60 Gy/sec to study the nature of haematological changes induced in the animals which were maintained for a maximum period of 60 days post irradiation. The investigated parameters include total red blood cell counts, haemoglobin content, haematocrit value, mean corpuscular volume and mean corpuscular haemoglobin concentration values. The results show that the haematological changes induced with 2.10 Gy and 2 x 2.10 Gy fractionated dosage are reversible and do not cause permanent damage to the erythroid characteristics. However, the system failed to recover with 6.60 Gy whole-body acute exposure. (author)

  9. Effect of Dietary Supplementation by Irradiated Full-Fat Rapeseed on Biochemical Changes in Rats

    International Nuclear Information System (INIS)

    Farga, D. M. H.; El-Shennawy, H. M.; Soliman, N.A.

    2000-01-01

    Supplementation of 230 gk 1 of raw and irradiated full-fat rapeseed at 20 kGy in the food of male albino rats for ten weeks of age, caused significantly lower total plasma protein concentration as compared with those fed control diet, heated seeds and seeds irradiated at 50 and 70 kGy diets. On the other hand, the highest total plasma protein value was obtained from the control group flowed in descending order by heated and seeds irradiated at 70 kGy, and 50 kGy. Plasma albumin decreased significantly in rats fed either raw or rapeseed irradiated at 20 and 50 kGy as compared with rats fed control diet, heated or irradiated rapeseed at 70 kGy diets. The same result was observed with plasma globulin and A/G ratio. Supplementing the diet of rats with raw and irradiated rapeseed at 20 and 50 kGy caused significantly higher plasma transaminases activities (GOT and GPT) as compared with those fed control diet, heated or rapeseed irradiated at 70 kGy. However, rats fed raw and rapeseed irradiated at 20 kGy caused a significant increase in alkaline phosphatase as compared with those fed control diet, heated or irradiated seeds at 50 or 70 kGy diets. Moreover, there was no significant discrepancy between groups fed heated seed and seeds irradiated at 50 or 70 kGy as compared with those fed control diets. Level of plasma creatinine was significantly higher in groups of rats fed row and irradiated seeds at 20 kGy as compared with those fed heat processed and irradiated seeds at 50 kGy and 70 kGy and control diets. The results confirm that the applied radiation doses are insufficient enough to bring a complete detoxification of processed seeds. Increasing the applied radiation doses might be be beneficial in this respect

  10. Integral dose delivered to normal brain with conventional intensity-modulated radiotherapy (IMRT) and helical tomotherapy IMRT during partial brain radiotherapy for high-grade gliomas with and without selective sparing of the hippocampus, limbic circuit and neural stem cell compartment

    International Nuclear Information System (INIS)

    Marsh, James C.; Ziel, Ellis G; Diaz, Aidnag Z; Turian, Julius V; Wendt, Julie A.; Gobole, Rohit

    2013-01-01

    We compared integral dose with uninvolved brain (ID brain ) during partial brain radiotherapy (PBRT) for high-grade glioma patients using helical tomotherapy (HT) and seven field traditional inverse-planned intensity-modulated radiotherapy (IMRT) with and without selective sparing (SPA) of contralateral hippocampus, neural stem cell compartment (NSC) and limbic circuit. We prepared four PBRT treatment plans for four patients with high-grade gliomas (60Gy in 30 fractions delivered to planning treatment volume (PTV60Gy)). For all plans, a structure denoted 'uninvolved brain' was created, which included all brain tissue not part of PTV or standard (STD) organs at risk (OAR). No dosimetric constraints were included for uninvolved brain. Selective SPA plans were prepared with IMRT and HT; contralateral hippocampus, NSC and limbic circuit were contoured; and dosimetric constraints were entered for these structures without compromising dose to PTV or STD OAR. We compared V100 and D95 for PTV46Gy and PTV60Gy, and ID brain for all plans. There were no significant differences in V100 and D95 for PTV46Gy and PTV60Gy. ID brain was lower in traditional IMRT versus HT plans for STD and SPA plans (mean ID brain 23.64Gy vs. 28Gy and 18.7Gy vs. 24.5Gy, respectively) and in SPA versus STD plans both with IMRT and HT (18.7Gy vs. 23.64Gy and 24.5Gy vs. 28Gy, respectively). n the setting of PBRT for high-grade gliomas, IMRT reduces ID brain compared with HT with or without selective SPA of contralateral hippocampus, limbic circuit and NSC, and the use of selective SPA reduces ID brain compared with STD PBRT delivered with either traditional IMRT or HT.

  11. Altered fractionation of hemithorax irradiation for pleural mesothelioma and failure patterns after treatment

    Energy Technology Data Exchange (ETDEWEB)

    Holsti, L.R. [Dept. of Radiotherapy and Oncology, Helsinki University Central Hospital (Finland); Pyrhoenen, S. [Dept. of Radiotherapy and Oncology, Helsinki University Central Hospital (Finland); Kajanti, M. [Dept. of Radiotherapy and Oncology, Helsinki University Central Hospital (Finland); Maentylae, M. [Dept. of Radiotherapy and Oncology, Helsinki University Central Hospital (Finland); Mattson, K. [Dept. of Internal Medicine, Div. of Pulmonary Medicine, Helsinki University Central Hospital (Finland); Maasilta, P. [Dept. of Internal Medicine, Div. of Pulmonary Medicine, Helsinki University Central Hospital (Finland); Kivisaari, L. [Dept. of Diagnostic Radiology, Helsinki University Central Hospital (Finland)

    1997-09-01

    Malignant pleural mesothelioma is a rare malignancy with a bleak prognosis. The role of radiotherapy has not yet been clarified. Our aim was to study the effect of altered fractionation on mesothelioma. We have treated 57 patients, 41 males and 16 females, with hemithorax irradiation with six different fractionation schedules. All the patients have been included in a combined modality program consisting of surgery followed by chemotherapy and finally by hemithorax irradiation. The radiotherapy schedules used were: I. Conventional fractionation of 20 Gy in 10 fractions over 12 days. II, Split-course radiotherapy 55 Gy in 25 fractions of 2.2 Gy over 7 weeks (a two weeks rest halfways) followed by a boost dose of 15 Gy over 8 days to the major tumour area. III. Hyperfractionation of 70 Gy over 7 weeks, 1.25 Gy BID with a 6-h interval and a 10-day rest halfways. IV. Combined hyperfractionation and hypofractionation, 35 Gy hyperfractionation in 28 fractions (1.25 Gy BID with a 6-h interval) over three weeks followed by 36 Gy hypofractionation 9 fractions of 4 Gy given every other day over 3 weeks to the major tumour areas only. V. Hypofractionation of 38.5 Gy over 15 days (9x3.5 Gy). VI. Combined conventional radiotherapy and hypofractionation with 20 Gy given conventionally in 10 fractions followed by 10 fractions of 3 Gy over two weeks, overall time 4 weeks. The 2-year survival rate of all patients was 21% and the 5-year survival rate 9%. Two patients are still alive more than 6 and 9 years after radiotherapy. Progression occurred after surgery in four patients, during and after chemotherapy in 22 patients and after completed radiotherapy in 29 patients. The pattern of progression was similar in each treatment group. (orig.).

  12. Effect of different radiation dose rates on refrigerated mechanically deboned chicken meat

    Energy Technology Data Exchange (ETDEWEB)

    Brito, Poliana de Paula; Gomes, Heliana de Azevedo; Fukuma, Henrique Takuji [Comissao Nacional de Energia Nuclear (CNEN), Pocos de Caldas, MG (Brazil). Coordenacao de Laboratorios de Pocos de Caldas (COLAB)]. E-mail: polibrito@yahoo.com.br; hgomes@cnen.gov.br; htfukuma@cnen.gov.br

    2005-07-01

    Samples of mechanically deboned chicken meat (MDCM) were irradiated while frozen with doses of 0.0 kGy, 3.0 kGy - 4.04 kGy.h{sup -1} and 3.0 kGy - 0.32 kGy.h{sup -1}. Individual lots of irradiated and non irradiated samples were evaluated for Substances Reactive to Thiobarbituric Acid (TBARS) and total count of psychotropic bacteria, while in refrigerated storage (2 {+-}1 deg C), for 11 days. The values for percentage of recovery for 1,1,3,3-tetraetoxipropane (TEP) and for conversion of the K value for samples irradiated with 3.0 kGy - 4.35 kGy.h{sup -1} and 3.0 kGy - 0.3 kGy.h{sup -1} and samples non irradiated were, respectively: 80.3 %, 70.3 % and 80.4 % and 9.1, 11.2 and 9.1. The results showed that there was not a difference for the TBARS values when irradiated and non irradiated samples were compared up to the forth day of refrigerated storage. Between the seventh and eleventh day of storage the TBARS values increased gradually when values obtained for non irradiated and those samples irradiated with doses of 3.0 kGy - 0.3 kGy.h{sup -1} and 3.0 kGy - 4.35 kGy.h{sup -1} were compared. The average values for psychotropic bacteria obtained for samples non irradiated and those irradiated with doses of 3.0 kGy - 0.32 kGy.h{sup -1} and 3.0 kGy - 4.04 kGy.h{sup -1}, during the second and eleventh day of frozen storage were respectively 6.68 log (UFC.g{sup -1}), 2.87 log (UFC.g{sup -1}) and 2.66 log (UFC.g{sup -1}). When both variables were evaluated, it was verified that samples irradiated with a dose rate of 0.32 kGy.{sup -1} presented the smallest values of TBARS than those samples irradiated with a dose rate of 4.04 kGy.h{sup -1}, from the seventh day of refrigerated storage and bacterial count within the legal limits allowed by the regulation, being considered the best dosage rate for processing MDCM, in the conditions of the present study. (author)

  13. Response of rat spinal cord to very small doses per fraction: lack of enhanced radiosensitivity

    International Nuclear Information System (INIS)

    Shun, Wong C.; Yong, Hao; Hill, Richard P.

    1995-01-01

    Our previous work with rat spinal cord demonstrated that the linear quadratic (LQ) model based on data for large fraction sizes ((α(β)) of 2.4 Gy) failed to predict isoeffective doses between 1 and 2 Gy per fraction, and under-estimated the sparing effect of small doses per fraction given once daily. In contrast, data from mouse skin and kidney, and recent in vitro results revealed a paradoxical increase in radiosensitivity at below 1 Gy per fraction. To assess whether enhanced radiosensitivity is present in the spinal cord below 1 Gy per fraction, the rat spinal cord (C2-T2) was irradiated initially with three daily doses of 10.25 Gy (top-up doses representing 90% of tolerance), followed by graded single doses or fractionated doses in 1.5, 1.0, 0.8, 0.6 or 0.4 Gy fractions given once daily. To limit the overall treatment time to ≤ 8 weeks, a small number of the 0.6- and 0.4-Gy fractions were given twice daily with an interfraction interval of 16 h. The end-point was forelimb paralysis secondary to white matter necrosis, confirmed histologically. The ED 50 values, excluding the top-up doses, were 5.8, 10.6, 14.8, 15.2, 15.9 and 19.1 Gy for a single dose and doses in 1.5-, 1.0-, 0.8-, 0.6- and 0.4-Gy fractions, respectively. The data gave an (α(β)) of 2.1 Gy (95% CI, 1.4, 2.7 Gy). Pooling the data separately, the (α(β)) value was 2.3 Gy (95% CI, 0.82, 3.7 Gy) for fraction sizes ≥ 1 Gy, and 1.2 Gy (95% CI, 0.16, 2.3 Gy) for the 0.8-, 0.6- and 0.4-Gy experiments. These results in which top-up doses were given initially are consistent with a large sparing effect of very small fraction sizes in rat spinal cord provided sufficient time is allowed for repair of sublethal damage between fractions, and provide no evidence for a paradoxical increase in radiosensitivity in the rat spinal cord below 1 Gy down to 0.4 Gy per fraction

  14. Geochemistry and meaning of the geotectonic position of plutonic rocks from Chapada region, Goias, Brazil

    International Nuclear Information System (INIS)

    Kuyumjian, R.M.

    1989-01-01

    In common with other orogenic belts, in which the presence of both, granitic and small basic-ultrabasic intrusions are characteristics of medium-high pressure metamorphic terranes, the geological and geochemical evidences indicate a close relationship between the granitoid, gabbroic and pyroxenitic plutons and the orogenic metabasaltic rocks from the Chapada volcano-sedimentary sequence. The granitoids are tonalitic and, on discriminant diagrams, they plot in the volcanic arc and pre-collisional fields. They display geochemical characteristics similar to the Jamaican oceanic arc-related granities. They show low LIL and HSF element abundances, low (Ta, Nb)/(K, La, etc) ratios and very low concentrations of Th, Hf, K and Y, when compared to patterns of calkaline, alkali-calcic and alkaline-peralkaline granitoids of magmatic arcs. These chemical features are characteristic of immature island arcs mantle-derived intrusives. The Chapada olivine gabbro has a chondrite-normalized spidergram, closely resembling those of island-arc basaltic lavas, the compositions of its coexisting olivine and plagioclase been similar to those from arc-related cumulate gabbros, and therefore, it could be the plutonic equivalent of the arc volcanics in the Chapada region. It is suggested that the evolution of the granitoids and gabbro intrusives from Chapada are related to a process of subduction that occurred in central Brazil during the Brasiliano/Pan-African event. (author) [pt

  15. The behavior of iron and zinc stable isotopes accompanying the subduction of mafic oceanic crust: A case study from Western Alpine ophiolites

    Science.gov (United States)

    Inglis, Edward C.; Debret, Baptiste; Burton, Kevin W.; Millet, Marc-Alban; Pons, Marie-Laure; Dale, Christopher W.; Bouilhol, Pierre; Cooper, Matthew; Nowell, Geoff M.; McCoy-West, Alex J.; Williams, Helen M.

    2017-07-01

    Arc lavas display elevated Fe3+/ΣFe ratios relative to MORB. One mechanism to explain this is the mobilization and transfer of oxidized or oxidizing components from the subducting slab to the mantle wedge. Here we use iron and zinc isotopes, which are fractionated upon complexation by sulfide, chloride, and carbonate ligands, to remark on the chemistry and oxidation state of fluids released during prograde metamorphism of subducted oceanic crust. We present data for metagabbros and metabasalts from the Chenaillet massif, Queyras complex, and the Zermatt-Saas ophiolite (Western European Alps), which have been metamorphosed at typical subduction zone P-T conditions and preserve their prograde metamorphic history. There is no systematic, detectable fractionation of either Fe or Zn isotopes across metamorphic facies, rather the isotope composition of the eclogites overlaps with published data for MORB. The lack of resolvable Fe isotope fractionation with increasing prograde metamorphism likely reflects the mass balance of the system, and in this scenario Fe mobility is not traceable with Fe isotopes. Given that Zn isotopes are fractionated by S-bearing and C-bearing fluids, this suggests that relatively small amounts of Zn are mobilized from the mafic lithologies in within these types of dehydration fluids. Conversely, metagabbros from the Queyras that are in proximity to metasediments display a significant Fe isotope fractionation. The covariation of δ56Fe of these samples with selected fluid mobile elements suggests the infiltration of sediment derived fluids with an isotopically light signature during subduction.

  16. Studies on the radiation absorption characteristics of various rocks

    International Nuclear Information System (INIS)

    Rahman, K.N.; Abdullah, S.A.; Gazzaz, M.A.

    1984-05-01

    Radiation absorption characteristics of nine different rocks, namely, ferrugenous quartz, metabasalt, larvikite, coarse grained diorite, coarse grained granite, coarse grained alkali granite, marble, quartz mica schist, and metamorphosed rock are studied. The rocks were collected from Jeddah, Makkah, Mina and Taif areas. Special attention was given on the availability, compactness, physical formation and uniform composition in selecting the rocks. The rocks were identified by optical method and their elemental composition determined by chemical analysis. The data were used to calculate the effective atomic numbers, half value layers mass and linear attenuation coefficients. The half value layers and the linear attenuation coefficientsof these rocks were determined experimentally using Am-241, Cs-137,and Co-60 sources. The results are compared with those obtained by theoretical calculations and agrre within 10%. Most of the rocks show much higher radiation attenuation characteristics than the standard concrete. Rocks containing higher percentage of Fe, Ca, Ti, and Mn show much higher radiation absorption characteristics than concrete. Only granites are found to be almost equivalent to concrete. 12 Ref

  17. Geologic strip map along the Hines Creek Fault showing evidence for Cenozoic displacement in the western Mount Hayes and northeastern Healy quadrangles, eastern Alaska Range, Alaska

    Science.gov (United States)

    Nokleberg, Warren J.; Aleinikoff, John N.; Bundtzen, Thomas K.; Hanshaw, Maiana N.

    2013-01-01

    Geologic mapping of the Hines Creek Fault and the adjacent Trident Glacier and McGinnis Glacier Faults to the north in the eastern Alaska Range, Alaska, reveals that these faults were active during the Cenozoic. Previously, the Hines Creek Fault, which is considered to be part of the strike-slip Denali Fault system (Ridgway and others, 2002; Nokleberg and Richter, 2007), was interpreted to have been welded shut during the intrusion of the Upper Cretaceous Buchanan Creek pluton (Wahrhaftig and others, 1975; Gilbert, 1977; Sherwood and Craddock, 1979; Csejtey and others, 1992). Our geologic mapping along the west- to west-northwest-striking Hines Creek Fault in the northeastern Healy quadrangle and central to northwestern Mount Hayes quadrangle reveals that (1) the Buchanan Creek pluton is truncated by the Hines Creek Fault and (2) a tectonic collage of fault-bounded slices of various granitic plutons, metagabbro, metabasalt, and sedimentary rock of the Pingston terrane occurs south of the Hines Creek Fault.

  18. Re-appraisal of the Santa Rita Greenstone Belt stratigraphy, central Brazil, based on new U-Pb SHRIMP age and Sm-Nd data of felsic metavolcanic rocks

    International Nuclear Information System (INIS)

    Pimentel, Marcio Martins; Jost, Hardy; Fuck, Reinhardt Adolfo; Junges, Sergio Luiz; Armstrong, Richard; Resende, Marcelo Goncalves

    2000-01-01

    The Santa Rita greenstone belt represents one of the supracrustal belts of the Archaen terranes of Goias, central Brazil. The stratigraphic sequence of this greenstone belt comprises a lower of komatities and basalts and an upper metasedimentary unit made of carbonaceous schits, chert, iron formation and marble, unconformably overlain by clastic metasedimentary rocks. Felsic metavolcanics occur at the interface between the metabasalts and the upper metasedimentary pile. U-Pb SHRIMP age for zircons from the felsic metavolcanics reveal that it is not part of the Archaean sequence, but represents the product of mesoproterozoic (1580 ± 12 Ma) magmatic event. Sm-Nd isotopic data (initial e CHUR values between -10.5 and -14.9) and T DM values of 3.0 and 3.2 Ga, within the range of the surrounding TTG terranes, indicate that the original felsic magmas were produced by re-melting of Archaen crust. The data demonstrate that the Goias greenstone belt contains infolded and imbricated proterozoic rocks, as previously suggested by Sm-Nd isotopic analyses of some of the upper detrital metasedimentary rocks. (author)

  19. Petrology of metabasites in the south of Arousan, northeastern Isfahan province

    Directory of Open Access Journals (Sweden)

    Fereshteh Bayat

    2012-10-01

    Full Text Available Metagabbro, metadiabase and metabasalt of the Chah Palang and Me'raji mountains associated with Lower Paleozoic metamorphites are situated in the south of Arousan. Metabasites of these areas are relatively similar in terms of mineralogy and geochemical characteristics. Rock-forming minerals of the Me'raji metabasites are feldspar, amphibole, biotite, sphene, epidote, chlorite ± calcite. Metagabbro and metadiabase of the Chah Palang area are similar to the Me'raji metabasites in mineralogy and geochemistry. Volcanic rocks are overlain by metagabbros and consist of plagioclase, biotite, sphene, sanidine, chlorite, epidote and iron oxides. The rigid dykes, which are found in the volcanic units are associated with metagabbros and mineralogically are similar to the metavolcanics. Amphibolitic dykes are composed of amphibole, plagioclase and biotite with preferred orientation. Metabasites show limited range of differentiation. Me'raji metabasites are basalt and trachy-basalt in composition, whereas the Chah Palang ones present basalt and trachy-basalt composition. Similar to metabasites of the other parts of Iran, the studied basic rocks demonstrate alkaline to transitional chemical characteristic and are formed in an extensional environment by low-degree partial melting of a garnet-spinel peridotite. Metamorphic episodes have changed the studied rocks to amphibolite and greenschist, but the primitive igneous textures are preserved.

  20. The influence of tectonical structures on the stability rock massif in the area of the magnesite deposit Jelšava of the Dúbrava massif

    Directory of Open Access Journals (Sweden)

    Sasvári Tibor

    2002-12-01

    Full Text Available Magnesite deposits Dúbrava and Miková are located in Carboniferous formations between Brádno and Ochtiná (Dúbrava massif. Carboniferous magnesites are, according to the lithostratigraphic division of Early Paleozoic complexes of Gemericum by Bajaník et al. (1983, situated in the Dobšiná Group, more precisely in the upper part of the Ochtiná Formation, in the environment of black schists with intercalation of metabasalts and their pyroclastics. In the lower parts of the formation are small-pebble conglomerates and polymict sandstones. Carbonatic bodies of the Dúbrava massif has the directional length, 4 500 m, course NE-SW, inclination 55-60o to SE and maximal thickness 600 m. A calculation in 1967 indicated above 500 millions kt of reserves whish after a modification of conditional parameters was reduced to its three fifths. Reserves excluded during the second calculation had a higher content of Fe2O3 causing the lowering of fireproof products quality.In the text the structural and stability conditions in the area of the Dúbrava deposit and the Miková deposit of the Dúbrava massif are analysed.