The role of small woodland remnants on ground dwelling insect conservation in Chaco Serrano, Central Argentina.

Science.gov (United States)

Moreno, María Laura; Fernández, María Guadalupe; Molina, Silvia Itati; Valladares, Graciela

2013-01-01

Many terrestrial ecosystems are changing due to extensive land use and habitat fragmentation, posing a major threat to biodiversity. In this study, the effects of patch size, isolation, and edge/interior localization on the ground dwelling insect communities in the Chaco Serrano woodland remnants in central Argentina were examined. Sampling was carried out in December 2003 and March 2004 in nine remnants (0.57 to 1000 hectares) using pitfall traps. In total, 7071 individuals representing 12 orders and 79 families were recorded. The taxonomic composition of these communities was linked to remnant size. Insect abundance increased (as did their richness, albeit marginally) as remnant area decreased, with no significant effects of isolation or edge/interior localization on abundance, richness, or diversity. No differential area effects were observed when abundance and richness of predators, scavengers, and herbivores were compared. Thus, ground insect communities in fragmented Chaco Serrano seem to respond mainly to patch level, rather than to within-patch (edge effects) or landscape (isolation) level variables. These results suggest that small Chaco Serrano remnants, by supporting larger ground-dwelling insect assemblages, may play an important role from a conservation viewpoint.

Pinyon pine mortality alters communities of ground-dwelling arthropods

Science.gov (United States)

Robert J. Delph; Michael J. Clifford; Neil S. Cobb; Paulette L. Ford; Sandra L. Brantley

2014-01-01

We documented the effect of drought-induced mortality of pinyon pine (Pinus edulis Engelm.) on communities of ground-dwelling arthropods. Tree mortality alters microhabitats utilized by ground-dwelling arthropods by increasing solar radiation, dead woody debris, and understory vegetation. Our major objectives were to determine (1) whether there were changes in...

The response of spider (Araneae assemblages to structural heterogeneity and prey abundance in sub-montane vegetation modified by conservation grazing

Directory of Open Access Journals (Sweden)

Peter Dennis

2015-01-01

Full Text Available The effect of experimental livestock grazing regimens (4 treatments×6 replicates on spiders via habitat structure and prey abundance was investigated on sub-montane habitats in the Southern Highlands of Scotland. The study, 2002–2004 included a baseline survey under the prior, commercial sheep grazing regimen and two assessments of spider assemblages post-treatment: commercial stocking density of sheep; 1/3 stocking density with sheep; 1/3 stocking density cattle with sheep; and no grazing. Spiders were sampled with a suction sampler, five sucks at each of 25 sample units by 24 plots (600 samples in 2003 and 2004, ca. 320 in 2002. Spider abundance and species richness increased under reduced stocking density, mixed herbivore and ungrazed treatments indirectly via changes in vegetation structure and prey abundance. The results refuted a meta-analysis that concluded species richness of spiders is unaffected by grazing. Grazing regimens caused turnover in species composition more than the net difference in species richness suggested, implying that no single, optimal grazing regimen will support as many species as a patchwork under varied grazing management. Conservation grazing benefits spiders and will have significant benefits for food webs in sub-montane ecosystems but the period to equilibrium after changes to grazing requires further investigation.

Spider phylogenomics: untangling the Spider Tree of Life

Directory of Open Access Journals (Sweden)

Nicole L. Garrison

2016-02-01

Full Text Available Spiders (Order Araneae are massively abundant generalist arthropod predators that are found in nearly every ecosystem on the planet and have persisted for over 380 million years. Spiders have long served as evolutionary models for studying complex mating and web spinning behaviors, key innovation and adaptive radiation hypotheses, and have been inspiration for important theories like sexual selection by female choice. Unfortunately, past major attempts to reconstruct spider phylogeny typically employing the “usual suspect” genes have been unable to produce a well-supported phylogenetic framework for the entire order. To further resolve spider evolutionary relationships we have assembled a transcriptome-based data set comprising 70 ingroup spider taxa. Using maximum likelihood and shortcut coalescence-based approaches, we analyze eight data sets, the largest of which contains 3,398 gene regions and 696,652 amino acid sites forming the largest phylogenomic analysis of spider relationships produced to date. Contrary to long held beliefs that the orb web is the crowning achievement of spider evolution, ancestral state reconstructions of web type support a phylogenetically ancient origin of the orb web, and diversification analyses show that the mostly ground-dwelling, web-less RTA clade diversified faster than orb weavers. Consistent with molecular dating estimates we report herein, this may reflect a major increase in biomass of non-flying insects during the Cretaceous Terrestrial Revolution 125–90 million years ago favoring diversification of spiders that feed on cursorial rather than flying prey. Our results also have major implications for our understanding of spider systematics. Phylogenomic analyses corroborate several well-accepted high level groupings: Opisthothele, Mygalomorphae, Atypoidina, Avicularoidea, Theraphosoidina, Araneomorphae, Entelegynae, Araneoidea, the RTA clade, Dionycha and the Lycosoidea. Alternatively, our results

Spider phylogenomics: untangling the Spider Tree of Life

Science.gov (United States)

Garrison, Nicole L.; Rodriguez, Juanita; Agnarsson, Ingi; Coddington, Jonathan A.; Griswold, Charles E.; Hamilton, Christopher A.; Hedin, Marshal; Kocot, Kevin M.; Ledford, Joel M.

2016-01-01

Spiders (Order Araneae) are massively abundant generalist arthropod predators that are found in nearly every ecosystem on the planet and have persisted for over 380 million years. Spiders have long served as evolutionary models for studying complex mating and web spinning behaviors, key innovation and adaptive radiation hypotheses, and have been inspiration for important theories like sexual selection by female choice. Unfortunately, past major attempts to reconstruct spider phylogeny typically employing the “usual suspect” genes have been unable to produce a well-supported phylogenetic framework for the entire order. To further resolve spider evolutionary relationships we have assembled a transcriptome-based data set comprising 70 ingroup spider taxa. Using maximum likelihood and shortcut coalescence-based approaches, we analyze eight data sets, the largest of which contains 3,398 gene regions and 696,652 amino acid sites forming the largest phylogenomic analysis of spider relationships produced to date. Contrary to long held beliefs that the orb web is the crowning achievement of spider evolution, ancestral state reconstructions of web type support a phylogenetically ancient origin of the orb web, and diversification analyses show that the mostly ground-dwelling, web-less RTA clade diversified faster than orb weavers. Consistent with molecular dating estimates we report herein, this may reflect a major increase in biomass of non-flying insects during the Cretaceous Terrestrial Revolution 125–90 million years ago favoring diversification of spiders that feed on cursorial rather than flying prey. Our results also have major implications for our understanding of spider systematics. Phylogenomic analyses corroborate several well-accepted high level groupings: Opisthothele, Mygalomorphae, Atypoidina, Avicularoidea, Theraphosoidina, Araneomorphae, Entelegynae, Araneoidea, the RTA clade, Dionycha and the Lycosoidea. Alternatively, our results challenge the

Community structure of grassland ground-dwelling arthropods along increasing soil salinities.

Science.gov (United States)

Pan, Chengchen; Feng, Qi; Liu, Jiliang; Li, Yulin; Li, Yuqiang; Yu, Xiaoya

2018-03-01

Ground-dwelling arthropod communities are influenced by numerous biotic and abiotic factors. Little is known, however, about the relative importance of vegetation structure and abiotic environmental factors on the patterns of ground-dwelling arthropod community across a wide range of soil salinities. Here, a field survey was conducted to assess the driving forces controlling ground-dwelling arthropod community in the salinized grasslands in the Hexi Corridor, Gansu Province, China. The data were analyzed by variance partitioning with canonical correspondence analysis (CCA). We found that vegetation structure and edaphic factors were at least of similar importance to the pattern of the whole ground-dwelling arthropod community. However, when all collected ground-dwelling arthropods were categorized into three trophic guilds (predators, herbivores, and decomposers), as these groups use different food sources, their populations were controlled by different driving forces. Predators and decomposers were mainly determined by biotic factors such as vegetation cover and aboveground plant biomass and herbivores by plant density and vegetation cover. Abiotic factors were also major determinants for the variation occurring in these guilds, with predators strongly affected by soil electrical conductivity (EC) and the content of fine particles (silt + clay, CS), herbivores by soil N:P, EC, and CS, and decomposers by soil EC and organic matter content (SOM). Since plant cover, density, and aboveground biomass can indicate resource availability, which are mainly constrained by soil N:P, EC, CS, and SOM, we consider that the ground-dwelling arthropod community in the salinized grasslands was mainly influenced by resource availability.

Spider assemblages associated with different crop stages of irrigated rice agroecosystems from eastern Uruguay.

Science.gov (United States)

Bao, Leticia; Ginella, Juaquín; Cadenazzi, Mónica; Castiglioni, Enrique A; Martínez, Sebastián; Casales, Luis; Caraballo, María P; Laborda, Álvaro; Simo, Miguel

2018-01-01

The rice crop and associated ecosystems constitute a rich mosaic of habitats that preserve a rich biological diversity. Spiders are an abundant and successful group of natural predators that are considered efficient in the biocontrol of the major insect pests in agroecosystems. Spider diversity in different stages of the rice crop growth from eastern Uruguay was analysed. Field study was developed on six rice farms with rotation system with pasture, installed during intercropping stage as cover crop. Six rice crops distributed in three locations were sampled with pitfall and entomological vaccum suction machine. Sixteen families, representing six guilds, were collected. Lycosidae, Linyphiidae, Anyphaenidae and Tetragnathidae were the most abundant families (26%, 25%, 20% and 12%, respectively) and comprised more than 80% of total abundance. Other hunters (29%), sheet web weavers (25%) and ground hunters (24%) were the most abundant guilds. Species composition along different crop stages was significantly different according to the ANOSIM test. The results showed higher spider abundance and diversity along the crop and intercrop stages. This study represents the first contribution to the knowledge of spider diversity associated with rice agroecosystem in the country.

The influence of vegetation structure on spider species richness, diversity and community organization in the Apšuciems calcareous fen, Latvia

Energy Technology Data Exchange (ETDEWEB)

Štokmane, M.; Spuņģis, V.

2016-07-01

Calcareous fens are considered to be among the most threatened ecosystems of Europe. They are also one of the most diverse habitats as they support an incredibly rich and diverse range of plant and animal species. However, in spite of their diversity, calcareous fens are still poorly investigated, especially when referring to fen invertebrates, such as spiders. Because spiders are good bioindicators, knowledge of their ecology in rare and threatened habitats is of interest. The aim of this study was to document the composition and diversity of spider species, families and foraging guilds in the ground– and grass–layers of the Apšuciems calcareous fen, and to evaluate the influence of vegetation structure on spider community organization. In summer 2012, we collected ground–dwelling spiders using pitfall traps and grass–dwelling spiders using sweep–netting. A total of 2,937 spider individuals belonging to 19 families and 80 species was collected in the Apšuciems fen. Our results indicate that spider species and families tend to be stratified across the vertical structure of the habitat; the spider composition in the ground stratum differed from that in the grass stratum. On the contrary, however, the spider foraging guild structure between the ground–layer and the grass–layer was similar. Each of the two studied strata presented similar guilds in similar proportions. Our results also showed that spider composition differed considerably between fen parts and that much of this variability could be explained by the architectural properties of the habitat. More diverse vegetation generally supported a higher number of spider species. (Author)

Studies on Tropical Pholcidae I Panjange, a new genus of Indo-Australian Leaf- and rock-dwelling Pholcid spiders (Araneae)

NARCIS (Netherlands)

Deeleman-Reinhold, C.L.; Deeleman, P.R.

1983-01-01

The study of tropical spiders was taken up in the last part of the nineteenth century by Thorell, Simon and others, but since then passed through a long dormant stage. Only during the last few decades there was some revival. In particular numerous spider species from leaf-litter, ground debris, etc.

Chronic exposure to soil salinity in terrestrial species: Does plasticity and underlying physiology differ among specialized ground-dwelling spiders?

Science.gov (United States)

Renault, D; Puzin, C; Foucreau, N; Bouchereau, A; Pétillon, J

2016-07-01

In salt marshes, the alternation of low and high tides entails rapid shifts of submersion and aerial exposure for terrestrial communities. In these intertidal environments, terrestrial species have to deal with an osmotic loss in body water content and an increase in sodium chloride concentration when salt load increases. In salt marshes, spiders represent an abundant arthropod group, whose physiological ecology in response to variations of soil salinity must be further investigated. In this study, we compared the effect of salinity on the survival and physiology of three species of Lycosidae; two salt marsh species (Arctosa fulvolineata and Pardosa purbeckensis) and one forest species (P. saltans). Spiders were individually exposed at three salinity conditions (0‰, 35‰ and 70‰) and survival, changes in body water content, hemolymph ions (Na(+), Ca(2+), Mg(2+), K(+); ICP-MS technique) and metabolites (mainly amino acids, polyols, sugars; LC and GC techniques) were assessed. The survival of the forest species P. saltans was very quickly hampered at moderate and high salinities. In this spider, variations of hemolymph ions and metabolites revealed a quick loss of physiological homeostasis and a rapid salt-induced dehydration of the specimens. Conversely, high survival durations were measured in the two salt-marsh spiders, and more particularly in A. fulvolineata. In both P. purbeckensis and A. fulvolineata, the proportion of Na(+), Ca(2+), Mg(2+), K(+) remained constant at the three experimental conditions. Accumulation of hemolymph Na(+) and amino acids (mainly glutamine and proline) demonstrated stronger osmoregulatory capacities in these salt-marsh resident spiders. To conclude, even if phylogenetically close (belonging to the same, monophyletic, family), we found different physiological capacities to cope with salt load among the three tested spider species. Nevertheless, physiological responses to salinity were highly consistent with the realized

The influence of vegetation structure on spider species richness, diversity and community organization in the Apšuciems calcareous fen, Latvia

Directory of Open Access Journals (Sweden)

Štokmane, M.

2016-07-01

Full Text Available Calcareous fens are considered to be among the most threatened ecosystems of Europe. They are also one of the most diverse habitats as they support an incredibly rich and diverse range of plant and animal species. However, in spite of their diversity, calcareous fens are still poorly investigated, especially when referring to fen invertebrates, such as spiders. Because spiders are good bioindicators, knowledge of their ecology in rare and threatened habitats is of interest. The aim of this study was to document the composition and diversity of spider species, families and foraging guilds in the ground– and grass–layers of the Apšuciems calcareous fen, and to evaluate the influence of vegetation structure on spider community organization. In summer 2012, we collected ground–dwelling spiders using pitfall traps and grass–dwelling spiders using sweep–netting. A total of 2,937 spider individuals belonging to 19 families and 80 species was collected in the Apšuciems fen. Our results indicate that spider species and families tend to be stratified across the vertical structure of the habitat; the spider composition in the ground stratum differed from that in the grass stratum. On the contrary, however, the spider foraging guild structure between the ground–layer and the grass–layer was similar. Each of the two studied strata presented similar guilds in similar proportions. Our results also showed that spider composition differed considerably between fen parts and that much of this variability could be explained by the architectural properties of the habitat. More diverse vegetation generally supported a higher number of spider species.

Global patterns of guild composition and functional diversity of spiders.

Directory of Open Access Journals (Sweden)

Pedro Cardoso

Full Text Available The objectives of this work are: (1 to define spider guilds for all extant families worldwide; (2 test if guilds defined at family level are good surrogates of species guilds; (3 compare the taxonomic and guild composition of spider assemblages from different parts of the world; (4 compare the taxonomic and functional diversity of spider assemblages and; (5 relate functional diversity with habitat structure. Data on foraging strategy, prey range, vertical stratification and circadian activity was collected for 108 families. Spider guilds were defined by hierarchical clustering. We searched for inconsistencies between family guild placement and the known guild of each species. Richness and abundance per guild before and after correcting guild placement were compared, as were the proportions of each guild and family between all possible pairs of sites. Functional diversity per site was calculated based on hierarchical clustering. Eight guilds were discriminated: (1 sensing, (2 sheet, (3 space, and (4 orb web weavers; (5 specialists; (6 ambush, (7 ground, and (8 other hunters. Sixteen percent of the species richness corresponding to 11% of all captured individuals was incorrectly attributed to a guild by family surrogacy; however, the correlation of uncorrected vs. corrected guilds was invariably high. The correlation of guild richness or abundances was generally higher than the correlation of family richness or abundances. Functional diversity was not always higher in the tropics than in temperate regions. Families may potentially serve as ecological surrogates for species. Different families may present similar roles in the ecosystems, with replacement of some taxa by other within the same guild. Spiders in tropical regions seem to have higher redundancy of functional roles and/or finer resource partitioning than in temperate regions. Although species and family diversity were higher in the tropics, functional diversity seems to be also

Impact of cutting and sheep grazing on ground-active spiders and carabids in intertidal salt marshes (Western France

Directory of Open Access Journals (Sweden)

Pétillon, J.

2007-12-01

Full Text Available The aims of this study were to characterize spider (Araneae and ground beetle (Coleoptera Carabidae communities in managed (cutting and sheep grazing and non-managed salt marshes and to assess the efficiency of management regimes in these particular ecosystems. The two groups were studied during 2002 in salt marshes of the Mont Saint-Michel Bay (NW France using pitfall traps. By opening soil and vegetation structures cutting and grazing enhanced the abundances of some halophilic species of spiders and ground beetles. Nevertheless, grazing appeared to be too intensive as spider species richness decreased. We discuss the implications of management practices in terms of nature conservation and their application in the particular area of intertidal salt marshes.

[Effects of cutting and reseeding on the ground-dwelling arthropod community in Caragana intermedia forest in desert steppe].

Science.gov (United States)

Liu, Ren-Tao; Chai, Yong-Qing; Yang, Xin-Guo; Song, Nai-Ping; Wang, Xin-Yun; Wang, Lei

2013-01-01

Taking a 25-year-old Caragana intermedia forest in desert steppe as test object, an investigation was conducted on the ground-dwelling arthropod community in cutting and no-cutting stands with and without reseeding, aimed to understand the effects of cutting, reseeding and their interaction on the individual number and group richness of ground-dwelling arthropod in C. intermedia forest. There were significantly lower number and richness of ground-dwelling arthropod in the open spaces than under the shrubs in the no-cutting and no-reseeding stands. Cutting, reseeding and both of them could significantly increase the number and richness of ground-dwelling arthropod in the open spaces, but not under the shrubs, compared with no cutting or reseeding. Consequently, there were no significant differences in the distribution of ground-dwelling arthropod in the open spaces and under the shrubs in the cutting, reseeding, or cutting and reseeding stands. Further, there was a similar buffer effect between cutting and reseeding on the ground-dwelling arthropod. No significant differences were observed in the ground-dwelling arthropod distribution, between cutting stand and reseeding stand, between cutting stand and cutting and reseeding stand, and between reseeding stand and cutting and reseeding stand. It was suggested that cutting, reseeding, or both of them could significantly improve the ground-dwelling arthropod diversity especially in the open spaces, being beneficial for the restoration of degraded grassland ecosystem and the rational management on artificial C. intermedia forest in desert steppe.

Ground-dwelling ant fauna of sites with high levels of copper.

Science.gov (United States)

Diehl, E; Sanhudo, C E; Diehl-Fleig, Ed

2004-02-01

Richness and diversity of ant species are related to environmental factors such as vegetation, soil, presence of heavy metals, and insecticides, which allow the use of the assemblage members as terrestrial indicators of environmental conservation status. This study presents the results of ground ants surveyed in Minas do Camaquã in the municipality of Cacapava do Sul (Camaquã Basin), State of Rio Grande do Sul. Collections were performed in four sites, which high levels of copper in the soil, three of which--a mine, a liquid reject, and a solid reject-, had sparse or no plant cover, and one site where Pinus has been used for rehabilitation. Parque das Guaritas was the control site, since it presented normal levels of copper and a dense savanna cover. For each site, three transect lines extending 100 m were draw, and at each 10 m sardine baits were distributed; after two hours the ants present were collected. Hand collections in all five sites were performed during one hour (capture effort). A total of 51 species belonging to 17 genera were collected. The control site was the richest in ant species (r = 45). Sites with high level of copper and poor plant cover presented the lowest richness: mine (r = 14), solid reject (r = 15), and liquid reject (r = 16). In contrast, the site planted with Pinus presented an increment in richness (r = 24) of ground-dwelling ants, suggesting a reahabilitation process.

Ground-dwelling ant fauna of sites with high levels of copper

Directory of Open Access Journals (Sweden)

E. Diehl

Full Text Available Richness and diversity of ant species are related to environmental factors such as vegetation, soil, presence of heavy metals, and insecticides, which allow the use of the assemblage members as terrestrial indicators of environmental conservation status. This study presents the results of ground ants surveyed in Minas do Camaquã in the municipality of Caçapava do Sul (Camaquã Basin, State of Rio Grande do Sul. Collections were performed in four sites, with high levels of copper in the soil, three of which - a mine, a liquid reject, and a solid reject -, had sparse or no plant cover, and one site where Pinus has been used for rehabilitation. Parque das Guaritas was the control site, since it presented normal levels of copper and a dense savanna cover. For each site, three transect lines extending 100 m were draw, and at each 10 m sardine baits were distributed; after two hours the ants present were collected. Hand collections in all five sites were performed during one hour (capture effort. A total of 51 species belonging to 17 genera were collected. The control site was the richest in ant species (r = 45. Sites with high level of copper and poor plant cover presented the lowest richness: mine (r = 14, solid reject (r = 15, and liquid reject (r = 16. In contrast, the site planted with Pinus presented an increment in richness (r = 24 of ground-dwelling ants, suggesting a reahabilitation process.

Exposure to radon in dwellings below the ground level in the area of Zagreb

International Nuclear Information System (INIS)

Lokobauer, N.; Franic, Z.; Sokolovic, E.; Petroci, L.; Sencar, J.; Lokner, V.

1998-01-01

Radon measurements were carried out in 44 dwellings at 22 locations in the area of Zagreb with the aim of establishing possible differences in radon levels between dwellings located below ground level, and those on higher floors. The measurements were performed using a Honeywell professional radon monitor both during the spring/summer and the autumn/winter seasons. Significant differences were found: for dwellings below ground level, the average annual radon activity concentration was 57±20 Bqm -3 ; for those on higher floors the value was 35±15 Bqm -3 . (A.K.)

Community structure of spiders in coastal habitats of a Mediterranean delta region (Nestos Delta, NE Greece

Directory of Open Access Journals (Sweden)

S. Buchholz

2009-01-01

Full Text Available (pp 101-115Habitat zonation and ecology of spider assemblages have been poorly studied in Mediterranean ecosystems. A first analysis of spider assemblages in coastal habitats in the east Mediterranean area is presented. The study area is the 250 km² Nestos Delta, located in East Macedonia in the North-East of Greece. Spiders were caught in pitfall traps at 17 sites from the beginning of April to the end of June 2004. Nonparametric estimators were used to determine species richness and alpha diversity. Ordination analysis (redundancy analysis indicated four clearly separable spider species groups (salt meadows, dunes, mea-dows and floodplain forests, along a soil salinity and moisture gradient. Based on these results we discuss the habitat preferences of these spiders and include the first ecological data on several species.

Linking Vegetation Structure and Spider Diversity in Riparian and Adjacent Habitats in Two Rivers of Central Argentina: An Analysis at Two Conceptual Levels.

Science.gov (United States)

Griotti, Mariana; Muñoz-Escobar, Christian; Ferretti, Nelson E

2017-08-01

The link between vegetation structure and spider diversity has been well explored in the literature. However, few studies have compared spider diversity and its response to vegetation at two conceptual levels: assemblage (species diversity) and ensemble (guild diversity). Because of this, we studied spider diversity in riparian and adjacent habitats of a river system from the Chacoan subregion in central Argentina and evaluated their linkage with vegetation structure at these two levels. To assess vegetation structure, we measured plant species richness and vegetation cover in the herb and shrub - tree layers. We collected spiders for over 6 months by using vacuum netting, sweep netting and pitfall traps. We collected 3,808 spiders belonging to 119 morphospecies, 24 families and 9 guilds. At spider assemblage level, SIMPROF analysis showed significant differences among studied habitats. At spider ensemble level, nevertheless, we found no significant differences among habitats. Concerning the linkage with vegetation structure, BIOENV test showed that spider diversity at either assemblage or ensemble level was not significantly correlated with the vegetation variables assessed. Our results indicated that spider diversity was not affected by vegetation structure. Hence, even though we found a pattern in spider assemblages among habitats, this could not be attributed to vegetation structure. In this study, we show that analyzing a community at two conceptual levels will be useful for recognizing different responses of spider communities to vegetation structure in diverse habitat types. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Characterizing movement of ground-dwelling arthropods with a novel mark-capture method using fluorescent powder

Science.gov (United States)

Kayla I. Perry; Kimberly F. Wallin; John W. Wenzel; Daniel A. Herms

2017-01-01

A major knowledge gap exists in understanding dispersal potential of ground-dwelling arthropods, especially in forest ecosystems. Movement of the ground-dwelling arthropod community was quantified using a novel markcapture technique in which three different colored fluorescent powders in two separate mixtures were applied to the floor of a deciduous forest in...

Weeds and ground-dwelling predators' response to two different weed management systems in glyphosate-tolerant cotton: A farm-scale study.

Science.gov (United States)

García-Ruiz, Esteban; Loureiro, Íñigo; Farinós, Gema P; Gómez, Pablo; Gutiérrez, Elena; Sánchez, Francisco Javier; Escorial, María Concepción; Ortego, Félix; Chueca, María Cristina; Castañera, Pedro

2018-01-01

The use of glyphosate, as a post-emergence broad-spectrum herbicide in genetically modified glyphosate-tolerant (GT) cotton, supposes a big change in weed management programs with respect to a conventional regime. Thus, alterations in arable flora and arthropod fauna must be considered when evaluating their potential impacts. A 3-year farm-scale study was conducted in a 2-ha GT cotton crop, in southern Spain, to compare the effects of conventional and glyphosate herbicide regimes on weed abundance and diversity and their consequences for ground-dwelling predators. Surveys reveal that weed density was relatively low within all treatments with a few dominant species, with significantly higher weed densities and modifications of the floristic composition in glyphosate-treated plots that led to an increase in the abundance of Portulaca oleracea and to a reduction in plant diversity. The activity-density of the main predatory arthropod taxa (spiders, ground beetles, rove beetles and earwigs) varied among years, but no significant differences were obtained between conventional and glyphosate herbicide regimes. However, significant differences between treatments were obtained for ground beetles species richness and diversity, being higher under the glyphosate herbicide regime, and a positive correlation with weed density could be established for both parameters. The implications of these findings to weed control in GT cotton are discussed.

[Population dynamics of ground carabid beetles and spiders in a wheat field along the wheat-alfalfa interface and their response to alfalfa mowing].

Science.gov (United States)

Liu, Wen-Hui; Hu, Yi-Jun; Hu, Wen-Chao; Hong, Bo; Guan, Xiao-Qing; Ma, Shi-Yu; He, Da-Han

2014-09-01

Taking the wheat-alfalfa and wheat-wheat interfaces as model systems, sampling points were set by the method of pitfall trapping in the wheat field at the distances of 3 m, 6 m, 9 m, 12 m, 15 m, 18 m, 21 m, 24 m, and 27 m from the interface. The species composition and abundance of ground carabid beetles and spiders captured in pitfalls were investigated. The results showed that, to some extent there was an edge effect on species diversity and abundance of ground carabid beetles and spiders along the two interfaces. A marked edge effect was observed between 15 m and 18 m along the alfalfa-wheat interface, while no edge effect was found at a distance over 20 m. The edge effect along the wheat-wheat interface was weaker in comparison to the alfalfa-wheat interface. Alfalfa mowing resulted in the migration of a large number of ground carabid beetles and spiders to the adjacent wheat filed. During ten days since mowing, both species and abundance of ground carabid beetles and spiders increased in wheat filed within the distance of 20 m along the alfalfa-wheat interface. The spatial distribution of species diversity of ground beetles and spiders, together with the population abundance of the dominant Chlaenius pallipes and Pardosa astrigera, were depicted, which could directly indicate the migrating process of natural enemy from alfalfa to wheat field.

The effects of overwintering and habitat type on body condition and locomotion of the wolf spider Pardosa alacris

Science.gov (United States)

Ingle, Kapilkumar; Horváth, Ádám; Gallé-Szpisjak, Nikolett; Gellért, Levente; Csata, Enikő; Gallé, Róbert

2018-05-01

Overwintering in temperate regions is a prominent mortality risk for invertebrates and may affect their behaviour and body condition. Pardosa alacris is a common ground dwelling spider in central European native and plantation forests, and habitat type and prey availability may play important roles in their overwintering. The effect of overwintering on body condition and behaviour of spiders in semi natural and exotic habitats is relatively unknown. Here we assess the effects of winter on spiders from native poplar and exotic pine plantations. The locomotory behaviour of P. alacris (distance covered and speed) was assessed by tracking their movement in a white circular plastic arena. We assessed body condition, body size, and total fat content. Forest type and sex had significant effects on body length. Fat content was significantly higher in the spring than in autumn, and spiders covered larger distances and were faster in autumn than in spring. Fat content had a significant negative effect on average speed. Spiders in native forests were smaller but grew more during the winter than in exotic plantations, possibly due to higher prey availability in native forests. Visually-hunting predators may significantly affect spiders. Fat spiders with better body condition moved less, and were thus less detectable by predators. However the low movement rate may result in a low rate of encountering prey items, thus lowering feeding efficiency.

Colonization of subterranean habitats by spiders in Central Europe

Directory of Open Access Journals (Sweden)

Vlastimil Růžička

2013-05-01

Full Text Available Using data from the Czech Republic, we studied the distribution of spiders in soils, crevice systems, scree and caves, i.e. subterranean habitats at depths spanning from 10 cm to 100 m. In total, we found 161 species. The number of species declines with increasing habitat depth, with a major drop in species richness at the depth of 10 meters. Thirteen species exhibit morphological adaptations to life in subterranean habitats. At depths greater than 10 meters, spider assemblages are almost exclusively composed of troglomorphic species. We propose a hypothesis of evolution of troglomorphisms at spiders during Quaternary climatic cycles.

Ground beetle (Coleoptera: Carabidae) assemblages in narrow hedgerows in a Danish agricultural landscape

DEFF Research Database (Denmark)

Lövei, G. L.; Magura, T.

2015-01-01

Sorbus intermedia), and the non-native spruce (Picea spp.). We hypothesised that hedgerows with deciduous trees harbour more diverse ground beetle assemblages than hedges composed of non-native conifer trees. We also investigated which vegetation structure characteristics might influence the ground...

Weeds and ground-dwelling predators′ response to two different weed management systems in glyphosate-tolerant cotton: A farm-scale study

Science.gov (United States)

Farinós, Gema P.; Gómez, Pablo; Gutiérrez, Elena; Sánchez, Francisco Javier; Escorial, María Concepción; Ortego, Félix; Chueca, María Cristina; Castañera, Pedro

2018-01-01

The use of glyphosate, as a post-emergence broad-spectrum herbicide in genetically modified glyphosate-tolerant (GT) cotton, supposes a big change in weed management programs with respect to a conventional regime. Thus, alterations in arable flora and arthropod fauna must be considered when evaluating their potential impacts. A 3-year farm-scale study was conducted in a 2-ha GT cotton crop, in southern Spain, to compare the effects of conventional and glyphosate herbicide regimes on weed abundance and diversity and their consequences for ground-dwelling predators. Surveys reveal that weed density was relatively low within all treatments with a few dominant species, with significantly higher weed densities and modifications of the floristic composition in glyphosate-treated plots that led to an increase in the abundance of Portulaca oleracea and to a reduction in plant diversity. The activity-density of the main predatory arthropod taxa (spiders, ground beetles, rove beetles and earwigs) varied among years, but no significant differences were obtained between conventional and glyphosate herbicide regimes. However, significant differences between treatments were obtained for ground beetles species richness and diversity, being higher under the glyphosate herbicide regime, and a positive correlation with weed density could be established for both parameters. The implications of these findings to weed control in GT cotton are discussed. PMID:29351549

Dispatch from the field: ecology of ground-web-building spiders with description of a new species (Araneae, Symphytognathidae)

Science.gov (United States)

2014-01-01

Abstract Crassignatha danaugirangensis sp. n. (Araneae: Symphytognathidae) was discovered during a tropical ecology field course held at the Danau Girang Field Centre in Sabah, Malaysia. A taxonomic description and accompanying ecological study were completed as course activities. To assess the ecology of this species, which belongs to the ground-web-building spider community, three habitat types were surveyed: riparian forest, recently inundated riverine forest, and oil palm plantation. Crassignatha danaugirangensis sp. n. is the most abundant ground-web-building spider species in riparian forest; it is rare or absent from the recently inundated forest and was not found in a nearby oil palm plantation. The availability of this taxonomic description may help facilitate the accumulation of data about this species and the role of inundated riverine forest in shaping invertebrate communities. PMID:24891829

Dispatch from the field: ecology of ground-web-building spiders with description of a new species (Araneae, Symphytognathidae

Directory of Open Access Journals (Sweden)

Jeremy Miller

2014-03-01

Full Text Available Crassignatha danaugirangensis sp. n. (Araneae: Symphytognathidae was discovered during a tropical ecology field course held at the Danau Girang Field Centre in Sabah, Malaysia. A taxonomic description and accompanying ecological study were completed as course activities. To assess the ecology of this species, which belongs to the ground-web-building spider community, three habitat types were surveyed: riparian forest, recently inundated riverine forest, and oil palm plantation. Crassignatha danaugirangensis sp. n. is the most abundant ground-web-building spider species in riparian forest; it is rare or absent from the recently inundated forest and was not found in a nearby oil palm plantation. The availability of this taxonomic description may help facilitate the accumulation of data about this species and the role of inundated riverine forest in shaping invertebrate communities.

Edge effect on weevils and spiders

Directory of Open Access Journals (Sweden)

R. Horváth

2002-05-01

Full Text Available The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest interior was significantly lower than that of the forest edge and the meadow. The composition of the spider assemblage of the edge was more similar to the forest, while the composition of weevils in the edge was more similar to the meadow. Our results based on two invertebrate groups operating on different trophic levels suggest that there is a significant edge effect for the studied taxa resulting in higher species richness in the edge.

Integrating immunomarking with ecological and behavioural approaches to assess predation of Helicoverpa spp. larvae by wolf spiders in cotton

Science.gov (United States)

Wolf spiders (Araneae: Lycosidae) are abundant soil-dwelling predators found in cotton fields and can contribute important pest management services. These spiders can kill and consume larvae of the cotton bollworm Helicoverpa spp. (Lepidoptera: Noctuidae) that survive foraging on Bt cotton and desce...

Invasion patterns of ground-dwelling arthropods in Canarian laurel forests

Science.gov (United States)

Arndt, Erik; Perner, Jörg

2008-09-01

Patterns of invasive species in four different functional groups of ground-dwelling arthropods (Carnivorous ground dwelling beetles; Chilopoda; Diplopoda; Oniscoidea) were examined in laurel forests of the Canary Islands. The following hypotheses were tested: (A) increasing species richness is connected with decreasing invasibility as predicted by the Diversity-invasibility hypothesis (DIH); (B) disturbed or anthropogenically influenced habitats are more sensitive for invasions than natural and undisturbed habitats; and (C) climatic differences between laurel forest sites do not affect the rate of invasibility. A large proportion of invasives (species and abundances) was observed in most of the studied arthropod groups. However, we did not find any support for the DIH based on the examined arthropod groups. Regarding the impact of the extrinsic factors 'disturbance' and 'climate' on invasion patterns, we found considerable differences between the studied functional groups. Whereas the 'disturbance parameters' played a minor role and only affected the relative abundances of invasive centipedes (positively) and millipedes (negatively), the 'climate parameters' were significantly linked with the pattern of invasive detritivores. Interactions between native and invading species have not been observed thus far, but cannot completely be excluded.

Arthropod diversity and assemblage structure response to deforestation and desertification in the Sahel of western Senegal

Directory of Open Access Journals (Sweden)

Brandon J. Lingbeek

2017-07-01

Full Text Available Drylands are highly vulnerable to desertification and among the most endangered ecosystems. To understand how biodiversity responds to environmental degradation in these fragile ecosystems, we examined whether arthropod, beetle, spider and ant diversity and assemblage structure differed (1 between seasons, (2 among locations (3 between protected areas of tropical dry forest and adjacent communal lands suffering from desertification, as well as (4 how vegetation impacts assemblage structures. We established 12 plots spaced homogenously throughout each protected area and the adjacent communal land at three locations: Beersheba, Bandia and Ngazobil. Within each plot, we measured canopy closure, vegetation height, percent cover of bare ground, leaf litter, grasses and forbs and collected arthropods using pitfall traps during the 2014 dry (May and rainy (September seasons. We collected 123,705 arthropods representing 733 morphospecies, 10,849 beetles representing 216 morphospecies, 4969 spiders representing 91 morphospecies and 59,183 ants representing 45 morphospecies. Results showed greater arthropod and beetle diversities (P = 0.002–0.040 in the rainy season, no difference in diversity among locations for any taxonomic group and a difference (P ≤ 0.001 in diversity for all taxa between protected areas and communal lands. Assemblage structures of all taxa responded (P = 0.001 to vegetation characteristics, differed (P = 0.015–0.045 between seasons and, with a few exceptions, locations and fragments. Our results illustrate the importance of a multi-taxa approach in understanding biodiversity response to anthropogenic disturbances as well as the value of protected areas in preserving biodiversity of the Sahel.

[Characteristics of ground-dwelling soil macro-arthropod communities in a biodiversity monitoring plot of black soil cropland, northeastern China].

Science.gov (United States)

Liu, Jie; Gao, Mie Xiang; Wu, Dong Hui

2017-12-01

Agro-ecosystem is an important component of terrestrial ecosystems and it is one of the key areas of global ecological and environmental studies. A 16 hm 2 permanent plot in black soil cropland was built to study the community structure of soil biodiversity in typical black soil region in Northeast China. Pitfall trap was used to investigate the ground-dwelling soil macro-arthropods from August to October 2015 in accordance with the three crop growth stages: whirling stage, silking stage, and milk stage. A total of 5284 ground-dwelling soil macro-arthropods belonging to 47 species were captured sorted into 3 classes, 12 orders, 32 families. 3 dominant groups and 11 common groups were found. Phytophages and Omnivores were dominant groups. The individuals and species numbers of ground-dwelling soil macro-arthropods had significant changes with the vegetative growth period. The maximum values of the Shannon index, Margalef index, Pielou index of soil macro-arthropods all appeared in September, but the maximum dominant index appeared in August. From the variation coefficient (CV) and spatial interpolation of different species, it could be seen that there was heterogeneity in the horizontal direction of the ground-dwelling soil macro-arthropod communities. Regarding the relationships between the ground-dwelling soil macro-arthropod communities and soil environmental factors including soil pH, soil organic matter, total nitrogen and soil water content, the bivariate correlation analysis showed there was no significant correlation between them. Results of canonical correspondence analysis (CCA) further indicated that the dominant and common groups were adaptable to environmental factors and widely distributed in the study area. The results showed that the species richness of ground-dwelling soil macro-arthropods was very high in cropland, and the dynamic of soil arthropod's composition and spatial distribution pattern in diffe-rent crop growth stages were significantly

Trunk structural traits explain habitat use of a tree-dwelling spider (Selenopidae) in a tropical forest

Science.gov (United States)

Villanueva-Bonilla, German Antonio; Salomão, Adriana Trevizoli; Vasconcellos-Neto, João

2017-11-01

Habitat selection by spiders may be strongly influenced by biotic, climatic, and physical factors. However, it has been shown that the selection of habitats by generalist predators (like spiders) is regulated more by the physical structure of the habitat than by prey availability. Yet, the preferences of spiders in relation to plants or plant traits remain poorly explored. In a remnant of the Atlantic forest in Brazil, the spider Selenops cocheleti is frequently detected on the trunks of plants from the Myrtaceae family. Here, we investigated quantitatively and experimentally whether the colonization of trees by S. cocheleti is related to plant species or the presence of specific structures on trunks. We found that S. cocheleti preferentially occurred on plants of the family Myrtaceae. This spider was also strongly associated with trees that have smooth trunks and/or exfoliating bark. Non-Myrtaceae plants that were occupied by this species have exfoliating bark (e.g., Piptadenia gonoacantha) or deep fissures on the trunk (e.g., the exotic species Pinus elliottii). Our results indicate that the selection of host plants by S. cocheleti is not species-specific, but based on the structural characteristics of plants. Trunks with exfoliating bark may benefit spiders by providing shelter against predators and harsh climatic conditions. Smooth surfaces might allow rapid movements, facilitating both attacks on preys and escape from predators. Our study emphasizes the importance of the physical structure of the habitat on spider's distribution. Future studies investigating how specific plant characteristics influence prey acquisition and predator avoidance would improve our understanding of habitat selection by these animals.

Kettle Holes in the Agrarian Landscape: Isolated and Ecological Unique Habitats for Carabid Beetles (Col.: Carabidae and Spiders (Arach.: Araneae

Directory of Open Access Journals (Sweden)

Platen Ralph

2016-11-01

Full Text Available Kettle holes are small depressional wetlands and because of the high variability of site factors they are potential hotspots of biodiversity in the monotone arable land. We investigated eight kettle holes and two agrarian reference biotopes for carabid beetles and spiders. The animals were captured with pitfall traps from May to August 2005, along with surveys of the soil and vegetation. We asked whether each kettle hole has specific ecological properties which match with characteristic carabid beetle and spider coenoses and whether they represent isolated biotopes. Differences in the composition of ecological and functional groups of carabid beetles and spiders between the plots were tested with an ANOVA. The impact of the soil variables and vegetation structure on the distribution of species was analyzed with a Redundancy Analysis. The assemblage similarities between the kettle hole plots were calculated by the Wainstein-Index. Ecological groups and habitat preferences of carabid beetles had maximal expressions in seven different kettle holes whereas most of the ecological characteristics of the spiders had maximal expression in only two kettle holes. High assemblage similarity values of carabid beetle coenoses were observed only in a few cases whereas very similar spider coenoses were found between nearly all of the kettle holes. For carabid beetles, kettle holes represent much more isolated habitats than that for spiders. We concluded that kettle holes have specific ecological qualities which match with different ecological properties of carabid beetles and spiders and that isolation effects affect carabid beetles more than spiders.

A comparison of spider communities in Bt and non-Bt rice fields.

Science.gov (United States)

Lee, Sue Yeon; Kim, Seung Tae; Jung, Jong Kook; Lee, Joon-Ho

2014-06-01

To assess the potential adverse effects of a Bt rice line (Japonica rice cultivar, Nakdong) expressing a synthetic cry1Ac1 gene, C7-1-9-1-B, which was highly active against all larval stages of Cnaphalocrocis medinalis (Guenée) (Lepidoptera: Crambidae), we investigated the community structure of spiders in Bt and non-Bt rice fields during the rice-growing season in 2007 and 2008 in Chungcheongnam-do, Korea. Spiders were surveyed with a sweep net and suction device. Suction sampling captured more spiders, measured in terms of species level and abundance, than sweeping. Araneidae and Thomisidae were captured more by sweeping, and certain species were captured only by sweeping. These findings show that both suction and sweep sampling methods should be used because these methods are most likely complementary. In total, 29 species in 23 genera and nine families were identified from the 4,937 spiders collected, and both Bt and non-Bt rice fields showed a typical Korean spider assemblage. The temporal patterns of spider species richness and spider abundance were very similar between Bt and non-Bt rice, although significant differences in species richness were observed on a few occasions. Overall, spider community structure, including diversity, the dominant species, and abundance did not differ between Bt and non-Bt rice. The results of the study indicated that the transgenic Cry1Ac rice lines tested in this study had no adverse effects on the spider community structure of the rice fields.

Side effects of kaolin particle films on apple orchard bug, beetle and spider communities

NARCIS (Netherlands)

Marko, V.; Bogya, S.; Kondorosy, E.; Blommers, L.H.M.

2010-01-01

The effects of multiple applications of hydrophobic kaolin particle film on apple orchard bug (Heteroptera), beetle (Coleoptera) and spider (Araneae) assemblages were studied in the Netherlands. Insecticide-free orchard plots served as a control. The kaolin applications significantly reduced the

Spider (Araneae) predations on white-backed planthopper Sogatella furcifera in subtropical rice ecosystems, China.

Science.gov (United States)

Wang, Xue-Qin; Wang, Guang-Hua; Zhu, Zeng-Rong; Tang, Qi-Yi; Hu, Yang; Qiao, Fei; Heong, Kong Luen; Cheng, Jia-An

2017-06-01

Spiders are effective biological control agents in rice ecosystems, but the comparative study of predations among main spider species under field conditions has not been fully explored owing to a lack of practical methodology. In this study, more than 6000 spiders of dominant species were collected from subtropical rice ecosystems to compare their predations on Sogatella furcifera (Horváth) (white-backed planthopper, WBPH) using DNA-based gut content analysis. The positive rates for all spider taxa were closely related to prey densities, as well as their behaviors and niches. The relationships of positive rates to prey planthopper densities for Pardosa pseudoannulata (Böes. et Str.), Coleosoma octomaculata (Böes. et Str.), Tetragnatha maxillosa Thorell and Ummeliata insecticeps (Böes. et Str.) under field conditions could be described using saturated response curves. Quantitative comparisons of predations among the four spider species confirmed that P. pseudoannulata and C. octomaculata were more rapacious than U. insecticeps and T. maxillosa under field conditions. A comparison of ratio of spiders to WBPH and positive rates between fields revealed that biological control by spiders could be effectively integrated with variety resistance. Generalist spiders could follow up WBPH population timely, and assemblages of spiders coupled with variety resistance could effectively suppress WBPH population. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

Impacts of Rotation Schemes on Ground-Dwelling Beneficial Arthropods.

Science.gov (United States)

Dunbar, Mike W; Gassmann, Aaron J; O'Neal, Matthew E

2016-10-01

Crop rotation alters agroecosystem diversity temporally, and increasing the number of crops in rotation schemes can increase crop yields and reduce reliance on pesticides. We hypothesized that increasing the number of crops in annual rotation schemes would positively affect ground-dwelling beneficial arthropod communities. During 2012 and 2013, pitfall traps were used to measure activity-density and diversity of ground-dwelling communities within three previously established, long-term crop rotation studies located in Wisconsin and Illinois. Rotation schemes sampled included continuous corn, a 2-yr annual rotation of corn and soybean, and a 3-yr annual rotation of corn, soybean, and wheat. Insects captured were identified to family, and non-insect arthropods were identified to class, order, or family, depending upon the taxa. Beneficial arthropods captured included natural enemies, granivores, and detritivores. The beneficial community from continuous corn plots was significantly more diverse compared with the community in the 2-yr rotation, whereas the community in the 3-yr rotation did not differ from either rotation scheme. The activity-density of the total community and any individual taxa did not differ among rotation schemes in either corn or soybean. Crop species within all three rotation schemes were annual crops, and are associated with agricultural practices that make infield habitat subject to anthropogenic disturbances and temporally unstable. Habitat instability and disturbance can limit the effectiveness and retention of beneficial arthropods, including natural enemies, granivores, and detritivores. Increasing non-crop and perennial species within landscapes in conjunction with more diverse rotation schemes may increase the effect of biological control of pests by natural enemies. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Molecular Diversity of Compounds from Pygidial Gland Secretions of Cave-Dwelling Ground Beetles: The First Evidence.

Science.gov (United States)

Vesović, Nikola; Ćurčić, Srećko; Vujisić, Ljubodrag; Nenadić, Marija; Krstić, Gordana; Perić-Mataruga, Vesna; Milosavljević, Slobodan; Antić, Dragan; Mandić, Boris; Petković, Matija; Vučković, Ivan; Marković, Đorđe; Vrbica, Maja; Ćurčić, Božidar; Makarov, Slobodan

2015-06-01

Three adult cave-dwelling ground beetle species were induced to discharge secretions of their pygidial glands into vials. Dichloromethane extraction was used to obtain the secretions. In total, 42 compounds were identified by GC/MS analysis. Pheggomisetes ninae contained 32 glandular compounds, Laemostenus (Pristonychus) punctatus 13, whereas Duvalius (Paraduvalius) milutini had nine compounds. Caproic, oleic, palmitic, and stearic acids were present in the samples of all analyzed species. Undecane was predominant in the extract of L. punctatus. Palmitic acid was the major component in the secretion of D. milutini. Finally, the most abundant compounds in P. ninae secretion were heptacosene and nonacosadienes. Herein, we present the first data on the identification of pygidial gland secretion components in both troglophilous and troglobite cave-dwelling ground beetles. Some compounds are reported for the first time in the secretions of ground beetles and other higher or lower taxa. The adaptation to underground life has not led to a reduction or changes in the chemical defense mechanism in the analyzed troglophilous and troglobitic Platyninae and Trechinae taxa.

[Assemblage effect of ground arthropod community in desert steppe shrubs with different ages].

Science.gov (United States)

Liu, Ren-Tao; Zhu, Fan; Chai, Yong-Qing

2014-01-01

Taking the 6-, 15-, 24- and 36-year-old Caragana intermedia shrubs in desert steppe as a subject, an investigation on soil properties and ground arthropod community was carried out under the shrub and in the open to probe into the assemblage effect of ground arthropod community in desert steppe shrubs with different ages. The results were as follows: 1) In the 6-year-old shrubland, significant differences were only found in soil physical properties (soil texture, soil moisture and electrical conductivity) between the microhabitats under shrub and in the open. Beginning from the 15-year-old shrubland, however, soil organic matter and nutrition (N, P) increased significantly. 2) A total of 27 groups were captured in the studied sites which dominated by Carabidae, Tenebrionidae and Formicidae. From 6- to 15-year-old shrubland, the number of dominant groups decreased while that of common groups increased for the ground arthropod community under the shrub. From 15- to 24- and 36-year-old shrubland, the difference between the microhabitats under the shrub and in the open decreased firstly, and then increased. Some special groups appeared under the shrub in the 36-year-old shrubland, and dung beetles became dominant. 3) In the 6- and 24-year-old shrublands, there were no significant differences in group richness, abundance, and diversity index between the microhabitats under the shrub and in the open. As for the 15- and 36-year-old shrublands, however, significant differences were observed. 4) The shrub age had a stronger effect on the distribution of ground arthropods living under the shrubs compared to that in the open. The changes in soil texture, pH and electrical conductivity could significantly influence on the distribution of ground arthropods under the shrub, also in the open to some degree. It was suggested that the development of shrubland had strong impact on assemblage effect of ground arthropods, which was closely correlated with the stand age and would

Spider-Ant Associations: An Updated Review of Myrmecomorphy, Myrmecophily, and Myrmecophagy in Spiders

Directory of Open Access Journals (Sweden)

Paula E. Cushing

2012-01-01

Full Text Available This paper provides a summary of the extensive theoretical and empirical work that has been carried out in recent years testing the adaptational significance of various spider-ant associations. Hundreds of species of spiders have evolved close relationships with ants and can be classified as myrmecomorphs, myrmecophiles, or myrmecophages. Myrmecomorphs are Batesian mimics. Their close morphological and behavioral resemblance to ants confers strong survival advantages against visually hunting predators. Some species of spiders have become integrated into the ant society as myrmecophiles or symbionts. These spider myrmecophiles gain protection against their own predators, live in an environment with a stable climate, and are typically surrounded by abundant food resources. The adaptations by which this integration is made possible are poorly known, although it is hypothesized that most spider myrmecophiles are chemical mimics and some are even phoretic on their hosts. The third type of spider-ant association discussed is myrmecophagy—or predatory specialization on ants. A table of known spider myrmecophages is provided as is information on their biology and hunting strategies. Myrmecophagy provides these predators with an essentially unlimited food supply and may even confer other protections to the spiders.

Community structure and composition of litter spiders (Arachnida: Araneae and influence of macro-climatic factors on Parque Ecológico Jatobá Centenário, Morrinhos, Goiás, Brazil

Directory of Open Access Journals (Sweden)

Renan Castro Santana

2015-08-01

Full Text Available Spiders are a diverse group and are considered to be good bioindicators due to their sensitivity to variation in biotic and abiotic factors.  Despite this the taxonomy of the Araneae is poorly known, particularly in the tropical and subtropical regions.  The use of spider guilds can improve our understanding of the dynamics of spider communities, and in this paper we analyse the influence of climatic factors on guilds and species dominance of spiders within the leaf litter layer of a semi-deciduous forest in the tropical savanna Cerrado, Brazil. The study site was Parque Ecológico Jatobá Centenário, a fragment of 90ha, in Morrinhos, Goiás, Brazil.  Spiders were sampled from November 2006 to August 2007 using pitfall traps that remained open for seven days on each of four occasions.  Overall 4139 spiders from 35 families and 118 species were collected. The main families were Salticidae (28%, Linyphiidae (27%, Lycosidae (12% and Theridiidae (11%.  In terms of richness the main families were: Theridiidae, Salticidae, Corinnidae and Araneidae, with 18, 16, 15 and 13 species respectively. The overall Shannon-Wiener (H’ diversity was 3.6. The rainy season showed higher values than the dry season for abundance (2,868 and 1,271 respectively, richness (100 and 71 and diversity (3,296 and 3,237.  The families Theridiidae, Corinnidae and Salticidae presented more species in both dry and wet seasons.  Observed climatic variation (rainfall, humidity and temperature between seasons influenced the community structure of ground-dwelling spiders. 

Impact of prescribed burning on a heathland inhabiting spider community

Directory of Open Access Journals (Sweden)

Krause, Rolf Harald

2016-04-01

Full Text Available Heathlands can provide refuge for many stenotopic and endangered arthropods, if habitat management practices are applied. A management measure that is rarely being used today, but which has the potential to support diversity of arthropod communities, is prescribed burning. In this study we investigated the effects of prescribed burning on spider assemblages on a burned site with Calluna vulgaris in the nature reserve Lueneburg Heath, northwest Germany. We used pitfall trapping with a sampling design of 39 traps over a period of one year and 17 sampling intervals on a burned and a control site. We compared overall species richness, activity abundance patterns and community composition of the two sites, with a particular focus on stenotopic and endangered species. We collected 5116 adult spiders and 99 species altogether in a relatively small sampling area. This number of species represents nearly one third of the regional species pool of heathland spider species. Twelve species occurred exclusively on the burned site in contrast to 28 species exclusively found on the unburned site. Although we found more than twice as many spider individuals and higher mean species richness on the control site than on the burned site, the species richness of red-listed spiders was higher on the burned site. Especially the fact that we found 24 endangered species on the burned site and only 20 on the control site indicates that the applied measure of prescribed burning can foster certain endangered spider species and contribute to preserving the overall biodiversity of heathland ecosystems.

Attending to detail by communal spider-eating spiders.

Science.gov (United States)

Jackson, Robert R; Nelson, Ximena J

2012-07-01

Communal predators may often need to make especially intricate foraging decisions, as a predator's success may depend on the actions of its neighbours. Here,we consider the decisions made by Portia africana, a jumping spider (Salticidae) that preys on other spiders, including Oecobius amboseli (Oecobiidae), a small prey spider that lives under small sheets of silk (nests) on the walls of buildings. P. africana juveniles settle near oecobiid nests and then ambush oecobiids as they leave or enter the nest. Two or more P. africana juveniles sometimes settle at the same nest and, when an oecobiid is captured, the P. africana juveniles may share the meal. We investigated the joining decisions made by naïve P. africana juveniles. Experiments were based on using lures (dead spiders positioned in lifelike posture) arranged in a series of 17 different scenes defined by the presence/absence of a nest, the lure types present and the configuration of the lures and the nest. Our findings imply that P. africana juveniles make remarkably precise predatory decisions, with the variables that matter including whether a nest is present, the identity of spiders inside and outside a nest and how spiders are positioned relative to each other and the nest.

A Comparison of the Pitfall Trap, Winkler Extractor and Berlese Funnel for Sampling Ground-Dwelling Arthropods in Tropical Montane Cloud Forests

Science.gov (United States)

Sabu, Thomas K.; Shiju, Raj T.; Vinod, KV.; Nithya, S.

2011-01-01

Little is known about the ground-dwelling arthropod diversity in tropical montane cloud forests (TMCF). Due to unique habitat conditions in TMCFs with continuously wet substrates and a waterlogged forest floor along with the innate biases of the pitfall trap, Berlese funnel and Winkler extractor are certain to make it difficult to choose the most appropriate method to sample the ground-dwelling arthropods in TMCFs. Among the three methods, the Winkler extractor was the most efficient method for quantitative data and pitfall trapping for qualitative data for most groups. Inclusion of floatation method as a complementary method along with the Winkler extractor would enable a comprehensive quantitative survey of ground-dwelling arthropods. Pitfall trapping is essential for both quantitative and qualitative sampling of Diplopoda, Opiliones, Orthoptera, and Diptera. The Winkler extractor was the best quantitative method for Psocoptera, Araneae, Isopoda, and Formicidae; and the Berlese funnel was best for Collembola and Chilopoda. For larval forms of different insect orders and the Acari, all the three methods were equally effective. PMID:21529148

Spiders of Kerala Agricultural University Campus, Thrissur, Kerala, India

Directory of Open Access Journals (Sweden)

C. K. Adarsh

2015-12-01

Full Text Available A total of 86 species of spiders belonging to 56 genera of 20 families have been recorded from the Kerala Agricultural University (KAU campus, Thrissur, Kerala, southern India.  This represents 5.1% of the total spiders’ species and 33.33% of the total families of spiders recorded in India.  The dominant spider family at KAU campus is Araneidae with 18 species of nine genera. Salticidae is represented by 14 species of 13 genera.  Out of 252 endemic spiders of India, 16 have been reported from KAU campus.  Guild structure analysis shows spiders belonging to seven types of feeding guilds present in KAU campus.  Orb-web builders are the dominant feeding guild accounting for 34%, followed by stalkers (22%, ground runners (20%, ambushers (8%, scattered line weavers (8%, foliage runners (7% and sheet-web builders (1%. 

VIPR III VADR SPIDER Structural Design and Analysis

Science.gov (United States)

Li, Wesley; Chen, Tony

2016-01-01

In support of the National Aeronautics and Space Administration (NASA) Vehicle Integrated Propulsion Research (VIPR) Phase III team to evaluate the volcanic ash environment effects on the Pratt & Whitney F117-PW-100 turbofan engine, NASA Armstrong Flight Research Center has successfully performed structural design and analysis on the Volcanic Ash Distribution Rig (VADR) and the Structural Particulate Integration Device for Engine Research (SPIDER) for the ash ingestion test. Static and dynamic load analyses were performed to ensure no structural failure would occur during the test. Modal analysis was conducted, and the results were used to develop engine power setting avoidance zones. These engine power setting avoidance zones were defined to minimize the dwell time when the natural frequencies of the VADR/SPIDER system coincided with the excitation frequencies of the engine which was operating at various revolutions per minute. Vortex-induced vibration due to engine suction air flow during the ingestion test was also evaluated, but was not a concern.

Deer herbivory reduces web-building spider abundance by simplifying forest vegetation structure

Directory of Open Access Journals (Sweden)

Elizabeth J. Roberson

2016-09-01

Full Text Available Indirect ecological effects are a common feature of ecological systems, arising when one species affects interactions among two or more other species. We examined how browsing by white-tailed deer (Odocoileus virginianus indirectly affected the abundance and composition of a web-building spider guild through their effects on the structure of the ground and shrub layers of northern hardwood forests. We examined paired plots consisting of deer-free and control plots in the Allegheny Plateau region Pennsylvania and Northern Highlands region of Wisconsin. We recorded the abundance of seven types of webs, each corresponding to a family of web-building spiders. We quantified vegetation structure and habitat suitability for the spiders by computing a web scaffold availability index (WSAI at 0.5 m and 1.0 m above the ground. At Northern Highlands sites, we recorded prey availability. Spider webs were twice as abundant in deer-free plots compared to control plots, while WSAI was 7–12 times greater in deerfree plots. Prey availability was lower in deer-free plots. With the exception of funnel web-builders, all spider web types were significantly more abundant in deer-free plots. Both deer exclusion and the geographic region of plots were significant predictors of spider community structure. In closed canopy forests with high browsing pressure, the low density of tree saplings and shrubs provides few locations for web-building spiders to anchor webs. Recruitment of these spiders may become coupled with forest disturbance events that increase tree and shrub recruitment. By modifying habitat structure, deer appear to indirectly modify arthropod food web interactions. As deer populations have increased in eastern North America over the past several decades, the effects of deer on web-building spiders may be widespread.

Spider Movement, UV Reflectance and Size, but Not Spider Crypsis, Affect the Response of Honeybees to Australian Crab Spiders

Science.gov (United States)

Llandres, Ana L.; Rodríguez-Gironés, Miguel A.

2011-01-01

According to the crypsis hypothesis, the ability of female crab spiders to change body colour and match the colour of flowers has been selected because flower visitors are less likely to detect spiders that match the colour of the flowers used as hunting platform. However, recent findings suggest that spider crypsis plays a minor role in predator detection and some studies even showed that pollinators can become attracted to flowers harbouring Australian crab spider when the UV contrast between spider and flower increases. Here we studied the response of Apis mellifera honeybees to the presence of white or yellow Thomisus spectabilis Australian crab spiders sitting on Bidens alba inflorescences and also the response of honeybees to crab spiders that we made easily detectable painting blue their forelimbs or abdomen. To account for the visual systems of crab spider's prey, we measured the reflectance properties of the spiders and inflorescences used for the experiments. We found that honeybees did not respond to the degree of matching between spiders and inflorescences (either chromatic or achromatic contrast): they responded similarly to white and yellow spiders, to control and painted spiders. However spider UV reflection, spider size and spider movement determined honeybee behaviour: the probability that honeybees landed on spider-harbouring inflorescences was greatest when the spiders were large and had high UV reflectance or when spiders were small and reflected little UV, and honeybees were more likely to reject inflorescences if spiders moved as the bee approached the inflorescence. Our study suggests that only the large, but not the small Australian crab spiders deceive their preys by reflecting UV light, and highlights the importance of other cues that elicited an anti-predator response in honeybees. PMID:21359183

Spider movement, UV reflectance and size, but not spider crypsis, affect the response of honeybees to Australian crab spiders.

Science.gov (United States)

Llandres, Ana L; Rodríguez-Gironés, Miguel A

2011-02-16

According to the crypsis hypothesis, the ability of female crab spiders to change body colour and match the colour of flowers has been selected because flower visitors are less likely to detect spiders that match the colour of the flowers used as hunting platform. However, recent findings suggest that spider crypsis plays a minor role in predator detection and some studies even showed that pollinators can become attracted to flowers harbouring Australian crab spider when the UV contrast between spider and flower increases. Here we studied the response of Apis mellifera honeybees to the presence of white or yellow Thomisus spectabilis Australian crab spiders sitting on Bidens alba inflorescences and also the response of honeybees to crab spiders that we made easily detectable painting blue their forelimbs or abdomen. To account for the visual systems of crab spider's prey, we measured the reflectance properties of the spiders and inflorescences used for the experiments. We found that honeybees did not respond to the degree of matching between spiders and inflorescences (either chromatic or achromatic contrast): they responded similarly to white and yellow spiders, to control and painted spiders. However spider UV reflection, spider size and spider movement determined honeybee behaviour: the probability that honeybees landed on spider-harbouring inflorescences was greatest when the spiders were large and had high UV reflectance or when spiders were small and reflected little UV, and honeybees were more likely to reject inflorescences if spiders moved as the bee approached the inflorescence. Our study suggests that only the large, but not the small Australian crab spiders deceive their preys by reflecting UV light, and highlights the importance of other cues that elicited an anti-predator response in honeybees.

Attentional bias to moving spiders in spider fearful individuals.

Science.gov (United States)

Vrijsen, Janna N; Fleurkens, Pascal; Nieuwboer, Wieteke; Rinck, Mike

2009-05-01

We investigated if an attentional bias for spiders in spider fearful individuals (SFs) can also be found for moving spiders, rather than static images. In Study 1, 28 SFs and 33 non-anxious controls (NACs) participated in a modified version of the dot probe paradigm: they had to react to a probe that appeared either in the next, previous, or side position of a spider's or a wheel's path. 24 SFs and 29 NACs participated in Study 2, in which a fourth, highly predictable, probe position was added. We expected that moving spiders would capture the attention of SFs. In addition, we tested whether SFs try to predict the movement of the spider to make it less threatening. As expected, SFs showed an attentional bias towards moving spiders. However, both groups reacted fastest to unpredictable movements, indicating that SFs and NACs alike anticipate unpredictable spider movements.

New species and new records of ground spiders (Araneae: Gnaphosidae) from Cyprus.

Science.gov (United States)

Chatzaki, Maria; Russell-Smith, Anthony

2017-10-04

New taxonomic data on the ground spiders of the family Gnaphosidae from the island of Cyprus are presented. Three species are proposed as new to science (Drassyllus cyprius sp. n., Setaphis mccowani sp. n., Zelotes limnatis sp. n.). The male of Synaphosus shirin Ovtsharenko, Levy & Platnick, 1994 and the female of Zelotes zekharya Levy, 2009 are described for the first time. The transfer of Zelotes helvolus (O.P. Cambridge, 1872) and Z. helvoloides Levy, 1998 (the latter not recorded in Cyprus) to Cryptodrassus is proposed. The mismatching of male and female of C. helvoloides is discussed, and the female originally described as C. helvoloides is transferred to C. helvolus. Micaria pallipes (Lucas, 1846) is here recorded and the synonymy with Castanilla marchesii Caporiacco, 1936 is rejected, while the paralectotype of Castanilla marchesii is here assigned to Leptodrassex algericus Dalmas, 1919. Finally a male Poecilochroa still not attributed to a known or new species is described.

Repeated Evolution of Power-Amplified Predatory Strikes in Trap-Jaw Spiders.

Science.gov (United States)

Wood, Hannah M; Parkinson, Dilworth Y; Griswold, Charles E; Gillespie, Rosemary G; Elias, Damian O

2016-04-25

Small animals possess intriguing morphological and behavioral traits that allow them to capture prey, including innovative structural mechanisms that produce ballistic movements by amplifying power [1-6]. Power amplification occurs when an organism produces a relatively high power output by releasing slowly stored energy almost instantaneously, resulting in movements that surpass the maximal power output of muscles [7]. For example, trap-jaw, power-amplified mechanisms have been described for several ant genera [5, 8], which have evolved some of the fastest known movements in the animal kingdom [6]. However, power-amplified predatory strikes were not previously known in one of the largest animal classes, the arachnids. Mecysmaucheniidae spiders, which occur only in New Zealand and southern South America, are tiny, cryptic, ground-dwelling spiders that rely on hunting rather than web-building to capture prey [9]. Analysis of high-speed video revealed that power-amplified mechanisms occur in some mecysmaucheniid species, with the fastest species being two orders of magnitude faster than the slowest species. Molecular phylogenetic analysis revealed that power-amplified cheliceral strikes have evolved four times independently within the family. Furthermore, we identified morphological innovations that directly relate to cheliceral function: a highly modified carapace in which the cheliceral muscles are oriented horizontally; modification of a cheliceral sclerite to have muscle attachments; and, in the power-amplified species, a thicker clypeus and clypeal apodemes. These structural innovations may have set the stage for the parallel evolution of ballistic predatory strikes. Copyright © 2016 Elsevier Ltd. All rights reserved.

Factors that influence the beta-diversity of spider communities in northwestern Argentinean Grasslands

Directory of Open Access Journals (Sweden)

Sandra M. Rodriguez-Artigas

2016-04-01

Full Text Available Beta-diversity, defined as spatial replacement in species composition, is crucial to the understanding of how local communities assemble. These changes can be driven by environmental or geographic factors (such as geographic distance, or a combination of the two. Spiders have been shown to be good indicators of environmental quality. Accordingly, spiders are used in this work as model taxa to establish whether there is a decrease in community similarity that corresponds to geographic distance in the grasslands of the Campos & Malezales ecoregion (Corrientes. Furthermore, the influence of climactic factors and local vegetation heterogeneity (environmental factors on assemblage composition was evaluated. Finally, this study evaluated whether the differential dispersal capacity of spider families is a factor that influences their community structure at a regional scale. Spiders were collected with a G-Vac from vegetation in six grassland sites in the Campos & Malezales ecoregion that were separated by a minimum of 13 km. With this data, the impact of alpha-diversity and different environmental variables on the beta-diversity of spider communities was analysed. Likewise, the importance of species replacement and nesting on beta-diversity and their contribution to the regional diversity of spider families with different dispersion capacities was evaluated. The regional and site-specific inventories obtained were complete. The similarity between spider communities declined as the geographic distance between sites increased. Environmental variables also influenced community composition; stochastic events and abiotic forces were the principal intervening factors in assembly structure. The differential dispersal capacity of spider groups also influenced community structure at a regional scale. The regional beta-diversity, as well as species replacement, was greater in high and intermediate vagility spiders; while nesting was greater in spiders with low

Interactive effects of fire and large herbivores on web-building spiders.

Science.gov (United States)

Foster, C N; Barton, P S; Wood, J T; Lindenmayer, D B

2015-09-01

Altered disturbance regimes are a major driver of biodiversity loss worldwide. Maintaining or re-creating natural disturbance regimes is therefore the focus of many conservation programmes. A key challenge, however, is to understand how co-occurring disturbances interact to affect biodiversity. We experimentally tested for the interactive effects of prescribed fire and large macropod herbivores on the web-building spider assemblage of a eucalypt forest understorey and investigated the role of vegetation in mediating these effects using path analysis. Fire had strong negative effects on the density of web-building spiders, which were partly mediated by effects on vegetation structure, while negative effects of large herbivores on web density were not related to changes in vegetation. Fire amplified the effects of large herbivores on spiders, both via vegetation-mediated pathways and by increasing herbivore activity. The importance of vegetation-mediated pathways and fire-herbivore interactions differed for web density and richness and also differed between web types. Our results demonstrate that for some groups of web-building spiders, the effects of co-occurring disturbance drivers may be mostly additive, whereas for other groups, interactions between drivers can amplify disturbance effects. In our study system, the use of prescribed fire in the presence of high densities of herbivores could lead to reduced densities and altered composition of web-building spiders, with potential cascading effects through the arthropod food web. Our study highlights the importance of considering both the independent and interactive effects of disturbances, as well as the mechanisms driving their effects, in the management of disturbance regimes.

Exposure to Radon in Dwellings in the Area of Zagreb

International Nuclear Information System (INIS)

Lokobauer, N.; Franic, Z.; Petroci, Lj.; Sokolovic, E.; Lokner, V.

1998-01-01

Until the 1970s radon and its progeny were regarded as radiation health hazards encountered only in the mining and processing of uranium ore. This notion has dramatically changed as a result of increasing efforts made by many countries to measure radon in dwellings. Since it has been assessed that radon constitutes on average about 53% of the human exposure to natural radiation (UNSCEAR 1993), attention to the problem of exposure to radon and associated health risk has been growing in both developed and developing countries. This paper deals with the investigations of indoor radon activity concentrations at selected dwellings in the area of Zagreb. The fact that concentration of indoor radon depends strongly on radium sources in the soil pointed to the possibility that increased radon levels could be measured in the ground floor dwellings. The measurements of indoor radon performed by Honeywell professional radon monitor in the 30 ground floor dwellings, and at same location in 10 dwellings on higher floors. In order to obtain average daily values, radon activity concentrations were measured throughout 24 hours at each dwelling, over the seasons spring-summer and autumn-winter. In the season spring-summer radon activity concentrations in the ground floor dwellings ranged from 22±5 to 133±12 Bqm -3 (mean value 56±31 Bqm -3 ) and in the season autumn-winter ranged from 22±5 to 311±18 Bqm -3 (mean value 94±64 Bqm -3 ). In the dwellings on higher floors radon activity concentrations in the season spring-summer ranged from 11±3 to 78±9 Bqm -3 (mean value 32±21 Bqm -3 ), and in the season autumn-winter ranged from 30±5 to 137±12 Bqm -3 (mean value 60±32 Bqm -3 ). Average annual radon activity concentration for the 30 investigated ground floor dwellings were 75±45 Bqm -3 , and 46±26 Bqm -3 for the 10 dwellings on higher floors. Investigations performed in the dwellings in the area of Zagreb revealed significant differences in radon levels between the ground

Ground beetle (Coleoptera, Carabidae) assemblages inhabiting Scots pine stands of Puszcza Piska Forest: six-year responses to a tornado impact.

Science.gov (United States)

Skłodowski, Jarosław; Garbalińska, Paulina

2011-01-01

Ground beetle assemblages were studied during 2003-08 in the Pisz Forest by comparing stands disturbed by a tornado to undisturbed control stands. The following exploratory questions were put forward. (1) How do the carabid assemblages change during six years following the tornado impact? (2) Does the carabid assemblage recovery begin during the six first post-tornado years? To assess the state of carabid assemblages we used two indices: the MIB (Mean Individual Biomass) and the SPC (Sum of Progressive Characteristics). Carabid assemblages in the disturbed and in the control stands, as expressed by these two indices, were compared using the length of a regression distance (sample distance in a MIB:SPC coordinate system). A cluster analysis revealed that the assemblages of the disturbed and the control stands were different. The tornado-impacted stands produced lower carabid catch rates, but species richness was significantly higher there than in the control stands. They hosted lower proportions of individuals of European species, of large zoophages, and of forest and brachypterous species, than the control stands. The observed reduction in SPC and MIB, and an increase in the regression distances may indicate that the carabid assemblages had not started to recover from the tornado-caused disturbance. Carabid assemblages apparently responded to the tornado in two steps. Firstly, the first three years were characterized by moderate decreases of index values. Secondly, from the fourth to the sixth year after the tornado, many observed changes became magnified. We did not observe clear signals of the recovery of forest carabid assemblages during the six follow-up years.

The changing use of the ovipositor in host shifts by ichneumonid ectoparasitoids of spiders (Hymenoptera, Ichneumonidae, Pimplinae

Directory of Open Access Journals (Sweden)

Takasuka Keizo

2018-01-01

Full Text Available Accurate egg placement into or onto a living host is an essential ability for many parasitoids, and changes in associated phenotypes, such as ovipositor morphology and behaviour, correlate with significant host shifts. Here, we report that in the ichneumonid group of koinobiont spider-ectoparasitoids (“polysphinctines”, several putatively ancestral taxa (clade I here, parasitic on ground-dwelling RTA-spiders (a group characterised by retrolateral tibial apophysis on male palpal tibiae, lay their eggs in a specific way. They tightly bend their metasoma above the spider’s cephalothorax, touching the carapace with the dorsal side of the ovipositor apically (“dorsal-press”. The egg slips out from the middle part of the ventral side of the ovipositor and moves towards its apex with the parted lower valves acting as rails. Deposition occurs as the parasitoid draws the ovipositor backwards from under the egg. Oviposition upon the tough carapace of the cephalothorax, presumably less palatable than the abdomen, is conserved in these taxa, and presumed adaptive through avoiding physical damage to the developing parasitoid. This specific way of oviposition is reversed in the putatively derived clade of polysphinctines (clade II here parasitic on Araneoidea spiders with aerial webs, which is already known. They bend their metasoma along the spider’s abdomen, grasping the abdomen with their fore/mid legs, pressing the ventral tip of the metasoma and the lower valves of the ovipositor against the abdomen (“ventral-press”. The egg is expelled through an expansion of the lower valves, which is developed only in this clade and evident in most species, onto the softer and presumably more nutritious abdomen.

Evolutionary morphology of the hemolymph vascular system of basal araneomorph spiders (Araneae: Araneomorphae).

Science.gov (United States)

Huckstorf, Katarina; Michalik, Peter; Ramírez, Martín; Wirkner, Christian S

2015-11-01

The superfamily Austrochiloidea (Austrochilidae and Gradungulidae) take a pivotal position in araneomorph spider phylogeny. In this discussion crevice weaver spiders (Filistatidae) are of equal interest. Especially data from these phylogenetically uncertain yet basal off branching groups can enlighten our understanding on the evolution of organ systems. In the course of a survey on the evolutionary morphology of the circulatory system in spiders we therefore investigated the hemolymph vascular system in two austrochiloid and one filistatid species. Additionally some data on a hypochilid and a gradungulid species are included. Using up-to-date morphological methods, the vascular systems in these spiders are visualized three dimensionally. Ground pattern features of the circulatory systems in austrochiloid spiders are presented and the data discussed along recent lines of phylogenetic hypotheses. Special topics highlighted are the intraspecific variability of the origins of some prosomal arteries and the evolutionary correlation of respiratory and circulatory systems in spiders. Copyright © 2015 Elsevier Ltd. All rights reserved.

Declines in a ground-dwelling arthropod community during an invasion by Sahara mustard (Brassica tournefortii) in aeolian sand habitats

Science.gov (United States)

Heather L. Hulton VanTassel; Anne M. Hansen; Cameron W. Barrows; Quresh Latif; Margaret W. Simon; Kurt E. Anderson

2014-01-01

Sahara Mustard (Brassica tournefortii; hereafter mustard), an exotic plant species, has invaded habitats throughout the arid southwestern United States. Mustard has reached high densities across aeolian sand habitats of southwestern deserts, including five distinct sand habitats in the eastern Coachella Valley, California. We examined trends in ground-dwelling...

Spiders in dermatology.

Science.gov (United States)

Kang, Jun K; Bhate, Chinmoy; Schwartz, Robert A

2014-09-01

Spider bites represent an unusual and potentially over-represented clinical diagnosis. Despite a common fear of spiders, known as arachnophobia, current knowledge suggests that only a small number of families within the order Araneae are medically relevant. Moreover, most cutaneous spider reactions, including both evenomations and physical trauma, produce mild, local symptoms which may be managed with supportive care alone. The differential diagnosis for spider bites may be broad, especially if the offending arachnid is not seen or found. We describe a series of spiders relevant to the dermatologist in the United States.

Specialised use of working memory by Portia africana, a spider-eating salticid.

Science.gov (United States)

Cross, Fiona R; Jackson, Robert R

2014-03-01

Using expectancy-violation methods, we investigated the role of working memory in the predatory strategy of Portia africana, a salticid spider from Kenya that preys by preference on other spiders. One of this predator's tactics is to launch opportunistic leaping attacks on to other spiders in their webs. Focussing on this particular tactic, our experiments began with a test spider on a ramp facing a lure (dead prey spider mounted on a cork disc) that could be reached by leaping. After the test spider faced the lure for 30 s, we blocked the test spider's view of the lure by lowering an opaque shutter before the spider leapt. When the shutter was raised 90 s later, either the same lure came into view again (control) or a different lure came into view (experimental: different prey type in same orientation or same prey type in different orientation). We recorded attack frequency (number of test spiders that leapt at the lure) and attack latency (time elapsing between shutter being raised and spiders initiating a leap). Attack latencies in control trials were not significantly different from attack latencies in experimental trials, regardless of whether it was prey type or prey orientation that changed in the experimental trials. However, compared with test spiders in the no-change control trials, significantly fewer test spiders leapt when prey type changed. There was no significant effect on attack frequency when prey orientation changed. These findings suggest that this predator represents prey type independently of prey orientation.

Molecular phylogeny of moth-specialized spider sub-family Cyrtarachninae, which includes bolas spiders.

Science.gov (United States)

Tanikawa, Akio; Shinkai, Akira; Miyashita, Tadashi

2014-11-01

The evolutionary process of the unique web architectures of spiders of the sub-family Cyrtarachninae, which includes the triangular web weaver, bolas spider, and webless spider, is thought to be derived from reduction of orbicular 'spanning-thread webs' resembling ordinal orb webs. A molecular phylogenetic analysis was conducted to explore this hypothesis using orbicular web spiders Cyrtarachne, Paraplectana, Poecilopachys, triangular web spider Pasilobus, bolas spiders Ordgarius and Mastophora, and webless spider Celaenia. The phylogeny inferred from partial sequences of mt-COI, nuclear 18S-rRNA and 28S-rRNA showed that the common ancestor of these spiders diverged into two clades: a spanning-thread web clade and a bolas or webless clade. This finding suggests that the triangular web evolved by reduction of an orbicular spanning web, but that bolas spiders evolved in the early stage, which does not support the gradual web reduction hypothesis.

Application of 3 kinds of practical electromagnetic spiders in electromagnetic spider web

Directory of Open Access Journals (Sweden)

Jiang Min

2016-01-01

Full Text Available Electromagnetic spider web the launch circuit has introduced a lot, but in the center position of the utility of the spider generally have 3 kinds of circuits respectively, the use of single-chip microcomputer circuit of the low energy consumption spider by multi-channel transmission, single circuit receiver circuit. Direct use of the 3 channels of the spider and the use of PLC circuit spider, depending on the actual situation were placed.

Application of 3 kinds of practical electromagnetic spiders in electromagnetic spider web

OpenAIRE

Jiang Min

2016-01-01

Electromagnetic spider web the launch circuit has introduced a lot, but in the center position of the utility of the spider generally have 3 kinds of circuits respectively, the use of single-chip microcomputer circuit of the low energy consumption spider by multi-channel transmission, single circuit receiver circuit. Direct use of the 3 channels of the spider and the use of PLC circuit spider, depending on the actual situation were placed.

Spider Vein Removal

Science.gov (United States)

Spider veins: How are they removed? I have spider veins on my legs. What options are available ... M.D. Several options are available to remove spider veins — thin red lines or weblike networks of ...

Changes in ground beetle assemblages above and below the treeline of the Dolomites after almost 30 years (1980/2009)

OpenAIRE

Pizzolotto, Roberto; Gobbi, Mauro; Brandmayr, Pietro

2014-01-01

Very little is known about the changes of ground beetle assemblages in the last few decades in the Alps, and different responses to climate change of animal populations living above and below the treeline have not been estimated yet. This study focuses on an altitudinal habitat sequence from subalpine spruce forest to alpine grassland in a low disturbance area of the southeastern Dolomites in Italy, the Paneveggio Regional Park. We compared the ground beetle (Carabidae) populations sampled in...

Short-term response of ground-dwelling arthropods to prescribed fire and mechanical fuel reduction in a Southern Appalachian upland hardwood forest

Science.gov (United States)

Cathryn H. Greenberg; T.G. Forrest; Thomas. Waldrop

2010-01-01

As part of the multidisciplinary National Fire and Fire Surrogate Study, we used drift fences with pitfall traps to determine how three fuel reduction treatments affected ground-dwelling macroarthropods in the southern Appalachian Mountains of North Carolina. Four experimental units, each

Recreational Trails Reduce the Density of Ground-Dwelling Birds in Protected Areas

Science.gov (United States)

Thompson, Bill

2015-05-01

Recreational disturbance associated with trails has been identified as one of the major factors causing a decline of native biodiversity within protected areas. However, despite the negative impacts that recreation can have on biodiversity, providing public access to nature is critical for the future of the conservation of biodiversity. As such, many protected area managers are looking for tools to help maintain a balance between public access and biodiversity conservation. The objectives of this study were to examine the impacts of recreational trails on forest-dwelling bird communities in eastern North America, identify functional guilds which are particularly sensitive to recreational trails, and derive guidelines for trail design to assist in managing the impacts of recreational trails on forest-dwelling birds. Trails within 24 publicly owned natural areas were mapped, and breeding bird communities were described with the use of point count surveys. The density of forest birds, particularly of those species which nest or forage on the ground, were significantly positively influenced by the amount of trail-free refuge habitat. Although management options to control trail use in non-staffed protected areas are limited, this study suggests that protected area managers could design and maintain a trail network that would minimize impacts on resident wildlife, while providing recreational opportunities for visitors, by designing their trail network to maximize the area of trail-free habitat.

Recreational trails reduce the density of ground-dwelling birds in protected areas.

Science.gov (United States)

Thompson, Bill

2015-05-01

Recreational disturbance associated with trails has been identified as one of the major factors causing a decline of native biodiversity within protected areas. However, despite the negative impacts that recreation can have on biodiversity, providing public access to nature is critical for the future of the conservation of biodiversity. As such, many protected area managers are looking for tools to help maintain a balance between public access and biodiversity conservation. The objectives of this study were to examine the impacts of recreational trails on forest-dwelling bird communities in eastern North America, identify functional guilds which are particularly sensitive to recreational trails, and derive guidelines for trail design to assist in managing the impacts of recreational trails on forest-dwelling birds. Trails within 24 publicly owned natural areas were mapped, and breeding bird communities were described with the use of point count surveys. The density of forest birds, particularly of those species which nest or forage on the ground, were significantly positively influenced by the amount of trail-free refuge habitat. Although management options to control trail use in non-staffed protected areas are limited, this study suggests that protected area managers could design and maintain a trail network that would minimize impacts on resident wildlife, while providing recreational opportunities for visitors, by designing their trail network to maximize the area of trail-free habitat.

Spider Bites: First Aid

Science.gov (United States)

... care immediately if: You were bitten by a black widow or brown recluse spider You are unsure whether the bite ... in the South. Signs and symptoms of a black widow spider bite may include: At ... fever and nausea Brown recluse spider The brown recluse spider has a ...

Efficacy of Pitfall Trapping, Winkler and Berlese Extraction Methods for Measuring Ground-Dwelling Arthropods in Moist-Deciduous Forests in the Western Ghats

Science.gov (United States)

Sabu, Thomas K.; Shiju, Raj T.

2010-01-01

The present study provides data to decide on the most appropriate method for sampling of ground-dwelling arthropods measured in a moist-deciduous forest in the Western Ghats in South India. The abundance of ground-dwelling arthropods was compared among large numbers of samples obtained using pitfall trapping, Berlese and Winkler extraction methods. Highest abundance and frequency of most of the represented taxa indicated pitfall trapping as the ideal method for sampling of ground-dwelling arthropods. However, with possible bias towards surface-active taxa, pitfall-trapping data is inappropriate for quantitative studies, and Berlese extraction is the better alternative. Berlese extraction is the better method for quantitative measurements than the other two methods, whereas pitfall trapping would be appropriate for qualitative measurements. A comparison of the Berlese and Winkler extraction data shows that in a quantitative multigroup approach, Winkler extraction was inferior to Berlese extraction because the total number of arthropods caught was the lowest; and many of the taxa that were caught from an identical sample via Berlese extraction method were not caught. Significantly a greater frequency and higher abundance of arthropods belonging to Orthoptera, Blattaria, and Diptera occurred in pitfall-trapped samples and Psocoptera and Acariformes in Berlese-extracted samples than that were obtained in the other two methods, indicating that both methods are useful, one complementing the other, eliminating a chance for possible under-representation of taxa in quantitative studies. PMID:20673122

Spiders in caves.

Science.gov (United States)

Mammola, Stefano; Isaia, Marco

2017-04-26

World experts of different disciplines, from molecular biology to macro-ecology, recognize the value of cave ecosystems as ideal ecological and evolutionary laboratories. Among other subterranean taxa, spiders stand out as intriguing model organisms for their ecological role of top predators, their unique adaptations to the hypogean medium and their sensitivity to anthropogenic disturbance. As the description of the first eyeless spider ( Stalita taenaria ), an array of papers on subterranean spider biology, ecology and evolution has been published, but a comprehensive review on these topics is still lacking. We provide a general overview of the spider families recorded in hypogean habitats worldwide, we review the different adaptations of hypogean spiders to subterranean life, and we summarize the information gathered so far about their origin, population structure, ecology and conservation status. Finally, we point out the limits of the knowledge we currently have regarding hypogean spiders, aiming to stimulate future research. © 2017 The Author(s).

Characteristics of the first recorded spider (Arthropoda: Arachnida fauna from Sheringal, Khyber Pakhtunkhwa, Pakistan

Directory of Open Access Journals (Sweden)

Farzana Khan Perveen

2015-12-01

Full Text Available The spiders (order: Aranae are an important environmental indicator and play a significant role as predators in biological control of the most of the key insect pests. The present study was conducted to establish the characteristics of the first recorded spider fauna from Sheringal, Dir Upper (DU, Khyber Pakhtunkhwa (KP, Pakistan during June 2013-July 2014. Their 10 species belong to 7 families, and 10 genera (nt=123: total; ni=77: identified; nui=46: unidentified were recorded in the 6 quadrates, i.e., Daramdala, Doki, Guryaal, Samang, Shahoor and Sia-Sheringal of Sheringal. The largest family was Lycosidae (wolf spiders with respect to size and numbers of specimens collected (n=20, which contained Arctosa littorali Simon, 1897; Hippasa partita Takidar, 1970; Pardosa distincta Backwall, 1867, while the smallest family was Gnphosidae (ground spiders (n=3 with Gnaphosa eucalyptus Ghafoor and Beg, 2002; while other families Sparassidae (huntsman spiders (n=19 Halconia insignis Thorell, 1836, and Isopeda tuhogniga Barrion and Litsinger, 1995, Opilionidae (harvestmen spiders (n=12 Hadrobunus grandis Sundevall, 1833; Pholcidae (cellar spider (n=10 have Crossopriza lyoni Blackwall, 1867; Hersiliidae (two-tailed spiders (n=6 is having Harsilia savignyi Lucas, 1836; (n=5 with Araneus diadematus Clerck, 1757 were recorded. It was concluded that 50% of the spiders collected from the study area were venomous. A detail study is required for further exploration of spider fauna of Sheringal, KP, Pakistan with special reference to their taxonomical, physiological and ecological characteristics.

Assessing habitat connectivity for ground-dwelling animals in an urban environment.

Science.gov (United States)

Braaker, S; Moretti, M; Boesch, R; Ghazoul, J; Obrist, M K; Bontadina, F

To ensure viable species populations in fragmented landscapes, individuals must be able to move between suitable habitat patches. Despite the increased interest in biodiversity assessment in urban environments, the ecological relevance of habitat connectivity in highly fragmented landscapes remains largely unknown. The first step to understanding the role of habitat connectivity in urban ecology is the challenging task of assessing connectivity in the complex patchwork of contrasting habitats that is found in cities. We developed a data-based framework, minimizing the use of subjective assumptions, to assess habitat connectivity that consists of the following sequential steps: (1) identification of habitat preference based on empirical habitat-use data; (2) derivation of habitat resistance surfaces evaluating various transformation functions; (3) modeling of different connectivity maps with electrical circuit theory (Circuitscape), a method considering all possible pathways across the landscape simultaneously; and (4) identification of the best connectivity map with information-theoretic model selection. We applied this analytical framework to assess habitat connectivity for the European hedgehog Erinaceus europaeus, a model species for ground-dwelling animals, in the city of Zurich, Switzerland, using GPS track points from 40 individuals. The best model revealed spatially explicit connectivity “pinch points,” as well as multiple habitat connections. Cross-validation indicated the general validity of the selected connectivity model. The results show that both habitat connectivity and habitat quality affect the movement of urban hedgehogs (relative importance of the two variables was 19.2% and 80.8%, respectively), and are thus both relevant for predicting urban animal movements. Our study demonstrates that even in the complex habitat patchwork of cities, habitat connectivity plays a major role for ground-dwelling animal movement. Data-based habitat connectivity

Geophagy in brown spider monkeys (Ateles hybridus) in a lowland tropical rainforest in Colombia.

Science.gov (United States)

Link, Andres; de Luna, Ana Gabriela; Arango, Ricardo; Diaz, Maria Clara

2011-01-01

Spider monkeys and howler monkeys are the only Neotropical primates that eat soil from mineral licks. Not all species within these genera visit mineral licks, and geophagy has been restricted to populations of Ateles belzebuth belzebuth,Ateles belzebuth chamek and Alouatta seniculus in western Amazonian rainforests. With the aid of a camera trap we studied the visitation patterns of a group of brown spider monkeys (Ateles hybridus) to a mineral lick at Serrania de Las Quinchas, in Colombia. Spider monkeys visited the lick frequently throughout the year, with a monthly average of 21.7 ± 7.2 visits per 100 days of camera trapping (n = 14 months). Spider monkeys visited the mineral lick almost always on days with no rain, or very little (<3 mm) rain, suggesting that proximate environmental variables might determine spider monkeys' decisions to come to the ground at the licks. This study expands the geographical occurrence of mineral lick use by spider monkeys providing additional data for future assessments on the biogeographical correlates of mineral lick use by platyrrhines. Copyright © 2011 S. Karger AG, Basel.

Hunting with sticky tape: functional shift in silk glands of araneophagous ground spiders (Gnaphosidae).

Science.gov (United States)

Wolff, Jonas O; Řezáč, Milan; Krejčí, Tomáš; Gorb, Stanislav N

2017-06-15

Foraging is one of the main evolutionary driving forces shaping the phenotype of organisms. In predators, a significant, though understudied, cost of foraging is the risk of being injured by struggling prey. Hunting spiders that feed on dangerous prey like ants or other spiders are an extreme example of dangerous feeding, risking their own life over a meal. Here, we describe an intriguing example of the use of attachment silk (piriform silk) for prey immobilization that comes with the costs of reduced silk anchorage function, increased piriform silk production and additional modifications of the extrusion structures (spigots) to prevent their clogging. We show that the piriform silk of gnaphosids is very stretchy and tough, which is an outstanding feat for a functional glue. This is gained by the combination of an elastic central fibre and a bi-layered glue coat consisting of aligned nanofibrils. This represents the first tensile test data on the ubiquitous piriform gland silk, adding an important puzzle piece to the mechanical catalogue of silken products in spiders. © 2017. Published by The Company of Biologists Ltd.

Respiration in spiders (Araneae).

Science.gov (United States)

Schmitz, Anke

2016-05-01

Spiders (Araneae) are unique regarding their respiratory system: they are the only animal group that breathe simultaneously with lungs and tracheae. Looking at the physiology of respiration the existence of tracheae plays an important role in spiders with a well-developed tracheal system. Other factors as sex, life time, type of prey capture and the high ability to gain energy anaerobically influence the resting and the active metabolic rate intensely. Most spiders have metabolic rates that are much lower than expected from body mass; but especially those with two pairs of lungs. Males normally have higher resting rates than females; spiders that are less evolved and possess a cribellum have lower metabolic rates than higher evolved species. Freely hunting spiders show a higher energy turnover than spiders hunting with a web. Spiders that live longer than 1 year will have lower metabolic rates than those species that die after 1 year in which development and reproduction must be completed. Lower temperatures and starvation, which most spiders can cope with, will decrease the metabolic rate as well.

Exploring of the first recorded spider (Arachenida: Aranae species of Sheringal, Khyber Pakhtunkhwa, Pakistan

Directory of Open Access Journals (Sweden)

Farzana Perveen

2015-09-01

Full Text Available The spiders (Arthropoada: Arachenida are one of the groups of grasping animals. Their carapaces are found on the dorsal side of the cephalothorax, which is an important characteristic of spiders. The present study was conducted to explore the first recorded spider species (nti=75 of Sheringal, Dir Upper (DU, Khyber Pakhtunkhwa (KP, Dir Upper, Khyber Pakhtunkhwa, Pakistan. The 10 genera with 10 species under 7 families were recorded from June 2013-July 2014. According to length of legs, the largest spider was the huntsman spider, Halconia insignis Thorell having length of the first leg was 1.9±0.20, however, the same of the last leg was 1.44±0.25 (n=9. In the same contest, the smallest spider was the ground spider, Gnaphosa eucalyptus Ghafoor and Beg having length of the first leg was 0.4±0.08, while the same of the last leg was 0.4±0.08 (n=3. According to length of cephalothorax and abdomen, the largest spider was the wolf spider, Hippasa partita Takidar having length of the cephalothorax was 1.1±0.01, however, the same of the abdomen was 0.7±0.1 (n=6. In the same contest, the smallest spider was the harvestmen, Hadrobunus grandis Sundevall having length of the cephalothorax was 0.1±0.04, while the same of the abdomen was 0.3±0.04 (n=12. During present research, 10 spider species of Sheringal with different sizes were explored. The present research will be useful to educate and create awareness about spiders in the people of Sheringal.

Tarantula spider

Science.gov (United States)

... page: //medlineplus.gov/ency/article/002855.htm Tarantula spider bite To use the sharing features on this ... This article describes the effects of a tarantula spider bite. The class of insects to which the ...

Initial response of small ground-dwelling mammals to forest alternative buffers along headwater streams in the Washington Coast Range, USA

Science.gov (United States)

Randall J. Wilk; Martin G. Raphael; Christopher S. Nations; Jeffrey D. Ricklefs

2010-01-01

We assessed the short-term effects of alternative designs of forested buffer treatments along headwater streams on small ground-dwelling mammals in managed forests in western Washington, USA. Over three summers (one pretreatment and two posttreatment), we trapped 19 mammalian species along 23 streams in the northern Coast Range. We compared faunal communities in...

Almost a spider: a 305-million-year-old fossil arachnid and spider origins.

Science.gov (United States)

Garwood, Russell J; Dunlop, Jason A; Selden, Paul A; Spencer, Alan R T; Atwood, Robert C; Vo, Nghia T; Drakopoulos, Michael

2016-03-30

Spiders are an important animal group, with a long history. Details of their origins remain limited, with little knowledge of their stem group, and no insights into the sequence of character acquisition during spider evolution. We describe a new fossil arachnid, Idmonarachne brasierigen. et sp. nov. from the Late Carboniferous (Stephanian,ca 305-299 Ma) of Montceau-les-Mines, France. It is three-dimensionally preserved within a siderite concretion, allowing both laboratory- and synchrotron-based phase-contrast computed tomography reconstruction. The latter is a first for siderite-hosted fossils and has allowed us to investigate fine anatomical details. Although distinctly spider-like in habitus, this remarkable fossil lacks a key diagnostic character of Araneae: spinnerets on the underside of the opisthosoma. It also lacks a flagelliform telson found in the recently recognized, spider-related, Devonian-Permian Uraraneida. Cladistic analysis resolves our new fossil as sister group to the spiders: the spider stem-group comprises the uraraneids and I. brasieri While we are unable to demonstrate the presence of spigots in this fossil, the recovered phylogeny suggests the earliest character to evolve on the spider stem-group is the secretion of silk. This would have been followed by the loss of a flagelliform telson, and then the ability to spin silk using spinnerets. This last innovation defines the true spiders, significantly post-dates the origins of silk, and may be a key to the group's success. The Montceau-les-Mines locality has previously yielded a mesothele spider (with spinnerets). Evidently, Late Palaeozoic spiders lived alongside Palaeozoic arachnid grades which approached the spider condition, but did not express the full suite of crown-group autapomorphies. © 2016 The Authors.

Radon in Norwegian dwellings

International Nuclear Information System (INIS)

Strand, T.; Green, B.M.R; Lomas, P.R.; Mangnus, K.; Stranden, E.

1991-01-01

Measurements of radon in indoor air have been made in a total of about 7500 randomly selected dwellings in Norway from all parts of the country. The number of selected dwellings in each municipality is about proportional to its population, except for the two largest municipalities, Oslo and Bergen, where somewhat smaller samples were taken due to the higher population density. The measurements were performed by nuclear track detectors from the National Radiological Protection Boards in United Kingdom, and the integration time for the measurements was 6 months. The detectors were spread evenly over all seasons of the year to eliminate influence from seasonal variation in the radon level. One single measurement was performed in each dwelling: in the main bedroom. The results shows that the distribution of radon concentrations in Norwegian bedrooms is log-normal. The aritmetic mean of the measurements, including all categories of dwellings, is calculated to be 51 Bq/m 3 and the corresponding geometric mean to be 26 Bq/m 3 . In a large proportion of single-family houses the living room and the kitchen are located on the ground floor while the bedrooms are located one floor higher. The results of the study shows that the radon level is somewhat higher at the ground floor than on the first floor, and higher in the basement than on the first floor. Taking this into account, and assuming that measurements in bedrooms on the first floor is a representative average for living room and kitchen, the average radon concentration for Norwegian dwellings is estimated to be between 55-65 Bq/m 3 . In this estimate, possible influences of the fact that the winters 87/88 and 88/89 were much warmer than normal and may therefor have lowered the results, has been taken into account. 15 refs., 9 figs., 15 tabs

Verified spider bites in Oregon (USA) with the intent to assess hobo spider venom toxicity.

Science.gov (United States)

McKeown, Nathanael; Vetter, Richard S; Hendrickson, Robert G

2014-06-01

This study compiled 33 verified spider bites from the state of Oregon (USA). The initial goal was to amass a series of bites by the hobo spider to assess whether it possesses toxic venom, a supposition which is currently in a contested state. None of the 33 bites from several spider species developed significant medical symptoms nor did dermonecrosis occur. The most common biters were the yellow sac spider, Cheiracanthium mildei (N = 10) and orb-weavers of the genus Araneus (N = 6). There were 10 bites from three genera of funnel web spiders of the family Agelenidae including one hobo spider bite and one from the congeneric giant house spider which is readily confused as a hobo spider. The hobo spider bite resulted in pain, redness, twitching in the calf muscle and resolved in 12 h. Also generated from this study were possibly the first records of bites from spiders of the genera Callobius (Amaurobiidae) and Antrodiaetus (Antrodiaetidae), both with minor manifestations. Published by Elsevier Ltd.

Comparison of ground beetle (Coleoptera: Carabidae) assemblages in Rocky Mountain savannas invaded and un-invaded by an exotic forb, spotted knapweed

Science.gov (United States)

Allison K. Hansen; Yvette K. Ortega; Diana L. Six

2009-01-01

We compared ground beetle (Carabidae) assemblages between spotted knapweed (Centaurea maculosa Lam.) -invaded (invaded) and un-invaded (native) habitats in Rocky Mountain savannas. Carabids play important roles in biotic communities and are known as a good indictor group of environmental change. Carabid species activity-abundance and diversity were estimated, and...

Funnel-web spider bite

Science.gov (United States)

... page: //medlineplus.gov/ency/article/002844.htm Funnel-web spider bite To use the sharing features on ... the effects of a bite from the funnel-web spider. Male funnel-web spiders are more poisonous ...

Spider Bites (For Parents)

Science.gov (United States)

... Videos for Educators Search English Español First Aid: Spider Bites KidsHealth / For Parents / First Aid: Spider Bites ... rare. Signs and Symptoms Of a brown recluse spider bite: red blister in the center with surrounding ...

Flee or fight: ontogenetic changes in the behavior of cobweb spiders in encounters with spider-hunting wasps.

Science.gov (United States)

Uma, Divya B; Weiss, Martha R

2012-12-01

An animal's body size plays a predominant role in shaping its interspecific interactions, and, in encounters between two predators, often determines which shall be predator and which shall be prey. Spiders are top predators of insects, yet can fall prey to mud-dauber wasps that provision their larval nests with paralyzed spiders. Here we examined predator-prey interactions between Chalybion californicum (Saussure) (Sphecidae), a mud-dauber wasp, and Parasteatoda tepidariorum C. L. Koch (Theridiidae), a cobweb spider. We examined whether a spider's size influences its response to an attacking wasp, and report a size-dependent change in spider behavior: small-sized spiders fled, whereas medium- and large-sized spiders fought in response to wasp attacks. From the wasps' perspective, we examined whether spider size influences a wasp's hunting behavior and capture success. We found that wasps commonly approached small spiders, but were much less likely to approach medium and large spiders. However, wasp capture success did not vary with spider size. We also report a strategy used by Chalybion wasps toward cobweb spiders that is consistent with an interpretation of aggressive mimicry.

SPIDER SILK

Directory of Open Access Journals (Sweden)

PORAV Viorica

2014-05-01

Full Text Available The strengthness and toughness of spider fiber and its multifunctional nature is only surpassed in some cases by synthetic high performance fibers. In the world of natural fibers, spider silk has been long time recognized as a wonder fiber for its unique combination of high strength and rupture elongation. Scientists in civil military engineering reveal that the power of biological material (spider silk lies in the geometric configuration of structural protein, and the small cluster of week hydrogen bonds that works together to resist force and dissipate energy. Each spider and each type of silk has a set of mechanical properties optimized for their biological function. Most silks, in particular deagline silk, have exceptional mechanical properties. They exhibit a unique combination of high tensile strength and extensibility (ductility. This enables a silk fiber to absorb a lot of energy before breaking (toughness, the area under a stress- strain curve. A frequent mistake made in the mainstream media is to confuse strength and toughness when comparing silk to other materials. As shown below in detail, weight for weight, silk is stronger than steel, but not as strong as Kevlar. Silk is,however, tougher than both.This paper inform about overview on the today trend in the world of spider silk.

Bat Predation by Spiders

Science.gov (United States)

Nyffeler, Martin; Knörnschild, Mirjam

2013-01-01

In this paper more than 50 incidences of bats being captured by spiders are reviewed. Bat-catching spiders have been reported from virtually every continent with the exception of Antarctica (∼90% of the incidences occurring in the warmer areas of the globe between latitude 30° N and 30° S). Most reports refer to the Neotropics (42% of observed incidences), Asia (28.8%), and Australia-Papua New Guinea (13.5%). Bat-catching spiders belong to the mygalomorph family Theraphosidae and the araneomorph families Nephilidae, Araneidae, and Sparassidae. In addition to this, an attack attempt by a large araneomorph hunting spider of the family Pisauridae on an immature bat was witnessed. Eighty-eight percent of the reported incidences of bat catches were attributable to web-building spiders and 12% to hunting spiders. Large tropical orb-weavers of the genera Nephila and Eriophora in particular have been observed catching bats in their huge, strong orb-webs (of up to 1.5 m diameter). The majority of identifiable captured bats were small aerial insectivorous bats, belonging to the families Vespertilionidae (64%) and Emballonuridae (22%) and usually being among the most common bat species in their respective geographic area. While in some instances bats entangled in spider webs may have died of exhaustion, starvation, dehydration, and/or hyperthermia (i.e., non-predation death), there were numerous other instances where spiders were seen actively attacking, killing, and eating the captured bats (i.e., predation). This evidence suggests that spider predation on flying vertebrates is more widespread than previously assumed. PMID:23516436

Bat predation by spiders.

Science.gov (United States)

Nyffeler, Martin; Knörnschild, Mirjam

2013-01-01

In this paper more than 50 incidences of bats being captured by spiders are reviewed. Bat-catching spiders have been reported from virtually every continent with the exception of Antarctica (≈ 90% of the incidences occurring in the warmer areas of the globe between latitude 30° N and 30° S). Most reports refer to the Neotropics (42% of observed incidences), Asia (28.8%), and Australia-Papua New Guinea (13.5%). Bat-catching spiders belong to the mygalomorph family Theraphosidae and the araneomorph families Nephilidae, Araneidae, and Sparassidae. In addition to this, an attack attempt by a large araneomorph hunting spider of the family Pisauridae on an immature bat was witnessed. Eighty-eight percent of the reported incidences of bat catches were attributable to web-building spiders and 12% to hunting spiders. Large tropical orb-weavers of the genera Nephila and Eriophora in particular have been observed catching bats in their huge, strong orb-webs (of up to 1.5 m diameter). The majority of identifiable captured bats were small aerial insectivorous bats, belonging to the families Vespertilionidae (64%) and Emballonuridae (22%) and usually being among the most common bat species in their respective geographic area. While in some instances bats entangled in spider webs may have died of exhaustion, starvation, dehydration, and/or hyperthermia (i.e., non-predation death), there were numerous other instances where spiders were seen actively attacking, killing, and eating the captured bats (i.e., predation). This evidence suggests that spider predation on flying vertebrates is more widespread than previously assumed.

Body burdens of metals in spiders from the Lidice coal dump near Ostrava (Czech Republic)

Energy Technology Data Exchange (ETDEWEB)

Wilczek, G.; Babczynska, A.; Majkus, Z. [Silesian University, Katowice (Poland)

2005-09-01

Spiders' feeding behaviour and external digestion expose them to man-made pollutants, especially those easily transferred along the food chain. The problem for this study was whether the levels of heavy metals in selected species of spiders from the Lidice coal dump reflect adaptation to environmental pollutants. We used flameless and flame AAS to measure the whole-body concentrations of Cd, Pb, Cu, Zn, Fe, Ni and Mg in male and female spiders differing in their hunting strategies, type of web construction, prey, and taxonomic position (Araneidae, Agelenidae, Linyphiidae, Theridiidae, Tetragnathidae, Lycosidae, Salticidae, Pisauridae, Clubionidae, Philodromidae). The levels of metals found in the spiders were species-dependent, indicating differences related to the hunting strategy and type of prey. Accumulation of Pb, Cu and Zn was always higher in ground spiders than in web-constructing species. Sheet-web spiders Linyphia triangularis and wandering spiders Clubiona lutescens had the lowest Cd, Mg and Cu content of all the studied species. Web-building spiders of the Tetragnathidae family showed the highest Cd, Cu and Pb content, even in species with feeding behaviour similar to spiders of other families. There were no interspecific differences in accumulation only for Fe and Mg. The concentrations of Cd, Ni and Pb were lower in females than in males, irrespective of their taxonomic position and the intensity of their hunting activity. This may suggest that females have better metal-excretion ability than males.

Spiders from Mars?

Science.gov (United States)

2003-01-01

MGS MOC Release No. MOC2-426, 19 July 2003No, this is not a picture of a giant, martian spider web. This Mars Global Surveyor (MGS) Mars Orbiter Camera (MOC) image shows a plethora of polygonal features on the floor of a northern hemisphere impact crater near 65.6oN, 327.7oW. The picture was acquired during spring, after the seasonal carbon dioxide frost cap had largely migrated through the region. At the time the picture was taken, remnants of seasonal frost remained on the crater rim and on the edges of the troughs that bound each of the polygons. Frost often provides a helpful hint as to where polygons and patterned ground occur. The polygons, if they were on Earth, would indicate the presence of freeze-thaw cycles in ground ice. Although uncertain, the same might be true of Mars. Sunlight illuminates the scene from the lower left.

Optimization of systems with the combination of ground-source heat pump and solar collectors in dwellings

DEFF Research Database (Denmark)

Kjellsson, Elisabeth; Hellström, Göran; Perers, Bengt

2010-01-01

The use of ground-source heat pumps for heating and domestic hot water in dwellings is common in Sweden. The combination with solar collectors has been introduced to reduce the electricity demand in the system. In order to analyze different systems with combinations of solar collectors and ground......-source heat pumps, computer simulations have been carried out with the simulation program TRNSYS. Large differences were found between the system alternatives. The optimal design is when solar heat produces domestic hot water during summertime and recharges the borehole during wintertime. The advantage...... is related to the rate of heat extraction from the borehole as well as the overall design of the system. The demand of electricity may increase with solar recharging, because of the increased operating time of the circulation pumps. Another advantage with solar heat in combination with heat pumps is when...

Radon in Norwegian dwellings

International Nuclear Information System (INIS)

Strand, T.; Green, B.M.R.; Lomas, P.R.

1992-01-01

The results of a large-scale survey of radon concentrations in Norwegian dwellings are reported. Measurements of radon have been made in a total of 7500 dwellings. The dwellings were randomly selected and the number in each municipality is proportional to its population. The measurements were performed using etched track detectors from the National Radiological Protection Board in the UK. One detector was placed in the main bedroom in each dwelling for 6 months. The annual average of radon concentration in Norwegian bedrooms is calculated to be 51 Bq.m -3 . The frequency distribution is approximately log-normal with a geometric mean of 26 Bq.m -3 and about 4% of the bedrooms have concentrations above 200 Bq.m -3 . The radon concentrations are found to be about 40% higher for bedrooms in single-family houses than in blocks of flats and other multifamily houses. In a large proportion of single-family houses the living room and the kitchen are located on the ground floor and the bedrooms on the first floor. An additional factor is that the winters of 1987-1988 and 1988-1989 were much warmer than normal. Taking these factors into account, the average radon concentration in Norwegian dwellings is estimated to be between 55 and 65 Bq.m -3 . (author)

Did You Say Spiders?

Science.gov (United States)

Campbell, Alene

This spider unit focuses on students' development of cooperative learning and inquiry-based skills. Students read "The Very Busy Spider" by Eric Carle, and then work in cooperative groups using the Internet to research and synthesize important information about spiders. Technology is used for vocabulary instruction and to create a…

Ant mimicry lessens predation on a North American jumping spider by larger salticid spiders.

Science.gov (United States)

Durkee, Caitlin A; Weiss, Martha R; Uma, Divya B

2011-10-01

Ant-like appearance (myrmecomorphy) has evolved >70 times in insects and spiders, accounting for >2,000 species of myrmecomorphic arthropods. Most myrmecomorphic spiders are considered to be Batesian mimics; that is, a palatable spider avoids predation through resemblance to an unpalatable ant-although this presumption has been tested in relatively few cases. Here we explicitly examined the extent to which Peckhamia picata (Salticidae), a North American ant-mimicking jumping spider, is protected from four species of jumping spider predators, relative to nonmimetic salticids and model ants. In addition, we conducted focused behavioral observations on one salticid predator, Thiodina puerpera, to determine the point at which the predators' behaviors toward model, mimic, and nonmimic diverge. We also examined the behaviors of Peckhamia in the presence of Thiodina. We found that mimetic jumping spiders were consumed less than a third as often as nonmimetic jumping spiders, suggesting that Peckhamia does indeed gain protection as a result of its resemblance to ants, and so can be considered a Batesian mimic. Furthermore, our focal predator did not consume any ant-mimicking spiders, and seemed to categorize Peckhamia with its model ant early in the hunting sequence. Such early determination of prey versus nonprey may be the result of speed-accuracy trade-offs in predator decision-making.

Black widow spider

Science.gov (United States)

... medlineplus.gov/ency/article/002858.htm Black widow spider To use the sharing features on this page, please enable JavaScript. The black widow spider (Latrodectus) has a shiny black body with a ...

Tropical House Gecko (Hemidactylus mabouia predation on brown spiders (Loxosceles intermedia

Directory of Open Access Journals (Sweden)

E.N. Ramires

2004-01-01

Full Text Available Brown spiders (Loxosceles spp. are venomous arachnids, successfully adapted to urban habitats in Brazil. Loxoscelism became a serious public health problem in Paraná State, especially at the capital Curitiba, where the most abundant species is Loxosceles intermedia. Hemidactylus mabouia (Gekkonidae lizards are synanthropic predators of arthropods. In this paper, we describe the predatory behavior of the Tropical House Gecko H. mabouia on L. intermedia under laboratory conditions. Twelve geckos were observed, and all of them fed on brown spiders (n=123 observations. The attack consisted of a fast run followed by one bite on the spider’s abdomen or legs. The geckos did not attack L. intermedia anterior body parts, probably due to the fangs present in this region. Two Hemidactylus individuals were killed by L. intermedia bites: during a predatory encounter, and by an induced bite on a restrained lizard. The observations summarized in this paper show that H. mabouia could be used in the biological control of Loxosceles populations in human dwellings. However, additional field studies are necessary to quantify the impact of H. mabouia predation on urban populations of L. intermedia and other species of the same genus.

What you fear will appear: detection of schematic spiders in spider fear.

Science.gov (United States)

Peira, Nathalie; Golkar, Armita; Larsson, Maria; Wiens, Stefan

2010-01-01

Various experimental tasks suggest that fear guides attention. However, because these tasks often lack ecological validity, it is unclear to what extent results from these tasks can be generalized to real-life situations. In change detection tasks, a brief interruption of the visual input (i.e., a blank interval or a scene cut) often results in undetected changes in the scene. This setup resembles real-life viewing behavior and is used here to increase ecological validity of the attentional task without compromising control over the stimuli presented. Spider-fearful and nonfearful women detected schematic spiders and flowers that were added to one of two identical background pictures that alternated with a brief blank in between them (i.e., flicker paradigm). Results showed that spider-fearful women detected spiders (but not flowers) faster than did nonfearful women. Because spiders and flowers had similar low-level features, these findings suggest that fear guides attention on the basis of object features rather than simple low-level features.

Brown Recluse Spider

Science.gov (United States)

... to a group of spiders commonly known as violin spiders or fiddlebacks. The characteristic fiddle-shaped pattern ... 4-19.1mm) • Color: Golden brown • A dark violin/fiddle shape (see top photo) is located on ...

The complete mitochondrial genome of the sea spider Achelia bituberculata (Pycnogonida, Ammotheidae: arthropod ground pattern of gene arrangement

Directory of Open Access Journals (Sweden)

Lee Yong-Seok

2007-10-01

Full Text Available Abstract Background The phylogenetic position of pycnogonids is a long-standing and controversial issue in arthropod phylogeny. This controversy has recently been rekindled by differences in the conclusions based on neuroanatomical data concerning the chelifore and the patterns of Hox expression. The mitochondrial genome of a sea spider, Nymphon gracile (Pycnogonida, Nymphonidae, was recently reported in an attempt to address this issue. However, N. gracile appears to be a long-branch taxon on the phylogenetic tree and exhibits a number of peculiar features, such as 10 tRNA translocations and even an inversion of several protein-coding genes. Sequences of other pycnogonid mitochondrial genomes are needed if the position of pycnogonids is to be elucidated on this basis. Results The complete mitochondrial genome (15,474 bp of a sea spider (Achelia bituberculata belonging to the family Ammotheidae, which combines a number of anatomical features considered plesiomorphic with respect to other pycnogonids, was sequenced and characterized. The genome organization shows the features typical of most metazoan animal genomes (37 tightly-packed genes. The overall gene arrangement is completely identical to the arthropod ground pattern, with one exception: the position of the trnQ gene between the rrnS gene and the control region. Maximum likelihood and Bayesian inference trees inferred from the amino acid sequences of mitochondrial protein-coding genes consistently indicate that the pycnogonids (A. bituberculata and N. gracile may be closely related to the clade of Acari and Araneae. Conclusion The complete mitochondrial genome sequence of A. bituberculata (Family Ammotheidae and the previously-reported partial sequence of Endeis spinosa show the gene arrangement patterns typical of arthropods (Limulus-like, but they differ markedly from that of N. gracile. Phylogenetic analyses based on mitochondrial protein-coding genes showed that Pycnogonida may be

Ground-dwelling arthropod association with coarse woody debris following long-term dormant season prescribed burning in the longleaf pine flatwoods of north Florida.

Science.gov (United States)

J.L. Hanula; D.D. Wade; J. O' Brien; S.C. Loeb

2009-01-01

A 5·year study of long· term (40 years) study plots was conducted on the Osceola National·Forest in northern Florida to determine how dormant-season fire frequency (annual, biennial,quadrennial, or unburned) affects ground-dwelling macroarthropod use of coarsewoody debris in longleaf pine (Pinus...

THE EXECUTION OF PLANNED DETOURS BY SPIDER-EATING PREDATORS

Science.gov (United States)

Cross, Fiona R.; Jackson, Robert R.

2016-01-01

Many spiders from the salticid subfamily Spartaeinae specialize at preying on other spiders and they adopt complex strategies when targeting these dangerous prey. We tested 15 of these spider-eating spartaeine species for the capacity to plan detours ahead of time. Each trial began with the test subject on top of a tower from which it could view two boxes: one containing prey and the other not containing prey. The distance between the tower and the boxes was too far to reach by leaping and the tower sat on a platform surrounded by water. As the species studied are known to avoid water, the only way they could reach the prey without getting wet was by taking one of two circuitous walkways from the platform: one leading to the prey (‘correct’) and one not leading to the prey (‘incorrect’). After leaving the tower, the test subject could not see the prey and sometimes it had to walk past the incorrect walkway before reaching the correct walkway. Yet all 15 species chose the correct walkway significantly more often than the incorrect walkway. We propose that these findings exemplify genuine cognition based on representation. PMID:26781057

A comparative analysis of terrestrial arthropod assemblages from a relict forest unveils historical extinctions and colonization differences between two oceanic islands

Science.gov (United States)

Matthews, Thomas J.; Rego, Carla; Crespo, Luis; Aguiar, Carlos A. S.; Cardoso, Pedro; Rigal, François; Silva, Isamberto; Pereira, Fernando; Borges, Paulo A. V.; Serrano, Artur R. M.

2018-01-01

During the last few centuries oceanic island biodiversity has been drastically modified by human-mediated activities. These changes have led to the increased homogenization of island biota and to a high number of extinctions lending support to the recognition of oceanic islands as major threatspots worldwide. Here, we investigate the impact of habitat changes on the spider and ground beetle assemblages of the native forests of Madeira (Madeira archipelago) and Terceira (Azores archipelago) and evaluate its effects on the relative contribution of rare endemics and introduced species to island biodiversity patterns. We found that the native laurel forest of Madeira supported higher species richness of spiders and ground beetles compared with Terceira, including a much larger proportion of indigenous species, particularly endemics. In Terceira, introduced species are well-represented in both terrestrial arthropod taxa and seem to thrive in native forests as shown by the analysis of species abundance distributions (SAD) and occupancy frequency distributions (OFD). Low abundance range-restricted species in Terceira are mostly introduced species dispersing from neighbouring man-made habitats while in Madeira a large number of true rare endemic species can still be found in the native laurel forest. Further, our comparative analysis shows striking differences in species richness and composition that are due to the geographical and geological particularities of the two islands, but also seem to reflect the differences in the severity of human-mediated impacts between them. The high proportion of introduced species, the virtual absence of rare native species and the finding that the SADs and OFDs of introduced species match the pattern of native species in Terceira suggest the role of man as an important driver of species diversity in oceanic islands and add evidence for an extensive and severe human-induced species loss in the native forests of Terceira. PMID:29694360

Assembly patterns of soil-dwelling lichens after glacier retreat in the European Alps.

Science.gov (United States)

Nascimbene, Juri; Mayrhofer, Helmut; Dainese, Matteo; Bilovitz, Peter Othmar

2017-06-01

To assess the spatial-temporal dynamics of primary succession following deglaciation in soil-dwelling lichen communities. European Alps (Austria, Switzerland and Italy). Five glacier forelands subjected to relevant glacier retreat during the last century were investigated. In each glacier foreland, three successional stages were selected at increasing distance from the glacier, corresponding to a gradient of time since deglaciation between 25 and 160 years. In each successional stage, soil-dwelling lichens were surveyed within five 1 × 1 m plots. In addition to a classical ecological framework, based on species richness and composition, we applied a functional approach to better elucidate community assembly mechanisms. A positive relationship was found between species richness and time since deglaciation indicating that richer lichen communities can be found at increasing terrain ageing. This pattern was associated with compositional shifts, suggesting that different community assemblages can be found along the successional stages. The analysis of β-diversity revealed a significant nested pattern of species assemblages along the gradient (i.e. earlier successional stages hosted a subset of the species already established in older successional stages), while the turnover component was less relevant. Considering functional groups, we found contrasting patterns in relation to time since deglaciation: the incidence of species with a cyanobacterial photobiont and those reproducing by spores decreased, while that of species reproducing by vegetative propagules increased. This study reveals that community assembly patterns of soil-dwelling lichens in alpine glacier forelands are ruled by mechanisms of directional species accumulation and trait selection that involve a trade-off between different functional strategies. Functional traits that reflect the dispersal and adaptation capability of the species underpin the colonization success of soil-dwelling lichens in

Nature Study Tips. Spiders.

Science.gov (United States)

Mulaik, Stanley B.

1990-01-01

Different types of spiders, their ranges and habits are discussed. Activities associated with the study of spiders are suggested. Four references are listed which may be of interest to beginners. (CW)

Ground-dwelling arthropod association with coarse woody debris following long-term dormant season prescribed burning in the longleaf pine flatwoods of North Carolina

Science.gov (United States)

James L Hanula; Dale Wade; Joseph O' Brien; Susan Loeb

2009-01-01

A 5-year study of long-term (40 years) study plots was conducted on the Osceola National Forest in northern Florida to determine how dormant-season fire frequency (annual, biennial, quadrennial, or unburned) affects ground-dwelling macroarthropod use of coarse woody debris in longleaf pine (Pinus palustris Mill.) forests. Pitfall traps were used to sample arthropods...

Monitoring Effect of Fire on Ant Assemblages in Brazilian Rupestrian Grasslands: Contrasting Effects on Ground and Arboreal Fauna

Directory of Open Access Journals (Sweden)

Diego Anjos

2017-06-01

Full Text Available Fire is one of the most relevant ecological disturbances in nature. Little is known about the effects of fire on biodiversity in ecosystems like rupestrian grasslands, which share characteristics with savanna and forest biomes. Brazilian rupestrian grasslands are part of an endangered ecosystem that has been modified by anthropogenic fire events that have become more intense in recent decades. In this study, we evaluated the effects of fire on ground and arboreal ant assemblages through a two-year monitoring program (24 monthly samplings. We found that fire does not change cumulative species richness after 24 months, and that fire does not affect mean ant richness, abundance, and species composition in arboreal ants. On the other hand, fire increased mean ground ant species richness and abundance, and caused a significant change in species composition. Our results indicate a weak and beneficial effect of fire only for ground ant communities, which generally agrees with results from other studies in Brazilian savannas. Taken together, results from these studies may be useful for improvement of fire suppression policy in fire-prone habitats in Brazil.

Mobile work, multilocal dwelling and spaces of wellbeing.

Science.gov (United States)

Gorman-Murray, Andrew; Bissell, David

2018-05-01

Mobile work is increasingly common. For our purposes, mobile work entails long-distance commuting arrangements with periods living away from the primary domestic residence that may be considered 'home'. Mobile work reconfigures the relational fabric of 'home', introducing multilocal mooring points into worker's lives, and thus reshaping the spatial and temporal patterns and meanings of dwelling. Geography and cognate disciplines have begun to investigate the spatialities and temporalities of mobile work and multilocal dwelling, including the complexities of space-time management, but as yet little attention has been given to implications and impacts on the wellbeing of workers and their families - this is despite growing concern for worker and family wellbeing in some mobile work sectors, such as FIFO mining. Wellbeing is also a complex and multivalent concept, taking in objective and subjective dimensions, including health indicators and quality of life. In this context, this paper reviews recent literature on mobile work and multilocal dwelling and geographies of wellbeing to identify productive intersections for conceptual and empirical development. We suggest that provocations about space-times of wellbeing (Fleuret and Prugneau, 2015) and wellbeing as a relational, situated assemblage (Atkinson, 2013) are productive for analysing wellbeing in a context of mobility and multilocality. Copyright © 2018 Elsevier Ltd. All rights reserved.

The evolution of sociality in spiders

DEFF Research Database (Denmark)

Lubin, Yael; Bilde, T.

2007-01-01

. Anelosimus (Theridiidae) C. Sociality in Spiders: An Evolutionary Dead End? V. Evolution and Maintenance of Sociality in Spiders: Relevant Models A. Kin Selection 1. Kin Recognition 2. Inbreeding and Kin Selection B. Multilevel Selection (Group Selection) C. Ecological Benefits D. Ecological Constraints E......I. Introducing Social Spiders II. Social and Subsocial Species: A Survey of Behavioral Traits III. Inbred Sociality in Spiders A. Cooperation Versus Competition: A Balancing Act B. Do Social Spiders Have Division of Labor? C. Colony Foundation: Propagule Dispersal Versus Fission D. Female......-Biased Colony Sex Ratios: Primary and Operational Sex Ratios E. Mating System: Inbreeding and Its Population-Genetic Consequences F. "Boom and Bust" Colony Dynamics IV. Phylogenetic Relationships Among Social Spider Species A. Common Features of Social Evolution B. Case Studies 1. Stegodyphus (Eresidae) 2...

Radon quantification in dwellings of different construction located in Pichincha Province

International Nuclear Information System (INIS)

Ayala, Maria Mercedes

1992-01-01

The desintegration of uranium-238 yields radon-222 present in most dwellings and buildings. Radon-222 gets into them, accumulatively, through floors and walls, domestic fuel-gas and drinking water pipes. Upon inhalation radon is cancer's causes, death-rate being about 5000 deaths per year in USA. This fact evidences the necessity to quantifying radon in dwellings in Ecuador. This research involves data from dwellings built up with different types of raw materials found spread in Pichincha province. The SSNTD method using a cellulose nitrate sensible film LR-115 was used for the research. The incidence of temperature, altitude, ventilation on the concentration gas Rn 222 were also subject of a qualitative study. Eventually, the results shows that the adobe dwellings and/or poorly ventilated dwellings produce maximum concentration of Rn 222 . Some cases show that ground floors have higher rate of Rn 222 than the first or second floors, meaning that the gas is also coming up from the ground. in any case the level of Rn 222 concentration is less than accepted limit 200 Bq/m 3 by UNCEAR only places, such as Mindo and Calderon, surpass the limit

Vertical distribution of spiders associated to Quercus humboldtii and clusia spp. at sanctuary of fauna and flora Iguaque, Colombia

International Nuclear Information System (INIS)

Vanegas, Silvia; Fagua, Giovanny; Florez, Eduardo

2012-01-01

the vertical distribution of spiders associated to trees of quercus humboldtii and clusia spp. with different architectural model, was studied at sanctuary of fauna and flora of Iguaque; for this, we selected trees of each architectural model, stratified them each three m in high starting at the base to the canopy of the tree. We took samples in each stratus for 20 min during the day and at night. Also, we took samples in the nearest ground plot (4 m 2) . We collected 1,261 specimens of 104 morphospecies and 20 families. The most frequent families were theridiidae, salticidae, araneidae, linyphiidae, anyphaenidae, and theridiosomatidae. We observed differences in the spiders' vertical distribution in abundance, richness, composition, time period, and sex ratio, all of them attributable to plant architectures and its stratification. Clusia spider community was the most diverse, quercus spider community was the richest rain, period of time at day, and support availability affected the spiders' composition.

Non-webbuilding spiders: prey specialists or generalists?

Science.gov (United States)

Nentwig, Wolfgang

1986-07-01

Feeding experiments were performed with seven species of non-webbuilding spiders and a variety of prey taxa. Some species were generally polyphagous whereas other spiders restricted their prey to a few groups. At one end of the spectrum of prey specialization the thomisid Misumena vatia is limited to a few taxa of possible prey (Table 1). The literature of prey records of non-webbuilding spiders is reviewed (Table 2) with special emphasis on oligophagous or monophagous spiders. Monophagous spiders are generally rare and have specialized on only a few prey taxa: social insects (ants, bees, termites) and spiders.

Measurement of indoor radon-thoron and their progeny levels in dwellings and radon concentrations in ground water of Hassan city, Karnataka, India

International Nuclear Information System (INIS)

Srinivasa, E.; Rangaswamy, D.R.; Sannappa, J.

2014-01-01

The indoor radon and thoron concentrations in dwellings of Hassan city have been measured by using LR-115 type-Il Solid State Nuclear Tracks Detectors (SSNTDs). Measurements were carried in summer season from March to May-2013. The radon and thoron activity concentration in the corresponding dwellings has been found to vary from 7.4 to 45.7 Bqm -3 and 5.4 to 34.9 Bqm -3 with a median of 23.59±11 Bqm -3 and 14.47±8 Bqm -3 respectively. The overall average radon concentrations are found to be less than the lower reference level of 200 Bq m -3 of the International Commission on Radiological Protection. The annual effective dose received due to radon and its progeny by the inhabitants in the dwellings under study has also been calculated which found to vary from 0.320 ±0.4 to 1.86 ±1.1 mSv y -1 with an average value of 0.957±0.8 mSv -1 . The obtained results are much lower than the upper reference level of 10 mSv y -1 (ICRP 2007). Radon in bore well water at different locations of Hassan city was determined using the emanometry technique and exposure dose from ingestion of drinking water was estimated. The radon concentration in ground water was found to vary from 19.49 to 60.74 Bq l -1 with an average value of 47.16±14Bq l -1 . From this study it is evident that, the recorded ground water radon concentration values are higher than MCL of 11 Bq l -1 proposed by USEPA. The total dose due to inhalation and ingestion of 222 Rn in ground water ranges from 0.053 mSv y -1 to 0.165mSv y -1 with an average value of 0.127±0.038mSv y -1 . (author)

Carabid beetle assemblages in three environments in the Araucaria humid forest of southern Brazil

Directory of Open Access Journals (Sweden)

Rodrigo Milton Moraes

2013-03-01

Full Text Available Carabid beetle assemblages in three environments in the Araucaria humid forest of southern Brazil. Carabidae is composed mainly by ground-dwelling predator beetles. It is the fourth most diverse group within Coleoptera, but its diversity in the Neotropical region is understudied. Here we describe and analyze the diversity of carabid beetles in a region of subtropical rain forest dominated by Araucaria angustifolia with different landscapes. Three areas were chosen in an environmental integrity gradient: primary forests, secondary forests and old Pinus plantations. Pitfall traps were taken monthly, in a total of 14 samples per area. 1733 adult carabid beetles, belonging to 18 species, were sampled. There were differences in richness and abundance between the sampled areas. The total scores followed the same tendency: primary forests (14 species/747 individuals, secondary forests (13/631 and Pinus forests (10/355. An analysis of similarity shows differences in species composition, for both areas and seasons. Galerita lacordarei was the most abundant species for all samples and seasons. Carabid species show similar responses in accordance with habitat heterogeneity and disturbance. The abundance of Galerita lacordarei was influenced by temperature, for all sampled sites. Environmental changes affect the carabid assemblages and decrease diversity, possibly interfering in local dynamics. Seasonality patterns seem to indicate an increase in individual movement during summer, probably in search of resources. It is suggested that microhabitat patchiness is probably an important factor affecting carabid beetle diversity at small spatial scales.

Remembering the object you fear: brain potentials during recognition of spiders in spider-fearful individuals.

Science.gov (United States)

Michalowski, Jaroslaw M; Weymar, Mathias; Hamm, Alfons O

2014-01-01

In the present study we investigated long-term memory for unpleasant, neutral and spider pictures in 15 spider-fearful and 15 non-fearful control individuals using behavioral and electrophysiological measures. During the initial (incidental) encoding, pictures were passively viewed in three separate blocks and were subsequently rated for valence and arousal. A recognition memory task was performed one week later in which old and new unpleasant, neutral and spider pictures were presented. Replicating previous results, we found enhanced memory performance and higher confidence ratings for unpleasant when compared to neutral materials in both animal fearful individuals and controls. When compared to controls high animal fearful individuals also showed a tendency towards better memory accuracy and significantly higher confidence during recognition of spider pictures, suggesting that memory of objects prompting specific fear is also facilitated in fearful individuals. In line, spider-fearful but not control participants responded with larger ERP positivity for correctly recognized old when compared to correctly rejected new spider pictures, thus showing the same effects in the neural signature of emotional memory for feared objects that were already discovered for other emotional materials. The increased fear memory for phobic materials observed in the present study in spider-fearful individuals might result in an enhanced fear response and reinforce negative beliefs aggravating anxiety symptomatology and hindering recovery.

Science Education Resources on the Web--Spiders.

Science.gov (United States)

Thirunarayanan, M. O.

1997-01-01

Lists Web sites containing information on spiders and offers brief descriptions of the information available at those sites. The 11 sites provide information on taxonomy of spiders, anatomy, different ways spiders use silk, Internet mailing lists, folk literature and art, bibliographies, night collection, and spiders commonly found in the state of…

Aquatic subsidies transport anthropogenic nitrogen to riparian spiders

Energy Technology Data Exchange (ETDEWEB)

Akamatsu, Fumikazu, E-mail: f-akamt55@pwri.go.jp [Department of Environmental Sciences, Shinshu University, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan); Toda, Hideshige [Department of Environmental Sciences, Shinshu University, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan)

2011-05-15

Stable nitrogen isotopic composition ({delta}{sup 15}N) of aquatic biota increases with anthropogenic N inputs such as sewage and livestock waste downstream. Increase in {delta}{sup 15}N of riparian spiders downstream may reflect the anthropogenic pollution exposure through predation on aquatic insects. A two-source mixing model based on stable carbon isotopic composition showed the greatest dependence on aquatic insects (84%) by horizontal web-building spiders, followed by intermediate (48%) and low (31%) dependence by cursorial and vertical web-building spiders, respectively. The spider body size was negatively correlated with the dietary proportion of aquatic insects and spider {delta}{sup 15}N. The aquatic subsidies transported anthropogenic N to smaller riparian spiders downstream. This transport of anthropogenic N was regulated by spider's guild designation and body size. - Highlights: > {delta}{sup 15}N of aquatic insects increases downstream with anthropogenic nitrogen inputs. > {delta}{sup 15}N of riparian spiders increases with a high dietary proportion of aquatic insects and smaller spider body size. > The aquatic subsidies transport anthropogenic nitrogen to smaller riparian spiders downstream. - Smaller spiders assimilate anthropogenic nitrogen through the predation on aquatic subsides.

Aquatic subsidies transport anthropogenic nitrogen to riparian spiders

International Nuclear Information System (INIS)

Akamatsu, Fumikazu; Toda, Hideshige

2011-01-01

Stable nitrogen isotopic composition (δ 15 N) of aquatic biota increases with anthropogenic N inputs such as sewage and livestock waste downstream. Increase in δ 15 N of riparian spiders downstream may reflect the anthropogenic pollution exposure through predation on aquatic insects. A two-source mixing model based on stable carbon isotopic composition showed the greatest dependence on aquatic insects (84%) by horizontal web-building spiders, followed by intermediate (48%) and low (31%) dependence by cursorial and vertical web-building spiders, respectively. The spider body size was negatively correlated with the dietary proportion of aquatic insects and spider δ 15 N. The aquatic subsidies transported anthropogenic N to smaller riparian spiders downstream. This transport of anthropogenic N was regulated by spider's guild designation and body size. - Highlights: → δ 15 N of aquatic insects increases downstream with anthropogenic nitrogen inputs. → δ 15 N of riparian spiders increases with a high dietary proportion of aquatic insects and smaller spider body size. → The aquatic subsidies transport anthropogenic nitrogen to smaller riparian spiders downstream. - Smaller spiders assimilate anthropogenic nitrogen through the predation on aquatic subsides.

Radiation effect onto biodiversity of spiders

International Nuclear Information System (INIS)

Mehrabova, M.A.; Naghiyev, J.A; Huseynov, N.I; Topchiyeva, Sh.A.; Hasanov, N.H.

2010-01-01

At present time spiders are one of the considerably diverse groups of living organisms in fauna of Azerbayjan Republic. They play an important in environmental chain, being the main group of wild arthropodas in most biocoenoses. Therefore, it's not surprised that recently an increased interest has being observed to the study of spiders as indicators of environmental conditions. Spiders have been collected in polluted areas, their identification and sampling of soil, water and plants has been conducted. The degree of radionuclides' impact on the number and distribution of spiders and their venom in the observed zones of Azerbaijan has been revealed and preliminarily predicted. The number of the collected spiders equals to 292 which has been determined later at an electronic identifier Spinnen Mitteleuropas. The radionuclides in spiders have been determined at Canberra facility. Different natural radioactive elements were revealed in the investigated samples.

Individual and species-specific traits explain niche size and functional role in spiders as generalist predators.

Science.gov (United States)

Sanders, Dirk; Vogel, Esther; Knop, Eva

2015-01-01

The function of a predator within a community is greatly based on its trophic niche, that is the number and the strength of feeding links. In generalist predators, which feed on a wide range of prey, the size and position of the trophic niche is likely determined by traits such as hunting mode, the stratum they occur in, their body size and age. We used stable isotope analyses ((13)C and (15)N) to measure the trophic niche size of nine spider species within a forest hedge community and tested for species traits and individual traits that influence stable isotope enrichment, niche size and resource use. The spiders Enoplognatha, Philodromus, Floronia, and Heliophanus had large isotopic niches, which correspond to a more generalistic feeding behaviour. In contrast, Araneus, Metellina and Agelena, as top predators in the system, had rather narrow niches. We found a negative correlation between trophic position and niche size. Differences in trophic position in spiders were explained by body size, hunting modes and stratum, while niche size was influenced by hunting mode. In Philodromus, the size of the trophic niche increased significantly with age. Fitting spiders to functional groups according to their mean body size, hunting mode and their habitat domain resulted in largely separated niches, which indicates that these traits are meaningful for separating functional entities in spiders. Functional groups based on habitat domain (stratum) caught the essential functional differences between the species with species higher up in the vegetation feeding on flying insects and herb and ground species also preying on forest floor decomposers. Interestingly, we found a gradient from large species using a higher habitat domain and having a smaller niche to smaller species foraging closer to the ground and having a larger niche. This shows that even within generalist predators, such as spiders, there is a gradient of specialism that can be predicted by functional traits. �

Energetics, scaling and sexual size dimorphism of spiders.

Science.gov (United States)

Grossi, B; Canals, M

2015-03-01

The extreme sexual size dimorphism in spiders has motivated studies for many years. In many species the male can be very small relative to the female. There are several hypotheses trying to explain this fact, most of them emphasizing the role of energy in determining spider size. The aim of this paper is to review the role of energy in sexual size dimorphism of spiders, even for those spiders that do not necessarily live in high foliage, using physical and allometric principles. Here we propose that the cost of transport or equivalently energy expenditure and the speed are traits under selection pressure in male spiders, favoring those of smaller size to reduce travel costs. The morphology of the spiders responds to these selective forces depending upon the lifestyle of the spiders. Climbing and bridging spiders must overcome the force of gravity. If bridging allows faster dispersal, small males would have a selective advantage by enjoying more mating opportunities. In wandering spiders with low population density and as a consequence few male-male interactions, high speed and low energy expenditure or cost of transport should be favored by natural selection. Pendulum mechanics show the advantages of long legs in spiders and their relationship with high speed, even in climbing and bridging spiders. Thus small size, compensated by long legs should be the expected morphology for a fast and mobile male spider.

Principal determinants of species and functional diversity of carabid beetle assemblages during succession at post-industrial sites.

Science.gov (United States)

Sipos, J; Hodecek, J; Kuras, T; Dolny, A

2017-08-01

Although ecological succession is one of the principal focuses of recent restoration ecology research, it is still unclear which factors drive this process and positively influence species richness and functional diversity. In this study we sought to elucidate how species traits and functional diversity change during forest succession, and to identify important factors that determine the species in the observed assemblages. We analyzed species richness and functional diversity of ground beetle assemblages in relation to succession on post-industrial localities after habitat deterioration caused by spoil deposition. We selected ground beetles as they are known to be sensitive to landscape changes (with a large range of responses), and their taxonomy and ecology are generally well-known. Ground beetles were sampled on the spoil heaps during the last 30 years when spontaneous succession occurred. To calculate functional diversity, we used traits related to habitat and trophic niche, i.e. food specialization, wing morphology, trophic level, and bio-indication value. Ground beetle species were found to be distributed non-randomly in the assemblages in the late phase of succession. Ordination analyses revealed that the ground beetle assemblage was significantly associated with the proportion of forested area. Environmental heterogeneity generated assemblages that contained over-dispersed species traits. Our findings indicated that environmental conditions at late successional stages supported less mobile carnivorous species. Overall, we conclude that the decline in species richness and functional diversity in the middle of the studied succession gradient indicated that the assemblages of open habitats had been replaced by species typical of forest ecosystems.

Spiders do have melanin after all.

Science.gov (United States)

Hsiung, Bor-Kai; Blackledge, Todd A; Shawkey, Matthew D

2015-11-01

Melanin pigments are broadly distributed in nature - from bacteria to fungi to plants and animals. However, many previous attempts to identify melanins in spiders were unsuccessful, suggesting that these otherwise ubiquitous pigments were lost during spider evolution. Yet, spiders exhibit many dark colours similar to those produced by melanins in other organisms, and the low solubility of melanins makes isolation and characterization difficult. Therefore, whether melanins are truly absent or have simply not yet been detected is an open question. Raman spectroscopy provides a reliable way to detect melanins in situ, without the need for isolation. In this study, we document the presence of eumelanin in diverse species of spiders using confocal Raman microspectroscopy. Comparisons of spectra with theoretically calculated data falsify the previous hypothesis that dark colours are produced solely by ommochromes in spiders. Our data indicate that melanins are present in spiders and further supporting that they are present in most living organisms. © 2015. Published by The Company of Biologists Ltd.

Phobic spider fear is associated with enhanced attentional capture by spider pictures: a rapid serial presentation event-related potential study.

Science.gov (United States)

Van Strien, Jan W; Franken, Ingmar H A; Huijding, Jorg

2009-03-04

The early posterior negativity (EPN) reflects early selective visual processing of emotionally significant information. This study explored the association between fear of spiders and the EPN for spider pictures. Fifty women completed a Spider Phobia Questionnaire and watched the random rapid serial presentation of 600 neutral, 600 negatively valenced emotional, and 600 spider pictures (three pictures per second). The EPN was scored as the mean activity in the 225-300-ms time window at lateral occipital electrodes. Participants with higher scores on the phobia questionnaire showed larger (i.e. more negative) EPN amplitudes in response to spider pictures. The results suggest that the attentional capture of spider-related stimuli is an automatic response, which is modulated by the extent of spider fear.

Radon in dwellings and shelters in Zagreb

International Nuclear Information System (INIS)

Lokobauer, N.; Franic, Z.; Sencar, J.; Bauman, A.

1994-01-01

Since 1990, radon activity was measured in dwellings of Zagreb. In only small number of dwellings radon activity exceeded 100 Bq.m -3 . Since the inhabitants of Croatia have to stay in the facilities below the ground due to the war against Croatia, the paper gives also data on radon activity measured in the shelters and cellars in 1991. Measurements were performed using Kodak LR-115 detectors, type II. At several locations radon activity was measured with a silicon detector (Radhome). Radon values obtained for the shelters, cellars and dwellings at all locations were compared. With respect to children as most susceptable population group the paper gives data on radon activity for kindergartens and elementary schools (and its shelters) where children usually spend almost one-third to the day. (orig.)

Sparse trees and shrubs confers a high biodiversity to pastures: Case study on spiders from Transylvania.

Science.gov (United States)

Gallé, Róbert; Urák, István; Nikolett, Gallé-Szpisjak; Hartel, Tibor

2017-01-01

The integration of food production and biodiversity conservation represents a key challenge for sustainability. Several studies suggest that even small structural elements in the landscape can make a substantial contribution to the overall biodiversity value of the agricultural landscapes. Pastures can have high biodiversity potential. However, their intensive and monofunctional use typically erodes its natural capital, including biodiversity. Here we address the ecological value of fine scale structural elements represented by sparsely scattered trees and shrubs for the spider communities in a moderately intensively grazed pasture in Transylvania, Eastern Europe. The pasture was grazed with sheep, cattle and buffalo (ca 1 Livestock Unit ha-1) and no chemical fertilizers were applied. Sampling sites covered the open pasture as well as the existing fine-scale heterogeneity created by scattered trees and shrub. 40 sampling locations each being represented by three 1 m2 quadrats were situated in a stratified design while assuring spatial independency of sampling locations. We identified 140 species of spiders, out of which 18 were red listed and four were new for the Romanian fauna. Spider species assemblages of open pasture, scattered trees, trees and shrubs and the forest edge were statistically distinct. Our study shows that sparsely scattered mature woody vegetation and shrubs substantially increases the ecological value of managed pastures. The structural complexity provided by scattered trees and shrubs makes possible the co-occurrence of high spider diversity with a moderately high intensity grazing possible in this wood-pasture. Our results are in line with recent empirical research showing that sparse trees and shrubs increases the biodiversity potential of pastures managed for commodity production.

The phylogeny of fossil whip spiders.

Science.gov (United States)

Garwood, Russell J; Dunlop, Jason A; Knecht, Brian J; Hegna, Thomas A

2017-04-21

Arachnids are a highly successful group of land-dwelling arthropods. They are major contributors to modern terrestrial ecosystems, and have a deep evolutionary history. Whip spiders (Arachnida, Amblypygi), are one of the smaller arachnid orders with ca. 190 living species. Here we restudy one of the oldest fossil representatives of the group, Graeophonus anglicus Pocock, 1911 from the Late Carboniferous (Duckmantian, ca. 315 Ma) British Middle Coal Measures of the West Midlands, UK. Using X-ray microtomography, our principal aim was to resolve details of the limbs and mouthparts which would allow us to test whether this fossil belongs in the extant, relict family Paracharontidae; represented today by a single, blind species Paracharon caecus Hansen, 1921. Tomography reveals several novel and significant character states for G. anglicus; most notably in the chelicerae, pedipalps and walking legs. These allowed it to be scored into a phylogenetic analysis together with the recently described Paracharonopsis cambayensis Engel & Grimaldi, 2014 from the Eocene (ca. 52 Ma) Cambay amber, and Kronocharon prendinii Engel & Grimaldi, 2014 from Cretaceous (ca. 99 Ma) Burmese amber. We recovered relationships of the form ((Graeophonus (Paracharonopsis + Paracharon)) + (Charinus (Stygophrynus (Kronocharon (Charon (Musicodamon + Paraphrynus)))))). This tree largely reflects Peter Weygoldt's 1996 classification with its basic split into Paleoamblypygi and Euamblypygi lineages; we were able to score several of his characters for the first time in fossils. Our analysis draws into question the monophyly of the family Charontidae. Our data suggest that Graeophonus is a crown group amblypygid, and falls within a monophyletic Paleoamblypgi clade, but outside the family Paracharontidae (= Paracharonopsis + Paracharon). Our results also suggest a new placement for the Burmese amber genus Kronocharon, a node further down from its original position. Overall, we offer a

Foraging modality and plasticity in foraging traits determine the strength of competitive interactions among carnivorous plants, spiders and toads.

Science.gov (United States)

Jennings, David E; Krupa, James J; Rohr, Jason R

2016-07-01

Foraging modalities (e.g. passive, sit-and-wait, active) and traits are plastic in some species, but the extent to which this plasticity affects interspecific competition remains unclear. Using a long-term laboratory mesocosm experiment, we quantified competition strength and the plasticity of foraging traits in a guild of generalist predators of arthropods with a range of foraging modalities. Each mesocosm contained eight passively foraging pink sundews, and we employed an experimental design where treatments were the presence or absence of a sit-and-wait foraging spider and actively foraging toad crossed with five levels of prey abundance. We hypothesized that actively foraging toads would outcompete the other species at low prey abundance, but that spiders and sundews would exhibit plasticity in foraging traits to compensate for strong competition when prey were limited. Results generally supported our hypotheses. Toads had a greater effect on sundews at low prey abundances, and toad presence caused spiders to locate webs higher above the ground. Additionally, the closer large spider webs were to the ground, the greater the trichome densities produced by sundews. Also, spider webs were larger with than without toads and as sundew numbers increased, and these effects were more prominent as resources became limited. Finally, spiders negatively affected toad growth only at low prey abundance. These findings highlight the long-term importance of foraging modality and plasticity of foraging traits in determining the strength of competition within and across taxonomic kingdoms. Future research should assess whether plasticity in foraging traits helps to maintain coexistence within this guild and whether foraging modality can be used as a trait to reliably predict the strength of competitive interactions. © 2016 The Authors. Journal of Animal Ecology © 2016 British Ecological Society.

OYSTER GROUNDS, A SUPERIOR HABITAT FOR SMALL, SEDIMENT-DWELLING INVERTEBRATES

Science.gov (United States)

As part of a programmatic effort to determine estuarine habitat values for ecological risk assessments, quantitative field studies of small, sediment-dwelling invertebrates were conducted in Willapa Bay, WA in July 1998 and Tillamook Bay, OR in July 1999. The six habitats includ...

Scavenging by spiders (Araneae) and its relationship to pest management of the brown recluse spider.

Science.gov (United States)

Vetter, Richard S

2011-06-01

Experiments reported in Sandidge (2003; Nature 426: 30) indicated that the brown recluse spider, Loxosceles reclusa Gertsch & Mulaik, preferred to scavenge dead prey over live prey and that the spiders were not detrimentally affected when fed insecticide-killed crickets. Extrapolations made in subsequent media coverage disseminating the results of this research made counter-intuitive statements that pesticide treatment in houses would increase brown recluse populations in homes. This information was presented as if the scavenging behavior was specialized in the brown recluse; however, it was more likely that this behavior has not been well studied in other species. To provide a comparison, the current laboratory study examined the likelihood of non-Loxosceles spiders to scavenge dead prey. Of 100 non-Loxosceles spiders that were tested (from 11 families, 24 genera, and at least 29 species from a variety of spider hunting guilds), 99 scavenged dead crickets when offered in petri dishes. Some of the spiders were webspinners in which real-world scavenging of dead prey is virtually impossible, yet they scavenge when given the opportunity. Therefore, scavenging is a flexible opportunistic predatory behavior that is spread across a variety of taxa and is not a unique behavior in brown recluses. These findings are discussed in relation to pest management practices.

Spider and burnable poison rod combinations

International Nuclear Information System (INIS)

Edwards, G.T.; Schluderberg, D.C.

1980-01-01

An improved design of burnable poison rods and associated spiders used in fuel assemblies of pressurized water power reactor cores, is described. The rods are joined to the spider arms in a manner which is proof against the reactor core environment and yet allows the removal of the rods from the spider simply, swiftly and delicately. (U.K.)

Trait-specific processes of convergence and conservatism shape ecomorphological evolution in ground-dwelling squirrels.

Science.gov (United States)

McLean, Bryan S; Helgen, Kristofer M; Goodwin, H Thomas; Cook, Joseph A

2018-03-01

Our understanding of mechanisms operating over deep timescales to shape phenotypic diversity often hinges on linking variation in one or few trait(s) to specific evolutionary processes. When distinct processes are capable of similar phenotypic signatures, however, identifying these drivers is difficult. We explored ecomorphological evolution across a radiation of ground-dwelling squirrels whose history includes convergence and constraint, two processes that can yield similar signatures of standing phenotypic diversity. Using four ecologically relevant trait datasets (body size, cranial, mandibular, and molariform tooth shape), we compared and contrasted variation, covariation, and disparity patterns in a new phylogenetic framework. Strong correlations existed between body size and two skull traits (allometry) and among skull traits themselves (integration). Inferred evolutionary modes were also concordant across traits (Ornstein-Uhlenbeck with two adaptive regimes). However, despite these broad similarities, we found divergent dynamics on the macroevolutionary landscape, with phenotypic disparity being differentially shaped by convergence and conservatism. Such among-trait heterogeneity in process (but not always pattern) reiterates the mosaic nature of morphological evolution, and suggests ground squirrel evolution is poorly captured by single process descriptors. Our results also highlight how use of single traits can bias macroevolutionary inference, affirming the importance of broader trait-bases in understanding phenotypic evolutionary dynamics. © 2018 The Author(s). Evolution © 2018 The Society for the Study of Evolution.

Are temperate canopy spiders tree-species specific?

Science.gov (United States)

Mupepele, Anne-Christine; Müller, Tobias; Dittrich, Marcus; Floren, Andreas

2014-01-01

Arboreal spiders in deciduous and coniferous trees were investigated on their distribution and diversity. Insecticidal knock-down was used to comprehensively sample spiders from 175 trees from 2001 to 2003 in the Białowieża forest and three remote forests in Poland. We identified 140 species from 9273 adult spiders. Spider communities were distinguished between deciduous and coniferous trees. The richest fauna was collected from Quercus where beta diversity was also highest. A tree-species-specific pattern was clearly observed for Alnus, Carpinus, Picea and Pinus trees and also for those tree species that were fogged in only four or three replicates, namely Betula and Populus. This hitherto unrecognised association was mainly due to the community composition of common species identified in a Dufrene-Legendre indicator species analysis. It was not caused by spatial or temporal autocorrelation. Explaining tree-species specificity for generalist predators like spiders is difficult and has to involve physical and ecological tree parameters like linkage with the abundance of prey species. However, neither did we find a consistent correlation of prey group abundances with spiders nor could differences in spider guild composition explain the observed pattern. Our results hint towards the importance of deterministic mechanisms structuring communities of generalist canopy spiders although the casual relationship is not yet understood.

Fish predation by semi-aquatic spiders: a global pattern.

Directory of Open Access Journals (Sweden)

Martin Nyffeler

Full Text Available More than 80 incidences of fish predation by semi-aquatic spiders--observed at the fringes of shallow freshwater streams, rivers, lakes, ponds, swamps, and fens--are reviewed. We provide evidence that fish predation by semi-aquatic spiders is geographically widespread, occurring on all continents except Antarctica. Fish predation by spiders appears to be more common in warmer areas between 40° S and 40° N. The fish captured by spiders, usually ranging from 2-6 cm in length, are among the most common fish taxa occurring in their respective geographic area (e.g., mosquitofish [Gambusia spp.] in the southeastern USA, fish of the order Characiformes in the Neotropics, killifish [Aphyosemion spp.] in Central and West Africa, as well as Australian native fish of the genera Galaxias, Melanotaenia, and Pseudomugil. Naturally occurring fish predation has been witnessed in more than a dozen spider species from the superfamily Lycosoidea (families Pisauridae, Trechaleidae, and Lycosidae, in two species of the superfamily Ctenoidea (family Ctenidae, and in one species of the superfamily Corinnoidea (family Liocranidae. The majority of reports on fish predation by spiders referred to pisaurid spiders of the genera Dolomedes and Nilus (>75% of observed incidences. There is laboratory evidence that spiders from several more families (e.g., the water spider Argyroneta aquatica [Cybaeidae], the intertidal spider Desis marina [Desidae], and the 'swimming' huntsman spider Heteropoda natans [Sparassidae] predate fish as well. Our finding of such a large diversity of spider families being engaged in fish predation is novel. Semi-aquatic spiders captured fish whose body length exceeded the spiders' body length (the captured fish being, on average, 2.2 times as long as the spiders. Evidence suggests that fish prey might be an occasional prey item of substantial nutritional importance.

Fish predation by semi-aquatic spiders: a global pattern.

Science.gov (United States)

Nyffeler, Martin; Pusey, Bradley J

2014-01-01

More than 80 incidences of fish predation by semi-aquatic spiders--observed at the fringes of shallow freshwater streams, rivers, lakes, ponds, swamps, and fens--are reviewed. We provide evidence that fish predation by semi-aquatic spiders is geographically widespread, occurring on all continents except Antarctica. Fish predation by spiders appears to be more common in warmer areas between 40° S and 40° N. The fish captured by spiders, usually ranging from 2-6 cm in length, are among the most common fish taxa occurring in their respective geographic area (e.g., mosquitofish [Gambusia spp.] in the southeastern USA, fish of the order Characiformes in the Neotropics, killifish [Aphyosemion spp.] in Central and West Africa, as well as Australian native fish of the genera Galaxias, Melanotaenia, and Pseudomugil). Naturally occurring fish predation has been witnessed in more than a dozen spider species from the superfamily Lycosoidea (families Pisauridae, Trechaleidae, and Lycosidae), in two species of the superfamily Ctenoidea (family Ctenidae), and in one species of the superfamily Corinnoidea (family Liocranidae). The majority of reports on fish predation by spiders referred to pisaurid spiders of the genera Dolomedes and Nilus (>75% of observed incidences). There is laboratory evidence that spiders from several more families (e.g., the water spider Argyroneta aquatica [Cybaeidae], the intertidal spider Desis marina [Desidae], and the 'swimming' huntsman spider Heteropoda natans [Sparassidae]) predate fish as well. Our finding of such a large diversity of spider families being engaged in fish predation is novel. Semi-aquatic spiders captured fish whose body length exceeded the spiders' body length (the captured fish being, on average, 2.2 times as long as the spiders). Evidence suggests that fish prey might be an occasional prey item of substantial nutritional importance.

Evidence for competition between carnivorous plants and spiders.

Science.gov (United States)

Jennings, David E; Krupa, James J; Raffel, Thomas R; Rohr, Jason R

2010-10-07

Several studies have demonstrated that competition between disparate taxa can be important in determining community structure, yet surprisingly, to our knowledge, no quantitative studies have been conducted on competition between carnivorous plants and animals. To examine potential competition between these taxa, we studied dietary and microhabitat overlap between pink sundews (Drosera capillaris) and wolf spiders (Lycosidae) in the field, and conducted a laboratory experiment examining the effects of wolf spiders on sundew fitness. In the field, we found that sundews and spiders had a high dietary overlap with each other and with the available arthropod prey. Associations between sundews and spiders depended on spatial scale: both sundews and spiders were found more frequently in quadrats with more abundant prey, but within quadrats, spiders constructed larger webs and located them further away from sundews as the total sundew trapping area increased, presumably to reduce competition. Spiders also constructed larger webs when fewer prey were available. In the laboratory, our experiment revealed that spiders can significantly reduce sundew fitness. Our findings suggest that members of the plant and animal kingdoms can and do compete.

Genus-specificity of araneophagy of linyphiid spiders and spiders of other families (Arachnida, Araneae)

NARCIS (Netherlands)

Heuts, B.; Brunt, T.

2009-01-01

We found genus specificity of predation by spiders on other spiders in captivity which surpass them in body size (araneophagy). Adult specimens of three species of the linyphiid genus Walckenaeria which were successively tested for araneophagy (in the laboratory) in the order of first species

Approach and avoidance in fear of spiders

NARCIS (Netherlands)

Rinck, M.; Becker, E.S.

2007-01-01

We examined attitudes towards spiders by employing an Approach-Avoidance Task, in which participants respond to pictures by pulling a joystick towards themselves or by pushing it away from themselves. For spider fearfuls, this stimulus–response assignment is either compatible (push spiders away) or

Learning to avoid spiders: fear predicts performance, not competence.

Science.gov (United States)

Luo, Xijia; Becker, Eni S; Rinck, Mike

2018-01-05

We used an immersive virtual environment to examine avoidance learning in spider-fearful participants. In 3 experiments, participants were asked to repeatedly lift one of 3 virtual boxes, under which either a toy car or a spider appeared and then approached the participant. Participants were not told that the probability of encountering a spider differed across boxes. When the difference was large (Exps. 1 and 2), spider-fearfuls learned to avoid spiders by lifting the few-spiders-box more often and the many-spiders-box less often than non-fearful controls did. However, they hardly managed to do so when the probability differences were small (Exp. 3), and they did not escape from threat more quickly (Exp. 2). In contrast to the observed performance differences, spider-fearfuls and non-fearfuls showed equal competence, that is comparable post-experimental knowledge about the probability to encounter spiders under the 3 boxes. The limitations and implications of the present study are discussed.

Attention and amygdala activity: an fMRI study with spider pictures in spider phobia.

Science.gov (United States)

Alpers, Georg W; Gerdes, Antje B M; Lagarie, Bernadette; Tabbert, Katharina; Vaitl, Dieter; Stark, Rudolf

2009-06-01

Facilitated detection of threatening visual cues is thought to be adaptive. In theory, detection of threat cues should activate the amygdala independently from allocation of attention. However, previous studies using emotional facial expressions as well as phobic cues yielded contradictory results. We used fMRI to examine whether the allocation of attention to components of superimposed spider and bird displays modulates amygdala activation. Nineteen spider-phobic women were instructed to identify either a moving or a stationary animal in briefly presented double-exposure displays. Amygdala activation followed a dose-response relationship: Compared to congruent neutral displays (two birds), amygdala activation was most pronounced in response to congruent phobic displays (two spiders) and less but still significant in response to mixed displays (spider and bird) when attention was focused on the phobic component. When attention was focused on the neutral component, mixed displays did not result in significant amygdala activation. This was confirmed in a significant parametric graduation of the amygdala activation in the order of congruent phobic displays, mixed displays with attention focus on the spider, mixed displays with focus on the bird and congruent neutral displays. These results challenge the notion that amygdala activation in response to briefly presented phobic cues is independent from attention.

Locating and limiting radon in dwellings

International Nuclear Information System (INIS)

Hildingson, O.; Gustafsson, J.; Nilsson, I.

1984-01-01

More than 3,300 Swedish dwellings have an indoor radon daughter concentration above 400 Bq.m -3 (or 0.108 WL). It is considered to be unsafe to live in any of these dwellings and the radon daughter concentration has to be reduced. Before deciding what measures to take, it is important to determine the radon sources. Possible sources are exhalation from building materials and/or radon transport from the ground into the building through cracks and joints in the slab. Different methods of locating the sources have been developed. To locate cracks and joints in slabs the ventilation rate and the air pressure difference relative to the ground are changed while monitoring radon/radon daughter concentration. The effect of five different measures to reduce the indoor radon daughter concentration have also been evaluated: increased ventilation rate by mechanical ventilation, ventilation of the small spaces between the floor and the slab, sealing the surface of radon exhaling walls, sealing joints and cracks in the slab, and ventilation of the drainage under the slab. (author)

Uncovering the structure-function relationship in spider silk

Science.gov (United States)

Yarger, Jeffery L.; Cherry, Brian R.; van der Vaart, Arjan

2018-03-01

All spiders produce protein-based biopolymer fibres that we call silk. The most studied of these silks is spider dragline silk, which is very tough and relatively abundant compared with other types of spider silks. Considerable research has been devoted to understanding the relationship between the molecular structure and mechanical properties of spider dragline silks. In this Review, we overview experimental and computational studies that have provided a wealth of detail at the molecular level on the highly conserved repetitive core and terminal regions of spider dragline silk. We also discuss the role of the nanocrystalline β-sheets and amorphous regions in determining the properties of spider silk fibres, endowing them with strength and elasticity. Additionally, we outline imaging techniques and modelling studies that elucidate the importance of the hierarchical structure of silk fibres at the molecular level. These insights into structure-function relationships can guide the reverse engineering of spider silk to enable the production of superior synthetic fibres.

Animal coloration: sexy spider scales.

Science.gov (United States)

Taylor, Lisa A; McGraw, Kevin J

2007-08-07

Many male jumping spiders display vibrant colors that are used in visual communication. A recent microscopic study on a jumping spider from Singapore shows that three-layered 'scale sandwiches' of chitin and air are responsible for producing their brilliant iridescent body coloration.

Time-dependent motor properties of multipedal molecular spiders.

Science.gov (United States)

Samii, Laleh; Blab, Gerhard A; Bromley, Elizabeth H C; Linke, Heiner; Curmi, Paul M G; Zuckermann, Martin J; Forde, Nancy R

2011-09-01

Molecular spiders are synthetic biomolecular walkers that use the asymmetry resulting from cleavage of their tracks to bias the direction of their stepping motion. Using Monte Carlo simulations that implement the Gillespie algorithm, we investigate the dependence of the biased motion of molecular spiders, along with binding time and processivity, on tunable experimental parameters, such as number of legs, span between the legs, and unbinding rate of a leg from a substrate site. We find that an increase in the number of legs increases the spiders' processivity and binding time but not their mean velocity. However, we can increase the mean velocity of spiders with simultaneous tuning of the span and the unbinding rate of a spider leg from a substrate site. To study the efficiency of molecular spiders, we introduce a time-dependent expression for the thermodynamic efficiency of a molecular motor, allowing us to account for the behavior of spider populations as a function of time. Based on this definition, we find that spiders exhibit transient motor function over time scales of many hours and have a maximum efficiency on the order of 1%, weak compared to other types of molecular motors.

Natural history of the trapdoor spider Idiops joida Gupta et al 2013 (Araneae: Idiopidae from the Western Ghats in India

Directory of Open Access Journals (Sweden)

Neha Gupta

2015-03-01

Full Text Available We studied the habitat preferences and burrow characteristics of trapdoor spiders, Idiops joida Gupta et al 2013, within Dandeli Wildlife Sanctuary and nearby reserve forests of Uttara Kannada district of Karnataka, Western Ghats, India, from January 2010 to April 2010. We sampled 293 plots using 5 m2 quadrats, randomly placed in six habitat types at four localities. Spiders showed patchy distribution throughout the study area. The density of I. joida was highest in uncanopied habitats having sparse vegetation or bare grounds. Steep slopes were strongly preferred by spiders. Burrow characteristics of I. joida, such as burrow diameter, depth, and lid thickness, were independent of habitat type.

Cognitive bias in spider-phobic children: Comparison of a pictorial and a linguistic spider Stroop.

NARCIS (Netherlands)

Kindt, M.; Brosschot, J.F.

1999-01-01

Examined the relation between spider fear in children and cognitive processing bias toward threatening information. It was investigated whether spider fear in children is related to a cognitive bias for threatening pictures and words. Pictorial and linguistic Stroop stimuli were administered to 28

Molecular phylogeny of Pompilinae (Hymenoptera: Pompilidae): Evidence for rapid diversification and host shifts in spider wasps.

Science.gov (United States)

Rodriguez, Juanita; Pitts, James P; Florez, Jaime A; Bond, Jason E; von Dohlen, Carol D

2016-01-01

Pompilinae is one of the largest subfamilies of spider wasps (Pompilidae). Most pompilines are generalist spider predators at the family level, but some taxa exhibit ecological specificity (i.e., to spider-host guild). Here we present the first molecular phylogenetic analysis of Pompilinae, toward the aim of evaluating the monophyly of tribes and genera. We further test whether changes in the rate of diversification are associated with host-guild shifts. Molecular data were collected from five nuclear loci (28S, EF1-F2, LWRh, Wg, Pol2) for 76 taxa in 39 genera. Data were analyzed using maximum likelihood (ML) and Bayesian inference (BI). The phylogenetic results were compared with previous hypotheses of subfamilial and tribal classification, as well as generic relationships in the subfamily. The classification of Pompilus and Agenioideus is also discussed. A Bayesian relaxed molecular clock analysis was used to examine divergence times. Diversification rate-shift tests accounted for taxon-sampling bias using ML and BI approaches. Ancestral host family and host guild were reconstructed using MP and ML methods. Ancestral host guild for all Pompilinae, for the ancestor at the node where a diversification rate-shift was detected, and two more nodes back in time was inferred using BI. In the resulting phylogenies, Aporini was the only previously proposed monophyletic tribe. Several genera (e.g., Pompilus, Microphadnus and Schistonyx) are also not monophyletic. Dating analyses produced a well-supported chronogram consistent with topologies from BI and ML results. The BI ancestral host-use reconstruction inferred the use of spiders belonging to the guild "other hunters" (frequenting the ground and vegetation) as the ancestral state for Pompilinae. This guild had the highest probability for the ML reconstruction and was equivocal for the MP reconstruction; various switching events to other guilds occurred throughout the evolution of the group. The diversification of

Recent advances in the understanding of brown spider venoms: From the biology of spiders to the molecular mechanisms of toxins.

Science.gov (United States)

Gremski, Luiza Helena; Trevisan-Silva, Dilza; Ferrer, Valéria Pereira; Matsubara, Fernando Hitomi; Meissner, Gabriel Otto; Wille, Ana Carolina Martins; Vuitika, Larissa; Dias-Lopes, Camila; Ullah, Anwar; de Moraes, Fábio Rogério; Chávez-Olórtegui, Carlos; Barbaro, Katia Cristina; Murakami, Mario Tyago; Arni, Raghuvir Krishnaswamy; Senff-Ribeiro, Andrea; Chaim, Olga Meiri; Veiga, Silvio Sanches

2014-06-01

The Loxosceles genus spiders (the brown spiders) are encountered in all the continents, and the clinical manifestations following spider bites include skin necrosis with gravitational lesion spreading and occasional systemic manifestations, such as intravascular hemolysis, thrombocytopenia and acute renal failure. Brown spider venoms are complex mixtures of toxins especially enriched in three molecular families: the phospholipases D, astacin-like metalloproteases and Inhibitor Cystine Knot (ICK) peptides. Other toxins with low level of expression also present in the venom include the serine proteases, serine protease inhibitors, hyaluronidases, allergen factors and translationally controlled tumor protein (TCTP). The mechanisms by which the Loxosceles venoms act and exert their noxious effects are not fully understood. Except for the brown spider venom phospholipase D, which causes dermonecrosis, hemolysis, thrombocytopenia and renal failure, the pathological activities of the other venom toxins remain unclear. The objective of the present review is to provide insights into the brown spider venoms and loxoscelism based on recent results. These insights include the biology of brown spiders, the clinical features of loxoscelism and the diagnosis and therapy of brown spider bites. Regarding the brown spider venom, this review includes a description of the novel toxins revealed by molecular biology and proteomics techniques, the data regarding three-dimensional toxin structures, and the mechanism of action of these molecules. Finally, the biotechnological applications of the venom components, especially for those toxins reported as recombinant molecules, and the challenges for future study are discussed. Copyright © 2014 Elsevier Ltd. All rights reserved.

Spiders (Arachnida: Araneae of Gujarat University Campus, Ahmedabad, India with additional description of Eilica tikaderi (Platnick, 1976

Directory of Open Access Journals (Sweden)

Dhruv A. Prajapati

2016-09-01

Full Text Available We report a checklist of spiders based on a survey made from August 2013 to July 2014 in Gujarat University Campus, an urban area located in the middle of Ahmadabad City, Gujarat State. A total of 77 species of spiders belonging to 53 genera and 20 families of spiders were recorded from the study area represented by 31.74% of the total 63 families reported from India. Salticidae was found to be the most dominant family with 18 species from 14 genera. Guild structure analysis revealed six feeding guilds, namely stalkers, orb-web builders, space-web builders, ambushers, foliage hunters and ground runners. Stalkers and orb-web builders were the most dominant feeding guilds representing 28.58% and 20.78% respectively among all studied guilds. Species Eilica tikaderi (Platnick, 1976 is reported for the first time from Gujarat with additional description and detailed genitalic illustrations.

Maternal care and subsocial behaviour in spiders.

Science.gov (United States)

Yip, Eric C; Rayor, Linda S

2014-05-01

While most spiders are solitary and opportunistically cannibalistic, a variety of social organisations has evolved in a minority of spider species. One form of social organisation is subsociality, in which siblings remain together with their parent for some period of time but disperse prior to independent reproduction. We review the literature on subsocial and maternal behaviour in spiders to highlight areas in which subsocial spiders have informed our understanding of social evolution and to identify promising areas of future research. We show that subsocial behaviour has evolved independently at least 18 times in spiders, across a wide phylogenetic distribution. Subsocial behaviour is diverse in terms of the form of care provided by the mother, the duration of care and sibling association, the degree of interaction and cooperation among siblings, and the use of vibratory and chemical communication. Subsocial spiders are useful model organisms to study various topics in ecology, such as kin recognition and the evolution of cheating and its impact on societies. Further, why social behaviour evolved in some lineages and not others is currently a topic of debate in behavioural ecology, and we argue that spiders offer an opportunity to untangle the ecological causes of parental care, which forms the basis of many other animal societies. © 2013 The Authors. Biological Reviews © 2013 Cambridge Philosophical Society.

Checklist of spider fauna of FR Peshawar, FATA, Pakistan

Directory of Open Access Journals (Sweden)

F. Perveen

2012-03-01

Full Text Available The spiders are known as poisonous arthropods, but they also act as the predator or biological pests control agent. Their 23 species belonging to 15 genera and 09 families were reported during 2009-2010 from FR Peshawar, FATA, Pakistan. The reported families Clubionidae, Scytodidae and Sprassidae covered each 4%, Araneidae, Gnaphosidae, Pholicidae and Salticidae each 9%, Thomisidae 13% and Lycosidae 43% biodiversity of spiders of FATA. However, the largest spider collected was huntsman, Isopoda tuhodnigra (Barrion with total body length 15.80+-0.83 mm. Moreover, the smallest spider was wolf spider, Pardosa birmanica (Simon with total body length 4.20+-1.30 mm. Further, the crab spiders, Thomisus pugilis (Stoliczka, T. spectabilis (Doleschall and Diaea evanida (Thorell were the most colorful species belonging to family Thomisidae. A detail study is required for further exploration of spider fauna of FATA.

Inbreeding avoidance in spiders: evidence for rescue effect in fecundity of female spiders with outbreeding opportunity

DEFF Research Database (Denmark)

Bilde, T.; Maklakov, A.A.; Schilling, Nadia

2007-01-01

avoidance can be because of low risk of inbreeding, variation in tolerance to inbreeding or high costs of outbreeding. We examined the relationship between inbreeding depression and inbreeding avoidance adaptations under two levels of inbreeding in the spider Oedothorax apicatus, asking whether preference...... for unrelated sperm via pre- and/or post-copulatory mechanisms could restore female fitness when inbreeding depression increases. Using inbred isofemale lines we provided female spiders with one or two male spiders of different relatedness in five combinations: one male sib; one male nonsib; two male sibs; two...

Understanding Spider-Man: Your Everyday Superhero

OpenAIRE

Falk, Nicklas; Blomsterberg, Sofie Amalie; Suciu, Alice Sabrina; Pedersen, Mads Peter; Lucas, Vilhelm

2014-01-01

This project focuses on the understanding of Spider-Man, and the morals and ethics that lie behind the choices he makes. Through the Dimensions Philosophy & Science/Text & Sign, this understanding is concluded by looking at ethical theories and comic book analysis. Based on the Ultimate Spider-Man comic book series, the aim is to clarify who Spider-Man is and what causes him to act in certain ways; before and after his realization of power. Some theories used to investigate these area...

Effects of a Major Tree Invader on Urban Woodland Arthropods

Science.gov (United States)

2015-01-01

Biological invasions are a major threat to biodiversity; however, the degree of impact can vary depending on the ecosystem and taxa. Here, we test whether a top invader at a global scale, the tree Robinia pseudoacacia (black locust or false acacia), which is known to profoundly change site conditions, significantly affects urban animal diversity. As a first multi-taxon study of this kind, we analyzed the effects of Robinia dominance on 18 arthropod taxa by pairwise comparisons of woodlands in Berlin, Germany, that were dominated by R. pseudoacacia or the native pioneer tree Betula pendula. As a negative effect, abundances of five arthropod taxa decreased (Chilopoda, Formicidae, Diptera, Heteroptera, Hymenoptera); 13 others were not affected. Woodland type affected species composition of carabids and functional groups in spiders, but surprisingly did not decrease alpha and beta diversity of carabid and spider assemblages or the number of endangered species. Tree invasion thus did not induce biotic homogenization at the habitat scale. We detected no positive effects of alien dominance. Our results illustrate that invasions by a major tree invader can induce species turnover in ground-dwelling arthropods, but do not necessarily reduce arthropod species abundances or diversity and might thus contribute to the conservation of epigeal invertebrates in urban settings. Considering the context of invasion impacts thus helps to set priorities in managing biological invasions and can illustrate the potential of novel ecosystems to maintain urban biodiversity. PMID:26359665

Effects of a Major Tree Invader on Urban Woodland Arthropods.

Directory of Open Access Journals (Sweden)

Sascha Buchholz

Full Text Available Biological invasions are a major threat to biodiversity; however, the degree of impact can vary depending on the ecosystem and taxa. Here, we test whether a top invader at a global scale, the tree Robinia pseudoacacia (black locust or false acacia, which is known to profoundly change site conditions, significantly affects urban animal diversity. As a first multi-taxon study of this kind, we analyzed the effects of Robinia dominance on 18 arthropod taxa by pairwise comparisons of woodlands in Berlin, Germany, that were dominated by R. pseudoacacia or the native pioneer tree Betula pendula. As a negative effect, abundances of five arthropod taxa decreased (Chilopoda, Formicidae, Diptera, Heteroptera, Hymenoptera; 13 others were not affected. Woodland type affected species composition of carabids and functional groups in spiders, but surprisingly did not decrease alpha and beta diversity of carabid and spider assemblages or the number of endangered species. Tree invasion thus did not induce biotic homogenization at the habitat scale. We detected no positive effects of alien dominance. Our results illustrate that invasions by a major tree invader can induce species turnover in ground-dwelling arthropods, but do not necessarily reduce arthropod species abundances or diversity and might thus contribute to the conservation of epigeal invertebrates in urban settings. Considering the context of invasion impacts thus helps to set priorities in managing biological invasions and can illustrate the potential of novel ecosystems to maintain urban biodiversity.

Effects of a Major Tree Invader on Urban Woodland Arthropods.

Science.gov (United States)

Buchholz, Sascha; Tietze, Hedwig; Kowarik, Ingo; Schirmel, Jens

2015-01-01

Biological invasions are a major threat to biodiversity; however, the degree of impact can vary depending on the ecosystem and taxa. Here, we test whether a top invader at a global scale, the tree Robinia pseudoacacia (black locust or false acacia), which is known to profoundly change site conditions, significantly affects urban animal diversity. As a first multi-taxon study of this kind, we analyzed the effects of Robinia dominance on 18 arthropod taxa by pairwise comparisons of woodlands in Berlin, Germany, that were dominated by R. pseudoacacia or the native pioneer tree Betula pendula. As a negative effect, abundances of five arthropod taxa decreased (Chilopoda, Formicidae, Diptera, Heteroptera, Hymenoptera); 13 others were not affected. Woodland type affected species composition of carabids and functional groups in spiders, but surprisingly did not decrease alpha and beta diversity of carabid and spider assemblages or the number of endangered species. Tree invasion thus did not induce biotic homogenization at the habitat scale. We detected no positive effects of alien dominance. Our results illustrate that invasions by a major tree invader can induce species turnover in ground-dwelling arthropods, but do not necessarily reduce arthropod species abundances or diversity and might thus contribute to the conservation of epigeal invertebrates in urban settings. Considering the context of invasion impacts thus helps to set priorities in managing biological invasions and can illustrate the potential of novel ecosystems to maintain urban biodiversity.

Molluscan assemblages on coral reefs and associated hard substrata in the northern Red Sea

Science.gov (United States)

Zuschin, M.; Hohenegger, J.; Steininger, F.

2001-09-01

Information on spatial variability and distribution patterns of organisms in coral reef environments is necessary to evaluate the increasing anthropogenic disturbance of marine environments (Richmond 1993; Wilkinson 1993; Dayton 1994). Therefore different types of subtidal, reef-associated hard substrata (reef flats, reef slopes, coral carpets, coral patches, rock grounds), each with different coral associations, were investigated to determine the distribution pattern of molluscs and their life habits (feeding strategies and substrate relations). The molluscs were strongly dominated by taxa with distinct relations to corals, and five assemblages were differentiated. The Dendropoma maxima assemblage on reef flats is a discrete entity, strongly dominated by this encrusting and suspension-feeding gastropod. All other assemblages are arranged along a substrate gradient of changing coral associations and potential molluscan habitats. The Coralliophila neritoidea- Barbatia foliata assemblage depends on the presence of Porites and shows a dominance of gastropods feeding on corals and of bivalves associated with living corals. The Chamoidea- Cerithium spp. assemblage on rock grounds is strongly dominated by encrusting bivalves. The Drupella cornus-Pteriidae assemblage occurs on Millepora- Acropora reef slopes and is strongly dominated by bivalves associated with living corals. The Barbatia setigera- Ctenoides annulata assemblage includes a broad variety of taxa, molluscan life habits and bottom types, but occurs mainly on faviid carpets and is transitional among the other three assemblages. A predicted degradation of coral coverage to rock bottoms due to increasing eutrophication and physical damage in the study area (Riegl and Piller 2000) will result in a loss of coral-associated molluscs in favor of bivalve crevice dwellers in dead coral heads and of encrusters on dead hard substrata.

Learned predation risk management by spider mites

Directory of Open Access Journals (Sweden)

Thomas eHackl

2014-09-01

Full Text Available Predation is a prime selective force shaping prey behavior. Investment in anti-predator behavior is traded-off against time and energy for other fitness-enhancing activities such as foraging or reproduction. To optimize this benefit/cost trade-off, prey should be able to innately and/or by experience modulate their behavior to the level of predation risk. Here, we assessed learned predation risk management in the herbivorous two-spotted spider mite Tetranychus urticae. We exposed spider mites coming from benign (naïve or high immediate predation risk (experienced environments to latent and/or no risk and assessed their site choice, activity and oviposition. Benign environments were characterized by the absence of any predator cues, high immediate risk environments by killed spider mites, physical presence of the predatory mite Phytoseiulus persimilis and associated chemosensory traces left on the surface, and latent risk environments by only predator traces. In the no-choice experiment both naïve and experienced spider mites laid their first egg later on leaves with than without predator traces. Irrespective of predator traces presence/absence, experienced mites laid their first egg earlier than naïve ones did. Naïve spider mites were more active, indicating higher restlessness, and laid fewer eggs on leaves with predator traces, whereas experienced mites were less active and laid similar numbers of eggs on leaves with and without predator traces. In the choice experiment both naïve and experienced spider mites preferentially resided and oviposited on leaves without predator traces but experienced mites were less active than naïve ones. Overall, our study suggests that spider mites experienced with high predation risk behave bolder under latent risk than naïve spider mites. Since predator traces alone do not indicate immediate risk, we argue that the attenuated anti-predator response of experienced spider mites represents adaptive learned

No pain, no gain: Male plasticity in burrow digging according to female rejection in a sand-dwelling wolf spider.

Science.gov (United States)

Carballo, Matilde; Baldenegro, Fabiana; Bollatti, Fedra; Peretti, Alfredo V; Aisenberg, Anita

2017-07-01

Behavioral plasticity allows individuals to reversibly respond to short-term variations in their ecological and social environment in order to maximize their fitness. Allocosa senex is a burrow-digging spider that inhabits the sandy coasts of South America. This species shows a reversal in typical sex roles expected in spiders: females are wanderers that visit males at their burrows and initiate courtship. They prefer males with long burrows for mating, and males prefer virgin over mated females. We tested whether female sexual rejection induced males to enlarge their burrows and if female reproductive status affected males' responses. We exposed males who had constructed burrows to: a) virgin females or b) mated females, (n=16 for each category). If female rejection occurred, we repeated the trial 48h later with the same female. As control, we maintained a group of males without female exposure (unexposed group, n=32). Rejected males enlarged their burrows more frequently and burrows were longer compared to unexposed males. However, frequency and length of enlargement did not differ according to female reproductive status. Males of A. senex showed plasticity in digging behavior in response to the availability of females, as a way to maximize the possibilities of future mating. Copyright © 2017 Elsevier B.V. All rights reserved.

Ground stone tool assemblages at the end of the Chalcolithic period: A preliminary analysis of the Late Chalcolithic sites in the Fazael Valley

Directory of Open Access Journals (Sweden)

Haggai Cohen-Klonymus

2016-10-01

Full Text Available The very Late Chalcolithic sites of the Fazael Valley exhibit changes in settlement patterns and material culture. This paper presents the analysis of the ground stone tool assemblages of these sites, and includes the combination of attribute analysis, functional typology, and spatial and contextual analyses, allowing comparisons both between the different sites and between different phases within the sites. The assemblages of the late sites of Fazael 2 and Fazael 7 show similar use of raw materials and tool design, which is clearly different from the assemblage of the earlier typical Ghassulian Chalcolithic site of Fazael 1. In Fazael 2, two phases revealed a shift from the use of large grinding tools to mortars and small grinding tools. In both the earlier and the later phases, the separation of activity areas within the site is clear. Grinding activity in both phases is restricted to the western side of the site, while mortars and spindle whorls were found only in the south-eastern part. Finally, a comparison with Fazael 1, as well as with other Late Chalcolithic sites, such as Gilat, 'Ein Hilu and 'En Esur, show that the large number of mortars found in Fazael 2 and Fazael 7 is unique, and may hint at a shift to different subsistence strategies appearing in this region in the latest phases of the Chalcolithic period.

Prey interception drives web invasion and spider size determines successful web takeover in nocturnal orb-web spiders.

Science.gov (United States)

Gan, Wenjin; Liu, Shengjie; Yang, Xiaodong; Li, Daiqin; Lei, Chaoliang

2015-09-24

A striking feature of web-building spiders is the use of silk to make webs, mainly for prey capture. However, building a web is energetically expensive and increases the risk of predation. To reduce such costs and still have access to abundant prey, some web-building spiders have evolved web invasion behaviour. In general, no consistent patterns of web invasion have emerged and the factors determining web invasion remain largely unexplored. Here we report web invasion among conspecifics in seven nocturnal species of orb-web spiders, and examined the factors determining the probability of webs that could be invaded and taken over by conspecifics. About 36% of webs were invaded by conspecifics, and 25% of invaded webs were taken over by the invaders. A web that was built higher and intercepted more prey was more likely to be invaded. Once a web was invaded, the smaller the size of the resident spider, the more likely its web would be taken over by the invader. This study suggests that web invasion, as a possible way of reducing costs, may be widespread in nocturnal orb-web spiders. © 2015. Published by The Company of Biologists Ltd.

Prey interception drives web invasion and spider size determines successful web takeover in nocturnal orb-web spiders

Directory of Open Access Journals (Sweden)

Wenjin Gan

2015-10-01

Full Text Available A striking feature of web-building spiders is the use of silk to make webs, mainly for prey capture. However, building a web is energetically expensive and increases the risk of predation. To reduce such costs and still have access to abundant prey, some web-building spiders have evolved web invasion behaviour. In general, no consistent patterns of web invasion have emerged and the factors determining web invasion remain largely unexplored. Here we report web invasion among conspecifics in seven nocturnal species of orb-web spiders, and examined the factors determining the probability of webs that could be invaded and taken over by conspecifics. About 36% of webs were invaded by conspecifics, and 25% of invaded webs were taken over by the invaders. A web that was built higher and intercepted more prey was more likely to be invaded. Once a web was invaded, the smaller the size of the resident spider, the more likely its web would be taken over by the invader. This study suggests that web invasion, as a possible way of reducing costs, may be widespread in nocturnal orb-web spiders.

First report of clinical presentation of a bite by a running spider, Philodromus sp. (Araneae: Philodromidae), with recommendations for spider bite management.

Science.gov (United States)

Coetzee, Maureen; Dippenaar, Ansie; Frean, John; Hunt, Richard H

2017-06-30

This article describes the clinical progression of symptoms over a period of 5 days of a bite inflicted by a Philodromus sp. spider. Commonly known as 'running spiders', these are not considered to be harmful to humans. This report, however, is the first description of an actual bite by a member of this group of spiders showing cytotoxic envenomation. Management of the bites should be as recommended for other cytotoxic spider bites.

Responses of predatory invertebrates to seeding density and plant species richness in experimental tallgrass prairie restorations

Science.gov (United States)

Nemec, Kristine T.; Allen, Craig R.; Danielson, Stephen D.; Helzer, Christopher J.

2014-01-01

In recent decades, agricultural producers and non-governmental organizations have restored thousands of hectares of former cropland in the central United States with native grasses and forbs. However, the ability of these grassland restorations to attract predatory invertebrates has not been well documented, even though predators provide an important ecosystem service to agricultural producers by naturally regulating herbivores. This study assessed the effects of plant richness and seeding density on the richness and abundance of surface-dwelling (ants, ground beetles, and spiders) and aboveground (ladybird beetles) predatory invertebrates. In the spring of 2006, twenty-four 55 m × 55 m-plots were planted to six replicates in each of four treatments: high richness (97 species typically planted by The Nature Conservancy), at low and high seeding densities, and low richness (15 species representing a typical Natural Resources Conservation Service Conservation Reserve Program mix, CP25), at low and high seeding densities. Ants, ground beetles, and spiders were sampled using pitfall traps and ladybird beetles were sampled using sweep netting in 2007–2009. The abundance of ants, ground beetles, and spiders showed no response to seed mix richness or seeding density but there was a significant positive effect of richness on ladybird beetle abundance. Seeding density had a significant positive effect on ground beetle and spider species richness and Shannon–Weaver diversity. These results may be related to differences in the plant species composition and relative amount of grass basal cover among the treatments rather than richness.

Biomechanics of Spider Silks

Science.gov (United States)

2006-03-02

water and deformation conditions. Such fibres [Nexia ’ biosteel ’ silk ] were spun from recombinant silk ’cloned’ from Spidroin II and indeed show 67...SUBTITLE 5. FUNDING NUMBERS Biomechanics of Spider Silks F49620-03-1-0111 6. AUTHOR(S) Fritz Vollrath 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES...Perform Pro, WHSIDIOR, Oct 94 COVER SHEET FINAL (3rd Year) Report to AFOSR on: BIOMECHANICS OF SPIDER SILKS Fritz Vollrath, Oxford University, England

Sex-specific kleptoparasitic foraging in ant-eating spiders

DEFF Research Database (Denmark)

Martisová, Martina; Bilde, T.; Pekar, Stano

2009-01-01

. To investigate this hypothesis, we studied the effect of sex and life history stage on the frequency of kleptoparasitism in ant-eating spiders of the genus Zodarion in the field. These spiders use a special capture technique involving a quick attack on an ant that is left unguarded by spiders for several minutes......, providing ample opportunities for kleptoparasitism. We found that adult females consistently hunted actively, while adult males ceased active prey capture and instead engaged in kleptoparasitism. Juvenile spiders were active hunters irrespective of sex. Consistent with an ontogenetic shift in foraging...

Specific predictive power of automatic spider-related affective associations for controllable and uncontrollable fear responses toward spiders

NARCIS (Netherlands)

Huijdlng, J; de Jong, PJ; Huijding, J.

This study examined the predictive power of automatically activated spider-related affective associations for automatic and controllable fear responses. The Extrinsic Affective Simon Task (EAST; De Houwer, 2003) was used to indirectly assess automatic spider fear-related associations. The EAST and

Segregated Planktonic and Bottom-Dwelling Archaeal Communities in High-Temperature Acidic/Sulfuric Ponds of the Tatun Volcano Group, Northern Taiwan

Directory of Open Access Journals (Sweden)

Ting-Wen Cheng

2013-01-01

Full Text Available Geothermal environments are characterized by dynamic redox and temperature fluctuations inherited from the exposure of deeply-sourced, hot, reducing fluids to low-temperature, oxidizing ambient environments. To investigate whether microbial assemblages shifted in response to the changes of a redox state within acidic hot ponds, we collected three paired water and sediment samples from the Tatun Volcano Group, assessed metabolic roles of community members, and correlated their functional capabilities with geochemical factors along depth. Molecular analyses revealed that Sulfolobus spp., Acidianus spp. and Vulcanisaeta spp. capable of respiring elemental sulfur under oxic and/or low-oxygen conditions were the major archaeal members in planktonic communities. In contrast, obligate anaerobic Caldisphaera spp. dominated over others in bottom-dwelling communities. Bacteria were only detected in one locality wherein the majority was affiliated with microaerophilic Hydrogenobaculum spp. Cluster analyses indicated that archaeal communities associated with sediments tended to cluster together and branch off those with water. In addition, the quantities of dissolved oxygen within the water column were substantially less than those in equilibrium with atmospheric oxygen, indicating a net oxygen consumption most likely catalyzed by microbial processes. These lines of evidence suggest that the segregation of planktonic from bottom-dwelling archaeal assemblages could be accounted for by the oxygen affinities inherited in individual archaeal members. Community assemblages in geothermal ecosystems would be often underrepresented without cautious sampling of both water and sediments.

Changes in ground beetle assemblages above and below the treeline of the Dolomites after almost 30 years (1980/2009).

Science.gov (United States)

Pizzolotto, Roberto; Gobbi, Mauro; Brandmayr, Pietro

2014-04-01

Very little is known about the changes of ground beetle assemblages in the last few decades in the Alps, and different responses to climate change of animal populations living above and below the treeline have not been estimated yet. This study focuses on an altitudinal habitat sequence from subalpine spruce forest to alpine grassland in a low disturbance area of the southeastern Dolomites in Italy, the Paneveggio Regional Park. We compared the ground beetle (Carabidae) populations sampled in 1980 in six stands below and above the treeline (1650-2250 m a.s.l.) with those sampled in the same sites almost 30 years later (2008/9). Quantitative data (species richness and abundance) have been compared by means of several diversity indexes and with a new index, the Index of Rank-abundance Change (IRC). Our work shows that species richness and abundance have changed after almost 30 years as a consequence of local extinctions, uphill increment of abundance and uphill shift of distribution range. The overall species number dropped from 36 to 27, while in the sites above the treeline, species richness and abundance changed more than in the forest sites. Two microtherm characteristic species of the pioneer cushion grass mats, Nebria germari and Trechus dolomitanus, became extinct or showed strong abundance reduction. In Nardetum pastures, several hygrophilic species disappeared, and xerophilic zoophytophagous elements raised their population density. In forest ecosystems, the precipitation reduction caused deep soil texture and watering changes, driving a transformation from Sphagnum-rich (peaty) to humus-rich soil, and as a consequence, soil invertebrate biomass strongly increased and thermophilic carabids enriched the species structure. In three decades, Carabid assemblages changed consistently with the hypothesis that climate change is one of the main factors triggering natural environment modifications. Furthermore, the level of human disturbance could enhance the

Disentangling the phylogenetic and ecological components of spider phenotypic variation.

Science.gov (United States)

Gonçalves-Souza, Thiago; Diniz-Filho, José Alexandre Felizola; Romero, Gustavo Quevedo

2014-01-01

An understanding of how the degree of phylogenetic relatedness influences the ecological similarity among species is crucial to inferring the mechanisms governing the assembly of communities. We evaluated the relative importance of spider phylogenetic relationships and ecological niche (plant morphological variables) to the variation in spider body size and shape by comparing spiders at different scales: (i) between bromeliads and dicot plants (i.e., habitat scale) and (ii) among bromeliads with distinct architectural features (i.e., microhabitat scale). We partitioned the interspecific variation in body size and shape into phylogenetic (that express trait values as expected by phylogenetic relationships among species) and ecological components (that express trait values independent of phylogenetic relationships). At the habitat scale, bromeliad spiders were larger and flatter than spiders associated with the surrounding dicots. At this scale, plant morphology sorted out close related spiders. Our results showed that spider flatness is phylogenetically clustered at the habitat scale, whereas it is phylogenetically overdispersed at the microhabitat scale, although phylogenic signal is present in both scales. Taken together, these results suggest that whereas at the habitat scale selective colonization affect spider body size and shape, at fine scales both selective colonization and adaptive evolution determine spider body shape. By partitioning the phylogenetic and ecological components of phenotypic variation, we were able to disentangle the evolutionary history of distinct spider traits and show that plant architecture plays a role in the evolution of spider body size and shape. We also discussed the relevance in considering multiple scales when studying phylogenetic community structure.

[Transcatheter embolization for huge pulmonary arteriovenous fistula using metallic "spider" and spring embolus--application of hand-made metallic "spider" using partial monorail technique].

Science.gov (United States)

Hirota, S; Sako, M; Fujita, Y; Hasegawa, Y; Sugimoto, K; Suzuki, Y; Kono, M

1992-07-25

We performed transcatheter embolization in two cases with huge pulmonary arteriovenous fistula (AVF) using a metallic "spider" and spring embolus. Conventional spring embolus or detachable balloon could not be used in these cases. Metallic spider was indicated for pulmonary AVF with a feeding artery diameter of more than 16 mm to prevent embolus passing through the AVF. In the first case, we used large handmade metallic spiders of 25 mm in diameter followed by embolization by numerous spring coils. At that time, a partial monorail technique was newly devised to carry the large metallic spider into the feeding artery, otherwise the spider could not pass into a 9F catheter. After embolization, symptoms and PaO2 in arterial blood improved remarkably in both cases. In the second case, a spring coil migrated into the normal pulmonary artery, but no infarction resulted. In conclusion, the metallic spider was very useful for embolization of hugee pulmonary AVF to avoid the embolus passing through and to tangle spring coils together with it. If commercially available "spiders" are too small, ones can be made easily.

Second-order nonlinear optical microscopy of spider silk

Science.gov (United States)

Zhao, Yue; Hien, Khuat Thi Thu; Mizutani, Goro; Rutt, Harvey N.

2017-06-01

Asymmetric β-sheet protein structures in spider silk should induce nonlinear optical interaction such as second harmonic generation (SHG) which is experimentally observed for a radial line and dragline spider silk using an imaging femtosecond laser SHG microscope. By comparing different spider silks, we found that the SHG signal correlates with the existence of the protein β-sheets. Measurements of the polarization dependence of SHG from the dragline indicated that the β-sheet has a nonlinear response depending on the direction of the incident electric field. We propose a model of what orientation the β-sheet takes in spider silk.

Tangled in a sparse spider web

DEFF Research Database (Denmark)

Dimitrov, Dimitar Stefanov; Lopardo, Lara; Giribet, Gonzalo

2012-01-01

In order to study the tempo and the mode of spider orb web evolution and diversification, we conducted a phylogenetic analysis using six genetic markers along with a comprehensive taxon sample. The present analyses are the first to recover the monophyly of orb-weaving spiders based solely on DNA ...

Sclerotherapy of Varicose Veins and Spider Veins

Science.gov (United States)

... Index A-Z Sclerotherapy of Varicose Veins and Spider Veins Sclerotherapy uses injections from a very fine, ... Sclerotherapy? What is Sclerotherapy of Varicose Veins and Spider Veins? Sclerotherapy is a minimally invasive treatment used ...

Assassin bug uses aggressive mimicry to lure spider prey.

Science.gov (United States)

Wignall, Anne E; Taylor, Phillip W

2011-05-07

Assassin bugs (Stenolemus bituberus) hunt web-building spiders by invading the web and plucking the silk to generate vibrations that lure the resident spider into striking range. To test whether vibrations generated by bugs aggressively mimic the vibrations generated by insect prey, we compared the responses of spiders to bugs with how they responded to prey, courting male spiders and leaves falling into the web. We also analysed the associated vibrations. Similar spider orientation and approach behaviours were observed in response to vibrations from bugs and prey, whereas different behaviours were observed in response to vibrations from male spiders and leaves. Peak frequency and duration of vibrations generated by bugs were similar to those generated by prey and courting males. Further, vibrations from bugs had a temporal structure and amplitude that were similar to vibrations generated by leg and body movements of prey and distinctly different to vibrations from courting males or leaves, or prey beating their wings. To be an effective predator, bugs do not need to mimic the full range of prey vibrations. Instead bugs are general mimics of a subset of prey vibrations that fall within the range of vibrations classified by spiders as 'prey'.

SPIDER: CMB Polarimetry from the Edge of Space

Energy Technology Data Exchange (ETDEWEB)

Gualtieri, R.; et al.

2017-11-28

SPIDER is a balloon-borne instrument designed to map the polarization of the millimeter-wave sky at large angular scales. SPIDER targets the B-mode signature of primordial gravitational waves in the cosmic microwave background (CMB), with a focus on mapping a large sky area with high fidelity at multiple frequencies. SPIDER's first longduration balloon (LDB) flight in January 2015 deployed a total of 2400 antenna-coupled Transition Edge Sensors (TESs) at 90 GHz and 150 GHz. In this work we review the design and in-flight performance of the SPIDER instrument, with a particular focus on the measured performance of the detectors and instrument in a space-like loading and radiation environment. SPIDER's second flight in December 2018 will incorporate payload upgrades and new receivers to map the sky at 285 GHz, providing valuable information for cleaning polarized dust emission from CMB maps.

Ichthyoplankton assemblages of coastal west-central Lake Erie and associated habitat characteristics

Science.gov (United States)

McKenna, J.E.; Hunter, R. Douglas; Fabrizio, M.C.; Savino, J.F.; Todd, T.N.; Bur, M.

2008-01-01

Early life stage survival often determines fish cohort strength and that survival is affected by habitat conditions. The structure and dynamics of ichthyoplankton assemblages can tell us much about biodiversity and fish population dynamics, but are poorly understood in nearshore areas of the Great Lakes, where most spawning and nursery habitats exist. Ichthyoplankton samples were collected with a neuston net in waters 2-13 m deep weekly or biweekly from mid-April through August, during 3 years (2000-2002) as part of a study of fish assemblages in west-central Lake Erie. A suite of abiotic variables was simultaneously measured to characterize habitat. Cluster and ordination analyses revealed several distinct ichthyoplankton assemblages that changed seasonally. A lake whitefish (Coregonus clupeaformis) dominated assemblage appeared first in April. In May, assemblages were dominated by several percid species. Summer assemblages were overwhelmingly dominated by emerald shiner (Notropis atherinoides), with large gizzard shad (Dorosoma cepedianum) and alewife (Alosa pseudoharengus) components. This seasonal trend in species assemblages was also associated with increasing temperature and water clarity. Water depth and drift processes may also play a role in structuring these assemblages. The most common and widely distributed assemblages were not associated with substratum type, which we characterized as either hard or soft. The timing of hatch and larval growth separated the major groups in time and may have adaptive significance for the members of each major assemblage. The quality and locations (with reference to lake circulation) of spawning and nursery grounds may determine larval success and affect year class strength.

Cuticular antifungals in spiders: density- and condition dependence.

Directory of Open Access Journals (Sweden)

Daniel González-Tokman

Full Text Available Animals living in groups face a high risk of disease contagion. In many arthropod species, cuticular antimicrobials constitute the first protective barrier that prevents infections. Here we report that group-living spiders produce cuticular chemicals which inhibit fungal growth. Given that cuticular antifungals may be costly to produce, we explored whether they can be modulated according to the risk of contagion (i.e. under high densities. For this purpose, we quantified cuticular antifungal activity in the subsocial crab spider Diaea ergandros in both natural nests and experimentally manipulated nests of varying density. We quantified the body-condition of spiders to test whether antifungal activity is condition dependent, as well as the effect of spider density on body-condition. We predicted cuticular antifungal activity to increase and body-condition to decrease with high spider densities, and that antifungal activity would be inversely related to body-condition. Contrary to our predictions, antifungal activity was neither density- nor condition-dependent. However, body-condition decreased with density in natural nests, but increased in experimental nests. We suggest that pathogen pressure is so important in nature that it maintains high levels of cuticular antifungal activity in spiders, impacting negatively on individual energetic condition. Future studies should identify the chemical structure of the isolated antifungal compounds in order to understand the physiological basis of a trade-off between disease prevention and energetic condition caused by group living, and its consequences in the evolution of sociality in spiders.

Cuticular antifungals in spiders: density- and condition dependence.

Science.gov (United States)

González-Tokman, Daniel; Ruch, Jasmin; Pulpitel, Tamara; Ponton, Fleur

2014-01-01

Animals living in groups face a high risk of disease contagion. In many arthropod species, cuticular antimicrobials constitute the first protective barrier that prevents infections. Here we report that group-living spiders produce cuticular chemicals which inhibit fungal growth. Given that cuticular antifungals may be costly to produce, we explored whether they can be modulated according to the risk of contagion (i.e. under high densities). For this purpose, we quantified cuticular antifungal activity in the subsocial crab spider Diaea ergandros in both natural nests and experimentally manipulated nests of varying density. We quantified the body-condition of spiders to test whether antifungal activity is condition dependent, as well as the effect of spider density on body-condition. We predicted cuticular antifungal activity to increase and body-condition to decrease with high spider densities, and that antifungal activity would be inversely related to body-condition. Contrary to our predictions, antifungal activity was neither density- nor condition-dependent. However, body-condition decreased with density in natural nests, but increased in experimental nests. We suggest that pathogen pressure is so important in nature that it maintains high levels of cuticular antifungal activity in spiders, impacting negatively on individual energetic condition. Future studies should identify the chemical structure of the isolated antifungal compounds in order to understand the physiological basis of a trade-off between disease prevention and energetic condition caused by group living, and its consequences in the evolution of sociality in spiders.

Brain systems underlying encounter expectancy bias in spider phobia.

Science.gov (United States)

Aue, Tatjana; Hoeppli, Marie-Eve; Piguet, Camille; Hofstetter, Christoph; Rieger, Sebastian W; Vuilleumier, Patrik

2015-06-01

Spider-phobic individuals are characterized by exaggerated expectancies to be faced with spiders (so-called encounter expectancy bias). Whereas phobic responses have been linked to brain systems mediating fear, little is known about how the recruitment of these systems relates to exaggerated expectancies of threat. We used fMRI to examine spider-phobic and control participants while they imagined visiting different locations in a forest after having received background information about the likelihood of encountering different animals (spiders, snakes, and birds) at these locations. Critically, imagined encounter expectancies modulated brain responses differently in phobics as compared with controls. Phobics displayed stronger negative modulation of activity in the lateral prefrontal cortex, precuneus, and visual cortex by encounter expectancies for spiders, relative to snakes or birds (within-participants analysis); these effects were not seen in controls. Between-participants correlation analyses within the phobic group further corroborated the hypothesis that these phobia-specific modulations may underlie irrationality in encounter expectancies (deviations of encounter expectancies from objective background information) in spider phobia; the greater the negative modulation a phobic participant displayed in the lateral prefrontal cortex, precuneus, and visual cortex, the stronger was her bias in encounter expectancies for spiders. Interestingly, irrationality in expectancies reflected in frontal areas relied on right rather than left hemispheric deactivations. Our data accord with the idea that expectancy biases in spider phobia may reflect deficiencies in cognitive control and contextual integration that are mediated by right frontal and parietal areas.

The aerodynamic signature of running spiders.

Directory of Open Access Journals (Sweden)

Jérôme Casas

Full Text Available Many predators display two foraging modes, an ambush strategy and a cruising mode. These foraging strategies have been classically studied in energetic, biomechanical and ecological terms, without considering the role of signals produced by predators and perceived by prey. Wolf spiders are a typical example; they hunt in leaf litter either using an ambush strategy or by moving at high speed, taking over unwary prey. Air flow upstream of running spiders is a source of information for escaping prey, such as crickets and cockroaches. However, air displacement by running arthropods has not been previously examined. Here we show, using digital particle image velocimetry, that running spiders are highly conspicuous aerodynamically, due to substantial air displacement detectable up to several centimetres in front of them. This study explains the bimodal distribution of spider's foraging modes in terms of sensory ecology and is consistent with the escape distances and speeds of cricket prey. These findings may be relevant to the large and diverse array of arthropod prey-predator interactions in leaf litter.

Biotechnological Trends in Spider and Scorpion Antivenom Development

DEFF Research Database (Denmark)

Laustsen, Andreas Hougaard; Solà, Mireia; Jappe, Emma Christine

2016-01-01

in using bioactive toxins from spiders and scorpions for drug discovery purposes and for solving crystal structures of membrane-embedded receptors. Additionally, the identification and isolation of a myriad of spider and scorpion toxins has allowed research within next generation antivenoms to progress...... at an increasingly faster pace. In this review, the current knowledge of spider and scorpion venoms is presented, followed by a discussion of all published biotechnological efforts within development of spider and scorpion antitoxins based on small molecules, antibodies and fragments thereof, and next generation...... immunization strategies. The increasing number of discovery and development efforts within this field may point towards an upcoming transition from serum-based antivenoms towards therapeutic solutions based on modern biotechnology....

Biased interpretation and memory in children with varying levels of spider fear.

Science.gov (United States)

Klein, Anke M; Titulaer, Geraldine; Simons, Carlijn; Allart, Esther; de Gier, Erwin; Bögels, Susan M; Becker, Eni S; Rinck, Mike

2014-01-01

This study investigated multiple cognitive biases in children simultaneously, to investigate whether spider-fearful children display an interpretation bias, a recall bias, and source monitoring errors, and whether these biases are specific for spider-related materials. Furthermore, the independent ability of these biases to predict spider fear was investigated. A total of 121 children filled out the Spider Anxiety and Disgust Screening for Children (SADS-C), and they performed an interpretation task, a memory task, and a Behavioural Assessment Test (BAT). As expected, a specific interpretation bias was found: Spider-fearful children showed more negative interpretations of ambiguous spider-related scenarios, but not of other scenarios. We also found specific source monitoring errors: Spider-fearful children made more fear-related source monitoring errors for the spider-related scenarios, but not for the other scenarios. Only limited support was found for a recall bias. Finally, interpretation bias, recall bias, and source monitoring errors predicted unique variance components of spider fear.

Competitive interactions between a native spider (Frontinella communis, Araneae: Linyphiidae) and an invasive spider (Linyphia triangularis, Araneae: Linyphiidae)

Science.gov (United States)

Bednarski, Julie V.; Ginsberg, Howard S.; Jakob, Elizabeth M.

2010-01-01

There are numerous reports of spiders that have become established outside of their native ranges, but few studies examine their impact on native spiders. We examined the effect of the European hammock spider Linyphia triangularis (Araneae, Linyphiidae) on the native bowl-and-doily spider Frontinella communis (Araneae, Linyphiidae) in Acadia National Park, Maine, USA. First, we added L. triangularis to established plots of F. communis. Significantly more F. communis abandoned their webs when L. triangularis were added compared to control plots. Second, we tested whether F. communis were deterred from building webs in areas where L. triangularis was established. Significantly fewer F. communis built webs on plots with L. triangularis than on control plots. In both experiments, L. triangularis sometimes took over webs of F. communis or incorporated F. communis webs into their own webs, but F. communisnever took over or incorporated L. triangularis webs. Competition between L. triangularis and F. communis for both webs and web sites may contribute to the decline of F. communis.

Flourish or flush: effects of simulated extreme rainfall events on Sphagnum-dwelling testate amoebae in a subarctic bog (Abisko, Sweden).

Science.gov (United States)

Tsyganov, Andrey N; Keuper, Frida; Aerts, Rien; Beyens, Louis

2013-01-01

Extreme precipitation events are recognised as important drivers of ecosystem responses to climate change and can considerably affect high-latitude ombrotrophic bogs. Therefore, understanding the relationships between increased rainfall and the biotic components of these ecosystems is necessary for an estimation of climate change impacts. We studied overall effects of increased magnitude, intensity and frequency of rainfall on assemblages of Sphagnum-dwelling testate amoebae in a field climate manipulation experiment located in a relatively dry subarctic bog (Abisko, Sweden). The effects of the treatment were estimated using abundance, species diversity and structure of living and empty shell assemblages of testate amoebae in living and decaying layers of Sphagnum. Our results show that increased rainfall reduced the mean abundance and species richness of living testate amoebae. Besides, the treatment affected species structure of both living and empty shell assemblages, reducing proportions of hydrophilous species. The effects are counterintuitive as increased precipitation-related substrate moisture was expected to have opposite effects on testate amoeba assemblages in relatively dry biotopes. Therefore, we conclude that other rainfall-related factors such as increased infiltration rates and frequency of environmental disturbances can also affect testate amoeba assemblages in Sphagnum and that hydrophilous species are particularly sensitive to variation in these environmental variables.

Induction of direct and indirect plant responses by jasmonic acid, low spider mite densities, or a combination of jasmonic acid treatment and spider mite infestation.

Science.gov (United States)

Gols, Rieta; Roosjen, Mara; Dijkman, Herman; Dicke, Marcel

2003-12-01

Jasmonic acid (JA) and the octadecanoid pathway are involved in both induced direct and induced indirect plant responses. In this study, the herbivorous mite, Tetranychus urticae, and its predator, Phytoseiulus persimilis, were given a choice between Lima bean plants induced by JA or spider mites and uninduced control plants. Infestation densities resulting in the induction of predator attractants were much lower than thus far assumed, i.e., predatory mites were significantly attracted to plants that were infested for 2 days with only one or four spider mites per plant. Phytoseiulus persimilis showed a density-dependent response to volatiles from plants that were infested with different numbers of spider mites. Similarly, treating plants with increasing concentrations of JA also led to increased attraction of P. persimilis. Moreover, the duration of spider mite infestation was positively correlated with the proportion of predators that were attracted to mite-infested plants. A pretreatment of the plants with JA followed by a spider mite infestation enhanced the attraction of P. persimilis to plant volatiles compared to attraction to volatiles from plants that were only infested with spider mites and did not receive a pretreatment with JA. The herbivore, T. urticae preferred leaf tissue that previously had been infested with conspecifics to uninfested leaf tissue. In the case of choice tests with JA-induced and control leaf tissue, spider mites slightly preferred control leaf tissue. When spider mites were given a choice between leaf discs induced by JA and leaf discs damaged by spider mite feeding, they preferred the latter. The presence of herbivore induced chemicals and/or spider mite products enhanced settlement of the mites, whereas treatment with JA seemed to impede settlement.

Spider foraging strategy affects trophic cascades under natural and drought conditions.

Science.gov (United States)

Liu, Shengjie; Chen, Jin; Gan, Wenjin; Schaefer, Douglas; Gan, Jianmin; Yang, Xiaodong

2015-07-23

Spiders can cause trophic cascades affecting litter decomposition rates. However, it remains unclear how spiders with different foraging strategies influence faunal communities, or present cascading effects on decomposition. Furthermore, increased dry periods predicted in future climates will likely have important consequences for trophic interactions in detritus-based food webs. We investigated independent and interactive effects of spider predation and drought on litter decomposition in a tropical forest floor. We manipulated densities of dominant spiders with actively hunting or sit-and-wait foraging strategies in microcosms which mimicked the tropical-forest floor. We found a positive trophic cascade on litter decomposition was triggered by actively hunting spiders under ambient rainfall, but sit-and-wait spiders did not cause this. The drought treatment reversed the effect of actively hunting spiders on litter decomposition. Under drought conditions, we observed negative trophic cascade effects on litter decomposition in all three spider treatments. Thus, reduced rainfall can alter predator-induced indirect effects on lower trophic levels and ecosystem processes, and is an example of how such changes may alter trophic cascades in detritus-based webs of tropical forests.

Spider Trait Assembly Patterns and Resilience under Fire-Induced Vegetation Change in South Brazilian Grasslands

Science.gov (United States)

Podgaiski, Luciana R.; Joner, Fernando; Lavorel, Sandra; Moretti, Marco; Ibanez, Sebastien; Mendonça, Milton de S.; Pillar, Valério D.

2013-01-01

Disturbances induce changes on habitat proprieties that may filter organism's functional traits thereby shaping the structure and interactions of many trophic levels. We tested if communities of predators with foraging traits dependent on habitat structure respond to environmental change through cascades affecting the functional traits of plants. We monitored the response of spider and plant communities to fire in South Brazilian Grasslands using pairs of burned and unburned plots. Spiders were determined to the family level and described in feeding behavioral and morphological traits measured on each individual. Life form and morphological traits were recorded for plant species. One month after fire the abundance of vegetation hunters and the mean size of the chelicera increased due to the presence of suitable feeding sites in the regrowing vegetation, but irregular web builders decreased due to the absence of microhabitats and dense foliage into which they build their webs. Six months after fire rosette-form plants with broader leaves increased, creating a favourable habitat for orb web builders which became more abundant, while graminoids and tall plants were reduced, resulting in a decrease of proper shelters and microclimate in soil surface to ground hunters which became less abundant. Hence, fire triggered changes in vegetation structure that lead both to trait-convergence and trait-divergence assembly patterns of spiders along gradients of plant biomass and functional diversity. Spider individuals occurring in more functionally diverse plant communities were more diverse in their traits probably because increased possibility of resource exploitation, following the habitat heterogeneity hypothesis. Finally, as an indication of resilience, after twelve months spider communities did not differ from those of unburned plots. Our findings show that functional traits provide a mechanistic understanding of the response of communities to environmental change

Peculiar torsion dynamical response of spider dragline silk

Science.gov (United States)

Liu, Dabiao; Yu, Longteng; He, Yuming; Peng, Kai; Liu, Jie; Guan, Juan; Dunstan, D. J.

2017-07-01

The torsional properties of spider dragline silks from Nephila edulis and Nephila pilipes spiders are investigated by using a torsion pendulum technique. A permanent torsional deformation is observed after even small torsional strain. This behaviour is quite different from that of the other materials tested here, i.e., carbon fiber, thin metallic wires, Kevlar fiber, and human hair. The spider dragline thus displays a strong energy dissipation upon the initial excitation (around 75% for small strains and more for a larger strain), which correspondingly reduces the amplitude of subsequent oscillations around the new equilibrium position. The variation of torsional stiffness in relaxation dynamics of spider draglines for different excitations is also determined. The experimental result is interpreted in the light of the hierarchical structure of dragline silk.

Plastic material investment in load-bearing silk attachments in spiders.

Science.gov (United States)

Wolff, Jonas O; Jones, Braxton; Herberstein, Marie E

2018-05-17

The nature and size of attachments is a fundamental element of animal constructions. Presumably, these adhesive structures are plastically deployed to balance material investment and attachment strength. Here we studied plasticity in dragline anchorages of the golden orb web spider, Nephila plumipes. Specifically, we predict that spiders adjust the size and structure of dragline anchorages with load, i.e. spider mass. Mass was manipulated by attaching lead pieces to the spider's abdomen resulting in a 50 percent increase in mass. Loaded spiders spun larger but structurally similar thread anchorages than unloaded spiders. Thus, the spinning program that determines the overall anchor structure is highly stereotypic, and flexibility is introduced through varying the anchor size by increasing material investment. Our study showcases substrate attachments as suitable models to investigate the interplay between innate and changeable elements in the economy of building behaviours. Copyright © 2018 Elsevier GmbH. All rights reserved.

Influence of spider silk on refugia preferences of the recluse spiders Loxosceles reclusa and Loxosceles laeta (Araneae: Sicariidae).

Science.gov (United States)

Vetter, Richard S; Rust, Michael K

2010-06-01

In a previous experimental study, recluse spiders Loxosceles reclusa Gertsch and Mulaik and Loxosceles laeta (Nicolet) (Araneae: Sicariidae) preferred small cardboard refugia covered with conspecific silk compared with never-occupied refugia. Herein, we investigated some factors that might be responsible for this preference using similar cardboard refugia. When the two Loxosceles species were given choices between refugia previously occupied by their own and by the congeneric species, neither showed a species-specific preference; however, each chose refugia coated with conspecific silk rather than those previously inhabited by a distantly related cribellate spider, Metaltella simoni (Keyserling). When L. laeta spiders were offered refugia that were freshly removed from silk donors compared with heated, aged refugia from the same silk donor, older refugia were preferred. Solvent extracts of L. laeta silk were chosen approximately as often as control refugia when a range of solvents (methylene chloride:methanol, water, and hexane) were used. However, when acetone was used on similar silk, there was a statistical preference for the control, indicating that there might be a mildly repellent aspect to acetone-washed silk. Considering the inability to show attraction to chemical aspects of fresh silk, it seems that physical attributes may be more important for selection and that there might be repellency to silk of a recently vacated spider. These findings are discussed in regard to pest management strategies to control recluse spiders.

Photoluminescent properties of spider silk coated with Eu-doped nanoceria

Energy Technology Data Exchange (ETDEWEB)

Dmitrović, Svetlana, E-mail: svetlana8@vin.bg.ac.rs [University of Belgrade, Vinča Institute of Nuclear Sciences (Serbia); Nikolić, Marko G.; Jelenković, Branislav [University of Belgrade, Institute of Physics (Serbia); Prekajski, Marija [University of Belgrade, Vinča Institute of Nuclear Sciences (Serbia); Rabasović, Mihailo [University of Belgrade, Institute of Physics (Serbia); Zarubica, Aleksandra [University of Niš, Department of Chemistry, Faculty of Science and Mathematics (Serbia); Branković, Goran [University of Belgrade, Institute for Multidisciplinary Research, Department of Material Science (Serbia); Matović, Branko [University of Belgrade, Vinča Institute of Nuclear Sciences (Serbia)

2017-02-15

Spider dragline silk was coated with pure as well as Eu-doped ceria nanopowders at the room temperature. The treatment was done by immersion of the spider silk mesh into aqueous solutions of cerium nitrate (Ce(NO{sub 3}){sub 3}) and ammonium hydroxide (NH{sub 4}OH). Depending on the relationship between Ce{sup 3+} ion and ammonium hydroxide concentration, coated fibers exhibited a different thickness. Obtained materials were studied by means of FESEM. It was found that ceria nanoparticles of average size of 3 nm were coated along spider thread. X-ray diffraction (XRD) and selected-area electron diffraction (SAED) confirmed crystal nature of nanoparticle coating of spider silk. By using Williamson-Hall plots, crystallite size and strain were estimated. EDS measurement confirmed the presence of Eu in spider-Eu-doped ceria composite, and according to FTIR analysis, the interaction between CeO2 and spider silk was proposed. The morphology of obtained composite was observed by TEM. The photoluminescence emission spectra of spider silk coated with Eu-doped ceria were measured with two different excitations of 385 and 466 nm. The two-photon excited auto-fluorescence of spider silk coated with Eu-doped ceria was detected using a nonlinear laser scanning microscope. Obtained composite has a potential as a fluorescent labeling material in diverse applications.

High School Students' Attitudes Towards Spiders: A cross-cultural comparison

Science.gov (United States)

Prokop, Pavol; Tolarovičová, Andrea; Camerik, Anne M.; Peterková, Viera

2010-08-01

Spiders are traditionally considered to be among the least popular of animals. Current evidence suggests that a negative attitude towards spiders could be influenced by both cultural and evolutionary pressures. Some researchers suggest that science education activities could positively influence students' perceptions of spiders. Their evidence is, however, ambivalent. Using a five-point score Likert-type questionnaire in which the items were developed in a similar way to four of Kellert's categories of attitude (scientistic, negativistic, naturalistic, and ecologistic) towards invertebrates, we compared the level of knowledge of and attitudes towards spiders of high school students from two countries, Slovakia (n = 354) and South Africa (n = 382). The students represented different cultures and followed dissimilar science education curricula. Only among the Slovakian students there was a statistically significant but low correlation between knowledge and attitude (r = 0.30). The South African students scored higher in the categories of scientistic, naturalistic, and ecologistic attitudes. Comparison of attitude towards spiders of indigenous Africans from coeducational Catholic schools revealed that South African students have greater fear of spiders than Slovakian students, supporting the biological preparedness hypothesis. This hypothesis predicts a greater fear of spiders in South Africa than in Europe since several South African spiders possess venoms that are dangerous to humans. The results of this study are discussed from science education, cultural, and evolutionary perspectives.

Photoluminescent properties of spider silk coated with Eu-doped nanoceria

International Nuclear Information System (INIS)

Dmitrović, Svetlana; Nikolić, Marko G.; Jelenković, Branislav; Prekajski, Marija; Rabasović, Mihailo; Zarubica, Aleksandra; Branković, Goran; Matović, Branko

2017-01-01

Spider dragline silk was coated with pure as well as Eu-doped ceria nanopowders at the room temperature. The treatment was done by immersion of the spider silk mesh into aqueous solutions of cerium nitrate (Ce(NO_3)_3) and ammonium hydroxide (NH_4OH). Depending on the relationship between Ce"3"+ ion and ammonium hydroxide concentration, coated fibers exhibited a different thickness. Obtained materials were studied by means of FESEM. It was found that ceria nanoparticles of average size of 3 nm were coated along spider thread. X-ray diffraction (XRD) and selected-area electron diffraction (SAED) confirmed crystal nature of nanoparticle coating of spider silk. By using Williamson-Hall plots, crystallite size and strain were estimated. EDS measurement confirmed the presence of Eu in spider-Eu-doped ceria composite, and according to FTIR analysis, the interaction between CeO2 and spider silk was proposed. The morphology of obtained composite was observed by TEM. The photoluminescence emission spectra of spider silk coated with Eu-doped ceria were measured with two different excitations of 385 and 466 nm. The two-photon excited auto-fluorescence of spider silk coated with Eu-doped ceria was detected using a nonlinear laser scanning microscope. Obtained composite has a potential as a fluorescent labeling material in diverse applications.

Science 101: Why Don't Spiders Stick to Their Own Webs?

Science.gov (United States)

Robertson, Bill

2011-01-01

This article explains why spiders don't stick to their webs. Spiders don't get stuck in their own webs (and they aren't immune to their own glue) because they use a combination of sticky and nonsticky threads (different glands for producing those), and the glue is in droplets that the spider can avoid but the prey can't. The spider's nervous…

Salticid predation as one potential driving force of ant mimicry in jumping spiders

Science.gov (United States)

Huang, Jin-Nan; Cheng, Ren-Chung; Li, Daiqin; Tso, I-Min

2011-01-01

Many spiders possess myrmecomorphy, and species of the jumping spider genus Myrmarachne exhibit nearly perfect ant mimicry. Most salticids are diurnal predators with unusually high visual acuity that prey on various arthropods, including conspecifics. In this study, we tested whether predation pressure from large jumping spiders is one possible driving force of perfect ant mimicry in jumping spiders. The results showed that small non-ant-mimicking jumping spiders were readily treated as prey by large ones (no matter whether heterospecific or conspecific) and suffered high attack and mortality rates. The size difference between small and large jumping spiders significantly affected the outcomes of predatory interactions between them: the smaller the juvenile jumping spiders, the higher the predation risk from large ones. The attack and mortality rates of ant-mimicking jumping spiders were significantly lower than those of non-ant-mimicking jumping spiders, indicating that a resemblance to ants could provide protection against salticid predation. However, results of multivariate behavioural analyses showed that the responses of large jumping spiders to ants and ant-mimicking salticids differed significantly. Results of this study indicate that predation pressure from large jumping spiders might be one selection force driving the evolution of nearly perfect myrmecomorphy in spiders and other arthropods. PMID:20961898

Research on Artificial Spider Web Model for Farmland Wireless Sensor Network

Directory of Open Access Journals (Sweden)

Jun Wang

2018-01-01

Full Text Available Through systematic analysis of the structural characteristics and invulnerability of spider web, this paper explores the possibility of combining the advantages of spider web such as network robustness and invulnerability with farmland wireless sensor network. A universally applicable definition and mathematical model of artificial spider web structure are established. The comparison between artificial spider web and traditional networks is discussed in detail. The simulation result shows that the networking structure of artificial spider web is better than that of traditional networks in terms of improving the overall reliability and invulnerability of communication system. A comprehensive study on the advantage characteristics of spider web has important theoretical and practical significance for promoting the invulnerability research of farmland wireless sensor network.

Silk Spinning in Silkworms and Spiders.

Science.gov (United States)

Andersson, Marlene; Johansson, Jan; Rising, Anna

2016-08-09

Spiders and silkworms spin silks that outcompete the toughness of all natural and manmade fibers. Herein, we compare and contrast the spinning of silk in silkworms and spiders, with the aim of identifying features that are important for fiber formation. Although spiders and silkworms are very distantly related, some features of spinning silk seem to be universal. Both spiders and silkworms produce large silk proteins that are highly repetitive and extremely soluble at high pH, likely due to the globular terminal domains that flank an intermediate repetitive region. The silk proteins are produced and stored at a very high concentration in glands, and then transported along a narrowing tube in which they change conformation in response primarily to a pH gradient generated by carbonic anhydrase and proton pumps, as well as to ions and shear forces. The silk proteins thereby convert from random coil and alpha helical soluble conformations to beta sheet fibers. We suggest that factors that need to be optimized for successful production of artificial silk proteins capable of forming tough fibers include protein solubility, pH sensitivity, and preservation of natively folded proteins throughout the purification and initial spinning processes.

A novel neurotoxin from venom of the spider, Brachypelma albopilosum.

Directory of Open Access Journals (Sweden)

Yunhua Zhong

Full Text Available Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana and Tenebrio molitor (common mealbeetle. This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation.

Research on Artificial Spider Web Model for Farmland Wireless Sensor Network

OpenAIRE

Jun Wang; Song Gao; Shimin Zhao; Guang Hu; Xiaoli Zhang; Guowang Xie

2018-01-01

Through systematic analysis of the structural characteristics and invulnerability of spider web, this paper explores the possibility of combining the advantages of spider web such as network robustness and invulnerability with farmland wireless sensor network. A universally applicable definition and mathematical model of artificial spider web structure are established. The comparison between artificial spider web and traditional networks is discussed in detail. The simulation result shows tha...

Spider diffraction: a comparison of curved and straight legs

International Nuclear Information System (INIS)

Richter, J.L.

1984-01-01

It has been known for some time that, if curved legs rather than the usual straight ones are used in the spider that supports the secondary optics in certain telescopes, the visible diffraction effect is reduced. Fraunhofer theory is used to calculate the diffraction effects due to the curved leg spider. Calculated and photographic diffraction patterns are compared for straight and curved leg spiders

High School Students' Attitudes towards Spiders: A Cross-Cultural Comparison

Science.gov (United States)

Prokop, Pavol; Tolarovicova, Andrea; Camerik, Anne M.; Peterkova, Viera

2010-01-01

Spiders are traditionally considered to be among the least popular of animals. Current evidence suggests that a negative attitude towards spiders could be influenced by both cultural and evolutionary pressures. Some researchers suggest that science education activities could positively influence students' perceptions of spiders. Their evidence is,…

Optically probing torsional superelasticity in spider silks

Energy Technology Data Exchange (ETDEWEB)

Kumar, Bhupesh; Thakur, Ashish; Panda, Biswajit; Singh, Kamal P. [Department of Physical Sciences, IISER Mohali, Sector 81, Manauli, Mohali 140306 (India)

2013-11-11

We investigate torsion mechanics of various spider silks using a sensitive optical technique. We find that spider silks are torsionally superelastic in that they can reversibly withstand great torsion strains of over 10{sup 2−3} rotations per cm before failure. Among various silks from a spider, we find the failure twist-strain is greatest in the sticky capture silk followed by dragline and egg-case silk. Our in situ laser-diffraction measurements reveal that torsional strains on the silks induce a nano-scale transverse compression in its diameter that is linear and reversible. These unique torsional properties of the silks could find applications in silk-based materials and devices.

Optically probing torsional superelasticity in spider silks

International Nuclear Information System (INIS)

Kumar, Bhupesh; Thakur, Ashish; Panda, Biswajit; Singh, Kamal P.

2013-01-01

We investigate torsion mechanics of various spider silks using a sensitive optical technique. We find that spider silks are torsionally superelastic in that they can reversibly withstand great torsion strains of over 10 2−3 rotations per cm before failure. Among various silks from a spider, we find the failure twist-strain is greatest in the sticky capture silk followed by dragline and egg-case silk. Our in situ laser-diffraction measurements reveal that torsional strains on the silks induce a nano-scale transverse compression in its diameter that is linear and reversible. These unique torsional properties of the silks could find applications in silk-based materials and devices

And along Came a Spider: An Attentional Bias for the Detection of Spiders in Young Children and Adults

Science.gov (United States)

LoBue, Vanessa

2010-01-01

Spiders are among the most common targets of fears and phobias in the world. In visual search tasks, adults detect their presence more rapidly than other kinds of stimuli. Reported here is an investigation of whether young children share this attentional bias for the detection of spiders. In a series of experiments, preschoolers and adults were…

Early events in the evolution of spider silk genes.

Directory of Open Access Journals (Sweden)

James Starrett

Full Text Available Silk spinning is essential to spider ecology and has had a key role in the expansive diversification of spiders. Silk is composed primarily of proteins called spidroins, which are encoded by a multi-gene family. Spidroins have been studied extensively in the derived clade, Orbiculariae (orb-weavers, from the suborder Araneomorphae ('true spiders'. Orbicularians produce a suite of different silks, and underlying this repertoire is a history of duplication and spidroin gene divergence. A second class of silk proteins, Egg Case Proteins (ECPs, is known only from the orbicularian species, Lactrodectus hesperus (Western black widow. In L. hesperus, ECPs bond with tubuliform spidroins to form egg case silk fibers. Because most of the phylogenetic diversity of spiders has not been sampled for their silk genes, there is limited understanding of spidroin gene family history and the prevalence of ECPs. Silk genes have not been reported from the suborder Mesothelae (segmented spiders, which diverged from all other spiders >380 million years ago, and sampling from Mygalomorphae (tarantulas, trapdoor spiders and basal araneomorph lineages is sparse. In comparison to orbicularians, mesotheles and mygalomorphs have a simpler silk biology and thus are hypothesized to have less diversity of silk genes. Here, we present cDNAs synthesized from the silk glands of six mygalomorph species, a mesothele, and a non-orbicularian araneomorph, and uncover a surprisingly rich silk gene diversity. In particular, we find ECP homologs in the mesothele, suggesting that ECPs were present in the common ancestor of extant spiders, and originally were not specialized to complex with tubuliform spidroins. Furthermore, gene-tree/species-tree reconciliation analysis reveals that numerous spidroin gene duplications occurred after the split between Mesothelae and Opisthothelae (Mygalomorphae plus Araneomorphae. We use the spidroin gene tree to reconstruct the evolution of amino acid

Silk elasticity as a potential constraint on spider body size.

Science.gov (United States)

Rodríguez-Gironés, Miguel A; Corcobado, Guadalupe; Moya-Laraño, Jordi

2010-10-07

Silk is known for its strength and extensibility and has played a key role in the radiation of spiders. Individual spiders use different glands to produce silk types with unique sets of proteins. Most research has studied the properties of major ampullate and capture spiral silks and their ecological implications, while little is known about minor ampullate silk, the type used by those spider species studied to date for bridging displacements. A biomechanical model parameterised with available data shows that the minimum radius of silk filaments required for efficient bridging grows with the square root of the spider's body mass, faster than the radius of minor ampullate silk filaments actually produced by spiders. Because the morphology of spiders adapted to walking along or under silk threads is ill suited for moving on a solid surface, for these species there is a negative relationship between body mass and displacement ability. As it stands, the model suggests that spiders that use silk for their displacements are prevented from attaining a large body size if they must track their resources in space. In particular, silk elasticity would favour sexual size dimorphism because males that must use bridging lines to search for females cannot grow large. 2010 Elsevier Ltd. All rights reserved.

Herbivory in spiders: the importance of pollen for orb-weavers.

Science.gov (United States)

Eggs, Benjamin; Sanders, Dirk

2013-01-01

Orb-weaving spiders (Araneidae) are commonly regarded as generalist insect predators but resources provided by plants such as pollen may be an important dietary supplementation. Their webs snare insect prey, but can also trap aerial plankton like pollen and fungal spores. When recycling their orb webs, the spiders may therefore also feed on adhering pollen grains or fungal spores via extraoral digestion. In this study we measured stable isotope ratios in the bodies of two araneid species (Aculepeira ceropegia and Araneus diadematus), their potential prey and pollen to determine the relative contribution of pollen to their diet. We found that about 25% of juvenile orb-weaving spiders' diet consisted of pollen, the other 75% of flying insects, mainly small dipterans and hymenopterans. The pollen grains in our study were too large to be taken up accidentally by the spiders and had first to be digested extraorally by enzymes in an active act of consumption. Therefore, pollen can be seen as a substantial component of the spiders' diet. This finding suggests that these spiders need to be classified as omnivores rather than pure carnivores.

Molecular Evolution of Spider Vision: New Opportunities, Familiar Players.

Science.gov (United States)

Morehouse, Nathan I; Buschbeck, Elke K; Zurek, Daniel B; Steck, Mireille; Porter, Megan L

2017-08-01

Spiders are among the world's most species-rich animal lineages, and their visual systems are likewise highly diverse. These modular visual systems, composed of four pairs of image-forming "camera" eyes, have taken on a huge variety of forms, exhibiting variation in eye size, eye placement, image resolution, and field of view, as well as sensitivity to color, polarization, light levels, and motion cues. However, despite this conspicuous diversity, our understanding of the genetic underpinnings of these visual systems remains shallow. Here, we review the current literature, analyze publicly available transcriptomic data, and discuss hypotheses about the origins and development of spider eyes. Our efforts highlight that there are many new things to discover from spider eyes, and yet these opportunities are set against a backdrop of deep homology with other arthropod lineages. For example, many (but not all) of the genes that appear important for early eye development in spiders are familiar players known from the developmental networks of other model systems (e.g., Drosophila). Similarly, our analyses of opsins and related phototransduction genes suggest that spider photoreceptors employ many of the same genes and molecular mechanisms known from other arthropods, with a hypothesized ancestral spider set of four visual and four nonvisual opsins. This deep homology provides a number of useful footholds into new work on spider vision and the molecular basis of its extant variety. We therefore discuss what some of these first steps might be in the hopes of convincing others to join us in studying the vision of these fascinating creatures.

Acute Generalized Exanthematous Pustulosis (AGEP Triggered by a Spider Bite

Directory of Open Access Journals (Sweden)

Michael Makris

2009-01-01

Discussion: A spider bite may represent a possible causative factor of AGEP. A spider's venom contains sphingomyelinase that stimulates the release of IL8 and GM-CSF, which are involved in AGEP pathogenesis. Whether or not the con-current use of antibiotics has an effect in AGEP appearance when combined with a spider's venom, cannot be excluded.

Coagulopathy after spider bites in a six-year-old boy

Directory of Open Access Journals (Sweden)

Ansari SH.

2008-06-01

Full Text Available Background: Spider bites are common in most parts of the world. In some areas, where snake or scorpion bites are common, spider bites may not be considered a significant problem by the general public and those who have been bitten by spiders may not go to a hospital. However, significant problems are observed in the victims of certain species of spiders including: widow spider (of the genus Latrodectus, including the black widow and brown spiders (of the genus Loxosceles, such as the brown recluse. Case: We report a six-year-old boy, admitted to the hospital two weeks after suffering a spider bite. The patient presented with a severe nose bleed, ecchymosis and purpura, as well as anemia, indicating a clotting disorder. Laboratory results revealed abnormal values for prothrombin time (PT >50 sec, partial thromboplastin time (PTT >120 min and fibrinogen = 0 mg/dl, whereas factor VIII was normal according to a mixing study, with a normal platelet count of 350,000/µl. The patient was managed with fresh frozen plasma every 12 h, and was discharged one week after hospital admission. At present, the patient is well with more normal laboratory results one month after treatment: PT=13.4 sec, PTT= 34 sec, fibrinogen=105 mg/dl.         Conclusions: Although spider bites are uncommon in Iran, severe systemic reactions may occur in the pediatric population requiring admission to the pediatric intensive care unit. These systemic reactions may include hemolytic anemia coagulopathy and renal failure.

Camel spider (Solifugae) use of prairie dog colonies

Science.gov (United States)

Solifugids (camel spiders) are widespread throughout arid regions of western North America and are thought to be important in structuring desert arthropod communities. Despite the ubiquity of camel spiders, little is known about their ecology. Black-tailed prairie dogs (Cynomys ludovicianus) are als...

Nutrient regulation in a predator, the wolf spider Pardosa prativaga

DEFF Research Database (Denmark)

Jensen, Kim; Mayntz, David; Toft, Søren

2011-01-01

Nutrient balancing is well known in herbivores and omnivores, but has only recently been demonstrated in predators. To test how a predator might regulate nutrients when the prey varies in nutrient composition, we restricted juvenile Pardosa prativaga wolf spiders to diets of one of six fruit fly......, Drosophila melanogaster, prey types varying in lipid:protein composition during their second instar. We collected all fly remnants to estimate food and nutrient intake over each meal. The spiders adjusted their capture rate and nutrient extraction in response to prey mass and nutrient composition...... irrespective of energy intake. Intake was initially regulated to a constant lipid plus protein mass, but later spiders fed on prey with high proportions of protein increased consumption relative to spiders fed on other prey types. This pattern indicates that the spiders were prepared to overconsume vast...

Arachnid aloft: directed aerial descent in neotropical canopy spiders.

Science.gov (United States)

Yanoviak, Stephen P; Munk, Yonatan; Dudley, Robert

2015-09-06

The behaviour of directed aerial descent has been described for numerous taxa of wingless hexapods as they fall from the tropical rainforest canopy, but is not known in other terrestrial arthropods. Here, we describe similar controlled aerial behaviours for large arboreal spiders in the genus Selenops (Selenopidae). We dropped 59 such spiders from either canopy platforms or tree crowns in Panama and Peru; the majority (93%) directed their aerial trajectories towards and then landed upon nearby tree trunks. Following initial dorsoventral righting when necessary, falling spiders oriented themselves and then translated head-first towards targets; directional changes were correlated with bilaterally asymmetric motions of the anterolaterally extended forelegs. Aerial performance (i.e. the glide index) decreased with increasing body mass and wing loading, but not with projected surface area of the spider. Along with the occurrence of directed aerial descent in ants, jumping bristletails, and other wingless hexapods, this discovery of targeted gliding in selenopid spiders further indicates strong selective pressures against uncontrolled falls into the understory for arboreal taxa. © 2015 The Author(s).

Spider silk reinforced by graphene or carbon nanotubes

Science.gov (United States)

Lepore, Emiliano; Bosia, Federico; Bonaccorso, Francesco; Bruna, Matteo; Taioli, Simone; Garberoglio, Giovanni; Ferrari, Andrea C.; Pugno, Nicola Maria

2017-09-01

Spider silk has promising mechanical properties, since it conjugates high strength (~1.5 GPa) and toughness (~150 J g-1). Here, we report the production of silk incorporating graphene and carbon nanotubes by spider spinning, after feeding spiders with the corresponding aqueous dispersions. We observe an increment of the mechanical properties with respect to pristine silk, up to a fracture strength ~5.4 GPa and a toughness modulus ~1570 J g-1. This approach could be extended to other biological systems and lead to a new class of artificially modified biological, or ‘bionic’, materials.

Parasitism of Trombidium brevimanum larvae on agrobiont linyphiid spiders from Germany.

Science.gov (United States)

Tomić, Vladimir; Mąkol, Joanna; Stamenković, Srdjan; Büchs, Wolfgang; Prescher, Sabine; Sivčev, Ivan; Graora, Draga; Sivčev, Lazar; Gotlin-Čuljak, Tatjana; Dudić, Boris

2015-08-01

An experiment on three differently-managed agricultural fields in Ahlum, Germany, which aimed at establishing the impact of different management systems on the biodiversity of predators and decomposers, yielded a significant number of spiders parasitized by larvae of Trombidium brevimanum (Actinotrichida, Parasitengona, Trombidiidae). Spider data from the whole sampling period (September 2010-July 2012), indicated that ectoparasitic larvae were recorded only on spiders in pitfall traps in the period of June-July 2011. In this period, only eight species of Linyphiidae--out of 42 species assigned to nine spider families recorded from the study area--were parasitized by mites; considerable levels of parasitism were recorded on Erigone atra, E. dentipalpis, and Oedothorax apicatus. The highest prevalence of parasitism was recorded on the organic field for E. atra (29%), while on the integrated and conventional fields significantly fewer parasitized spiders were observed. The preferred attachment sites on the spider host were regions with softer cuticle, especially regions on the carapace and on the abdomen, adjacent to the pedicel.

Cognitive reappraisal of snake and spider pictures: An event-related potentials study.

Science.gov (United States)

Langeslag, Sandra J E; van Strien, Jan W

2018-05-30

Fear of snakes and spiders are common animal phobias. Emotion regulation can change the response to emotional stimuli, including snakes and spiders. It is well known that emotion regulation modulates the late positive potential (LPP), which reflects sustained motivated attention. However, research concerning the effect of emotion regulation on the early posterior negativity (EPN), which reflects early selective attention, is scarce. The present research question was whether the EPN and LPP amplitudes are modulated by regulation of emotional responses to snake and spider stimuli. Emotion up- and down-regulation were expected to enhance and reduce the LPP amplitude, respectively, but emotion regulation was not expected to modulate the EPN amplitude. Female participants passively viewed snake, spider, and bird pictures, and up- and down-regulated their emotional responses to the snake and spider pictures using self-focused reappraisal, while their electroencephalogram was recorded. There were EPNs for snakes and spiders vs. birds, as well as for snakes vs. spiders. The LPP amplitude tended to be enhanced for snakes and spiders compared to birds. Most importantly, the LPP amplitude was larger in the up-regulate than in the down-regulate condition for both snakes and spiders, but there was no evidence that the EPN amplitude was modulated by emotion regulation. This suggests that emotion regulation modulated sustained motivated attention, but not early selective attention, to snakes and spiders. The findings are in line with the notion that the emotional modulation of the EPN is more automatic than the emotional modulation of the LPP. Copyright © 2018 Elsevier B.V. All rights reserved.

Early Cretaceous greenhouse pumped higher taxa diversification in spiders.

Science.gov (United States)

Shao, Lili; Li, Shuqiang

2018-05-24

The Cretaceous experienced one of the most remarkable greenhouse periods in geological history. During this time, ecosystem reorganizations significantly impacted the diversification of many groups of organisms. The rise of angiosperms marked a major biome turnover. Notwithstanding, relatively little remains known about how the Cretaceous global ecosystem impacted the evolution of spiders, which constitute one of the most abundant groups of predators. Herein, we evaluate the transcriptomes of 91 taxa representing more than half of the spider families. We add 23 newly sequenced taxa to the existing database to obtain a robust phylogenomic assessment. Phylogenetic reconstructions using different datasets and methods obtain novel placements of some groups, especially in the Synspermiata and the group having a retrolateral tibial apophysis (RTA). Molecular analyses indicate an expansion of the RTA clade at the Early Cretaceous with a hunting predatory strategy shift. Fossil analyses show a 7-fold increase of diversification rate at the same period, but this likely owes to the first occurrences spider in amber deposits. Additional analyses of fossil abundance show an accumulation of spider lineages in the Early Cretaceous. We speculate that the establishment of a warm greenhouse climate pumped the diversification of spiders, in particular among webless forms tracking the abundance of insect prey. Our study offers a new pathway for future investigations of spider phylogeny and diversification. Copyright © 2018. Published by Elsevier Inc.

Phylogenomics resolves a spider backbone phylogeny and rejects a prevailing paradigm for orb web evolution.

Science.gov (United States)

Bond, Jason E; Garrison, Nicole L; Hamilton, Chris A; Godwin, Rebecca L; Hedin, Marshal; Agnarsson, Ingi

2014-08-04

Spiders represent an ancient predatory lineage known for their extraordinary biomaterials, including venoms and silks. These adaptations make spiders key arthropod predators in most terrestrial ecosystems. Despite ecological, biomedical, and biomaterial importance, relationships among major spider lineages remain unresolved or poorly supported. Current working hypotheses for a spider "backbone" phylogeny are largely based on morphological evidence, as most molecular markers currently employed are generally inadequate for resolving deeper-level relationships. We present here a phylogenomic analysis of spiders including taxa representing all major spider lineages. Our robust phylogenetic hypothesis recovers some fundamental and uncontroversial spider clades, but rejects the prevailing paradigm of a monophyletic Orbiculariae, the most diverse lineage, containing orb-weaving spiders. Based on our results, the orb web either evolved much earlier than previously hypothesized and is ancestral for a majority of spiders or else it has multiple independent origins, as hypothesized by precladistic authors. Cribellate deinopoid orb weavers that use mechanically adhesive silk are more closely related to a diverse clade of mostly webless spiders than to the araneoid orb-weaving spiders that use adhesive droplet silks. The fundamental shift in our understanding of spider phylogeny proposed here has broad implications for interpreting the evolution of spiders, their remarkable biomaterials, and a key extended phenotype--the spider web. Copyright © 2014 Elsevier Ltd. All rights reserved.

Volatile compounds from leaves of the African spider plant (Gynandropsis gynandra) with bioactivity against spider mite (Tetranychus urticae)

DEFF Research Database (Denmark)

Nyalala, Samuel Odeyo; Petersen, Mikael Agerlin; Grout, Brian William Wilson

2013-01-01

Previous studies have demonstrated that Gynandropsis gynandra emits acetonitrile as a foliar volatile from intact plants and isolated leaves, and that this compound is an effective spider mite repellent. This study has used gas chromatography–mass spectrometry to investigate volatile compounds...... emitted from homogenised G. gynandra leaves to evaluate their tissue acetonitrile content and to look for other compounds that might be exploited for the management of spider mites. Acetonitrile was absent from the homogenised tissues of five lines of G. gynandra, studied over two seasons. Thirteen...... volatile compounds were emitted by G. gynandra at significantly higher levels than mite-susceptible pot roses, including isothiocyanates, aldehydes, esters, alcohols and terpenes. Six representative compounds were selected to assess bioactivity. Spider mite populations were completely inactive after a 2¿h...

Invited review current progress and limitations of spider silk for biomedical applications.

Science.gov (United States)

Widhe, Mona; Johansson, Jan; Hedhammar, My; Rising, Anna

2012-06-01

Spider silk is a fascinating material combining remarkable mechanical properties with low density and biodegradability. Because of these properties and historical descriptions of medical applications, spider silk has been proposed to be the ideal biomaterial. However, overcoming the obstacles to produce spider silk in sufficient quantities and in a manner that meets regulatory demands has proven to be a difficult task. Also, there are relatively few studies of spider silk in biomedical applications available, and the methods and materials used vary a lot. Herein we summarize cell culture- and in vivo implantation studies of natural and synthetic spider silk, and also review the current status and future challenges in the quest for a large scale production of spider silk for medical applications. Copyright © 2011 Wiley Periodicals, Inc.

Determination of PCDDs in spider webs: preliminary studies

Science.gov (United States)

Rybak, Justyna; Rutkowski, Radosław

2018-01-01

The application of spider webs for determination of polichlorinated dibenzo-para-dioxins (PCDDs) has been studied for the first time. The aim of the studies was to find out if spider webs are suitable for such examinations as it was proved in the previous research they are excellent indicators of air pollutants. Spiders are ubiquitous, thus collection of samples is easy and non-invasive. Studies were conducted within the city of Wrocław and surroundings, one of the biggest and at the same time heaviest polluted city in Poland. Five research sites have been chosen, where spider webs were collected after 60 days of continuous exposure time. Webs belonging to two genera Tegenaria sylvestris and Tegenaria ferruginea (family Agelenidae) have been chosen as they are large and very dense, thus they are very suitable for such examinations. Webs were found to retain dioxins probably mainly by external exposure. These promising results should be continued and expanded in the future research.

Spider fauna of semiarid eastern Colorado agroecosystems: diversity, abundance, and effects of crop intensification.

Science.gov (United States)

Kerzicnik, Lauren M; Peairs, Frank B; Cushing, Paula E; Draney, Michael L; Merrill, Scott C

2013-02-01

Spiders are critical predators in agroecosystems. Crop management practices can influence predator density and diversity, which, in turn, can influence pest management strategies. Crop intensification is a sustainable agricultural technique that can enhance crop production although optimizing soil moisture. To date, there is no information on how crop intensification affects natural enemy populations, particularly spiders. This study had two objectives: to characterize the abundance and diversity of spiders in eastern Colorado agroecosystems, and to test the hypothesis that spider diversity and density would be higher in wheat (Triticum aestivum L.) in crop-intensified rotations compared with wheat in conventional rotations. We collected spiders through pitfall, vacuum, and lookdown sampling from 2002 to 2007 to test these objectives. Over 11,000 spiders in 19 families from 119 species were captured from all sampling techniques. Interestingly, the hunting spider guild represented 89% of the spider fauna captured from all sites with the families Gnaphosidae and Lycosidae representing 75% of these spiders. Compared with European agroecosystems, these agroecosystems had greater diversity, which can be beneficial for the biological control of pests. Overall, spider densities were low in these semiarid cropping systems, and crop intensification effects on spider densities were not evident at this scale.

Extended spider cognition.

Science.gov (United States)

Japyassú, Hilton F; Laland, Kevin N

2017-05-01

There is a tension between the conception of cognition as a central nervous system (CNS) process and a view of cognition as extending towards the body or the contiguous environment. The centralised conception requires large or complex nervous systems to cope with complex environments. Conversely, the extended conception involves the outsourcing of information processing to the body or environment, thus making fewer demands on the processing power of the CNS. The evolution of extended cognition should be particularly favoured among small, generalist predators such as spiders, and here, we review the literature to evaluate the fit of empirical data with these contrasting models of cognition. Spiders do not seem to be cognitively limited, displaying a large diversity of learning processes, from habituation to contextual learning, including a sense of numerosity. To tease apart the central from the extended cognition, we apply the mutual manipulability criterion, testing the existence of reciprocal causal links between the putative elements of the system. We conclude that the web threads and configurations are integral parts of the cognitive systems. The extension of cognition to the web helps to explain some puzzling features of spider behaviour and seems to promote evolvability within the group, enhancing innovation through cognitive connectivity to variable habitat features. Graded changes in relative brain size could also be explained by outsourcing information processing to environmental features. More generally, niche-constructed structures emerge as prime candidates for extending animal cognition, generating the selective pressures that help to shape the evolving cognitive system.

Dealing with radon in dwellings

International Nuclear Information System (INIS)

Castren, O.

1987-01-01

A review is made of the measurements, regulatory initiatives and remedial action taken in Finland since the discovery in 1981 of the first indoor radon concentrations higher than 10,000 Bq/m 3 . The emphasis is on the results of measurements, explanations of them and their use for the rational solution of the radon problems. Localizing the high-concentration areas and dwellings has been one of the main objectives. The latest radon map is based on measurements in 8,150 dwellings in 235 localities. The geographical distribution cannot be explained only by the uranium concentration of the bedrock. The main reason for deviations is the ground permeability. The local fine structure is most notably influenced by the glacifluvial sand and grvel formations (eskers and ice-marginal formations). The highest concentrations are often caused by synergism between an elevated uranium concentration, situation on an esker and a great temperature difference between indoor and outdoor air. They are usually connected with a large seasonal variation, the concentration being at maximum during the coldest time in winter. Indoor radon distribution is compared with newly published maps on the incidence of lung cancer in Finland

Composition and daytime vertical distribution of the ichthyoplankton assemblage in the Central Cantabrian Sea shelf, during summer: An Eulerian study

Science.gov (United States)

Rodriguez, J. M.; Gonzalez-Pola, C.; Lopez-Urrutia, A.; Nogueira, E.

2011-09-01

During summer, wind driven coastal upwelling dominates in the Central Cantabrian Sea (southern Bay of Biscay). Nevertheless, atmospheric forcing is highly variable and wind pulses may cause noticeable and fast hydrographic responses in the shelf region. In this paper, the composition and vertical distribution of the summer ichthyoplankton assemblage during the daytime at a fixed station, located on the Central Cantabrian Sea shelf, are documented. Also, the impact of a short-time scale hydrographic event on the abundance and structure of the larval fish assemblage is examined. Significant small-scale temporal hydrographic variability was observed. Currents showed changes in speed and direction and significant changes in thermocline depth were also observed. A total of 34 taxa of fish larvae were identified. Engraulis encrasicolus eggs and larvae of the shelf-dwelling species Trachurus trachurus, Capros aper and E. encrasicolus dominated the ichthyoplankton assemblage. The distribution of E. encrasicolus eggs and fish larvae was vertically structured. E. encrasicolus egg concentration increased exponentially towards the surface. Fish larvae showed a subsurface peak of concentration and their vertical distribution was not conditioned by thermocline depths. The short term hydrographic event did not affect the vertical distribution of fish larvae but it accounted for significant temporal changes in larval fish assemblage structure and abundance. Results suggest that temperature and light intensity are important factors in the vertical distribution of fish larvae. They also indicate that the temporal monitoring of the larval fish assemblage in this region requires multiple sampling sites.

Edge effect on weevils and spiders

OpenAIRE

Horváth, R.; Magura, T.; Péter, G.; Tóthmérész, B.

2002-01-01

The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest...

Cuticular bacteria appear detrimental to social spiders in mixed but not monoculture exposure

Science.gov (United States)

Keiser, Carl N.; Shearer, Taylor A.; DeMarco, Alexander E.; Brittingham, Hayley A.; Knutson, Karen A.; Kuo, Candice; Zhao, Katherine; Pruitt, Jonathan N.

2016-01-01

Abstract Much of an animal’s health status, life history, and behavior are dictated by interactions with its endogenous and exogenous bacterial communities. Unfortunately, interactions between hosts and members of their resident bacterial community are often ignored in animal behavior and behavioral ecology. Here, we aim to identify the nature of host–microbe interactions in a nonmodel organism, the African social spider Stegodyphus dumicola. We collected and identified bacteria from the cuticles of spiders in situ and then exposed spiders to bacterial monocultures cultures via topical application or injection. We also topically inoculated spiders with a concomitant “cocktail” of bacteria and measured the behavior of spiders daily for 24 days after inoculation. Lastly, we collected and identified bacteria from the cuticles of prey items in the capture webs of spiders, and then fed spiders domestic crickets which had been injected with these bacteria. We also injected 1 species of prey-borne bacteria into the hemolymph of spiders. Only Bacillus thuringiensis caused increased mortality when injected into the hemolymph of spiders, whereas no bacterial monocultures caused increased mortality when applied topically, relative to control solutions. However, a bacterial cocktail of cuticular bacteria caused weight loss and mortality when applied topically, yet did not detectibly alter spider behavior. Consuming prey injected with prey-borne bacteria was associated with an elongated lifespan in spiders. Thus, indirect evidence from multiple experiments suggests that the effects of these bacteria on spider survivorship appear contingent on their mode of colonization and whether they are applied in monoculture or within a mixed cocktail. We urge that follow-up studies should test these host–microbe interactions across different social contexts to determine the role that microbes play in colony performance. PMID:29491926

Subsocial behaviour and brood adoption in mixed-species colonies of two theridiid spiders

DEFF Research Database (Denmark)

Grinsted, Lena; Agnarsson, Ingi; Bilde, Trine

2012-01-01

Cooperation and group living often evolves through kin selection. However, associations between unrelated organisms, such as different species, can evolve if both parties benefit from the interaction. Group living is rare in spiders, but occurs in cooperative, permanently social spiders, as well...... as in territorial, colonial spiders. Mixed species spider colonies, involving closely related species, have rarely been documented. We examined social interactions in newly discovered mixed-species colonies of theridiid spiders on Bali, Indonesia. Our aim was to test the degree of intra- and interspecific tolerance...

The time course of location-avoidance learning in fear of spiders.

Science.gov (United States)

Rinck, Mike; Koene, Marieke; Telli, Sibel; Moerman-van den Brink, Wiltine; Verhoeven, Barbara; Becker, Eni S

2016-01-01

Two experiments were designed to study the time course of avoidance learning in spider fearfuls (SFs) under controlled experimental conditions. To achieve this, we employed an immersive virtual environment (IVE): While walking freely through a virtual art museum to search for specific paintings, the participants were exposed to virtual spiders. Unbeknown to the participants, only two of four museum rooms contained spiders, allowing for avoidance learning. Indeed, the more SF the participants were, the faster they learned to avoid the rooms that contained spiders (Experiment. 1), and within the first six trials, high fearfuls already developed a preference for starting their search task in rooms without spiders (Experiment 2). These results illustrate the time course of avoidance learning in SFs, and they speak to the usefulness of IVEs in fundamental anxiety research.

Survey of black howler (Alouatta pigra) and spider (Ateles geoffroyi) monkeys in the Mayan sites of Calakmul and Yaxchilán, Mexico and Tikal, Guatemala.

Science.gov (United States)

Estrada, Alejandro; Luecke, Leandra; Van Belle, Sarie; Barrueta, Emilio; Meda, Marleny Rosales

2004-01-01

Surveys of populations of spider and howler monkeys were conducted at the Mayan sites of Calakmul and Yaxchilán, Mexico and Tikal, Guatemala. The forests in which these sites are found are part of the largest landmass of tropical rain forests present in Mesoamerica, encompassing about 4 million ha. Triangulation of monkey vocalization combined with ground surveys was used to determine the presence of howler and spider monkey groups. Howler monkey mean troop size at these sites varied from 6.6+/-2.1 individuals in Yaxchilán to 7.5+/-1.9 in Calakmul to 8.7+/-2.2 in Tikal. Density estimates varied from 12.8 individuals/km(2 )in Yaxchilán to 15.2 individuals/km(2 )in Calakmul to 17.8 individuals/km(2 )in Tikal. Mean spider monkey subgroup size varied from 4.7+/-2.6 individuals in Tikal to 5.6+/-3.0 individuals in Yaxchilán to 7.7+/-3.8 individuals in Calakmul. Spider monkey density varied from 17.0 individuals/km(2 )in Yaxchilán to 17.2 individuals/km(2 )in Calakmul to 56.4 individuals/km(2 )in Tikal. All sightings of both howler and spider monkeys at the three sites were in undisturbed rain forest vegetation and spider monkeys in general were more frequently sighted at higher tree heights than howlers. We discuss the value of further acquiring data on howler and spider monkey populations existing in extensive forest tracts and on the conservation value for both primate species of the forests surrounding the Mayan ruins found in this area of Mesoamerica.

Endemic harvestmen and spiders of Austria (Arachnida: Opiliones, Araneae

Directory of Open Access Journals (Sweden)

Komposch, Christian

2011-01-01

Full Text Available A comprehensive overview of plant, fungus and animal species of Austria revealed a total of 748 endemic and subendemic species, including, 11 harvestman and 46 spider species. Altogether two endemic harvestmen (Nemastoma bidentatum relictum, Nemastoma schuelleri and 8 endemic spiders (Abacoproeces molestus, Collinsia (caliginosa nemenziana, Mughiphantes severus, Mughiphantes styriacus, Pelecopsis alpica, Scotophaeus nanus, Troglohyphantes novicordis, Troglohyphantes tauriscus, beside 9 subendemic harvestman and 38 subendemic spider species have been recorded from Austria. Hot-spots of endemism in the Eastern Alps are the north-eastern (Ennstaler Alps and southern Calcareous Alps (Karawanken, Karnische Alps and the Central Alps (Hohe Tauern, Gurktaler Alps, Ötztaler and Stubaier Alps. Most of the endemic arachnid species occur from the nival down to the montane zone. Important habitats are rocky areas, caves and woodlands. High absolute numbers and percentages of endemics can be found within the harvestman families Cladonychiidae, Ischyropsalididae and Nemastomatidae and in the spider genera Lepthyphantes s. l. and Troglohyphantes. The conservation status of these highly endangered taxa – 85 % of the spider species and 100 % of the harvestman taxa are endangered in Austria – is poor.

Dutch Dwellings

NARCIS (Netherlands)

Vries, de B.; Zee, van der A.; Carp, J.C.; Soddu, C.

2004-01-01

Applying Generative Design (GD) for dwelling is not very common but it opens up the possibility to study whether GD systems can reproduce existing design typologies. Dutch dwellings as an exemplification of a design typology are analysed using the SAR methodology. Building regulations are used as

SPIDER: A Framework for Understanding Driver Distraction.

Science.gov (United States)

Strayer, David L; Fisher, Donald L

2016-02-01

The objective was to identify key cognitive processes that are impaired when drivers divert attention from driving. Driver distraction is increasingly recognized as a significant source of injuries and fatalities on the roadway. A "SPIDER" model is developed that identifies key cognitive processes that are impaired when drivers divert attention from driving. SPIDER is an acronym standing for scanning, predicting, identifying, decision making, and executing a response. When drivers engage in secondary activities unrelated to the task of driving, SPIDER-related processes are impaired, situation awareness is degraded, and the ability to safely operate a motor vehicle may be compromised. The pattern of interference helps to illuminate the sources of driver distraction and may help guide the integration of new technology into the automobile. © 2015, Human Factors and Ergonomics Society.

Radon in Estonian dwellings - Results from a National Radon Survey

Energy Technology Data Exchange (ETDEWEB)

Pahapill, Lia; Rulkov, Anne; Rajamaee, Raivo [Estonian Radiation Protection Centre (Kiirguskeskus), Tallinn (Spain); Aakerblom, Gustav [Swedish Radiation Protection Authority, Stockholm (Sweden)

2003-10-01

A countrywide survey of radon concentrations in Estonian dwellings was carried out during the period 1998-2001. The survey formed a part of the cooperation program on radiation protection between the Estonian Radiation Protection (Kiirguskeskus) Centre and the Swedish Radiation Protection Authority (SSI). The survey included measurements in a number of dwellings representative for Estonia in detached houses and multifamily buildings (only dwellings on the bottom floor were included in the survey). Altogether, radon concentrations were measured in 515 dwellings, a number large enough to be statistically significant. All measurements were made with alphatrack film detectors of the same type that SSI uses in Sweden. The measurements were made during a 2-3 month period during the winter half-year. Two detectors were used in each dwelling. In Estonia there are 0.17 million dwellings in detached houses and 0.45 million in multi apartment buildings. Of the 1.26 million inhabitants in Estonia. 0.36 million live in detached houses and 0.90 million in multi apartment buildings. Most of the latter were built during the Soviet occupation. Of the dwellings in multifamily buildings 30 % are assumed to be situated on the first floor. The mean radon concentration in dwellings in detached hoses, according to the survey results, is 103 Bq/m{sup 3}, in dwellings on the bottom floor in multi apartment buildings it is 78 Bq/m{sup 3}. In 1% of the dwellings the radon concentration exceeded 400 Bq/m{sup 3}. The highest radon concentration found in the study was 1040 Bq/m{sup 3}. Based on the assumption that the average radon concentration in the dwellings in multi-apartment buildings that are not situated on the bottom floor is 30 Bq/m{sup 3}, and that these dwellings constitute 70% of all dwellings in multi apartment buildings, the mean radon concentration in dwellings in multi apartment buildings is calculated to be 44 Bq/m{sup 3}. The mean value for all Estonia dwellings is calculated

Radon in Estonian dwellings - Results from a National Radon Survey

International Nuclear Information System (INIS)

Pahapill, Lia; Rulkov, Anne; Rajamaee, Raivo; Aakerblom, Gustav

2003-10-01

A countrywide survey of radon concentrations in Estonian dwellings was carried out during the period 1998-2001. The survey formed a part of the cooperation program on radiation protection between the Estonian Radiation Protection (Kiirguskeskus) Centre and the Swedish Radiation Protection Authority (SSI). The survey included measurements in a number of dwellings representative for Estonia in detached houses and multifamily buildings (only dwellings on the bottom floor were included in the survey). Altogether, radon concentrations were measured in 515 dwellings, a number large enough to be statistically significant. All measurements were made with alphatrack film detectors of the same type that SSI uses in Sweden. The measurements were made during a 2-3 month period during the winter half-year. Two detectors were used in each dwelling. In Estonia there are 0.17 million dwellings in detached houses and 0.45 million in multi apartment buildings. Of the 1.26 million inhabitants in Estonia. 0.36 million live in detached houses and 0.90 million in multi apartment buildings. Most of the latter were built during the Soviet occupation. Of the dwellings in multifamily buildings 30 % are assumed to be situated on the first floor. The mean radon concentration in dwellings in detached hoses, according to the survey results, is 103 Bq/m 3 , in dwellings on the bottom floor in multi apartment buildings it is 78 Bq/m 3 . In 1% of the dwellings the radon concentration exceeded 400 Bq/m 3 . The highest radon concentration found in the study was 1040 Bq/m 3 . Based on the assumption that the average radon concentration in the dwellings in multi-apartment buildings that are not situated on the bottom floor is 30 Bq/m 3 , and that these dwellings constitute 70% of all dwellings in multi apartment buildings, the mean radon concentration in dwellings in multi apartment buildings is calculated to be 44 Bq/m 3 . The mean value for all Estonia dwellings is calculated to be 60 Bq/m 3 . Using

Information processing biases in spider phobia: application of the Stroop and "White Noise" Paradigm.

Science.gov (United States)

Olatunji, Bunmi O; Sawchuk, Craig N; Lee, Thomas C; Lohr, Jeffrey M; Tolin, David F

2008-06-01

The present study examines attentional and implicit memory biases in spider phobic and nonphobic participants. The results showed that spider phobics demonstrated increased interference for neutral, negative, and spider-relevant words on a computerized Stroop task. However, no group differences emerged when adjusting for differences in color-naming speed. Prior exposure to a dead spider did result in higher overall Stroop interference in spider phobics and this appeared to be mostly pronounced for spider-relevant words. Implicit memory bias for threat was examined with a noise judgment task. Participants first heard neutral and spider-relevant sentences and implicit memory for these sentences was evaluated by having participants rate the volume of noise accompanying the presentation of old sentences intermixed with new sentences. An implicit memory bias is indicated if participants rate noise accompanying old sentences as less loud than noise accompanying new sentences. No evidence was found for an implicit memory bias in spider phobics. These findings are discussed in relation to the role of information processing biases in spider phobia.

Spider: Probing the Early Universe with a Large-Scale CMB Polarization Survey

Science.gov (United States)

Jones, William

of the polarization of the CMB to search for the signature of primordial gravitational waves that are predicted within the currently favored theories of inflation. A definitive detection of this signal would provide the first direct insight into the underlying physics of inflation as well as a measurement of its energy scale. A stringent limit on the amplitude of this signal would exclude the currently favored class of inflationary models, bolstering the case for alternative theories. Spider is a suborbital Long-Duration Balloon payload housing six cryogenic smallaperture (half-degree resolution) millimeter-wave polarimeters. The frequency bands of the individual polarimeters are chosen to optimize overall sensitivity to the inflationary CMB polarization signal in the presence of Galactic foregrounds. By making extremely deep, high fidelity measurements of the entire portion of the southern sky that is relatively free of Galactic emission, the Spider data complement those of Planck (in sensitivity and control of systematics) PIPER (in frequency coverage) and EBEX (in sky coverage and angular scale). The data from Spider's inaugural flight in 2015 has resulted in high signal-to-noise maps of the southern Galactic hemisphere covering 10% of the full sky at each of 94 and 150 GHz. The payload is now being fabricated and fitted with a suite of 285 GHz cameras to extend our frequency coverage, improving our ability to disentangle the Galactic and cosmological signals. If its signature is present in the CMB, Spider's frequency coverage and fidelity to a broad range of angular scales enable the experiment to take a step beyond detection, toward the characterization of the gravitational wave induced signature in the CMB. Additionally Spider serves as a training ground for young scientists, including 16 graduate students (9 female, 7 male).

Spider diversity in coffee agroecosystems: the influence of agricultural intensification and aggressive ants.

Science.gov (United States)

Marín, Linda; Perfecto, Ivette

2013-04-01

Spiders are a very diverse group of invertebrate predators found in agroecosystems and natural systems. However, spider distribution, abundance, and eventually their ecological function in ecosystems can be influenced by abiotic and biotic factors such as agricultural intensification and dominant ants. Here we explore the influence of both agricultural intensification and the dominant arboreal ant Azteca instabilis on the spider community in coffee agroecosystems in southern Mexico. To measure the influence of the arboreal ant Azteca instabilis (F. Smith) on the spider community inhabiting the coffee layer of coffee agroecosystems, spiders were collected from coffee plants that were and were not patrolled by the ant in sites differing in agricultural intensification. For 2008, generalized linear mixed models showed that spider diversity was affected positively by agricultural intensification but not by the ant. However, results suggested that some spider species were associated with A. instabilis. Therefore, in 2009 we concentrated our research on the effect of A. instabilis on spider diversity and composition. For 2009, generalized linear mixed models show that spider richness and abundance per plant were significantly higher in the presence of A. instabilis. In addition, analyses of visual counts of insects and sticky traps data show that more resources were present in plants patrolled by the ant. The positive effect of A. instabilis on spiders seems to be caused by at least two mechanisms: high abundance of insects and protection against predators.

Reconstitutable control rod spider assembly

International Nuclear Information System (INIS)

Shallenberger, J.M.; Ferian, S.J.

1990-01-01

A reconstitutable control rod/spider assembly includes a hollow connecting finger of the spider having a pair of opposing flat segments formed on the interior thereof and engaging a pair of opposing flat sectors formed on the exterior of a stem extending form the upper end of control rod. The stem also has an externally-threaded portion engaging a nut and a pilot aligning portion for the nut. The nut has a radially flexible and expandable thread-defining element captured in its bore. The segments and sectors allow the rod to be removed and reattached after turning through 180 0 to allow more even wear on the rod. (author)

Meaning Profiles of Dwellings, Pathways, and Metaphors in Design: Implications for Education

Science.gov (United States)

Casakin, Hernan; Kreitler, Shulamith

2017-01-01

The study deals with the roles and interrelations of the meaning-based assessments of dwellings, pathways and metaphors in design performance. It is grounded in the Meaning Theory [Kreitler, S., and H. Kreitler. 1990. "The Cognitive Foundations of Personality Traits." New York: Plenum], which enables identifying the cognitive contents…

Phylogenomics, Diversification Dynamics, and Comparative Transcriptomics across the Spider Tree of Life.

Science.gov (United States)

Fernández, Rosa; Kallal, Robert J; Dimitrov, Dimitar; Ballesteros, Jesús A; Arnedo, Miquel A; Giribet, Gonzalo; Hormiga, Gustavo

2018-05-07

Dating back to almost 400 mya, spiders are among the most diverse terrestrial predators [1]. However, despite considerable effort [1-9], their phylogenetic relationships and diversification dynamics remain poorly understood. Here, we use a synergistic approach to study spider evolution through phylogenomics, comparative transcriptomics, and lineage diversification analyses. Our analyses, based on ca. 2,500 genes from 159 spider species, reject a single origin of the orb web (the "ancient orb-web hypothesis") and suggest that orb webs evolved multiple times since the late Triassic-Jurassic. We find no significant association between the loss of foraging webs and increases in diversification rates, suggesting that other factors (e.g., habitat heterogeneity or biotic interactions) potentially played a key role in spider diversification. Finally, we report notable genomic differences in the main spider lineages: while araneoids (ecribellate orb-weavers and their allies) reveal an enrichment in genes related to behavior and sensory reception, the retrolateral tibial apophysis (RTA) clade-the most diverse araneomorph spider lineage-shows enrichment in genes related to immune responses and polyphenic determination. This study, one of the largest invertebrate phylogenomic analyses to date, highlights the usefulness of transcriptomic data not only to build a robust backbone for the Spider Tree of Life, but also to address the genetic basis of diversification in the spider evolutionary chronicle. Copyright © 2018 Elsevier Ltd. All rights reserved.

Spiders (Araneae) Found in Bananas and Other International Cargo Submitted to North American Arachnologists for Identification.

Science.gov (United States)

Vetter, Richard S; Crawford, Rodney L; Buckle, Donald J

2014-11-01

Spiders found in international cargo brought into North America are sometimes submitted to arachnologists for identification. Often, these spiders are presumed to be of medical importance because of size or a submitter's familiarity with a toxic spider genus from the continent of origin. Starting in 2006, requests were made for spiders found in international cargo brought into North America, in addition to the specimens from similar cargo shipments already in our museum collections. This was an ad hoc study that allowed us to focus on spiders of concern to the discoverer. We identified 135 spiders found in international cargo. A key for the most common species is provided. The most frequently submitted spiders were the pantropical huntsman spider, Heteropoda venatoria (L.) (Sparassidae), and the redfaced banana spider, Cupiennius chiapanensis Medina Soriano (Ctenidae). Spiders of medical importance were rare. The most common cargo from which spiders were submitted was bananas with most specimens coming from Central America, Ecuador, or Colombia. Lack of experience with nonnative fauna caused several experienced American arachnologists to misidentify harmless ctenid spiders (C. chiapanensis, spotlegged banana spider, Cupiennius getazi Simon) as highly toxic Phoneutria spiders. These misidentifications could have led to costly, unwarranted prophylactic eradication measures, unnecessary employee health education, heightened employee anxiety and spoilage when perishable goods are left unloaded due to safety concerns. © 2014 Entomological Society of America.

Typhlonesticus gocmeni sp. n., a new cave-dwelling blind spider species from the Aegean region of Turkey (Araneae, Nesticidae

Directory of Open Access Journals (Sweden)

Carles Ribera

2014-06-01

Full Text Available A new species of the troglobitic spider genus Typhlonesticus is described from specimens found in Keloğlan Cave (Denizli Province, Dodurgalar Town, Turkey. Typhlonesticus gocmeni sp. n. is described on the basis of both sexes; and its phylogenetic relationships with closely related European genera and species are discussed based on morphological and molecular data (the cox1, rrnL and H3 genes. Three new combinations are proposed: Typhlonesticus idriacus (Roewer, 1931, comb. n., Typhlonesticus morisii (Brignoli, 1975 comb. n. and Typhlonesticus obcaecatus (Simon, 1907, comb. n. all ex. Nesticus.

Influence of abiotic factors on spider and ground beetle communities in different salt-marsh systems

NARCIS (Netherlands)

Petillon, Julien; Georges, Anita; Canard, Alain; Lefeuvre, Jean-Claude; Bakker, Jan P.; Ysnel, Frederic

2008-01-01

Salt marshes are interesting and endangered ecosystems in West-Europe. Nevertheless, their arthropod fauna remains largely unknown and the factors determining assemblages at micro-habitat scale are poorly understood. Few data are also available about the effects of management measures in salt

Remote monitoring of vibrational information in spider webs

Science.gov (United States)

Mortimer, B.; Soler, A.; Siviour, C. R.; Vollrath, F.

2018-06-01

Spiders are fascinating model species to study information-acquisition strategies, with the web acting as an extension of the animal's body. Here, we compare the strategies of two orb-weaving spiders that acquire information through vibrations transmitted and filtered in the web. Whereas Araneus diadematus monitors web vibration directly on the web, Zygiella x-notata uses a signal thread to remotely monitor web vibration from a retreat, which gives added protection. We assess the implications of these two information-acquisition strategies on the quality of vibration information transfer, using laser Doppler vibrometry to measure vibrations of real webs and finite element analysis in computer models of webs. We observed that the signal thread imposed no biologically relevant time penalty for vibration propagation. However, loss of energy (attenuation) was a cost associated with remote monitoring via a signal thread. The findings have implications for the biological use of vibrations by spiders, including the mechanisms to locate and discriminate between vibration sources. We show that orb-weaver spiders are fascinating examples of organisms that modify their physical environment to shape their information-acquisition strategy.

A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest.

Directory of Open Access Journals (Sweden)

Yann Hénaut

Full Text Available Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between 'Aechmea-areas' and 'control-areas' of the same surface area. We recorded six spider families: the Dipluridae, Ctenidae, Salticidae, Araneidae, Tetragnathidae and Linyphiidae among which the funnel-web tarantula, Ischnothele caudata, the only Dipluridae noted, was the most abundant. During the drought period, the spiders were more numerous in the Aechmea-areas than in the control-areas, but they were not obligatorily associated with the Aechmea. During the subsequent flooding, the spiders were concentrated in the A. bracteata patches, particularly those sheltering an ant colony. Also, a kind of specificity existed between certain spider taxa and ant species, but varied between the drought period and subsequent flooding. We conclude that climatic events modulate the relationship between A. bracteata patches and their associated fauna. Tank bromeliads, previously considered only for their ecological importance in supplying food and water during drought, may also be considered refuges for spiders during flooding. More generally, tank bromeliads have an important role in preserving non-specialized fauna in inundated forests.

A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest.

Science.gov (United States)

Hénaut, Yann; Corbara, Bruno; Pélozuelo, Laurent; Azémar, Frédéric; Céréghino, Régis; Herault, Bruno; Dejean, Alain

2014-01-01

Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between 'Aechmea-areas' and 'control-areas' of the same surface area. We recorded six spider families: the Dipluridae, Ctenidae, Salticidae, Araneidae, Tetragnathidae and Linyphiidae among which the funnel-web tarantula, Ischnothele caudata, the only Dipluridae noted, was the most abundant. During the drought period, the spiders were more numerous in the Aechmea-areas than in the control-areas, but they were not obligatorily associated with the Aechmea. During the subsequent flooding, the spiders were concentrated in the A. bracteata patches, particularly those sheltering an ant colony. Also, a kind of specificity existed between certain spider taxa and ant species, but varied between the drought period and subsequent flooding. We conclude that climatic events modulate the relationship between A. bracteata patches and their associated fauna. Tank bromeliads, previously considered only for their ecological importance in supplying food and water during drought, may also be considered refuges for spiders during flooding. More generally, tank bromeliads have an important role in preserving non-specialized fauna in inundated forests.

Environmental and hormonal factors controlling reversible colour change in crab spiders.

Science.gov (United States)

Llandres, Ana L; Figon, Florent; Christidès, Jean-Philippe; Mandon, Nicole; Casas, Jérôme

2013-10-15

Habitat heterogeneity that occurs within an individual's lifetime may favour the evolution of reversible plasticity. Colour reversibility has many different functions in animals, such as thermoregulation, crypsis through background matching and social interactions. However, the mechanisms underlying reversible colour changes are yet to be thoroughly investigated. This study aims to determine the environmental and hormonal factors underlying morphological colour changes in Thomisus onustus crab spiders and the biochemical metabolites produced during these changes. We quantified the dynamics of colour changes over time: spiders were kept in yellow and white containers under natural light conditions and their colour was measured over 15 days using a spectrophotometer. We also characterised the chemical metabolites of spiders changing to a yellow colour using HPLC. Hormonal control of colour change was investigated by injecting 20-hydroxyecdysone (20E) into spiders. We found that background colouration was a major environmental factor responsible for colour change in crab spiders: individuals presented with white and yellow backgrounds changed to white and yellow colours, respectively. An ommochrome precursor, 3-OH-kynurenine, was the main pigment responsible for yellow colour. Spiders injected with 20E displayed a similar rate of change towards yellow colouration as spiders kept in yellow containers and exposed to natural sunlight. This study demonstrates novel hormonal manipulations that are capable of inducing reversible colour change.

A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest

Science.gov (United States)

Hénaut, Yann; Corbara, Bruno; Pélozuelo, Laurent; Azémar, Frédéric; Céréghino, Régis; Herault, Bruno; Dejean, Alain

2014-01-01

Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between ‘Aechmea-areas’ and ‘control-areas’ of the same surface area. We recorded six spider families: the Dipluridae, Ctenidae, Salticidae, Araneidae, Tetragnathidae and Linyphiidae among which the funnel-web tarantula, Ischnothele caudata, the only Dipluridae noted, was the most abundant. During the drought period, the spiders were more numerous in the Aechmea-areas than in the control-areas, but they were not obligatorily associated with the Aechmea. During the subsequent flooding, the spiders were concentrated in the A. bracteata patches, particularly those sheltering an ant colony. Also, a kind of specificity existed between certain spider taxa and ant species, but varied between the drought period and subsequent flooding. We conclude that climatic events modulate the relationship between A. bracteata patches and their associated fauna. Tank bromeliads, previously considered only for their ecological importance in supplying food and water during drought, may also be considered refuges for spiders during flooding. More generally, tank bromeliads have an important role in preserving non-specialized fauna in inundated forests. PMID:25494055

Small Molecules from Spiders Used as Chemical Probes

DEFF Research Database (Denmark)

Olsen, Christian Adam; Kristensen, Anders S.; Strømgaard, Kristian

2011-01-01

Spiders are important species in ecological systems and as major predators of insects they are endowed with a plethora of low‐molecular‐weight natural products having intriguing biological activities. The isolation and biological characterization of these entities are well established, however......, only very recently have these compounds been used as templates for the design, synthesis, and biological evaluation of synthetic analogues. In contrast, the investigation of compounds responsible for chemical communication between spiders is far less developed, but recently new light has been shed onto...... the area of pheromones and allomones from spiders. Herein, we recapitulate these recent results, put them into perspective with previous findings, and provide an outlook for future studies of these chemotypes....

GPM GROUND VALIDATION NOAA S-BAND PROFILER ORIGINAL DWELL DATA MC3E V1

Data.gov (United States)

National Aeronautics and Space Administration — The S-band Profiler Original Dwell dataset in the netCDF format was gathered during the Midlatitude Continental Convective Clouds Experiment (MC3E) in Oklahoma...

Optical surface profiling of orb-web spider capture silks

Energy Technology Data Exchange (ETDEWEB)

Kane, D M; Joyce, A M; Staib, G R [Department of Physics, Macquarie University, Sydney, NSW 2109 (Australia); Herberstein, M E, E-mail: deb.kane@mq.edu.a [Department of Biological Sciences, Macquarie University, Sydney, NSW 2109 (Australia)

2010-09-15

Much spider silk research to date has focused on its mechanical properties. However, the webs of many orb-web spiders have evolved for over 136 million years to evade visual detection by insect prey. It is therefore a photonic device in addition to being a mechanical device. Herein we use optical surface profiling of capture silks from the webs of adult female St Andrews cross spiders (Argiope keyserlingi) to successfully measure the geometry of adhesive silk droplets and to show a bowing in the aqueous layer on the spider capture silk between adhesive droplets. Optical surface profiling shows geometric features of the capture silk that have not been previously measured and contributes to understanding the links between the physical form and biological function. The research also demonstrates non-standard use of an optical surface profiler to measure the maximum width of a transparent micro-sized droplet (microlens).

Optical surface profiling of orb-web spider capture silks

International Nuclear Information System (INIS)

Kane, D M; Joyce, A M; Staib, G R; Herberstein, M E

2010-01-01

Much spider silk research to date has focused on its mechanical properties. However, the webs of many orb-web spiders have evolved for over 136 million years to evade visual detection by insect prey. It is therefore a photonic device in addition to being a mechanical device. Herein we use optical surface profiling of capture silks from the webs of adult female St Andrews cross spiders (Argiope keyserlingi) to successfully measure the geometry of adhesive silk droplets and to show a bowing in the aqueous layer on the spider capture silk between adhesive droplets. Optical surface profiling shows geometric features of the capture silk that have not been previously measured and contributes to understanding the links between the physical form and biological function. The research also demonstrates non-standard use of an optical surface profiler to measure the maximum width of a transparent micro-sized droplet (microlens).

Spiders do not evoke greater early posterior negativity in the event-related potential as snakes.

Science.gov (United States)

He, Hongshen; Kubo, Kenta; Kawai, Nobuyuki

2014-09-10

It has been long believed that both snakes and spiders are archetypal fear stimuli for humans. Furthermore, snakes have been assumed as stronger threat cues for nonhuman primates. However, it is still unclear whether spiders hold a special status in human perception. The current study explored to what extent spider pictures draw early visual attention [as assessed with early posterior negativity (EPN)] when compared with insects similar to spiders. To measure the EPN, participants watched a random rapid serial presentation of pictures, which consisted of two conditions: spider condition (spider, wasp, bumblebee, beetle) and snake condition (snake, bird). EPN amplitudes revealed no significant difference between spider, wasp, bumblebee, and beetle pictures, whereas EPN amplitudes were significantly larger for snake pictures relative to bird pictures. In addition, EPN amplitudes were significantly larger for snake pictures relative to spider pictures. These results suggest that the early visual attentional capture of animate objects is stronger for snakes, whereas spiders do not appear to hold special early attentional value.

Solubilization of spider silk proteins and its structural analysis using Fourier transform infrared spectroscopy

Science.gov (United States)

Osbin, K.; Jayan, Manuel; Bhadrakumari, S.; Predeep, P.

2017-06-01

This study investigates the presence of various amide bands present in different spider silk species, which provides extraordinary physical properties. Three different spider silks were collected from Western Ghats region. The collected spider silks samples belonging to the spider Heteropoda venatoria (species 1), Hersilia savignyi (species 2) and Pholcus phalangioides (species 3). Fourier transform infrared (FTIR) spectra reveals the protein peaks in the amide I, II, and III regions in all the three types of spider silk species.

How informative are case studies of spider bites in the medical literature?

Science.gov (United States)

Stuber, Marielle; Nentwig, Wolfgang

2016-05-01

We analyzed the reliability and information content of 134 medical case studies on spider bites, published in 91 journal articles. Overall, we found that only 22% of these studies fulfilled the criteria for a verified spider bite. This means that the majority of such case studies cannot be attributed to a given spider species and usually not even to a spider. Their scientific value is negligible, moreover, such publications are even dangerous because they suggest incorrect conclusions. Secondly, we found that such case studies usually do not follow an obvious structure and many details on the development of symptoms, therapy and healing process are widely lacking. So even for verified spider bites, the comparability of case studies is limited. We discuss the obvious failure of a reviewing process for case studies and give recommendations how to increase the currently low information content of medical case studies on spider bites. Copyright © 2016 Elsevier Ltd. All rights reserved.

Rapid visuomotor processing of phobic images in spider- and snake-fearful participants.

Science.gov (United States)

Haberkamp, Anke; Schmidt, Filipp; Schmidt, Thomas

2013-10-01

This study investigates enhanced visuomotor processing of phobic compared to fear-relevant and neutral stimuli. We used a response priming design to measure rapid, automatic motor activation by natural images (spiders, snakes, mushrooms, and flowers) in spider-fearful, snake-fearful, and control participants. We found strong priming effects in all tasks and conditions; however, results showed marked differences between groups. Most importantly, in the group of spider-fearful individuals, spider pictures had a strong and specific influence on even the fastest motor responses: Phobic primes entailed the largest priming effects, and phobic targets accelerated responses, both effects indicating speeded response activation by phobic images. In snake-fearful participants, this processing enhancement for phobic material was less pronounced and extended to both snake and spider images. We conclude that spider phobia leads to enhanced processing capacity for phobic images. We argue that this is enabled by long-term perceptual learning processes. © 2013.

Who is afraid of a black Spider(-Man)?

OpenAIRE

Ora C. McWilliams

2013-01-01

An Internet post asking about Spider-Man's race in a film turned into an Internet campaign about an actor that led fans to interact with each other as well as with the actor, which in turn led to the attention of media producers, which resulted in a change in Spider-Man's race in a print comic book.

Nutrient Deprivation Induces Property Variations in Spider Gluey Silk

Science.gov (United States)

Blamires, Sean J.; Sahni, Vasav; Dhinojwala, Ali; Blackledge, Todd A.; Tso, I-Min

2014-01-01

Understanding the mechanisms facilitating property variability in biological adhesives may promote biomimetic innovations. Spider gluey silks such as the spiral threads in orb webs and the gumfoot threads in cobwebs, both of which comprise of an axial thread coated by glue, are biological adhesives that have variable physical and chemical properties. Studies show that the physical and chemical properties of orb web gluey threads change when spiders are deprived of food. It is, however, unknown whether gumfoot threads undergo similar property variations when under nutritional stress. Here we tested whether protein deprivation induces similar variations in spiral and gumfoot thread morphology and stickiness. We manipulated protein intake for the orb web spider Nephila clavipes and the cobweb spider Latrodectus hesperus and measured the diameter, glue droplet volume, number of droplets per mm, axial thread width, thread stickiness and adhesive energy of their gluey silks. We found that the gluey silks of both species were stickier when the spiders were deprived of protein than when the spiders were fed protein. In N. clavipes a concomitant increase in glue droplet volume was found. Load-extension curves showed that protein deprivation induced glue property variations independent of the axial thread extensions in both species. We predicted that changes in salt composition of the glues were primarily responsible for the changes in stickiness of the silks, although changes in axial thread properties might also contribute. We, additionally, showed that N. clavipes' glue changes color under protein deprivation, probably as a consequence of changes to its biochemical composition. PMID:24523902

Structure–Activity Relationship Study of Spider Polyamine Toxins as Inhibitors of Ionotropic Glutamate Receptors

DEFF Research Database (Denmark)

Xiong, Xiaofeng; Poulsen, Mette H; Hussein, Rama A

2014-01-01

The spider polyamine toxins Joro spider toxin-3 (JSTX-3) and Nephila polyamine toxins-1 and -8 (NPTX-1 and NPTX-8) are isolated from the venom of the orb-weaver spider Nephila clavata (Joro spider). They share a high degree of structural resemblance, their aromatic head groups being the only...

Record breaking achievements by spiders and the scientists who study them.

Science.gov (United States)

Mammola, Stefano; Michalik, Peter; Hebets, Eileen A; Isaia, Marco

2017-01-01

Organismal biology has been steadily losing fashion in both formal education and scientific research. Simultaneous with this is an observable decrease in the connection between humans, their environment, and the organisms with which they share the planet. Nonetheless, we propose that organismal biology can facilitate scientific observation, discovery, research, and engagement, especially when the organisms of focus are ubiquitous and charismatic animals such as spiders. Despite being often feared, spiders are mysterious and intriguing, offering a useful foundation for the effective teaching and learning of scientific concepts and processes. In order to provide an entryway for teachers and students-as well as scientists themselves-into the biology of spiders, we compiled a list of 99 record breaking achievements by spiders (the "Spider World Records"). We chose a world-record style format, as this is known to be an effective way to intrigue readers of all ages. We highlighted, for example, the largest and smallest spiders, the largest prey eaten, the fastest runners, the highest fliers, the species with the longest sperm, the most venomous species, and many more. We hope that our compilation will inspire science educators to embrace the biology of spiders as a resource that engages students in science learning. By making these achievements accessible to non-arachnologists and arachnologists alike, we suggest that they could be used: (i) by educators to draw in students for science education, (ii) to highlight gaps in current organismal knowledge, and (iii) to suggest novel avenues for future research efforts. Our contribution is not meant to be comprehensive, but aims to raise public awareness on spiders, while also providing an initial database of their record breaking achievements.

Radiation Safety System for SPIDER Neutral Beam Accelerator

International Nuclear Information System (INIS)

Sandri, S.; Poggi, C.; Coniglio, A.; D'Arienzo, M.

2011-01-01

SPIDER (Source for Production of Ion of Deuterium Extracted from RF Plasma only) and MITICA (Megavolt ITER Injector Concept Advanced) are the ITER neutral beam injector (NBI) testing facilities of the PRIMA (Padova Research Injector Megavolt Accelerated) Center. Both injectors accelerate negative deuterium ions with a maximum energy of 1 MeV for MITICA and 100 keV for SPIDER with a maximum beam current of 40 A for both experiments. The SPIDER facility is classified in Italy as a particle accelerator. At present, the design of the radiation safety system for the facility has been completed and the relevant reports have been presented to the Italian regulatory authorities. Before SPIDER can operate, approval must be obtained from the Italian Regulatory Authority Board (IRAB) following a detailed licensing process. In the present work, the main project information and criteria for the SPIDER injector source are reported together with the analysis of hypothetical accidental situations and safety issues considerations. Neutron and photon nuclear analysis is presented, along with special shielding solutions designed to meet Italian regulatory dose limits. The contribution of activated corrosion products (ACP) to external exposure of workers has also been assessed. Nuclear analysis indicates that the photon contribution to worker external exposure is negligible, and the neutron dose can be considered by far the main radiation protection issue. Our results confirm that the injector has no important radiological impact on the population living around the facility.

Distribution and importance of spiders inhabiting a Brazilian sugar cane plantation

Directory of Open Access Journals (Sweden)

Isabela Maria Piovesan Rinaldi

2002-07-01

Full Text Available The spider fauna (Araneae of a sugar eane plantation was surveyed monthly by hand colteetion and beating vegetation in sugar cane fields across Botucatu, State of São Paulo, Brazil. Composition and rchness (family and species where identifieation to species was possible microhabitat preferenees were reeorded, and diversity and evenness indices were calculated. A total of 1291 spiders belonging to 73 species and 20 families were collected. The most diverse families were Theridiidae, Salticidae, and Araneidae, and the most abundant ones were Theridiidae, Saltieidae, Anyphaenidae, and Araneidae, Seven species represented 58.6% of the total fauna, with Crysso pulcherrima (Mello-Leitão,1917 (Theridiidae composing 28.2%. About 65% of the spiders occupied the upper part of the plants (above 20 cm. Five spider species were present in the sugar cane throughout crop development. Evidence of spiders feeding on sugar cane pest species was observed.

Biomimetic calcium phosphate coatings on recombinant spider silk fibres

Energy Technology Data Exchange (ETDEWEB)

Yang Liang; Habibovic, Pamela; Van Blitterswijk, Clemens A [Department of Tissue Regeneration, University of Twente, PO Box 217, 7500 AE Enschede (Netherlands); Hedhammar, My; Johansson, Jan [Department of Anatomy, Physiology and Biochemistry, Swedish University of Agricultural Sciences, the Biomedical Centre, Box 575, 751 23 Uppsala (Sweden); Blom, Tobias; Leifer, Klaus [Department of Engineering Sciences, Uppsala University, Box 534, S-751 21 Uppsala (Sweden)

2010-08-01

Calcium phosphate ceramic coatings, applied on surfaces of metallic and polymeric biomaterials, can improve their performance in bone repair and regeneration. Spider silk is biocompatible, strong and elastic, and hence an attractive biomaterial for applications in connective tissue repair. Recently, artificial spider silk, with mechanical and structural characteristics similar to those of native spider silk, has been produced from recombinant minispidroins. In the present study, supersaturated simulated body fluid was used to deposit calcium phosphate coatings on recombinant spider silk fibres. The mineralization process was followed in time using scanning electron microscopy equipped with an energy dispersive x-ray (EDX) detector and Raman spectroscope. Focused ion beam technology was used to produce a cross section of a coated fibre, which was further analysed by EDX. Preliminary in vitro experiments using a culture of bone marrow-derived human mesenchymal stem cells (hMSCs) on coated fibres were also performed. This study showed that recombinant spider silk fibres were successfully coated with a homogeneous and thick crystalline calcium phosphate layer. In the course of the mineralization process from modified simulated body fluid, sodium chloride crystals were first deposited on the silk surface, followed by the deposition of a calcium phosphate layer. The coated silk fibres supported the attachment and growth of hMSCs.

Spider Silk as Guiding Biomaterial for Human Model Neurons

Directory of Open Access Journals (Sweden)

Frank Roloff

2014-01-01

Full Text Available Over the last years, a number of therapeutic strategies have emerged to promote axonal regeneration. An attractive strategy is the implantation of biodegradable and nonimmunogenic artificial scaffolds into injured peripheral nerves. In previous studies, transplantation of decellularized veins filled with spider silk for bridging critical size nerve defects resulted in axonal regeneration and remyelination by invading endogenous Schwann cells. Detailed interaction of elongating neurons and the spider silk as guidance material is unknown. To visualize direct cellular interactions between spider silk and neurons in vitro, we developed an in vitro crossed silk fiber array. Here, we describe in detail for the first time that human (NT2 model neurons attach to silk scaffolds. Extending neurites can bridge gaps between single silk fibers and elongate afterwards on the neighboring fiber. Culturing human neurons on the silk arrays led to an increasing migration and adhesion of neuronal cell bodies to the spider silk fibers. Within three to four weeks, clustered somata and extending neurites formed ganglion-like cell structures. Microscopic imaging of human neurons on the crossed fiber arrays in vitro will allow for a more efficient development of methods to maximize cell adhesion and neurite growth on spider silk prior to transplantation studies.

Biomimetic calcium phosphate coatings on recombinant spider silk fibres

International Nuclear Information System (INIS)

Yang Liang; Habibovic, Pamela; Van Blitterswijk, Clemens A; Hedhammar, My; Johansson, Jan; Blom, Tobias; Leifer, Klaus

2010-01-01

Calcium phosphate ceramic coatings, applied on surfaces of metallic and polymeric biomaterials, can improve their performance in bone repair and regeneration. Spider silk is biocompatible, strong and elastic, and hence an attractive biomaterial for applications in connective tissue repair. Recently, artificial spider silk, with mechanical and structural characteristics similar to those of native spider silk, has been produced from recombinant minispidroins. In the present study, supersaturated simulated body fluid was used to deposit calcium phosphate coatings on recombinant spider silk fibres. The mineralization process was followed in time using scanning electron microscopy equipped with an energy dispersive x-ray (EDX) detector and Raman spectroscope. Focused ion beam technology was used to produce a cross section of a coated fibre, which was further analysed by EDX. Preliminary in vitro experiments using a culture of bone marrow-derived human mesenchymal stem cells (hMSCs) on coated fibres were also performed. This study showed that recombinant spider silk fibres were successfully coated with a homogeneous and thick crystalline calcium phosphate layer. In the course of the mineralization process from modified simulated body fluid, sodium chloride crystals were first deposited on the silk surface, followed by the deposition of a calcium phosphate layer. The coated silk fibres supported the attachment and growth of hMSCs.

Modelling of the evolution of ground waters in a granite system at low temperature: the Stripa ground waters, Sweden

International Nuclear Information System (INIS)

Grimaud, D.; Michard, G.; Beaucaire, C.

1990-01-01

From chemical data on the Stripa ground waters we have tried to model the evolution of the chemical composition of a ground water in a granitic system at low temperature. The existence of two end-member ground water compositions made it possible first, to test the conventional model of a geothermal system according to which an overall equilibrium between the waters and a given mineral assemblage can be defined, and then to show that such a model could be extended to low temperatures (10 o C). Conversely, if we know the mineral assemblage, the equilibration temperature and the charge of the mobile ions (in this case, Cl), the composition of the solution is entirely fixed. In our model of the Stripa ground waters, the existence of two end-member ground water compositions can be explained by an evolution from a ''kaolinite-albite-laumontite'' equilibrium to a ''prehnite-albite-laumontite'' equilibrium, the latter requiring less Al than the former. We have also emphasized the importance of the Cl ion concentrations of the ground waters, because they can be considered as indicators of the degree of reaction progress between rock and water, thus determining the degree of equilibration of the system. (author)

Neural correlation of successful cognitive behaviour therapy for spider phobia: a magnetoencephalography study.

Science.gov (United States)

Wright, Barry; Alderson-Day, Ben; Prendergast, Garreth; Kennedy, Juliette; Bennett, Sophie; Docherty, Mary; Whitton, Clare; Manea, Laura; Gouws, Andre; Tomlinson, Heather; Green, Gary

2013-12-30

Cognitive behavioural therapy (CBT) can be an effective treatment for spider phobia, but the underlying neural correlates of therapeutic change are yet to be specified. The present study used magnetoencephalography (MEG) to study responses within the first half second, to phobogenic stimuli in a group of individuals with spider phobia prior to treatment (n=12) and then in nine of them following successful CBT (where they could touch and manage live large common house spiders) at least 9 months later. We also compared responses to a group of age-matched healthy control participants (n=11). Participants viewed static photographs of real spiders, other fear-inducing images (e.g. snakes, sharks) and neutral stimuli (e.g. kittens). Beamforming methods were used to localise sources of significant power changes in response to stimuli. Prior to treatment, participants with spider phobia showed a significant maximum response in the right frontal pole when viewing images of real spiders specifically. No significant frontal response was observed for either control participants or participants with spider phobia post-treatment. In addition, participants' subjective ratings of spider stimuli significantly predicted peak responses in right frontal regions. The implications for understanding brain-based effects of cognitive therapies are discussed. © 2013 Published by Elsevier Ireland Ltd.

SPIDER: Probing the dawn of time from above the clouds

Science.gov (United States)

Moncelsi, Lorenzo; Spider Collaboration

2017-11-01

SPIDER is a balloon-borne microwave polarimeter designed to measure cosmological B-modes on degree angular scales in the presence of Galactic foregrounds. With six independent telescopes housing a total of 2000 detectors in the 90 GHz and 150 GHz frequency bands, SPIDER is the most instantaneously-sensitive CMB polarimeter deployed on the sky to date. SPIDER was successfully launched from McMurdo Station, Antarctica in January 2015 and acquired science data for 16 days. We cover the in-flight performance and present highlights from the ongoing data-analysis. After a successful recovery, the SPIDER team is planning the next flight, featuring one foreground-optimized channel at 280GHz, which will allow us constrain the primordial tensor-mode amplitude at the level of r < 0.03 (99% CL), in the presence of foregrounds.

Interpretative bias in spider phobia: Perception and information processing of ambiguous schematic stimuli.

Science.gov (United States)

Haberkamp, Anke; Schmidt, Filipp

2015-09-01

This study investigates the interpretative bias in spider phobia with respect to rapid visuomotor processing. We compared perception, evaluation, and visuomotor processing of ambiguous schematic stimuli between spider-fearful and control participants. Stimuli were produced by gradually morphing schematic flowers into spiders. Participants rated these stimuli related to their perceptual appearance and to their feelings of valence, disgust, and arousal. Also, they responded to the same stimuli within a response priming paradigm that measures rapid motor activation. Spider-fearful individuals showed an interpretative bias (i.e., ambiguous stimuli were perceived as more similar to spiders) and rated spider-like stimuli as more unpleasant, disgusting, and arousing. However, we observed no differences between spider-fearful and control participants in priming effects for ambiguous stimuli. For non-ambiguous stimuli, we observed a similar enhancement for phobic pictures as has been reported previously for natural images. We discuss our findings with respect to the visual representation of morphed stimuli and to perceptual learning processes. Copyright © 2015 Elsevier B.V. All rights reserved.

Who is afraid of a black Spider(-Man?

Directory of Open Access Journals (Sweden)

Ora C. McWilliams

2013-06-01

Full Text Available An Internet post asking about Spider-Man's race in a film turned into an Internet campaign about an actor that led fans to interact with each other as well as with the actor, which in turn led to the attention of media producers, which resulted in a change in Spider-Man's race in a print comic book.

Status of the CNESM diagnostic for SPIDER

International Nuclear Information System (INIS)

Muraro, A.; Croci, G.; Albani, G.; Cazzaniga, C.; Claps, G.; Cavenago, M.; Grosso, G.; Palma, M. Dalla; Fincato, M.; Murtas, F.; Pasqualotto, R.; Cippo, E. Perelli; Rebai, M.; Tollin, M.; Tardocchi, M.; Gorini, G.

2015-01-01

Highlights: • We have finished the design of the detector box of the CNESM diagnostic for SPIDER. • We have constructed the GEM detector of the CNESM detector for SPIDER. • We have tested the detector under fast neutron irradiation. - Abstract: The ITER neutral beam test facility under construction in Padova will host two experimental devices: SPIDER, a 100 kV negative H/D RF source, and MITICA, a full scale, 1 MeV deuterium beam injector. A detection system called close-contact neutron emission surface mapping (CNESM) is under development with the aim to resolve the horizontal beam intensity profile in MITICA and one of the eight beamlet groups in SPIDER, with a spatial resolution of 1.5 and 2.5 cm respectively. This is achieved by the evaluation of the map of the neutron emission due to interaction of the deuterium beam with the deuterons implanted in the beam dump surface. CNESM uses nGEM detectors, i.e. GEM detectors equipped with a cathode that also serves as neutron–proton converter foil. The diagnostic will be placed right behind the SPIDER and MITICA beam dump, i.e. in an UHV environment, but the nGEM detectors need to operate at atmospheric pressure: in order to maintain the detector at atmospheric pressure, a vacuum sealed box, that will be mounted inside the vacuum, has been designed. The box design was driven by the need to minimize the neutron attenuation and the distance between the beam dump surface and the detector active area. This paper presents the status of the CNESM diagnostic describing the design of the detector, the design of the sealed box and reporting the results obtained with the first full-size prototype under fast neutron irradiation.

Design of the interlock and protection system for the SPIDER experiment

International Nuclear Information System (INIS)

Pomaro, N.; Grando, L.; Luchetta, A.; Paolucci, F.; Sartori, F.

2013-01-01

Highlights: •A custom designed interlock and protection system for SPIDER experiment is described. •It includes two subsystems implementing slow and fast protection functions. •High reliability PLCs are adopted for slow protection. •Fiber-optic based, custom designed fast logic circuitry is proposed for fast protection. •Accelerators breakdown events are also managed by the fast subsystem. -- Abstract: Unprecedented levels of beam energy and power are required for ITER Neutral Beam Heating systems. SPIDER experiment is an experimental device aimed to test and optimize a full size beam source satisfying ITER requirements. SPIDER experiment operation involves high power, voltage, temperature, and gas pressure. All these critical conditions are present simultaneously, so that any failure if not properly detected and managed is likely to cause severe damage. The Interlock and Protection System is a high-reliability system devoted to the investment protection of SPIDER. Its main purpose is to manage abnormal events occurring in one or more plants in order to minimize adverse consequences. The Interlock System also manages the SPIDER Operating Modes, defining the set and status of the Plants used in the various possible experimental configurations. In addition, the Interlock and Protection System takes care of particular events occurring during normal SPIDER operation, i.e. electrical arcs between accelerator grids, named breakdowns. Their treatment is committed to the Interlock and Protection System, as they need to be managed timely and with absolute reliability like actual faults. To perform the required functions, the Interlock and Protection System is interfaced with most SPIDER plants and with the SPIDER Control and Data Acquisition System. The paper describes the rationale of the protection functions, their implementation in the design and the technical specifications of the system

Assessing local scale impacts of Opuntia stricta (Cactaceae ...

African Journals Online (AJOL)

... assemblages were significantly different from uninvaded control sites. This study suggests that the current density of O. stricta does not significantly affect spider species richness, density or assemblages but that beetle assemblages are significantly affected. Key words: Araneae, arthropods, Coleoptera, invasion impacts, ...

Effects of attention manipulations on motivated attention to feared and nonfeared negative distracters in spider fear.

Science.gov (United States)

Norberg, Joakim; Wiens, Stefan

2013-11-09

When people view emotional and neutral pictures, the emotional pictures capture more attention than do neutral pictures. In support, studies with event-related potentials have shown that the early posterior negativity (EPN) and the late positive potential (LPP) to emotional versus neutral pictures are enhanced when pictures are attended. However, this motivated attention decreases when voluntary attention is directed away from the pictures. Most previous studies included only generally emotional pictures of either negative or positive valence. Because people with spider fear report intense fear of spiders, we examined whether directing attention away from emotional pictures at fixation decreases motivated attention less strongly for spiders than for generally negative distracters. We recorded event-related potentials from 128 channels to study whether manipulations of attention (i.e., spatial attention and perceptual load) decrease the EPN and the LPP to emotional distracters less strongly for spiders than for fear-irrelevant negative pictures in people with spider fear. Results confirmed that the EPN and the LPP to spiders (vs. neutral pictures) were particularly enhanced in participants with spider fear compared to participants without spider fear. When attention was directed away from the pictures, the EPN and the LPP to spiders (vs. neutral pictures) decreased similarly in fearful and nonfearful participants. Further, in fearful participants, the decrease in the EPN and the LPP was similar for spiders and for fear-irrelevant negative pictures. Our findings suggest that for people with spider fear, directing attention away from emotional pictures at fixation decreases motivated attention to these distracters similarly for spiders as for fear-irrelevant negative pictures. These findings imply that attention to spiders in spider fear does not exceed the level of attention expected from the spider pictures' high arousal and negative valence (i.e., their intrinsic

Dangerous mating systems: signal complexity, signal content and neural capacity in spiders.

Science.gov (United States)

Herberstein, M E; Wignall, A E; Hebets, E A; Schneider, J M

2014-10-01

Spiders are highly efficient predators in possession of exquisite sensory capacities for ambushing prey, combined with machinery for launching rapid and determined attacks. As a consequence, any sexually motivated approach carries a risk of ending up as prey rather than as a mate. Sexual selection has shaped courtship to effectively communicate the presence, identity, motivation and/or quality of potential mates, which help ameliorate these risks. Spiders communicate this information via several sensory channels, including mechanical (e.g. vibrational), visual and/or chemical, with examples of multimodal signalling beginning to emerge in the literature. The diverse environments that spiders inhabit have further shaped courtship content and form. While our understanding of spider neurobiology remains in its infancy, recent studies are highlighting the unique and considerable capacities of spiders to process and respond to complex sexual signals. As a result, the dangerous mating systems of spiders are providing important insights into how ecology shapes the evolution of communication systems, with future work offering the potential to link this complex communication with its neural processes. Copyright © 2014 Elsevier Ltd. All rights reserved.

Inactivation of complement by Loxosceles reclusa spider venom.

Science.gov (United States)

Gebel, H M; Finke, J H; Elgert, K D; Cambell, B J; Barrett, J T

1979-07-01

Zymosan depletion of serum complement in guinea pigs rendered them highly resistant to lesion by Loxosceles reclusa spider venom. Guinea pigs deficient in C4 of the complement system are as sensitive to the venom as normal guinea pigs. The injection of 35 micrograms of whole recluse venom intradermally into guinea pigs lowered their complement level by 35.7%. Brown recluse spider venom in concentrations as slight as 0.02 micrograms protein/ml can totally inactivate one CH50 of guinea pig complement in vitro. Bee, scorpion, and other spider venoms had no influence on the hemolytic titer of complement. Fractionation of recluse spider venom by Sephadex G-200 filtration separated the complement-inactivating property of the venom into three major regions which could be distinguished on the basis of heat stability as well as size. None was neutralized by antivenom. Polyacrylamide gel electrophoresis of venom resolved the complement inactivators into five fractions. Complement inactivated by whole venom or the Sephadex fractions could be restored to hemolytic activity by supplements of fresh serum but not by heat-inactivated serum, pure C3, pure C5, or C3 and C5 in combination.

SPIDER OPTIMIZATION. II. OPTICAL, MAGNETIC, AND FOREGROUND EFFECTS

International Nuclear Information System (INIS)

O'Dea, D. T.; Clark, C. N.; Contaldi, C. R.; Ade, P. A. R.; Amiri, M.; Burger, B.; Davis, G.; Benton, S. J.; Bock, J. J.; Crill, B. P.; Dore, O.; Filippini, J. P.; Bond, J. R.; Farhang, M.; Bonetti, J. A.; Bryan, S.; Chiang, H. C.; Fraisse, A. A.; Fissel, L. M.; Gandilo, N. N.

2011-01-01

SPIDER is a balloon-borne instrument designed to map the polarization of the cosmic microwave background (CMB) with degree-scale resolution over a large fraction of the sky. SPIDER's main goal is to measure the amplitude of primordial gravitational waves through their imprint on the polarization of the CMB if the tensor-to-scalar ratio, r, is greater than 0.03. To achieve this goal, instrumental systematic errors must be controlled with unprecedented accuracy. Here, we build on previous work to use simulations of SPIDER observations to examine the impact of several systematic effects that have been characterized through testing and modeling of various instrument components. In particular, we investigate the impact of the non-ideal spectral response of the half-wave plates, coupling between focal-plane components and Earth's magnetic field, and beam mismatches and asymmetries. We also present a model of diffuse polarized foreground emission based on a three-dimensional model of the Galactic magnetic field and dust, and study the interaction of this foreground emission with our observation strategy and instrumental effects. We find that the expected level of foreground and systematic contamination is sufficiently low for SPIDER to achieve its science goals.

25 CFR 700.53 - Dwelling, replacement.

Science.gov (United States)

2010-04-01

... 25 Indians 2 2010-04-01 2010-04-01 false Dwelling, replacement. 700.53 Section 700.53 Indians THE... Policies and Instructions Definitions § 700.53 Dwelling, replacement. The term replacement dwelling means a dwelling selected by the head of a household as a replacement dwelling that meets the criteria of this...

The Spider Files

Science.gov (United States)

McDonald, James; Dominguez, Lynn

2012-01-01

As children develop misconceptions about animals they believe are dangerous, they also adopt attitudes that are difficult to change. Changing these attitudes is challenging for teachers. One animal that is easy to find but difficult for children to understand is a spider. As with most wild animals, they are difficult to teach about because…

Structure-function-property-design interplay in biopolymers: spider silk.

Science.gov (United States)

Tokareva, Olena; Jacobsen, Matthew; Buehler, Markus; Wong, Joyce; Kaplan, David L

2014-04-01

Spider silks have been a focus of research for almost two decades due to their outstanding mechanical and biophysical properties. Recent advances in genetic engineering have led to the synthesis of recombinant spider silks, thus helping to unravel a fundamental understanding of structure-function-property relationships. The relationships between molecular composition, secondary structures and mechanical properties found in different types of spider silks are described, along with a discussion of artificial spinning of these proteins and their bioapplications, including the role of silks in biomineralization and fabrication of biomaterials with controlled properties. Copyright © 2013 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.

Inhibition of the spider heartbeat by gravity and vibration

Science.gov (United States)

Finck, A.

1984-01-01

The rate and vigor of the spider heartbeat is controlled by an external pacemaker. A mechanical feature of the spider cardio-vascular system is the production of high serum pressure in the prosoma and the legs. This appears to be the source for leg extension. The lyriform organ on the patella of the leg is sensitive to vibratory and kinesthetic stimuli. This sensitivity depends upon the degree of leg extension. Thus the activity of the heart and the response characteristics of the sense receptor are related. The effect of a supra-threshold vibratory or gravitational stimulus is to produce an inhibition and a tachycardia of the spider heartbeat.

Ineffective crypsis in a crab spider: a prey community perspective.

Science.gov (United States)

Brechbühl, Rolf; Casas, Jérôme; Bacher, Sven

2010-03-07

Cryptic coloration is assumed to be beneficial to predators because of an increased encounter rate with unwary prey. This hypothesis is, however, very rarely, if ever, studied in the field. The aim of this study was to quantify the encounter rate and capture success of an ambush predator, in the field, as a function of its level of colour-matching with the background. We used the crab spider Misumena vatia, which varies its body colour and can thereby match the colour of the flower it hunts upon. We carried out a manipulative field experiment using a complete factorial design resulting in six different colour combinations of crab spiders and flowers differing in their degree of colour-matching. A rich and diverse set of naturally occurring insects visited the flowers while we continuously video-recorded the spider's foraging activity. This enabled us to test the crypsis, the spider avoidance and the flower visitor attraction hypotheses, all three supported by previous studies. Flower visitors of different groups either avoided crab spiders independent of colour-matching, such as solitary bees and syrphid flies, or ignored them, such as bumble-bees and honeybees. Moreover, colour-matched spiders did not have a higher encounter rate and capture success compared to the visually apparent ones. Thus, our results support the spider avoidance hypothesis, reject the two other hypotheses and uncovered a fourth behaviour: indifference to predators. Because flower visitors reacted differently, a community approach is mandatory in order to understand the function of background colour-matching in generalist predators. We discuss our results in relation to the size and sociality of the prey and in relation to the functional significance of colour change in this predator.

Evolution of stenophagy in spiders (Araneae): evidence based on the comparative analysis of spider diets.

Science.gov (United States)

Pekár, Stano; Coddington, Jonathan A; Blackledge, Todd A

2012-03-01

Stenophagy (narrow diet breadth) represents an extreme of trophic specialization in carnivores, but little is known about the forces driving its evolution. We used spiders, the most diversified group of terrestrial predators, to investigate whether stenophagy (1) promoted diversification; (2) was phylogenetically conserved and evolutionarily derived state; and (3) was determined either by geographical distribution and foraging guild. We used published data on the prey of almost 600 species. Six categories of stenophagy were found: myrmecophagy, araneophagy, lepidopterophagy, termitophagy, dipterophagy, and crustaceophagy. We found that the species diversity of euryphagous genera and families was similar to stenophagous genera and families. At the family level, stenophagy evolved repeatedly and independently. Within families, the basal condition was oligophagy or euryphagy. Most types of stenophagy were clearly derived: myrmecophagy in Zodariidae; lepidopterophagy in Araneidae; dipterophagy in Theridiidae. In contrast, araneophagy was confined to basal and intermediate lineages, suggesting its ancestral condition. The diet breadth of species from the tropics and subtropics was less diverse than species from the temperate zone. Diet breadth was lower in cursorial spiders compared to web-building species. Thus, the evolution of stenophagy in spiders appears to be complex and governed by phylogeny as well as by ecological determinants. © 2011 The Author(s). Evolution© 2011 The Society for the Study of Evolution.

Three newly recorded Linyphiid spiders (Araneae: Linyphiidae from Korea

Directory of Open Access Journals (Sweden)

Sue Yeon Lee

2018-03-01

Full Text Available Three Linyphiid spiders, Caviphantes pseudosaxetorum Wunderlich, 1979, Erigone edentata Saito and Ono, 2001, and Savignia kawachiensis Oi, 1960, are reported for the first time from Korea with taxonomic illustrations and redescription. In this study, the genus Caviphantes Oi, 1960 is also newly recorded to Korean spider fauna.

First report of clinical presentation of a bite by a running spider ...

African Journals Online (AJOL)

This article describes the clinical progression of symptoms over a period of 5 days of a bite inflicted by a Philodromus sp. spider. Commonly known as 'running spiders', these are not considered to be harmful to humans. This report, however, is the first description of an actual bite by a member of this group of spiders ...

Web building and silk properties functionally covary among species of wolf spider.

Science.gov (United States)

Lacava, Mariángeles; Camargo, Arley; Garcia, Luis F; Benamú, Marco A; Santana, Martin; Fang, Jian; Wang, Xungai; Blamires, Sean J

2018-04-15

Although phylogenetic studies have shown covariation between the properties of spider major ampullate (MA) silk and web building, both spider webs and silks are highly plastic so we cannot be sure whether these traits functionally covary or just vary across environments that the spiders occupy. As MaSp2-like proteins provide MA silk with greater extensibility, their presence is considered necessary for spider webs to effectively capture prey. Wolf spiders (Lycosidae) are predominantly non-web building, but a select few species build webs. We accordingly collected MA silk from two web-building and six non-web-building species found in semirural ecosystems in Uruguay to test whether the presence of MaSp2-like proteins (indicated by amino acid composition, silk mechanical properties and silk nanostructures) was associated with web building across the group. The web-building and non-web-building species were from disparate subfamilies so we estimated a genetic phylogeny to perform appropriate comparisons. For all of the properties measured, we found differences between web-building and non-web-building species. A phylogenetic regression model confirmed that web building and not phylogenetic inertia influences silk properties. Our study definitively showed an ecological influence over spider silk properties. We expect that the presence of the MaSp2-like proteins and the subsequent nanostructures improves the mechanical performance of silks within the webs. Our study furthers our understanding of spider web and silk co-evolution and the ecological implications of spider silk properties. © 2018 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2018 European Society For Evolutionary Biology.

SPIDER: Probing the Early Universe with a Suborbital Polarimeter

Science.gov (United States)

Fraisse, Aurélien A.; SPIDER Collaboration

2012-01-01

SPIDER is a balloon-borne polarimeter designed to detect a divergence-free polarization pattern ("B-modes") in the Cosmic Microwave Background (CMB). In the inflationary scenario, the spectrum of the tensor perturbations that generate this signal is proportional to that of the primordial scalar perturbations through the tensor-to-scalar ratio r. The expected level of systematic error in the SPIDER instrument is significantly below the amplitude of an interesting cosmological B-mode signal with r=0.03. An optimized scanning strategy enables us to minimize uncertainty in the reconstruction of the Stokes parameters used to characterize the CMB, while providing access to a relatively wide range of angular scales. In the SPIDER field, the polarized emission from interstellar dust is as bright or brighter than the cosmological r=0.03 B-mode signal at all SPIDER frequencies (90, 150, and 280 GHz), a situation similar to that found in the "Southern Hole." Despite this foreground contamination, two 20-day flights of the SPIDER instrument will constrain the amplitude of the B-mode signal to rAPRA-NNX07AL64G), the National Science Foundation (ANT-1043515), the Gordon and Betty Moore Foundation, and the David and Lucile Packard Foundation. Support in Canada is provided by NSERC, the Canadian Space Agency, the Canada Foundation for Innovation, and CIFAR.

Spider Web Pattern

Science.gov (United States)

2006-01-01

A delicate pattern, like that of a spider web, appears on top of the Mars residual polar cap, after the seasonal carbon-dioxide ice slab has disappeared. Next spring, these will likely mark the sites of vents when the carbon-dioxide ice cap returns. This Mars Global Surveyor, Mars Orbiter Camera image is about 3-kilometers wide (2-miles).

PATHWAYS TO SPIDER PHOBIA

NARCIS (Netherlands)

MERCKELBACH, H; ARNTZ, A; ARRINDELL, WA; DEJONG, PJ

Using a revised version of the Phobic Origin Questionnaire (POQ; Ost, L. G. & Hugdahl, K. Behaviour Research and Therapy, 19,439-477; 1981), the present study examined whether conditioning experiences, modeling experiences, and/or informational learning experiences were more often reported by spider

Assessing the Cyborg Center: Assemblage-Based, Feminist Frameworks toward Socially Just Writing Center Assessments

Science.gov (United States)

Andersen, Erin M.

2017-01-01

This dissertation will broaden the purview of recent scholarship pertaining to socially just writing assessments by making connections among assemblage theory and materialism, studies of ecological and anti-racist assessments, and studies of writing center work, to ground theoretical conversations in everyday practices. Focusing on systemic…

Captive spider monkeys (Ateles geoffroyi) arm-raise to solicit allo-grooming.

Science.gov (United States)

Scheel, Matthew H; Edwards, Dori

2012-03-01

Old World monkeys solicit allo-grooming from conspecifics. However, there are relatively few studies of allo-grooming among spider monkeys, and descriptions of allo-grooming solicitation among spider monkeys are anecdotal. In this study, eighty-one hours of video, shot over eight weeks, captured 271 allo-grooming bouts among small groups of captive spider monkeys. Six of eight monkeys made heretofore unreported arm-raises that solicited higher than normal rates of allo-grooming. Allo-grooming bout durations following arm-raises also tended to be longer than bouts not preceded by arm-raises. The efficacy of the arm-raise at soliciting allo-grooming suggests spider monkeys are capable of intentional communication. Copyright © 2012 Elsevier B.V. All rights reserved.

Situations of dwelling

DEFF Research Database (Denmark)

Welling, Helen; Duelund Mortensen, Peder; Wiell Nordberg, Lene

2006-01-01

This article explores changeable dwellings that offer the possibility of satisfying spontaneous activities and needs arising from today's changing family patterns. It deals with dwellings that provide people with room for development and flexibility - an open framework, which can be adapted to new...

Vision in the nocturnal wandering spider Leucorchestris arenicola (Araneae: Sparassidae)

DEFF Research Database (Denmark)

Nørgaard, Thomas; Nilsson, Dan-Eric; Henschel, Joh R

2008-01-01

At night the Namib Desert spider Leucorchestris arenicola performs long-distance homing across its sand dune habitat. By disabling all or pairs of the spiders' eight eyes we found that homing ability was severely reduced when vision was fully abolished. Vision, therefore, seems to play a key role...... in the posterior and anteriomedian eyes, and at approximately 540 nm in the anteriolateral eyes. Theoretical calculations of photon catches showed that the eyes are likely to employ a combination of spatial and temporal pooling in order to function at night. Under starlit conditions, the raw spatial and temporal...... resolution of the eyes is insufficient for detecting any visual information on structures in the landscape, and bright stars would be the only objects visible to the spiders. However, by summation in space and time, the spiders can rescue enough vision to detect coarse landscape structures. We show that L...

Recombinant Spider Silks—Biopolymers with Potential for Future Applications

Directory of Open Access Journals (Sweden)

Thomas Scheibel

2011-03-01

Full Text Available Nature has evolved a range of materials that compete with man-made materials in physical properties; one of these is spider silk. Silk is a fibrous material that exhibits extremely high strength and toughness with regard to its low density. In this review we discuss the molecular structure of spider silk and how this understanding has allowed the development of recombinant silk proteins that mimic the properties of natural spider silks. Additionally, we will explore the material morphologies and the applications of these proteins. Finally, we will look at attempts to combine the silk structure with chemical polymers and how the structure of silk has inspired the engineering of novel polymers.

Gamma radiation in dwellings

International Nuclear Information System (INIS)

Mjoenes, L.

1981-08-01

A nationwide investigation has been made into the gamma radiation in Swedish dwellings. The measurements were made with small detectors containing thermoluminescent dosimeters. The detectors were sent to the selected participants by mail. 1300 dwellings were included in the investigation. In each dwelling three measurements were made: one detector was placed in the kitchen, one in the living-room and one in the bedroom. The mean annual absorbed tissue dose in dwellings in Sweden was found to be 0.65 mGy (corresponding to an exposition rate of 12 μR/h) when the contribution from cosmic radiation had been subtracted. That represents an annual collective dose of about 4000 mansieverts to the population of Sweden. From a previous investigation we have calculate the mean value for the gamma radiation in Swedish dwellings for 1950 to be 0.4 mGy/a (8μR/h). The reason for the relatively large increase in the mean value is an increased use of building materials on stone, particularly of lightweight concrete based on alum shale, from 1940 to middle 1960s. The production of this type of lightweight concrete was discontinued in 1975 and the use of other stone-based building materials has decreased. The mean value of gamma radiation in Swedish dwellings is therefore expected to decrease slowly in the future if this tendency holds. Sweden has some 3.5 million dwellings. About 10 % of them have mean values of 1 mGy/a (19 μR/h) or more, 0.2 % have 3 mGy/a (57 μR/h) or more and a couple of hundred 5 mGy/a (95 μR/h or more. The mean value for detached houses was found to be 0.43 mGy/a (8 μR/h) and for dwellings in multi-family houses 0.80 mGy/a (15 μR/h). The investigation dwellings have also been classified according to the building materials, the year of construction and the degree of urbanization of the area. (author)

Stable isotopes of Hawaiian spiders reflect substrate properties along a chronosequence

Science.gov (United States)

Dawson, Todd E.; Gillespie, Rosemary G.

2018-01-01

The Hawaiian Islands offer a unique opportunity to test how changes in the properties of an isolated ecosystem are propagated through the organisms that occur within that ecosystem. The age-structured arrangement of volcanic-derived substrates follows a regular progression over space and, by inference, time. We test how well documented successional changes in soil chemistry and associated vegetation are reflected in organisms at higher trophic levels—specifically, predatory arthropods (spiders)—across a range of functional groups. We focus on three separate spider lineages: one that builds capture webs, one that hunts actively, and one that specializes on eating other spiders. We analyze spiders from three sites across the Hawaiian chronosequence with substrate ages ranging from 200 to 20,000 years. To measure the extent to which chemical signatures of terrestrial substrates are propagated through higher trophic levels, we use standard stable isotope analyses of nitrogen and carbon, with plant leaves included as a baseline. The target taxa show the expected shift in isotope ratios of δ15N with trophic level, from plants to cursorial spiders to web-builders to spider eaters. Remarkably, organisms at all trophic levels also precisely reflect the successional changes in the soil stoichiometry of the island chronosequence, demonstrating how the biogeochemistry of the entire food web is determined by ecosystem succession of the substrates on which the organisms have evolved. PMID:29576984

Synthetic Spider Silk Production on a Laboratory Scale

Science.gov (United States)

Hsia, Yang; Gnesa, Eric; Pacheco, Ryan; Kohler, Kristin; Jeffery, Felicia; Vierra, Craig

2012-01-01

As society progresses and resources become scarcer, it is becoming increasingly important to cultivate new technologies that engineer next generation biomaterials with high performance properties. The development of these new structural materials must be rapid, cost-efficient and involve processing methodologies and products that are environmentally friendly and sustainable. Spiders spin a multitude of different fiber types with diverse mechanical properties, offering a rich source of next generation engineering materials for biomimicry that rival the best manmade and natural materials. Since the collection of large quantities of natural spider silk is impractical, synthetic silk production has the ability to provide scientists with access to an unlimited supply of threads. Therefore, if the spinning process can be streamlined and perfected, artificial spider fibers have the potential use for a broad range of applications ranging from body armor, surgical sutures, ropes and cables, tires, strings for musical instruments, and composites for aviation and aerospace technology. In order to advance the synthetic silk production process and to yield fibers that display low variance in their material properties from spin to spin, we developed a wet-spinning protocol that integrates expression of recombinant spider silk proteins in bacteria, purification and concentration of the proteins, followed by fiber extrusion and a mechanical post-spin treatment. This is the first visual representation that reveals a step-by-step process to spin and analyze artificial silk fibers on a laboratory scale. It also provides details to minimize the introduction of variability among fibers spun from the same spinning dope. Collectively, these methods will propel the process of artificial silk production, leading to higher quality fibers that surpass natural spider silks. PMID:22847722

SPIDERS (ARANEI OF THE REPUBLIC OF SOUTH OSSETIA

Directory of Open Access Journals (Sweden)

Alexander V. Ponomarev

2015-01-01

Full Text Available Aim. Until recently, spider fauna of the Republic of South Ossetia has been the least studied among the regional araneofaunas of the Caucasus. According to the literature data, as little as 30 spider species have been known from the republic’s territory (Mkheidze, 1997, Mikhailov, 1990; Ponomarev, Dvadnenko, 2013; Trilicauscas, Komarov, 2014. Therefore, the aim of the present article is to summarize available data on the spider fauna of South Ossetia.Location. Republic of South Ossetia.Methods. The material was collected in various districts of South Ossetia in 2011-2014 by Yu.E. Komarov. Mainly, the collecting was performed in the city of Tskhinvali and its environs, and in the South Ossetian State Reserve. Spiders were sampled with pitfall traps and sweep netting. The time of traps’ exposure is April–December.Results and main conclusions. To date, the spider fauna of the Republic of South Ossetia includes 230 species from 29 families. 222 species were registered by the authors, eight species (Clubiona pseudosimilis, Gnaphosa lugubris, Linyphia hortensis, Neriene peltata, Geolycosa vultuosa, Pardosa azerifalcata, Ero aphana, and Philodromus rufus are known from the literature only. Seven species are new to the Caucasus (Clubiona pseudosimilis, Gnaphosa lugubris, Linyphia hortensis, Neriene peltata, Geolycosa vultuosa, Pardosa azerifalcata, Ero aphana, and Philodromus rufus. Of these, two species were known earlier only from Turkey (Pardosa consimilis, Ozyptila spirembolus, and one species (Tegenaria pseudolyncea only from Azerbaijan. Against the background of the widespread species predominance, the Caucasian element is small and presented by twelve species (Tegenaria pseudolyncea, Dysdera tkibuliensis, Haplodrassus caucasius, Zelotes khostensis, Mansuphantes ovalis, Sintula oseticus, Tenuiphantes teberdaensis, Pardosa azerifalcata, P. caucasica, Piratula hurkai, Trochosa cachetiensis, and Xysticus ukrainicus.

Spider mite control and resistance management: does a genome help?

NARCIS (Netherlands)

Van Leeuwen, T.; Dermauw, W.; Grbic, M.; Tirry, L.; Feyereisen, R.

2012-01-01

The complete genome of the two-spotted spider mite, Tetranychus urticae, has been reported. This is the first sequenced genome of a highly polyphagous and resistant agricultural pest. The question as to what the genome offers the community working on spider mite control is addressed.

Sediment and carbon deposition vary among vegetation assemblages in a coastal salt marsh

Directory of Open Access Journals (Sweden)

J. J. Kelleway

2017-08-01

Sporobolus assemblages, compared to high retention and preservation of organic inputs in the Juncus assemblage. By combining medium-term accretion quantification with short-term deposition measurements and chemical analyses, we have gained novel insights into above-ground biophysical processes that may explain previously observed regional differences in surface dynamics among key salt marsh vegetation assemblages. Our results suggest that Sarcocornia and Sporobolus assemblages may be particularly susceptible to changes in sea level, though quantification of below-ground processes (e.g. root production, compaction is needed to confirm this.

Impact of Iron Baron oil spill on subtidal reef assemblages in Tasmania

International Nuclear Information System (INIS)

Edgara, Graham J.; Barrett, Neville S.

2000-01-01

The biological impact of the grounding of the bulk carrier Iron Baron on Hebe Reef in northern Tasmania, with release of approximately 350 tonnes of Bunker C fuel oil, was assessed using quantitative underwater censuses at numerous reef sites before and after the spill. Physical abrasion of the ship's hull during ground caused the complete destruction of the subtidal reef community within a localised area of ∼170 m by ∼20 m on Hebe Reef. However, the release of fuel oil did not appear to have substantially affected populations of subtidal reef-associated organisms in the near vicinity. Analyses of changes over time outside the hull impact area of oiled sites before and after the spill, and comparisons with undisturbed reference sites, indicated no significant change in number of species on reefs or densities of the most abundant animal and plant species. Post-impact monitoring of the grounding zone in adjacent reference sites on Hebe Reef indicated that the fish assemblages associated with the hull scar recovered rapidly in terms of species composition and species richness within one year, whereas plant and invertebrate assemblages had not reached inferred pre-disturbance levels after two years. Wave disturbance appeared to be hindering re-establishment of large macroalgae over part of the abrasion zone where the reef substrata had been converted to unstable gravels. (Author)

Intersexual Trophic Niche Partitioning in an Ant-Eating spider (Araneae: Zodariidae)

DEFF Research Database (Denmark)

Pekár, Stanislav; Martisová, Martina; Bilde, T.

2011-01-01

lead to higher energy demands in females driven by fecundity selection, while males invest in mate searching. We tested predictions of the two hypotheses underlying intersexual trophic niche partitioning in a natural population of spiders. Zodarion jozefienae spiders specialize on Messor barbarus ants...... that are polymorphic in body size and hence comprise potential trophic niches for the spider, making this system well-suited to study intersexual trophic niche partitioning. Methodology/Principal Findings Comparative analysis of trophic morphology (the chelicerae) and body size of males, females and juveniles...... demonstrated highly female biased SSD (Sexual Size Dimorphism) in body size, body weight, and in the size of chelicerae, the latter arising from sex-specific growth patterns in trophic morphology. In the field, female spiders actively selected ant sub-castes that were larger than the average prey size...

Radon in Finnish dwellings. Sample survey 2006

International Nuclear Information System (INIS)

Maekelaeinen, I.; Kinnunen, T.; Reisbacka, H.; Valmari, T.; Arvela, H.

2009-12-01

concentrations are high in houses using a slab-on-ground foundation. In addition, foundation solution in hillside houses or houses that have a basement with open staircase between the lowest floor and the rest of the dwelling still increases radon concentrations. This is caused by the ground contact constructions that allow radon-bearing air to flow through them into the living spaces. Also the soil at the building site affects radon concentration. Radon concentrations were higher in houses built on gravel and sand formations and quarried rock than other soil types. High concentrations were found also on tighter soil types. The use of light-weight concrete blocks increases radon leaks from the soil. Radon concentrations were lower in houses with mechanical supply and exhaust ventilation than in houses with natural or mechanical exhaust ventilation. After the rise in radon concentrations in new houses that started in sixties, concentrations have started to drop in houses built in 2000 and later. This is due to the crawl space foundation and mechanical supply and exhaust ventilation becoming more common. In addition, the use of radon prevention techniques in new building has increased. In the areas of Tavastia and South-Eastern Finland radon piping has been installed in 64 per cent of houses built after 1995, the percentage being 24 in the whole country. The sealing of foundation constructions, which is important for radon prevention, has not become as common as was hoped for. The success of radon prevention in new building is crucial when aiming for low radon concentrations in the building stock. (orig.)

Association of spiders and lichen on Robben Island, South Africa: a case report

Directory of Open Access Journals (Sweden)

A. Mukherjee

2010-04-01

Full Text Available The present study is a firstrecord of spider occurrence on Robben Island, South Africa. Some habitats were rich in lichens. As we know, lichens enhance wildlife habitat in less direct ways. The objective of the study was to examine the potential importance of lichens in enriching spider diversity and abundance. A total of 260 spiders (170 from lichens and 90 from bush were collected following the visual search method over one year. Seasonal trends in overall species richness and abundance indicated that the relative density of spiders was greater in lichens than in bushes. The result suggests that habitat structure, such as branch size and epiphytic lichen abundance, can be an explanation for the greater number of spiders in lichen-rich patches of the island.

Programming spiders, bots, and aggregators in Java

CERN Document Server

Heaton, Jeff

2006-01-01

The content and services available on the web continue to be accessed mostly through direct human control. But this is changing. Increasingly, users rely on automated agents that save them time and effort by programmatically retrieving content, performing complex interactions, and aggregating data from diverse sources. Programming Spiders, Bots, and Aggregators in Java teaches you how to build and deploy a wide variety of these agents-from single-purpose bots to exploratory spiders to aggregators that present a unified view of information from multiple user accounts. You will quickly build on

Recombinant DNA production of spider silk proteins.

Science.gov (United States)

Tokareva, Olena; Michalczechen-Lacerda, Valquíria A; Rech, Elíbio L; Kaplan, David L

2013-11-01

Spider dragline silk is considered to be the toughest biopolymer on Earth due to an extraordinary combination of strength and elasticity. Moreover, silks are biocompatible and biodegradable protein-based materials. Recent advances in genetic engineering make it possible to produce recombinant silks in heterologous hosts, opening up opportunities for large-scale production of recombinant silks for various biomedical and material science applications. We review the current strategies to produce recombinant spider silks. © 2013 The Authors. Microbial Biotechnology published by John Wiley & Sons Ltd and Society for Applied Microbiology.

Using Malaise traps to sample ground beetles (Coleoptera: Carabidae)

Science.gov (United States)

Michael D. Ulyshen; James L. Hanula; Scott Horn

2005-01-01

Pitfall traps provide an easy and inexpensive way to sample ground-dwelling arthropods (Spence and Niemela 1994; Spence et al. 1997; Abildsnes and Tommeras 2000) and have been used exclusively in many studies of the abundance and diversity of ground beetles (Coleoptera: Carabidae). Despite the popularity of this trapping technique, pitfall traps have many disadvantages...

Spider genomes provide insight into composition and evolution of venom and silk

Science.gov (United States)

Sanggaard, Kristian W.; Bechsgaard, Jesper S.; Fang, Xiaodong; Duan, Jinjie; Dyrlund, Thomas F.; Gupta, Vikas; Jiang, Xuanting; Cheng, Ling; Fan, Dingding; Feng, Yue; Han, Lijuan; Huang, Zhiyong; Wu, Zongze; Liao, Li; Settepani, Virginia; Thøgersen, Ida B.; Vanthournout, Bram; Wang, Tobias; Zhu, Yabing; Funch, Peter; Enghild, Jan J.; Schauser, Leif; Andersen, Stig U.; Villesen, Palle; Schierup, Mikkel H; Bilde, Trine; Wang, Jun

2014-01-01

Spiders are ecologically important predators with complex venom and extraordinarily tough silk that enables capture of large prey. Here we present the assembled genome of the social velvet spider and a draft assembly of the tarantula genome that represent two major taxonomic groups of spiders. The spider genomes are large with short exons and long introns, reminiscent of mammalian genomes. Phylogenetic analyses place spiders and ticks as sister groups supporting polyphyly of the Acari. Complex sets of venom and silk genes/proteins are identified. We find that venom genes evolved by sequential duplication, and that the toxic effect of venom is most likely activated by proteases present in the venom. The set of silk genes reveals a highly dynamic gene evolution, new types of silk genes and proteins, and a novel use of aciniform silk. These insights create new opportunities for pharmacological applications of venom and biomaterial applications of silk. PMID:24801114

Spider-silk-like shape memory polymer fiber for vibration damping

International Nuclear Information System (INIS)

Yang, Qianxi; Li, Guoqiang

2014-01-01

In this study, the static and dynamic properties of shape memory polyurethane (SMPU) fiber are reported and compared to those of spider dragline silk. Although the polymeric fiber has a lower strength compared to spider dragline silks (0.2–0.3 GPa versus 1.1 GPa), it possesses much higher toughness (276–289 MJ m −3 versus 160 MJ m −3 ), due to its excellent extensibility. The dynamic mechanical tests reveal that SMPU fiber has a high damping capacity (tan δ = 0.10–0.35) which is comparable to or even higher than that of spider silks (tan δ = 0.15). In addition, we found that, different programming methods change the shape memory and damping properties of the fiber in different ways and cold-drawing programming is more advocated in structural applications. These results suggest that the SMPU fiber has similar vibration damping and mechanical properties as spider silk, and may find applications in lightweight engineering structures. (paper)

Plasticity in Major Ampullate Silk Production in Relation to Spider Phylogeny and Ecology

Science.gov (United States)

Boutry, Cecilia; Řezáč, Milan; Blackledge, Todd Alan

2011-01-01

Spider major ampullate silk is a high-performance biomaterial that has received much attention. However, most studies ignore plasticity in silk properties. A better understanding of silk plasticity could clarify the relative importance of chemical composition versus processing of silk dope for silk properties. It could also provide insight into how control of silk properties relates to spider ecology and silk uses. We compared silk plasticity (defined as variation in the properties of silk spun by a spider under different conditions) between three spider clades in relation to their anatomy and silk biochemistry. We found that silk plasticity exists in RTA clade and orbicularian spiders, two clades that differ in their silk biochemistry. Orbiculariae seem less dependent on external spinning conditions. They probably use a valve in their spinning duct to control friction forces and speed during spinning. Our results suggest that plasticity results from different processing of the silk dope in the spinning duct. Orbicularian spiders seem to display better control of silk properties, perhaps in relation to their more complex spinning duct valve. PMID:21818328

Plasticity in major ampullate silk production in relation to spider phylogeny and ecology.

Directory of Open Access Journals (Sweden)

Cecilia Boutry

Full Text Available Spider major ampullate silk is a high-performance biomaterial that has received much attention. However, most studies ignore plasticity in silk properties. A better understanding of silk plasticity could clarify the relative importance of chemical composition versus processing of silk dope for silk properties. It could also provide insight into how control of silk properties relates to spider ecology and silk uses. We compared silk plasticity (defined as variation in the properties of silk spun by a spider under different conditions between three spider clades in relation to their anatomy and silk biochemistry. We found that silk plasticity exists in RTA clade and orbicularian spiders, two clades that differ in their silk biochemistry. Orbiculariae seem less dependent on external spinning conditions. They probably use a valve in their spinning duct to control friction forces and speed during spinning. Our results suggest that plasticity results from different processing of the silk dope in the spinning duct. Orbicularian spiders seem to display better control of silk properties, perhaps in relation to their more complex spinning duct valve.

Riparian spiders as sentinels of polychlorinated biphenyl contamination across heterogeneous aquatic ecosystems

Science.gov (United States)

Kraus, Johanna M.; Gibson, Polly P.; Walters, David M.; Mills, Marc A.

2017-01-01

Riparian spiders are being used increasingly to track spatial patterns of contaminants in and fluxing from aquatic ecosystems.However, our understanding of the circumstances under which spiders are effective sentinels of aquatic pollution is limited. The present study tests the hypothesis that riparian spiders may be effectively used to track spatial patterns of sediment pollution by polychlorinated biphenyls (PCBs) in aquatic ecosystems with high habitat heterogeneity. The spatial pattern of ΣPCB concentrations in 2 common families of riparian spiders sampled in 2011 to 2013 generally tracked spatial variation in sediment ΣPCBs across all sites within the Manistique River Great Lakes Area of Concern (AOC), a rivermouth ecosystem located on the south shore of the Upper Peninsula, Manistique (MI,USA) that includes harbor, river, backwater, and lake habitats. Sediment ΣPCB concentrations normalized for total organic carbon explained 41% of the variation in lipid-normalized spider ΣPCB concentrations across 11 sites. Furthermore, 2 common riparian spider taxa (Araneidae and Tetragnathidae) were highly correlated (r2> 0.78) and had similar mean ΣPCB concentrations when averaged acrossall years. The results indicate that riparian spiders may be useful sentinels of relative PCB availability to aquatic and riparian food webs in heterogeneous aquatic ecosystems like rivermouths where habitat and contaminant variability may make the use of aquatic taxa lesseffective. Furthermore, the present approach appears robust to heterogeneity in shoreline development and riparian vegetation that support different families of large web-building spiders. Environ Toxicol Chem 2016;9999:1–9. Published 2016 Wiley Periodicals, Inc. on behalf of SETAC. This article is a US government work and, as such, is in the public domain in the United States of America.

Megabenthic assemblages in the continental shelf edge and upper slope of the Menorca Channel, Western Mediterranean Sea

Science.gov (United States)

Grinyó, Jordi; Gori, Andrea; Greenacre, Michael; Requena, Susana; Canepa, Antonio; Lo Iacono, Claudio; Ambroso, Stefano; Purroy, Ariadna; Gili, Josep-Maria

2018-03-01

Highly diverse megabenthic assemblages dominated by passive and active suspension feeders have been recently reported in shelf edge environments of the Mediterranean Sea. Due to their frequent association with species of commercial interest, these assemblages have been heavily impacted by fishing. The vulnerability and low resilience of these assemblages, composed mainly by long-living and slow-growing species, have motivated the implementation of management measures such as the restriction of bottom trawling, and the establishment of large protected areas embracing these environments. The Menorca Channel is one of such areas recently included in the European Union Natura 2000 network. Quantitative analysis of video transects recorded at 95-360 m depth by manned submersible and remotely operated vehicles were used to characterize megabenthic assemblages and to assess their geographical and bathymetric distribution. Six different assemblages were identified, mainly segregated by substrate type and depth. Hard substrates hosted coral gardens and sponge grounds, whereas soft sediments were mainly characterized by large extensions of the crinoid Leptometra phalangium and the brachiopod Gryphus vitreus. The good preservation of most of the observed assemblages is probably related to a low bottom trawling pressure, which mainly concentrates deeper on the adjacent continental slope. Because of their biological and ecological value, management and conservation measures need to be established to preserve these benthic assemblages.

7 CFR 3550.106 - Dwelling requirements.

Science.gov (United States)

2010-01-01

... 7 Agriculture 15 2010-01-01 2010-01-01 false Dwelling requirements. 3550.106 Section 3550.106... Waste Disposal Grants § 3550.106 Dwelling requirements. (a) Modest dwelling. The property must be one... § 3550.63. (b) Post-repair condition. Dwellings repaired with section 504 funds need not be brought to...

Spider fauna in Caspian Costal region of Iran.

Science.gov (United States)

Ghavami, Sahra

2007-03-01

The current study investigated spider fauna of Caspian Costal region of Iran (Guilan, Mazandaran and Golestan provinces) during 2005-2006. Spiders were collected from on the ground and under the stones and grasses by bottle, aspirator, Pitfall trap and pans and from branches, leaves and trunks of different trees and bushes by Steiner and Baggiolini method and insect net. They transferred to the laboratory and classified in 52 species and 51 genera belonged to 20 families. Thirty species, 13 genera and 2 families are reported for the first time from Iran, as follows: Family Agelenidae: Agelena labyrinthica (Clerck, 1757), Cicurina sp., Family Araneidae: Agalenatea redii (Scopoli, 1763), Araniella inconspicua (Simon, 1874), Araniella alpica (C.L. Koch, 1869), Araneus diadematus Clerck, 1757, Cercidia sp., Cyclosa conica (Pallas, 1772), Hypsosinga sanguinea (C.L. Koch,1845), Family Clubionidae: Clubiona neglecta O.P. Camridge, 1862, Family Amaurobiidae, Family Eresidae: Eresus sp., Dresserus sp., Family Gnaphosidae: Aphantaulax sp., Micaria sp., Family Metidae: Zygiella x-notata (Clerck,1757), Family Miturgidae: Cheiracanthium erraticum (Walckenaer, 1802), Cheiracanthium pennyi O.P. Cambridge, 1873, Family Linyphiidae: Microlinyphia sp., Family Lycosidae: Alopecosa pulverulenta (Clerck, 1757), Pardosa amentata (Clerck, 1757), Pardosa agrestis (Westring, 1861), Pardosa monticola (Clerck, 1757), Family Oxyopidae: Oxyopes salticus (Hentx, 1802), Family Philodromidae: Philodromus cespitum (Walckenaer, 1802),Family Pholcidae: Psilochorus simoni (Berland, 1911), Pholcus phalangioides (Fuesslin, 1775), Family Salticidae: Salticus scenicus (Clerck, 1757), Family Tetragnathidae: Tetragnatha montana, Simon, 1874, Tetragnatha javana (Thorell, 1890), Family Theridiidae: Dipoena prona (Menge, 1868), Steatoda albomaculata (Degeer, 1778), Theridion impressum C. L. Koch, Theridion simile C.L. Koch,1836, Family Thomisidae: Misumena vatia (Clerck, 1757), Thanatus formicinus (Clerck

Spider diversity in relation to habitat heterogeneity and an altitudinal ...

African Journals Online (AJOL)

Using pitfall traps, wandering spiders (Arachnida: Araneae) were sampled in a nested design from three different localities in the mountainous arid ecosystem of South Sinai at low, middle, and high altitudes. Habitat type and altitude were clearly different among the three localities. Spider diversity per trap varied spatially ...

Risk of spider predation alters food web structure and reduces local herbivory in the field.

Science.gov (United States)

Bucher, Roman; Menzel, Florian; Entling, Martin H

2015-06-01

Predators can indirectly enhance plant performance via herbivore suppression, with both prey consumption and changes in prey traits (e.g. changes in foraging behaviour) contributing to the reduction in herbivory. We performed a field experiment to determine the extent of such non-consumptive effects which consisted of repeatedly placing spiders (Pisaura mirabilis) on enclosed plants (Urtica dioica) for cue deposition. Control plants were enclosed in the same way but without spiders. After cue deposition, the enclosures were removed to allow arthropods to colonize the plants and feed on them. Arthropods were removed from the plants before the subsequent spider deposition or control enclosure. During six cycles of enclosure, we quantified leaf damage on the plants. After a seventh cycle, the colonizing arthropods were sampled to determine community composition in relation to the presence/absence of spider cues. We found that the presence of chemotactile spider cues reduced leaf damage by 50 %. In addition, spider cues led to changes in the arthropod community: smaller spiders avoided plants with spider cues. In contrast, the aphid-tending ant Myrmica rubra showed higher recruitment of workers on cue-bearing plants, possibly to protect aphids. Our results show that the risk of spider predation can reduce herbivory on wild plants and also demonstrate that non-consumptive effects can be particularly strong within the predator guild.

An insect-feeding guild of carnivorous plants and spiders: does optimal foraging lead to competition or facilitation?

Science.gov (United States)

Crowley, Philip H; Hopper, Kevin R; Krupa, James J

2013-12-01

Carnivorous plants and spiders, along with their prey, are main players in an insect-feeding guild found on acidic, poorly drained soils in disturbed habitat. Darwin's notion that these plants must actively attract the insects they capture raises the possibility that spiders could benefit from proximity to prey hotspots created by the plants. Alternatively, carnivorous plants and spiders may deplete prey locally or (through insect redistribution) more widely, reducing each other's gain rates from predation. Here, we formulate and analyze a model of this guild, parameterized for carnivorous sundews and lycosid spiders, under assumptions of random movement by insects and optimal foraging by predators. Optimal foraging here involves gain maximization via trap investment (optimal web sizes and sundew trichome densities) and an ideal free distribution of spiders between areas with and without sundews. We find no facilitation: spiders and sundews engage in intense exploitation competition. Insect attraction by plants modestly increases sundew gain rates but slightly decreases spider gain rates. In the absence of population size structure, optimal spider redistribution between areas with and without sundews yields web sizes that are identical for all spiders, regardless of proximity to sundews. Web-building spiders have higher gain rates than wandering spiders in this system at high insect densities, but wandering spiders have the advantage at low insect densities. Results are complex, indicating that predictions to be tested empirically must be based on careful quantitative assessment.

12 CFR 541.10 - Dwelling unit.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Dwelling unit. 541.10 Section 541.10 Banks and... FEDERAL SAVINGS ASSOCIATIONS § 541.10 Dwelling unit. The term dwelling unit means the unified combination of rooms designed for residential use by one family, other than a single-family dwelling. ...

Effects of kaolin particle films on the life span of an orb-weaver spider.

Science.gov (United States)

Benhadi-Marín, Jacinto; Pereira, José Alberto; Santos, Sónia A P

2016-02-01

Araniella cucurbitina (Araneae: Araneidae) is a widespread orb-weaver spider commonly found in agroecosystems. Mineral particle films such as kaolin, due to their protective or anti-feeding action, can represent an alternative to pesticides, especially in organic farming systems, but little is known about its effects on A. cucurbitina. Therefore, we tested the effect of kaolin sprays on the life span of A. cucurbitina under laboratory conditions. Four treatments were tested encompassing different exposure routes. Thus, kaolin sprays were applied on (i) the surface, (ii) the prey (fly), (iii) the spider and (iv) both spider & prey. A control group was tested with water in each treatment. Results showed that sprays of kaolin significantly affected the survival of A. curcubitina when applications were done on the surface and on both spider & prey registering a reduction of 48% and 56%, respectively. Spiders in control obtained higher probability of reaching alive at the end of the assay than those treated with kaolin. Differences observed can be explained by the feeding behavior of the species and may depend on the consumption of the web by the spider and the ratio spider/fly for body size. Copyright © 2015 Elsevier Ltd. All rights reserved.

Can ant-eating Zodarion spiders (Araneae: Zodariidae) develop on a diet optimal for euryphagous arthropod predators?

DEFF Research Database (Denmark)

Pekar, Stano; Toft, Søren

2009-01-01

. Such adaptations may then entail trade-offs in handling and utilization of alternative prey. To investigate behavioural as well as nutritional adaptations and the occurrence of the corresponding trade-offs in two ant-eating spiders of the genus Zodarion [Zodarion atlanticum Pekár & Cardoso and Zodarion germanicum...... (C. L. Koch)], spiders are reared on two diets: ants (i.e. their preferred prey) and fruit flies (i.e. an alternative prey that is nutritionally optimal for euryphagous spiders). Food consumption is observed and several fitness-related life-history parameters are measured. Although spiders readily...... accept ants, more than one-third of 35 spiders refuse to consume fruit flies and starve. Furthermore, severe hunger does not induce these individuals to accept fruit flies. Starving spiders die before moulting to the second stadium. Spiders that eat fruit flies increase only little and slowly in weight...

Management intensity and vegetation complexity affect web-building spiders and their prey.

Science.gov (United States)

Diehl, Eva; Mader, Viktoria L; Wolters, Volkmar; Birkhofer, Klaus

2013-10-01

Agricultural management and vegetation complexity affect arthropod diversity and may alter trophic interactions between predators and their prey. Web-building spiders are abundant generalist predators and important natural enemies of pests. We analyzed how management intensity (tillage, cutting of the vegetation, grazing by cattle, and synthetic and organic inputs) and vegetation complexity (plant species richness, vegetation height, coverage, and density) affect rarefied richness and composition of web-building spiders and their prey with respect to prey availability and aphid predation in 12 habitats, ranging from an uncut fallow to a conventionally managed maize field. Spiders and prey from webs were collected manually and the potential prey were quantified using sticky traps. The species richness of web-building spiders and the order richness of prey increased with plant diversity and vegetation coverage. Prey order richness was lower at tilled compared to no-till sites. Hemipterans (primarily aphids) were overrepresented, while dipterans, hymenopterans, and thysanopterans were underrepresented in webs compared to sticky traps. The per spider capture efficiency for aphids was higher at tilled than at no-till sites and decreased with vegetation complexity. After accounting for local densities, 1.8 times more aphids were captured at uncut compared to cut sites. Our results emphasize the functional role of web-building spiders in aphid predation, but suggest negative effects of cutting or harvesting. We conclude that reduced management intensity and increased vegetation complexity help to conserve local invertebrate diversity, and that web-building spiders at sites under low management intensity (e.g., semi-natural habitats) contribute to aphid suppression at the landscape scale.

Comparative growth and development of spiders reared on live and dead prey.

Science.gov (United States)

Peng, Yu; Zhang, Fan; Gui, Shaolan; Qiao, Huping; Hose, Grant C

2013-01-01

Scavenging (feeding on dead prey) has been demonstrated across a number of spider families, yet the implications of feeding on dead prey for the growth and development of individuals and population is unknown. In this study we compare the growth, development, and predatory activity of two species of spiders that were fed on live and dead prey. Pardosa astrigera (Lycosidae) and Hylyphantes graminicola (Lyniphiidae) were fed live or dead fruit flies, Drosophila melanogaster. The survival of P. astrigera and H. graminicola was not affected by prey type. The duration of late instars of P. astrigera fed dead prey were longer and mature spiders had less protein content than those fed live prey, whereas there were no differences in the rate of H. graminicola development, but the mass of mature spiders fed dead prey was greater than those fed live prey. Predation rates by P. astrigera did not differ between the two prey types, but H. graminicola had a higher rate of predation on dead than alive prey, presumably because the dead flies were easier to catch and handle. Overall, the growth, development and reproduction of H. graminicola reared with dead flies was better than those reared on live flies, yet for the larger P. astrigera, dead prey may suit smaller instars but mature spiders may be best maintained with live prey. We have clearly demonstrated that dead prey may be suitable for rearing spiders, although the success of the spiders fed such prey appears size- and species specific.

Seagrass Parameter Affect the Fish Assemblages in Karimunjawa Archipelago

Science.gov (United States)

Sri Susilo, Endang; Nugroho Sugianto, Denny; Munasik; Nirwani; Adhi Suryono, Chrisna

2018-02-01

Seagrass beds promote high species diversity, abundance and biomass, and become important habitats for some economically important fishes. Plants of seagrasses result in structurally highly complex habitats and offering feeding grounds, shelter from predation as well as nursery areas for diverse fish assemblages. However, research on fish communities in Southeast Asian seagrass bed is rarely conducted. In the present study fish assemblages in seagrass beds with different parameters (cover, diversity and similarity indices, domination) was investigated in the Karimunjawa Islands, Indonesia. The purpose of this study were to assess whether fish assemblages differ concerning on the abundance and the species number. This study was conducted on the seagrass bed on Karimunjawa Islands in Java Sea, particularly in the water of Menjangan Besar and Menjangan Kecil Island. Line-quadrant transect was used to assess seagrass data, while the occurrence and individual number of fish harboured in the selected seagrass bed was counted by using underwater visual census in the stationary point count transects. Seagrass cover in Menjangan Kecil Island (41%) with various canopy included both upper and lower canopy was considerable higher than those in Menjangan Besar Island (5%). Fish diversity, species composition and abundance are considerably different between the two study sites. This study revealed that seagrass density or cover and canopy structure affected the fish abundance and species number harboured.

Detection and phylogenetic analysis of bacteriophage WO in spiders (Araneae).

Science.gov (United States)

Yan, Qian; Qiao, Huping; Gao, Jin; Yun, Yueli; Liu, Fengxiang; Peng, Yu

2015-11-01

Phage WO is a bacteriophage found in Wolbachia. Herein, we represent the first phylogenetic study of WOs that infect spiders (Araneae). Seven species of spiders (Araneus alternidens, Nephila clavata, Hylyphantes graminicola, Prosoponoides sinensis, Pholcus crypticolens, Coleosoma octomaculatum, and Nurscia albofasciata) from six families were infected by Wolbachia and WO, followed by comprehensive sequence analysis. Interestingly, WO could be only detected Wolbachia-infected spiders. The relative infection rates of those seven species of spiders were 75, 100, 88.9, 100, 62.5, 72.7, and 100 %, respectively. Our results indicated that both Wolbachia and WO were found in three different body parts of N. clavata, and WO could be passed to the next generation of H. graminicola by vertical transmission. There were three different sequences for WO infected in A. alternidens and two different WO sequences from C. octomaculatum. Only one sequence of WO was found for the other five species of spiders. The discovered sequence of WO ranged from 239 to 311 bp. Phylogenetic tree was generated using maximum likelihood (ML) based on the orf7 gene sequences. According to the phylogenetic tree, WOs in N. clavata and H. graminicola were clustered in the same group. WOs from A. alternidens (WAlt1) and C. octomaculatum (WOct2) were closely related to another clade, whereas WO in P. sinensis was classified as a sole cluster.

Riparian spiders as sentinels of PCB contamination across heterogeneous aquatic ecosystems

Science.gov (United States)

Riparian spiders are being used increasingly to track spatial patterns of contaminants in and fluxing from aquatic ecosystems. However, our understanding of the circumstances under which spiders are effective sentinels of aquatic pollution is limited. The present study tests the ...

Ecosystem services in the face of invasion: the persistence of native and nonnative spiders in an agricultural landscape.

Science.gov (United States)

Hogg, Brian N; Daane, Kent M

2011-03-01

The presence of intact natural ecosystems in agricultural landscapes can mitigate losses in the diversity of natural enemies and enhance ecosystem services. However, native natural enemies may fail to persist in agroecosystems if invaders dominate species interactions. In this study, native and nonnative spiders were sampled along transects that extended from oak woodland and riparian zones into surrounding California vineyards, to assess the role of natural habitat as a source for spider biodiversity in the vineyard landscape, and to compare the dominance of exotic Cheiracanthium spiders between habitats. Many spider species were more abundant in natural habitat than in vineyards, and numbers of spiders and spider species within vineyards were higher at the vineyard edge adjacent to oak woodland. These results suggest that natural habitat is a key source for spiders in vineyards. The positive effect of oak woodland on the vineyard spider community extended only to the vineyard edge, however. Proportions of Cheiracanthium spiders increased dramatically in the vineyard, while numbers of native wandering spiders (the native ecological homologues of Cheiracanthium spiders) decreased. Dispersal limitation and strong habitat preferences may have prevented native wandering spiders from establishing far from the vineyard edge. Exotic Cheiracanthium spiders, in contrast, may possess specific adaptations to vineyards or to a wide range of habitats. Results suggest that the ecosystem services provided by intact natural habitat may be limited in agricultural landscapes that are dominated by invasive species.

The life and adventures of an eight-legged castaway: Colonization and diversification of Philisca ghost spiders on Robinson Crusoe Island (Araneae, Anyphaenidae).

Science.gov (United States)

Soto, Eduardo M; Labarque, Facundo M; Ceccarelli, F Sara; Arnedo, Miquel A; Pizarro-Araya, Jaime; Ramírez, Martín J

2017-02-01

Oceanic archipelagoes, by their young origin and isolation, provide privileged settings to study the origin and diversification of species. Here, we study the anyphaenid spider genus Philisca, endemic to the Valdivian temperate rainforest, which includes species living both on the mainland as well as on the Robison Crusoe Island in the Juan Fernández archipelago. Anyphaenids, as many spiders, are potentially good colonizers due their ability for ballooning, an airborne dispersal mediated by strands of silk that are caught in the wind. We use a molecular approach to estimate both the phylogenetic relationships and the timeframe of species diversification of Philisca, with the aim to infer its evolutionary history. We further estimate the rates of speciation on both the insular and continental Philisca species and score the microhabitat used by each species and their sizes as a proxy to evaluate ecological niche diversification within the island. Most analyses support the monophyly of Philisca, with the exclusion of Philisca tripunctata. Our results reveal colonization from a single lineage that postdated the origin of the island, followed by rapid (∼2Ma) diversification. The ancestral microhabitat was most likely leaf-dwelling but we identify two independent microhabitat shifts. Our data provides evidence that Philisca has undergone an adaptive radiation on the Robison Crusoe Island. Copyright © 2016 Elsevier Inc. All rights reserved.

Functional Group of Spiders in Cultivated Landscape Dominated by Paddy Fields in West Java, Indonesia

Directory of Open Access Journals (Sweden)

I WAYAN SUANA

2009-03-01

Full Text Available Distribution of spiders in all colonized environments is limited by biotic and abiotic factors requiring adaptations with respect to, for example microhabitat choice and hunting behavior. These two factors were frequently used to group spiders into functional groups. In this study our objectives were to (i group of genera of spiders into functional group based on their microhabitat specificity, hunting behavior, and daily activity; and (ii compare the number and composition of functional group of spider at each habitat type and period of paddy growth. The study was conducted at a landscape dominated by paddy fields in Cianjur Watershed for a period of 9 months. Four different habitat types (paddy, vegetable, non-crop, and mixed garden, were sampled using five trapping techniques (pitfall traps, farmcop suction, sweep netting, yellow-pan traps, and sticky traps. The Unweighted Pair-Group Average and the Euclidean Distances were used to generate dendrogram of functional group of spider. We found 14 functional groups of spider at genus level. The number of functional group of spider at four habitat types was differing, but the composition was similar, because all habitats were closed to each other. Habitat structure diversity and disturbance level influenced the number of functional group of spider. Different architecture of vegetation and availability of differ prey during paddy growth, causing the composition of functional group of spider in each period of paddy growth was changed, although its number was unchanged.

Linking Native and Invader Traits Explains Native Spider Population Responses to Plant Invasion.

Directory of Open Access Journals (Sweden)

Jennifer N Smith

Full Text Available Theoretically, the functional traits of native species should determine how natives respond to invader-driven changes. To explore this idea, we simulated a large-scale plant invasion using dead spotted knapweed (Centaurea stoebe stems to determine if native spiders' web-building behaviors could explain differences in spider population responses to structural changes arising from C. stoebe invasion. After two years, irregular web-spiders were >30 times more abundant and orb weavers were >23 times more abundant on simulated invasion plots compared to controls. Additionally, irregular web-spiders on simulated invasion plots built webs that were 4.4 times larger and 5.0 times more likely to capture prey, leading to >2-fold increases in recruitment. Orb-weavers showed no differences in web size or prey captures between treatments. Web-spider responses to simulated invasion mimicked patterns following natural invasions, confirming that C. stoebe's architecture is likely the primary attribute driving native spider responses to these invasions. Differences in spider responses were attributable to differences in web construction behaviors relative to historic web substrate constraints. Orb-weavers in this system constructed webs between multiple plants, so they were limited by the overall quantity of native substrates but not by the architecture of individual native plant species. Irregular web-spiders built their webs within individual plants and were greatly constrained by the diminutive architecture of native plant substrates, so they were limited both by quantity and quality of native substrates. Evaluating native species traits in the context of invader-driven change can explain invasion outcomes and help to identify factors limiting native populations.

Formation of primary sperm conjugates in a haplogyne spider (Caponiidae, Araneae) with remarks on the evolution of sperm conjugation in spiders.

Science.gov (United States)

Lipke, Elisabeth; Michalik, Peter

2012-11-01

Sperm conjugation, where two or more sperm are physically united, is a rare but widespread pheno-menon across the animal kingdom. One group well known for its different types of sperm conjugation are spiders. Particularly, haplogyne spiders show a high diversity of sperm traits. Besides individual cleistospermia, primary (synspermia) and secondary (coenospermia, "spermatophore") sperm conjugation occurs. However, the evolution of sperm conjugates and sperm is not understood in this group. Here, we look at how sperm are transferred in Caponiidae (Haplogynae) in pursuit of additional information about the evolution of sperm transfer forms in spiders. Additionally, we investigated the male reproductive system and spermatozoa using light- and transmission electron-microscopy and provide a 3D reconstruction of individual as of well as conjugated spermatozoa. Mature spermatozoa are characterized by an extremely elongated, helical nucleus resulting in the longest spider sperm known to date. At the end of spermiogenesis, synspermia are formed by complete fusion of four spermatids. Thus, synspermia might have evolved early within ecribellate Haplogynae. The fused sperm cells are surrounded by a prominent vesicular area. The function of the vesicular area remains still unknown but might be correlated with the capacitation process inside the female. Further phylogenetic and functional implications of the spermatozoa and sperm conjugation are discussed. Copyright © 2012 Elsevier Ltd. All rights reserved.

Species richness and composition assessment of spiders in a Mediterranean scrubland

DEFF Research Database (Denmark)

Bondoso Cardoso, Pedro Miguel; Henriques, Sérgio S.; Gaspar, Clara

2009-01-01

Intensive fieldwork has been undertaken in Portugal in order to develop a standardized and optimized sampling protocol for Mediterranean spiders. The present study had the objectives of testing the use of semi-quantitative sampling for obtaining an exhaustive species richness assessment of spiders...

Methods of assembling and disassembling spider and burnable poison rod structures for nuclear reactors

International Nuclear Information System (INIS)

Edwards, G.T.; Schluderberg, D.C.

1981-01-01

A technique is provided for engaging and disengaging burnable poison rods from a spider in a nuclear reactor fuel assembly. A cap on the end of each of the burnable poison rods is provided with a shank or stem that is received in a respective bore formed in the spider. A frangible flange secures the shank and rod to the spider. Pressing the shank in the direction of the bore axis by means, e.g., of a plate ruptures the frangible flange to release the rod from the spider. (author)

The spider Harpactea sadistica: co-evolution of traumatic insemination and complex female genital morphology in spiders.

Science.gov (United States)

Rezác, Milan

2009-08-07

The males of invertebrates from a few phyla, including arthropods, have been reported to practise traumatic insemination (TI; i.e. injecting sperm by using the copulatory organ to penetrate the female's body wall). As all previously reported arthropod examples have been insects, there is considerable interest in whether TI might have evolved independently in other arthropods. The research reported here demonstrates the first case of TI in the arthropod subphylum Chelicerata, in particular how the genital morphology and mating behaviour of Harpactea sadistica (Rezác 2008), a spider from Israel, has become adapted specifically for reproduction based on TI. Males have needle-like intromittent organs and females have atrophied spermathecae. In other spiders, eggs are fertilized simultaneously with oviposition, but the eggs of H. sadistica are fertilized in the ovaries (internal fertilization) and develop as embryos before being laid. Sperm-storage organs of phylogenetically basal groups to H. sadistica provide males with last male sperm priority and allow removal of sperm by males that mate later, suggesting that TI might have evolved as an adaptive strategy to circumvent an unfavourable structure of the sperm-storage organs, allowing the first male to mate with paternity advantage. Understanding the functional significance of TI gives us insight into factors underlying the evolution of the genital and sperm-storage morphology in spiders.

Sphagnum-dwelling testate amoebae in subarctic bogs are more sensitive to soil warming in the growing season than in winter: the results of eight-year field climate manipulations.

Science.gov (United States)

Tsyganov, Andrey N; Aerts, Rien; Nijs, Ivan; Cornelissen, Johannes H C; Beyens, Louis

2012-05-01

Sphagnum-dwelling testate amoebae are widely used in paleoclimate reconstructions as a proxy for climate-induced changes in bogs. However, the sensitivity of proxies to seasonal climate components is an important issue when interpreting proxy records. Here, we studied the effects of summer warming, winter snow addition solely and winter snow addition together with spring warming on testate amoeba assemblages after eight years of experimental field climate manipulations. All manipulations were accomplished using open top chambers in a dry blanket bog located in the sub-Arctic (Abisko, Sweden). We estimated sensitivity of abundance, diversity and assemblage structure of living and empty shell assemblages of testate amoebae in the living and decaying layers of Sphagnum. Our results show that, in a sub-arctic climate, testate amoebae are more sensitive to climate changes in the growing season than in winter. Summer warming reduced species richness and shifted assemblage composition towards predominance of xerophilous species for the living and empty shell assemblages in both layers. The higher soil temperatures during the growing season also decreased abundance of empty shells in both layers hinting at a possible increase in their decomposition rates. Thus, although possible effects of climate changes on preservation of empty shells should always be taken into account, species diversity and structure of testate amoeba assemblages in dry subarctic bogs are sensitive proxies for climatic changes during the growing season. Copyright © 2011 Elsevier GmbH. All rights reserved.

Beneficial Effects of Ants and Spiders on the Reproductive Value of Eriotheca gracilipes (Malvaceae) in a Tropical Savanna.

Science.gov (United States)

Stefani, Vanessa; Pires, Tayna Lopes; Torezan-Silingardi, Helena Maura; Del-Claro, Kleber

2015-01-01

Predators affect plant fitness when they forage on them and reduce the action of herbivores. Our study evaluates the complementary effects of spiders and ants that visit the extrafloral nectaries of Eriotheca gracilipes (Malvaceae) on the production of fruits and viable seeds of these savanna trees. Four experimental groups were established: control group - with free access of spiders and ants; exclusion group - spiders and ants excluded; ant group - absence of spiders; and spider group - absence of ants. The presence of ants reduced the spider richness; however, the presence of spiders did not affect the ant richness. A significantly higher number of fruits per buds were found in the presence of spiders alone or spiders and ants together (control group) compared with the absence of both predators (exclusion group). The number of seeds per fruits and seed viability were higher in the control group. This is the first study showing that spiders and ants may exert a positive and complementary effect on the reproductive value of an extrafloral nectaried plant. Mostly the impact of ants and/or spiders on herbivores is considered, whereas our study reinforces the importance of evaluating the effect of multiple predators simultaneously, exploring how the interactions among predators with distinct skills may affect the herbivores and the plants on which they forage.

Riparian spiders as sentinels of polychlorinated biphenyl contamination across heterogeneous aquatic ecosystems.

Science.gov (United States)

Kraus, Johanna M; Gibson, Polly P; Walters, David M; Mills, Marc A

2017-05-01

Riparian spiders are being used increasingly to track spatial patterns of contaminants in and fluxing from aquatic ecosystems. However, our understanding of the circumstances under which spiders are effective sentinels of aquatic pollution is limited. The present study tests the hypothesis that riparian spiders may be effectively used to track spatial patterns of sediment pollution by polychlorinated biphenyls (PCBs) in aquatic ecosystems with high habitat heterogeneity. The spatial pattern of ΣPCB concentrations in 2 common families of riparian spiders sampled in 2011 to 2013 generally tracked spatial variation in sediment ΣPCBs across all sites within the Manistique River Great Lakes Area of Concern (AOC), a rivermouth ecosystem located on the south shore of the Upper Peninsula, Manistique (MI, USA) that includes harbor, river, backwater, and lake habitats. Sediment ΣPCB concentrations normalized for total organic carbon explained 41% of the variation in lipid-normalized spider ΣPCB concentrations across 11 sites. Furthermore, 2 common riparian spider taxa (Araneidae and Tetragnathidae) were highly correlated (r 2  > 0.78) and had similar mean ΣPCB concentrations when averaged across all years. The results indicate that riparian spiders may be useful sentinels of relative PCB availability to aquatic and riparian food webs in heterogeneous aquatic ecosystems like rivermouths where habitat and contaminant variability may make the use of aquatic taxa less effective. Furthermore, the present approach appears robust to heterogeneity in shoreline development and riparian vegetation that support different families of large web-building spiders. Environ Toxicol Chem 2017;36:1278-1286. Published 2016 Wiley Periodicals, Inc. on behalf of SETAC. This article is a US government work and, as such, is in the public domain in the United States of America. Published 2016 Wiley Periodicals, Inc. on behalf of SETAC. This article is a US government work and, as such, is in

Contributions of detrital subsidies to aboveground spiders during secondary succession, revealed by radiocarbon and stable isotope signatures.

Science.gov (United States)

Haraguchi, Takashi F; Uchida, Masao; Shibata, Yasuyuki; Tayasu, Ichiro

2013-04-01

Prey subsidies originating from detritus add nutrients and energy to arboreal communities. Measurement of this subsidy is required in the understanding of how food web dynamics respond to changes in surrounding environments. Shrub spiders are one of the key predators involved in food web coupling. We evaluate the effects of potential changes in prey availabilities during secondary succession on the contribution of subsidy from detrital food webs to shrub spiders and how different spider feeding guilds used the subsidy of prey from detrital food webs. We measured the relative importance of the subsidy for the spider feeding guilds, using the ratios of stable isotopes of C (δ(13)C), and N (δ(15)N) and C isotope discrimination (Δ(14)C). Diet age was calculated from Δ(14)C values, because old diet ages of spiders indicate that the spiders consume prey from detrital food sources. Dominant aerial prey (Diptera) had a distinctively old diet age compared with arboreal prey, which indicates that aerial prey were subsidized from detrital food webs. Sit-and-wait spiders tended to have an older diet age than active hunting spiders, which indicates that sit-and-wait spiders depended more on subsidies. Diet age varied only slightly for spiders in stands of different ages, indicating that rates at which spiders use grazing and detrital prey are probably determined more by foraging strategies and not by stand age. A dominance of sit-and-wait predators will lead to higher detrital subsidy inputs in shrub habitats. This study highlights the effect of shrub spider community structure (feeding guild composition) on the volume of the subsidy received from the detrital food web.

David and Goliath: potent venom of an ant-eating spider (Araneae) enables capture of a giant prey

Science.gov (United States)

Pekár, Stano; Šedo, Onřej; Líznarová, Eva; Korenko, Stanislav; Zdráhal, Zdeněk

2014-07-01

It is rare to find a true predator that repeatedly and routinely kills prey larger than itself. A solitary specialised ant-eating spider of the genus Zodarion can capture a relatively giant prey. We studied the trophic niche of this spider species and investigated its adaptations (behavioural and venomic) that are used to capture ants. We found that the spider captures mainly polymorphic Messor arenarius ants. Adult female spiders captured large morphs while tiny juveniles captured smaller morphs, yet in both cases ants were giant in comparison with spider size. All specimens used an effective prey capture strategy that protected them from ant retaliation. Juvenile and adult spiders were able to paralyse their prey using a single bite. The venom glands of adults were more than 50 times larger than those of juvenile spiders, but the paralysis latency of juveniles was 1.5 times longer. This suggests that this spider species possesses very potent venom already at the juvenile stage. Comparison of the venom composition between juvenile and adult spiders did not reveal significant differences. We discovered here that specialised capture combined with very effective venom enables the capture of giant prey.

Gamma irradiation as a quarantine treatment for spider mites (Acarina: tetranychidae) in horticultural products

International Nuclear Information System (INIS)

Ignatowicz, S.; Banasik-Solgala, K.

1999-01-01

The carmine spider mite, Tetranychus cinnabarinus (Boisd.), and the two-spotted spider mite, Tetranychus urticae Koch, are closely related species of tetranychid mites (Acarina, Tetranychidae) that respond to gamma irradiation in a similar way. Eggs of both species exposed to gamma radiation early in embryonic development were considerably more susceptible to irradiation than older eggs. The tolerance of eggs to gamma radiation increased in 3-4-day-old eggs, when eye-spots were formed. Nymphs were more resistant to gamma radiation than eggs and larvae. Deteriorative effects of irradiation treatment were reflected in the immatures by their mortality in subsequent developmental stages. A positive relationship between dosage and the percent egg mortality or the mortality of subsequent stages was usually found when the immature stages were irradiated. The sex ratio of adults developed from irradiated eggs, larvae, and nymphs was affected by the irradiation treatment; the ratio was usually skewed towards males. Irradiation of females resulted in increased mortality, lowered fecundity, reduced egg viability, and sex ratio distortion in their progeny. Two-day-old females of the carmine spider mite and the two-spotted spider mite irradiated with 200 or 300 Gy lived as long as the controls. Mortality occurred after 3 weeks. The number of eggs laid by irradiated females of spider mites was considerably lower than in the control, and it decreased as the absorbed dose increased. The higher the dose of gamma radiation applied to adults of the spider mites (the parental generation, P), the higher the mortality of the F1 mites during their embryonic development. Viability of eggs laid by irradiated females of spider mites mated with irradiated males was significantly reduced. Young females treated with a dose of 0.2 kGy produced 40-50% nonviable eggs, while control mites produced only 6.0-6.6% nonviable eggs. A dose of 0.3 kGy caused high mortality of eggs; 88% and 97% nonviable

Radon studies in Indian dwellings

International Nuclear Information System (INIS)

Khan, A.J.

2000-01-01

The indoor radon ( 222 Rn) concentration has been measured by Solid State Nuclear Track Detectors (SSNTDs) in large number of Indian dwellings. Radon concentrations were measured in different parts of the country. In the first study, radon concentrations were measured in 143 dwellings of Udaipur, Bikaner and Banswara towns of Rajasthan province. The distributions of the time-averaged indoor radon concentration in these three towns of the Rajasthan fit an approximately log normal distribution. The geometric mean (GM) values of radon concentrations in these three places were found to be 74 Bq m -3 , 46 Bq m -3 and 66 Bq m -3 with a geometric standard deviation (GSD) of 2.2, 2.2 and 2.5 respectively. In another study, radon concentrations were measured in about 150 dwellings of hilly regions of the country. The measurements were carried out in Kohima (Nagaland), Baijnath and Palampur (Himachal Pradesh). The distribution of radon concentration in Kohima dwellings was found to be approximately log normal, however, the radon distribution in Baijnath and Palampur dwellings seems to be bimodal. The GM values of the radon concentrations for 65 dwellings in Kohima and 43 dwellings in Baijnath and Palampur were 88 Bq m -3 and 134 Bq m -3 with GSD of 1.7 and 2.5 respectively. The results are discussed in detail. (author)

Spider Transcriptomes Identify Ancient Large-Scale Gene Duplication Event Potentially Important in Silk Gland Evolution.

Science.gov (United States)

Clarke, Thomas H; Garb, Jessica E; Hayashi, Cheryl Y; Arensburger, Peter; Ayoub, Nadia A

2015-06-08

The evolution of specialized tissues with novel functions, such as the silk synthesizing glands in spiders, is likely an influential driver of adaptive success. Large-scale gene duplication events and subsequent paralog divergence are thought to be required for generating evolutionary novelty. Such an event has been proposed for spiders, but not tested. We de novo assembled transcriptomes from three cobweb weaving spider species. Based on phylogenetic analyses of gene families with representatives from each of the three species, we found numerous duplication events indicative of a whole genome or segmental duplication. We estimated the age of the gene duplications relative to several speciation events within spiders and arachnids and found that the duplications likely occurred after the divergence of scorpions (order Scorpionida) and spiders (order Araneae), but before the divergence of the spider suborders Mygalomorphae and Araneomorphae, near the evolutionary origin of spider silk glands. Transcripts that are expressed exclusively or primarily within black widow silk glands are more likely to have a paralog descended from the ancient duplication event and have elevated amino acid replacement rates compared with other transcripts. Thus, an ancient large-scale gene duplication event within the spider lineage was likely an important source of molecular novelty during the evolution of silk gland-specific expression. This duplication event may have provided genetic material for subsequent silk gland diversification in the true spiders (Araneomorphae). © The Author(s) 2015. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

Posteruption arthropod succession on the Mount St. Helens volcano: the ground-dwelling beetle fauna (Coleoptera).

Science.gov (United States)

R.R. Parmenter; C.M. Crisafulli; N. Korbe; G. Parsons; M. Edgar; J.A. MacMahon

2005-01-01

The 1980 eruptions of Mount St. Helens created a complex mosaic of disturbance types over a 600 km2 area. From 1980 through 2000 we monitored beetle species relative abundance and faunal composition of assemblages at undisturbed reference sites and in areas subjected to tephra-fall, blowdown, and pyroclastic flow volcanic disturbance. We...

The ITER Neutral Beam Test Facility towards SPIDER operation

Science.gov (United States)

Toigo, V.; Dal Bello, S.; Gaio, E.; Luchetta, A.; Pasqualotto, R.; Zaccaria, P.; Bigi, M.; Chitarin, G.; Marcuzzi, D.; Pomaro, N.; Serianni, G.; Agostinetti, P.; Agostini, M.; Antoni, V.; Aprile, D.; Baltador, C.; Barbisan, M.; Battistella, M.; Boldrin, M.; Brombin, M.; Dalla Palma, M.; De Lorenzi, A.; Delogu, R.; De Muri, M.; Fellin, F.; Ferro, A.; Gambetta, G.; Grando, L.; Jain, P.; Maistrello, A.; Manduchi, G.; Marconato, N.; Pavei, M.; Peruzzo, S.; Pilan, N.; Pimazzoni, A.; Piovan, R.; Recchia, M.; Rizzolo, A.; Sartori, E.; Siragusa, M.; Spada, E.; Spagnolo, S.; Spolaore, M.; Taliercio, C.; Valente, M.; Veltri, P.; Zamengo, A.; Zaniol, B.; Zanotto, L.; Zaupa, M.; Boilson, D.; Graceffa, J.; Svensson, L.; Schunke, B.; Decamps, H.; Urbani, M.; Kushwah, M.; Chareyre, J.; Singh, M.; Bonicelli, T.; Agarici, G.; Garbuglia, A.; Masiello, A.; Paolucci, F.; Simon, M.; Bailly-Maitre, L.; Bragulat, E.; Gomez, G.; Gutierrez, D.; Mico, G.; Moreno, J.-F.; Pilard, V.; Chakraborty, A.; Baruah, U.; Rotti, C.; Patel, H.; Nagaraju, M. V.; Singh, N. P.; Patel, A.; Dhola, H.; Raval, B.; Fantz, U.; Fröschle, M.; Heinemann, B.; Kraus, W.; Nocentini, R.; Riedl, R.; Schiesko, L.; Wimmer, C.; Wünderlich, D.; Cavenago, M.; Croci, G.; Gorini, G.; Rebai, M.; Muraro, A.; Tardocchi, M.; Hemsworth, R.

2017-08-01

SPIDER is one of two projects of the ITER Neutral Beam Test Facility under construction in Padova, Italy, at the Consorzio RFX premises. It will have a 100 keV beam source with a full-size prototype of the radiofrequency ion source for the ITER neutral beam injector (NBI) and also, similar to the ITER diagnostic neutral beam, it is designed to operate with a pulse length of up to 3600 s, featuring an ITER-like magnetic filter field configuration (for high extraction of negative ions) and caesium oven (for high production of negative ions) layout as well as a wide set of diagnostics. These features will allow a reproduction of the ion source operation in ITER, which cannot be done in any other existing test facility. SPIDER realization is well advanced and the first operation is expected at the beginning of 2018, with the mission of achieving the ITER heating and diagnostic NBI ion source requirements and of improving its performance in terms of reliability and availability. This paper mainly focuses on the preparation of the first SPIDER operations—integration and testing of SPIDER components, completion and implementation of diagnostics and control and formulation of operation and research plan, based on a staged strategy.

Extended survival of spiders (Aranaeae) feeding on whitefly (Homoptera: Aleyrodidae) honeydew

Science.gov (United States)

Honeydew produced by homopteran insects such as aphids, whiteflies and mealybugs, can be abundant in some crops and may represent an important food resource for spiders and other honeydew feeding natural enemies. Woolly whiteflies are common in south Texas citrus, and spiders consistently make up a...

Tests for attraction to prey and predator avoidance by chemical cues in spiders of the beech forest floor

Directory of Open Access Journals (Sweden)

Wetter, Melissa B.

2012-07-01

Full Text Available Spiders leave draglines, faeces and other secretions behind when traveling through their microhabitat. The presence of these secretions may unintentionally inform other animals, prey as well as predators, about a recent and possible current predation risk or food availability. For a wolf spider, other spiders including smaller conspecifics, form a substantial part of their prey, and larger wolf spiders, again including conspecifics, are potential predators. We tested two hypotheses: that large wolf spiders may locate patches of potential spider prey through the presence of silk threads and/or other secretions; and that prey spiders may use secretions from large wolf spiders to avoid patches with high predation risk. We used large (subadult or adult Pardosa saltans to provide predator cues and mixed dwarf spiders or small (juvenile P. saltans to provide prey cues. Subadult wolf spiders were significantly attracted to litter contaminated by dwarf spiders or small conspecifics after 6 hours but no longer after 24 hours. In contrast, neither dwarf spiders nor small P. saltans showed significant avoidance of substrate contaminated by adult P. saltans. However, small P. saltans showed different activity patterns on the two substrates. The results indicate that wolf spiders are able to increase the efficiency of foraging by searching preferentially in patches with the presence of intraguild prey. The lack of a clear patch selection response of the prey in spite of a modified activity pattern may possibly be associated with the vertical stratification of the beech litter habitat: the reduced volume of spaces in the deeper layers could make downward rather than horizontal movement a fast and safe tactic against a large predator that cannot enter these spaces.

Nanofibre production in spiders without electric charge.

Science.gov (United States)

Joel, Anna-Christin; Baumgartner, Werner

2017-06-15

Technical nanofibre production is linked to high voltage, because nanofibres are typically produced by electrospinning. In contrast, spiders have evolved a way to produce nanofibres without high voltage. These spiders are called cribellate spiders and produce nanofibres within their capture thread production. It is suggested that their nanofibres become frictionally charged when brushed over a continuous area on the calamistrum, a comb-like structure at the metatarsus of the fourth leg. Although there are indications that electrostatic charges are involved in the formation of the thread structure, final proof is missing. We proposed three requirements to validate this hypothesis: (1) the removal of any charge during or after thread production has an influence on the structure of the thread; (2) the characteristic structure of the thread can be regenerated by charging; and (3) the thread is attracted to or repelled from differently charged objects. None of these three requirements were proven true. Furthermore, mathematical calculations reveal that even at low charges, the calculated structural assembly of the thread does not match the observed reality. Electrostatic forces are therefore not involved in the production of cribellate capture threads. © 2017. Published by The Company of Biologists Ltd.

Multiple origins of subsociality in crab spiders (Thomisidae).

Science.gov (United States)

Ruch, Jasmin; Riehl, Torben; May-Collado, Laura J; Agnarsson, Ingi

2015-01-01

Determining factors that facilitate the transition from a solitary to a social lifestyle is a major challenge in evolutionary biology, especially in taxa that are usually aggressive towards conspecifics. Most spiders live solitarily and few species are known to be social. Nevertheless, sociality has evolved multiple times across several families and nearly all studied social lineages have originated from a periodically social (subsocial) ancestor. Group-living crab spiders (Thomisidae) are exclusively found in Australia and differ from most other social spiders because they lack a communal capture web. Three of the group-living species were placed in the genus Diaea and another in the genus Xysticus. Most Australian thomisids are, however, difficult to identify as most descriptions are old and of poor quality, and the genera Diaea and Xysticus may not correspond to monophyletic groups. Here, we clarify the phylogenetic relationships of the four group-living Australian thomisids and conclude that amongst these subsociality has evolved two to three times independently. The subsocial Xysticus bimaculatus is not closely related to any of the social Diaea and an independent origin of subsociality is likely in this case. The presented data indicates that within Diaea two origins of subsociality are possible. Our results help to understand the evolution of sociality in thomisids and support the hypothesis that permanent sociality in spiders has evolved multiple times relatively recently from subsocial ancestors. Copyright © 2014 Elsevier Inc. All rights reserved.

The embryonic origin of the ampullate silk glands of the spider Cupiennius salei.

Science.gov (United States)

Hilbrant, Maarten; Damen, Wim G M

2015-05-01

Silk production in spiders is considered a key innovation, and to have been vital for the diversification of the clade. The evolutionary origin of the organs involved in spider silk production, however, and in particular of the silk glands, is poorly understood. Homologies have been proposed between these and other glands found in arachnids, but lacking knowledge of the embryonic development of spider silk glands hampers an evaluation of hypotheses. This study focuses on the embryonic origin of the largest silk glands of the spider Cupiennius salei, the major and minor ampullate glands. We show how the ampullate glands originate from ectodermal invaginations on the embryonic spinneret limb buds, in relation to morphogenesis of these buds. Moreover, we visualize the subsequent growth of the ampullate glands in sections of the early postembryonic stages. The invaginations are shown to correlate with expression of the proneural gene CsASH2, which is remarkable since it has been proposed that spider silk glands and their nozzles originate from sensory bristles. Hence, by confirming the ectodermal origin of spider silk glands, and by describing the (post-)embryonic morphogenesis of the ampullate glands, this work provides a starting point for further investigating into the genetic program that underlies their development. Copyright © 2015 Elsevier Ltd. All rights reserved.

The diversity of beetle assemblages in different habitat types in Sabah, Malaysia.

Science.gov (United States)

Chung, A Y; Eggleton, P; Speight, M R; Hammond, P M; Chey, V K

2000-12-01

The diversity of beetle assemblages in different habitat types (primary forest, logged forest, acacia plantation and oil palm plantation) in Sabah, Malaysia was investigated using three different methods based on habitat levels (Winkler sampling, flight-interception-trapping and mist-blowing). The overall diversity was extremely high, with 1711 species recorded from only 8028 individuals and 81 families (115 family and subfamily groups). Different degrees of environmental changes had varying effects on the beetle species richness and abundance, with oil palm plantation assemblage being most severely affected, followed by acacia plantation and then logged forest. A few species became numerically dominant in the oil palm plantation. In terms of beetle species composition, the acacia fauna showed much similarity with the logged forest fauna, and the oil palm fauna was very different from the rest. The effects of environmental variables (number of plant species, sapling and tree densities, amount of leaf litter, ground cover, canopy cover, soil pH and compaction) on the beetle assemblage were also investigated. Leaf litter correlated with species richness, abundance and composition of subterranean beetles. Plant species richness, tree and sapling densities correlated with species richness, abundance and composition of understorey beetles while ground cover correlated only with the species richness and abundance of these beetles. Canopy cover correlated only with arboreal beetles. In trophic structure, predators represented more than 40% of the species and individuals. Environmental changes affected the trophic structure with proportionally more herbivores (abundance) but fewer predators (species richness and abundance) in the oil palm plantation. Biodiversity, conservation and practical aspects of pest management were also highlighted in this study.

Whiteflies interfere with indirect plant defense against spider mites in Lima bean

Science.gov (United States)

Zhang, Peng-Jun; Zheng, Si-Jun; van Loon, Joop J. A.; Boland, Wilhelm; David, Anja; Mumm, Roland; Dicke, Marcel

2009-01-01

Plants under herbivore attack are able to initiate indirect defense by synthesizing and releasing complex blends of volatiles that attract natural enemies of the herbivore. However, little is known about how plants respond to infestation by multiple herbivores, particularly if these belong to different feeding guilds. Here, we report the interference by a phloem-feeding insect, the whitefly Bemisia tabaci, with indirect plant defenses induced by spider mites (Tetranychus urticae) in Lima bean (Phaseolus lunatus) plants. Additional whitefly infestation of spider-mite infested plants resulted in a reduced attraction of predatory mites (Phytoseiulus persimilis) compared to attraction to plants infested by spider mites only. This interference is shown to result from the reduction in (E)-β-ocimene emission from plants infested by both spider mites and whiteflies. When using exogenous salicylic acid (SA) application to mimic B. tabaci infestation, we observed similar results in behavioral and chemical analyses. Phytohormone and gene-expression analyses revealed that B. tabaci infestation, as well as SA application, inhibited spider mite-induced jasmonic acid (JA) production and reduced the expression of two JA-regulated genes, one of which encodes for the P. lunatus enzyme β-ocimene synthase that catalyzes the synthesis of (E)-β-ocimene. Remarkably, B. tabaci infestation concurrently inhibited SA production induced by spider mites. We therefore conclude that in dual-infested Lima bean plants the suppression of the JA signaling pathway by whitefly feeding is not due to enhanced SA levels. PMID:19965373

Progress on development of SPIDER diagnostics

Science.gov (United States)

Pasqualotto, R.; Agostini, M.; Barbisan, M.; Bernardi, M.; Brombin, M.; Cavazzana, R.; Croci, G.; Palma, M. Dalla; Delogu, R. S.; Gorini, G.; Lotto, L.; Muraro, A.; Peruzzo, S.; Pimazzoni, A.; Pomaro, N.; Rizzolo, A.; Serianni, G.; Spolaore, M.; Tardocchi, M.; Zaniol, B.; Zaupa, M.

2017-08-01

SPIDER experiment, the full size prototype of the beam source for the ITER heating neutral beam injector, has to demonstrate extraction and acceleration to 100 kV of a large negative ion hydrogen or deuterium beam with co-extracted electron fraction e-/D- SPIDER plant systems are being installed, the different diagnostic systems are in the procurement phase. Their final design is described here with a focus on some key solutions and most original and cost effective implementations. Thermocouples used to measure the power load distribution in the source and over the beam dump front surface will be efficiently fixed with proven technique and acquired through commercial and custom electronics. Spectroscopy needs to use well collimated lines of sight and will employ novel design spectrometers with higher efficiency and resolution and filtered detectors with custom built amplifiers. The electrostatic probes will be operated through electronics specifically developed to cope with the challenging environment of the RF source. The instrumented calorimeter STRIKE will use new CFC tiles, still under development. Two linear cameras, one built in house, have been tested as suitable for optical beam tomography. Some diagnostic components are off the shelf, others are custom developed: some of these are being prototyped or are under test before final production and installation, which will be completed before start of SPIDER operation.

Synthetic Adhesive Attachment Discs based on Spider Pyriform Silk Architecture

Science.gov (United States)

Jain, Dharamdeep; Sahni, Vasav; Dhinojwala, Ali

2014-03-01

Among the variety of silks produced by spiders, pyriform silk is used in conjunction with the dragline silk to attach webs to different surfaces. Cob weaver spiders employ different architectural patterns to utilize the pyriform silk and form attachment joints with each pattern having a characteristic adhesive performance. The staple pin architecture is a one of the strongest attachment designs employed by spiders to attach their webs. Here we use a synthetic approach to create the a similar patterned architecture attachment discs on aluminum substrate using thermoplastic polyurethane. Measurable pull off forces are generated when the synthetic discs are peeled off a surface. This innovative adhesive strategy can be a source of design in various biomedical applications. Financial Support from National Science Foundation.

Spider Silk Fibers Spun from Soluble Recombinant Silk Produced in Mammalian Cells

Science.gov (United States)

Lazaris, Anthoula; Arcidiacono, Steven; Huang, Yue; Zhou, Jiang-Feng; Duguay, François; Chretien, Nathalie; Welsh, Elizabeth A.; Soares, Jason W.; Karatzas, Costas N.

2002-01-01

Spider silks are protein-based ``biopolymer'' filaments or threads secreted by specialized epithelial cells as concentrated soluble precursors of highly repetitive primary sequences. Spider dragline silk is a flexible, lightweight fiber of extraordinary strength and toughness comparable to that of synthetic high-performance fibers. We sought to ``biomimic'' the process of spider silk production by expressing in mammalian cells the dragline silk genes (ADF-3/MaSpII and MaSpI) of two spider species. We produced soluble recombinant (rc)-dragline silk proteins with molecular masses of 60 to 140 kilodaltons. We demonstrated the wet spinning of silk monofilaments spun from a concentrated aqueous solution of soluble rc-spider silk protein (ADF-3; 60 kilodaltons) under modest shear and coagulation conditions. The spun fibers were water insoluble with a fine diameter (10 to 40 micrometers) and exhibited toughness and modulus values comparable to those of native dragline silks but with lower tenacity. Dope solutions with rc-silk protein concentrations >20% and postspinning draw were necessary to achieve improved mechanical properties of the spun fibers. Fiber properties correlated with finer fiber diameter and increased birefringence.

Reversing the mere exposure effect in spider fearfuls: Preliminary evidence of sensitization.

Science.gov (United States)

Becker, Eni S; Rinck, Mike

2016-12-01

A mere exposure effect (MEE) is said to occur when individuals' liking of a suboptimally and repeatedly presented stimulus increases compared to never-presented stimuli, while they are unable to indicate which stimuli were previously presented and which were not. In two experiments, we used the MEE to study automatic evaluative processes in highly spider-fearful individuals (SFs). Pictures of spiders and butterflies were repeatedly presented suboptimally to SFs and to non-anxious controls (NACs). In Experiment 1, both groups showed the MEE for butterflies, preferring previously presented butterfly pictures over new ones. For spider pictures, only NACs showed an MEE, whereas SFs showed no preference. Experiment 2 involved a more unpleasant presentation situation, because for each picture, participants had the difficult task to indicate what had been presented to them. This led to a reversed MEE for spiders in SFs: They preferred new spider pictures over previously presented ones. In both experiments, no evidence was observed for the ability to differentiate between old an new pictures. The results are tentatively explained within Zajonc' theory of the MEE, and they are related to the concept of sensitization in anxiety disorders. Copyright © 2016 Elsevier B.V. All rights reserved.

Hg-contaminated terrestrial spiders pose a potential risk to songbirds at Caddo Lake (Texas/Louisiana, USA).

Science.gov (United States)

Gann, Gretchen L; Powell, Cleveland H; Chumchal, Matthew M; Drenner, Ray W

2015-02-01

Methylmercury (MeHg) is an environmental contaminant that can have adverse effects on wildlife. Because MeHg is produced by bacteria in aquatic ecosystems, studies of MeHg contamination of food webs historically have focused on aquatic organisms. However, recent studies have shown that terrestrial organisms such as songbirds can be contaminated with MeHg by feeding on MeHg-contaminated spiders. In the present study, the authors examined the risk that MeHg-contaminated terrestrial long-jawed orb weaver spiders (Tetragnatha sp.) pose to songbirds at Caddo Lake (Texas/Louisiana, USA). Methylmercury concentrations in spiders were significantly different in river, wetland, and open-water habitats. The authors calculated spider-based wildlife values (the minimum spider MeHg concentrations causing physiologically significant doses in consumers) to assess exposure risks for arachnivorous birds. Methylmercury concentrations in spiders exceeded wildlife values for Carolina chickadee (Poecile carolinensis) nestlings, with the highest risk in the river habitat. The present study indicates that MeHg concentrations in terrestrial spiders vary with habitat and can pose a threat to small-bodied nestling birds that consume large amounts of spiders at Caddo Lake. This MeHg threat to songbirds may not be unique to Caddo Lake and may extend throughout the southeastern United States. © 2014 SETAC.

Untangling spider silk evolution with spidroin terminal domains

Directory of Open Access Journals (Sweden)

Garb Jessica E

2010-08-01

Full Text Available Abstract Background Spidroins are a unique family of large, structural proteins that make up the bulk of spider silk fibers. Due to the highly variable nature of their repetitive sequences, spidroin evolutionary relationships have principally been determined from their non-repetitive carboxy (C-terminal domains, though they offer limited character data. The few known spidroin amino (N-terminal domains have been difficult to obtain, but potentially contain critical phylogenetic information for reconstructing the diversification of spider silks. Here we used silk gland expression data (ESTs from highly divergent species to evaluate the functional significance and phylogenetic utility of spidroin N-terminal domains. Results We report 11 additional spidroin N-termini found by sequencing ~1,900 silk gland cDNAs from nine spider species that shared a common ancestor > 240 million years ago. In contrast to their hyper-variable repetitive regions, spidroin N-terminal domains have retained striking similarities in sequence identity, predicted secondary structure, and hydrophobicity. Through separate and combined phylogenetic analyses of N-terminal domains and their corresponding C-termini, we find that combined analysis produces the most resolved trees and that N-termini contribute more support and less conflict than the C-termini. These analyses show that paralogs largely group by silk gland type, except for the major ampullate spidroins. Moreover, spidroin structural motifs associated with superior tensile strength arose early in the history of this gene family, whereas a motif conferring greater extensibility convergently evolved in two distantly related paralogs. Conclusions A non-repetitive N-terminal domain appears to be a universal attribute of spidroin proteins, likely retained from the origin of spider silk production. Since this time, spidroin N-termini have maintained several features, consistent with this domain playing a key role in silk

Effects of Deer Grazing on Vegetation and Ground-Dwelling Insects in a Larch Forest in Okutama, Western Tokyo

Directory of Open Access Journals (Sweden)

Hodaka Yamada

2015-01-01

Full Text Available Sika deer (Cervus nippon have experienced a rapid increase in the Japanese archipelago. Although the effects of deer grazing have been widely studied, the indirect effects have received little attention. Using an eight-year-old deer exclosure in western Tokyo (Japan, we studied the direct effects on plants and the indirect effects on insects and microenvironments. Plant biomass was 14 times higher inside the exclosure than outside. Shrubs (e.g., Aralia elata and Hydrangea paniculata and trees (e.g., Symplocos sawafutagi and Clethra barbinervis were more abundant inside, whereas only unpalatable trees in poor condition grew outside (e.g., Pterostyrax hispida and Cynanchum caudatum. In the summer months, the maximum temperature was 8–10°C higher outside the exclosure and humidity was lower. Soil movement was 80 times more pronounced outside than inside. These results suggest that the abiotic environment became less stable for ground-dwelling insects. Carabid beetles were less abundant outside than inside, suggesting that deer grazing reduced plants and subsequently lowered habitat quality for these beetles. In contrast, carrion beetles, dung beetles, and camel crickets were more abundant outside. The increase in these insects is attributed to the availability of deer feces and carcasses and is a direct effect of deer presence.

Biased interpretation and memory in children with varying levels of spider fear

NARCIS (Netherlands)

Klein, A.M.; Titulaer, G.; Simons, C.; Allart, E.; de Gier, E.; Bögels, S.M.; Becker, E.S.; Rinck, M.

2014-01-01

This study investigated multiple cognitive biases in children simultaneously, to investigate whether spider-fearful children display an interpretation bias, a recall bias, and source monitoring errors, and whether these biases are specific for spider-related materials. Furthermore, the independent

The proportion of impervious surfaces at the landscape scale structures wild bee assemblages in a densely populated region.

Science.gov (United States)

Geslin, Benoît; Le Féon, Violette; Folschweiller, Morgane; Flacher, Floriane; Carmignac, David; Motard, Eric; Perret, Samuel; Dajoz, Isabelle

2016-09-01

Given the predicted expansion of cities throughout the world, understanding the effect of urbanization on bee fauna is a major issue for the conservation of bees. The aim of this study was to understand how urbanization affects wild bee assemblages along a gradient of impervious surfaces and to determine the influence of landscape composition and floral resource availability on these assemblages. We chose 12 sites with a proportion of impervious surfaces (soil covered by parking, roads, and buildings) ranging from 0.06% to 64.31% within a 500 m radius. We collected using pan trapping and estimated the landscape composition of the sites within a 500 m radius and the species richness of plant assemblages within a 200 m radius. We collected 1104 bees from 74 species. The proportion of impervious surfaces at the landscape scale had a negative effect on wild bee abundance and species richness, whereas local flower composition had no effect. Ground-nesting bees were particularly sensitive to the urbanization gradient. This study provides new evidences of the impact of urbanization on bee assemblages and the proportion of impervious surfaces at the landscape scale emerged as a key factor that drives those assemblages.

 “Spiders and Webs in American Literature”

Directory of Open Access Journals (Sweden)

Vincent Dussol

2012-05-01

Full Text Available From Jonathan Edwards to Jorie Graham, spiders are strikingly present in American literature. The purpose of this article is first to show how that theme may have become something of a national tradition as very different writers, all of them careful observers of aranae, answered one another through the years. It is very likely that the attention paid to spiders by American authors was increased by those Native American myths in which spiders are a central figure. More than occasionally, on the female side of the American counter-culture, especially among its feminist and lesbian exponents, simple activists and creative writers have harnessed the symbolic power invested in the spider by Native Americans.There may be deeper reasons accounting for American authors’ fascination with spiders. The country’s phobia of disunion is one; a nation of settlers’ acute consciousness of the precariousness of its occupation of the territory is another. In demonstrating outstanding skills for adjustment to unknown places, spiders epitomize a form of identity permanence. The predominantly positive character of spider symbols in American literature will occasionally be inverted. Following the national logic of checks and balances, any web covering the whole of the United States will tend to come under suspicion.This study ends with an inventory of cultural productions linked with spiders and webs and whose Americanness is yet to be clearly determined.De Jonathan Edwards à Jorie Graham, l’araignée apparaît dans un nombre frappant de textes littéraires américains. On a d’abord voulu tenter de montrer comment a pu se construire cette tradition thématique et faire la preuve que différents écrivains, réunis par un souci de l’observation, se sont répondus à travers elle. L’attention prêtée à l’araignée s’est certainement trouvée renforcée par les récits mythologiques des peuples premiers américains qui font de l’araignée une

Structure to function: Spider silk and human collagen

Science.gov (United States)

Rabotyagova, Olena S.

Nature has the ability to assemble a variety of simple molecules into complex functional structures with diverse properties. Collagens, silks and muscles fibers are some examples of fibrous proteins with self-assembling properties. One of the great challenges facing Science is to mimic these designs in Nature to find a way to construct molecules that are capable of organizing into functional supra-structures by self-assembly. In order to do so, a construction kit consisting of molecular building blocks along with a complete understanding on how to form functional materials is required. In this current research, the focus is on spider silk and collagen as fibrous protein-based biopolymers that can shed light on how to generate nanostructures through the complex process of self-assembly. Spider silk in fiber form offers a unique combination of high elasticity, toughness, and mechanical strength, along with biological compatibility and biodegrability. Spider silk is an example of a natural block copolymer, in which hydrophobic and hydrophilic blocks are linked together generating polymers that organize into functional materials with extraordinary properties. Since silks resemble synthetic block copolymer systems, we adopted the principles of block copolymer design from the synthetic polymer literature to build block copolymers based on spider silk sequences. Moreover, we consider spider silk to be an important model with which to study the relationships between structure and properties in our system. Thus, the first part of this work was dedicated to a novel family of spider silk block copolymers, where we generated a new family of functional spider silk-like block copolymers through recombinant DNA technology. To provide fundamental insight into relationships between peptide primary sequence, block composition, and block length and observed morphological and structural features, we used these bioengineered spider silk block copolymers to study secondary structure

Radon in dwellings in Sweden

International Nuclear Information System (INIS)

Swedjemark, G.A.

1978-04-01

Studies on the specific activities in building materials, the γ-radiation levels in dwellings, the concentrations of radon and daughters in the air indoors and the concentration of radon in tap water are in progress in Sweden. On basis of these investigations and of the investigation of Hultqvist from the beginning of the 1950s, an attempt has been made to show how the radiation doses in dwellings have changed or may be changed by human activities and what these changes imply in terms of collective dose. The annual collective absorbed dose in the basal cells of the critical bronchial region have increased from 11 . 10 3 manGy for the occupants of dwellings existing in 1950 to 25 . 10 3 manGy for dwellings existing in 1975. If the building of houses continues as at present it can be estimated that the annual collective dose will be between 25 and 31 . 10 3 manGy for the dwellings of 1985. (author)

Biomimetic Spider Leg Joints: A Review from Biomechanical Research to Compliant Robotic Actuators

Directory of Open Access Journals (Sweden)

Stefan Landkammer

2016-07-01

Full Text Available Due to their inherent compliance, soft actuated joints are becoming increasingly important for robotic applications, especially when human-robot-interactions are expected. Several of these flexible actuators are inspired by biological models. One perfect showpiece for biomimetic robots is the spider leg, because it combines lightweight design and graceful movements with powerful and dynamic actuation. Building on this motivation, the review article focuses on compliant robotic joints inspired by the function principle of the spider leg. The mechanism is introduced by an overview of existing biological and biomechanical research. Thereupon a classification of robots that are bio-inspired by spider joints is presented. Based on this, the biomimetic robot applications referring to the spider principle are identified and discussed.

Contamination vs. harm-relevant outcome expectancies and covariation bias in spider phobia

NARCIS (Netherlands)

de Jong, Peter J.; Peters, Madelon L.

There is increasing evidence that spiders are not feared because of harmful outcome expectancies but because of disgust and contamination-relevant outcome expectancies. This study investigated the relative strength of contamination- and harm-relevant UCS expectancies and covariation bias in spider

[Engineered spider silk: the intelligent biomaterial of the future. Part I].

Science.gov (United States)

Florczak, Anna; Piekoś, Konrad; Kaźmierska, Katarzyna; Mackiewicz, Andrzej; Dams-Kozłowska, Hanna

2011-06-17

The unique properties of spider silk such as strength, extensibility, toughness, biocompatibility and biodegradability are the reasons for the recent development in silk biomaterial technology. For a long time scientific progress was impeded by limited access to spider silk. However, the development of the molecular biology strategy was a breaking point in synthetic spider silk protein design. The sequences of engineered spider silk are based on the consensus motives of the corresponding natural equivalents. Moreover, the engineered silk proteins may be modified in order to gain a new function. The strategy of the hybrid proteins constructed on the DNA level combines the sequence of engineered silk, which is responsible for the biomaterial structure, with the sequence of polypeptide which allows functionalization of the silk biomaterial. The functional domains may comprise receptor binding sites, enzymes, metal or sugar binding sites and others. Currently, advanced research is being conducted, which on the one hand focuses on establishing the particular silk structure and understanding the process of silk thread formation in nature. On the other hand, there are attempts to improve methods of engineered spider silk protein production. Due to acquired knowledge and recent progress in synthetic protein technology, the engineered silk will turn into intelligent biomaterial of the future, while its industrial production scale will trigger a biotechnological revolution.

Thin Film Assembly of Spider Silk-like Block Copolymers

Science.gov (United States)

2011-01-01

Shipley, N. H.; Lewis, R. V. Int. J. Biol.Macromol. 1999, 24, 271. (c) Thiel, B. L.; Guess, K. B.; Viney, C. Biopolymers 1997, 41, 703. (13) Silk ...Film Assembly of Spider Silk -like Block Copolymers Sreevidhya T. Krishnaji,†,‡ Wenwen Huang,§ Olena Rabotyagova,†,‡ Eugenia Kharlampieva, ) Ikjun Choi...Received November 26, 2010 We report the self-assembly of monolayers of spider silk -like block copolymers. Langmuir isotherms were obtained for a series of

Demersal and epibenthic assemblages of trawlable grounds in the northern Alboran Sea (western Mediterranean

Directory of Open Access Journals (Sweden)

Esther Abad

2007-09-01

Full Text Available The composition and abundance of megabenthic fauna caught by the commercial trawl fleet in the Alboran Sea were studied. A total of 28 hauls were carried out at depths ranging from 50 to 640 m. As a result of a hierarchical classification analysis four assemblages were detected: (1 the outer shelf group (50-150 m, characterised by Octopus vulgaris and Cepola macrophthalma; (2 the upper slope group (151-350 m, characterised by Micromesistius poutassou, with Plesionika heterocarpus and Parapenaeus longirostris as secondary species; (3 the middle slope group (351-640 m, characterised by M. poutassou, Nephrops norvegicus and Caelorhincus caelorhincus, and (4 the small seamount Seco de los Olivos (310-360 m, characterised by M. poutassou, Helicolenus dactylopterus and Gadiculus argenteus, together with Chlorophthalmus agassizi, Stichopus regalis and Palinurus mauritanicus. The results also revealed significantly higher abundances in the Seco de los Olivos seamount, probably related to a higher food availability caused by strong localised currents and upwellings that enhanced primary production. Although depth proved to be the main structuring factor, others such as sediment type and food availability also appeared to be important. Differences between shelf and slope assemblages could be in part related to a greater dependence on benthic resources in the former and a higher use of planktonic resources in the latter.

The eunuch phenomenon: adaptive evolution of genital emasculation in sexually dimorphic spiders.

Science.gov (United States)

Kuntner, Matjaž; Agnarsson, Ingi; Li, Daiqin

2015-02-01

Under natural and sexual selection traits often evolve that secure paternity or maternity through self-sacrifice to predators, rivals, offspring, or partners. Emasculation-males removing their genitals-is an unusual example of such behaviours. Known only in insects and spiders, the phenomenon's adaptiveness is difficult to explain, yet its repeated origins and association with sexual size dimorphism (SSD) and sexual cannibalism suggest an adaptive significance. In spiders, emasculation of paired male sperm-transferring organs - secondary genitals - (hereafter, palps), results in 'eunuchs'. This behaviour has been hypothesized to be adaptive because (i) males plug female genitals with their severed palps (plugging hypothesis), (ii) males remove their palps to become better fighters in male-male contests (better-fighter hypothesis), perhaps reaching higher agility due to reduced total body mass (gloves-off hypothesis), and (iii) males achieve prolonged sperm transfer through severed genitals (remote-copulation hypothesis). Prior research has provided evidence in support of these hypotheses in some orb-weaving spiders but these explanations are far from general. Seeking broad macroevolutionary patterns of spider emasculation, we review the known occurrences, weigh the evidence in support of the hypotheses in each known case, and redefine more precisely the particular cases of emasculation depending on its timing in relation to maturation and mating: 'pre-maturation', 'mating', and 'post-mating'. We use a genus-level spider phylogeny to explore emasculation evolution and to investigate potential evolutionary linkage between emasculation, SSD, lesser genital damage (embolic breakage), and sexual cannibalism (females consuming their mates). We find a complex pattern of spider emasculation evolution, all cases confined to Araneoidea: emasculation evolved at least five and up to 11 times, was lost at least four times, and became further modified at least once. We also find

Recent saltmarsh foraminiferal assemblages from Iceland

Science.gov (United States)

Lübbers, Julia; Schönfeld, Joachim

2018-01-01

This study reports for the first time boreal to subarctic intertidal foraminiferal assemblages from saltmarshes at Borgarnes and Faskrudsfjördur on Iceland. The composition of living and dead foraminiferal assemblages was investigated along transects from the tidal flat to the highest reach of halophytic plants. The foraminiferal assemblages from Borgarnes showed 18 species in the total foraminiferal assemblage of which only 7 species were recorded in the living fauna. The assemblages were dominated by agglutinated taxa, whereas 3 calcareous species were recorded, of which only Haynesina orbicularis was found in the living fauna. The distribution limit of calcifying species corresponds to the lower boundary of the lower saltmarsh vegetation zone. Furthermore, calcareous tests showed many features of dissolution, which is an indication of a carbonate corrosive environment. The species forming the dead assemblages were mainly derived from the ambient intertidal areas and were displaced by tidal currents into the saltmarsh. The foraminiferal assemblages from Faskrudsfjördur showed two species, of which only one species was recorded in the living fauna. The assemblage was dominated by the agglutinated foraminifer Trochaminita irregularis. The foraminiferal species recorded on Iceland were the same as commonly found elsewhere in Europa. Since no species was found which is endemic to North America, Iceland is considered part of the European bio province. The foraminiferal could have been immigrated to Iceland from Europe through warm water currents, migratory birds or marine traffic since the last Ice Age.

SPiDer: Smart Pill Dispenser

OpenAIRE

Moreno Vázquez, Jonatan

2013-01-01

Aquest projecte proposa el sistema SPiDer el qual te l'objectiu d'assistir a la gent gran en el procés de medicar-se evitant els problemes associats amb la baixa adherència existent actualment amb els calendaris farmacològics receptats pels doctors.

Brown Spider (Loxosceles genus Venom Toxins: Tools for Biological Purposes

Directory of Open Access Journals (Sweden)

Andrea Senff-Ribeiro

2011-03-01

Full Text Available Venomous animals use their venoms as tools for defense or predation. These venoms are complex mixtures, mainly enriched of proteic toxins or peptides with several, and different, biological activities. In general, spider venom is rich in biologically active molecules that are useful in experimental protocols for pharmacology, biochemistry, cell biology and immunology, as well as putative tools for biotechnology and industries. Spider venoms have recently garnered much attention from several research groups worldwide. Brown spider (Loxosceles genus venom is enriched in low molecular mass proteins (5–40 kDa. Although their venom is produced in minute volumes (a few microliters, and contain only tens of micrograms of protein, the use of techniques based on molecular biology and proteomic analysis has afforded rational projects in the area and permitted the discovery and identification of a great number of novel toxins. The brown spider phospholipase-D family is undoubtedly the most investigated and characterized, although other important toxins, such as low molecular mass insecticidal peptides, metalloproteases and hyaluronidases have also been identified and featured in literature. The molecular pathways of the action of these toxins have been reported and brought new insights in the field of biotechnology. Herein, we shall see how recent reports describing discoveries in the area of brown spider venom have expanded biotechnological uses of molecules identified in these venoms, with special emphasis on the construction of a cDNA library for venom glands, transcriptome analysis, proteomic projects, recombinant expression of different proteic toxins, and finally structural descriptions based on crystallography of toxins.

Architecture of SPIDER control and data acquisition system

International Nuclear Information System (INIS)

Luchetta, A.; Manduchi, G.; Taliercio, C.; Soppelsa, A.; Barbalace, A.; Paolucci, F.; Sartori, F.; Barbato, P.; Breda, M.; Capobianco, R.; Molon, F.; Moressa, M.; Polato, S.; Simionato, P.; Zampiva, E.

2012-01-01

The ITER Heating Neutral Beam injectors will be implemented in three steps: development of the ion source prototype, development of the full injector prototype, and, finally, construction of up to three ITER injectors. The first two steps will be carried out in the ITER neutral beam test facility under construction in Italy. The ion source prototype, referred to as SPIDER, which is currently in the development phase, is a complex experiment involving more than 20 plant units and operating with beam-on pulses lasting up to 1 h. As for control and data acquisition it requires fast and slow control (cycle time around 0.1 ms and 10 ms, respectively), synchronization (10 ns resolution), and data acquisition for about 1000 channels (analogue and images) with sampling frequencies up to tens of MS/s, data throughput up to 200 MB/s, and data storage volume of up to tens of TB/year. The paper describes the architecture of the SPIDER control and data acquisition system, discussing the SPIDER requirements and the ITER CODAC interfaces and specifications for plant system instrumentation and control.

Context-dependent crypsis: a prey's perspective of a color polymorphic predator

Science.gov (United States)

Rodríguez-Morales, D.; Rico-Gray, V.; García-Franco, J. G.; Ajuria-Ibarra, H.; Hernández-Salazar, L. T.; Robledo-Ospina, L. E.; Rao, D.

2018-06-01

Many animals use body coloration as a strategy to communicate with conspecifics, prey, and predators. Color is a trade-off for some species, since they should be visible to conspecifics but cryptic to predators and prey. Some flower-dwelling predators, such as crab spiders, are capable of choosing the color of flowers where they ambush flower visitors and pollinators. In order to avoid being captured, visitors evaluate flowers visually before landing. The crab spider Mecaphesa dubia is a polymorphic species (white/purple color morphs), which inhabits the flower heads of a dune plant, Palafoxia lindenii. Using full-spectrum photography of spiders and flowers, we evaluated how honeybees perceived the spiders at different distances. Using visual modeling, we obtained the chromatic and achromatic contrasts of the spiders on flower heads as perceived by honeybees. Purple morphs were found mainly on the receptacle area and white morphs were equally likely to be found in the flowers and receptacle. According to theoretical modeling, white morphs were visible to honeybees from a distance of 10 cm in receptacle area but appeared to be cryptic in the flower area. Purple morphs were cryptic on the receptacle and less so when they were on the flowers. Spiders on flower heads are predicted to be more easily detected by honeybees using chromatic contrast. Our study shows that the conspicuousness of flower dwelling spiders to honeybees depends on the color morph, the distance of observation, and the position of spider on the flower head.

Social makes smart: rearing conditions affect learning and social behaviour in jumping spiders.

Science.gov (United States)

Liedtke, J; Schneider, J M

2017-11-01

There is a long-standing debate as to whether social or physical environmental aspects drive the evolution and development of cognitive abilities. Surprisingly few studies make use of developmental plasticity to compare the effects of these two domains during development on behaviour later in life. Here, we present rearing effects on the development of learning abilities and social behaviour in the jumping spider Marpissa muscosa. These spiders are ideally suited for this purpose because they possess the ability to learn and can be reared in groups but also in isolation without added stress. This is a critical but rarely met requirement for experimentally varying the social environment to test its impact on cognition. We split broods of spiders and reared them either in a physically or in a socially enriched environment. A third group kept under completely deprived conditions served as a 'no-enrichment' control. We tested the spiders' learning abilities by using a modified T-maze. Social behaviour was investigated by confronting spiders with their own mirror image. Results show that spiders reared in groups outperform their conspecifics from the control, i.e. 'no-enrichment', group in both tasks. Physical enrichment did not lead to such an increased performance. We therefore tentatively suggest that growing up in contact with conspecifics induces the development of cognitive abilities in this species.

Spider fauna of semi-dry grasslands on a military training base in Northwest Germany (Münster

Directory of Open Access Journals (Sweden)

Buchholz, Sascha

2008-07-01

Full Text Available The spider fauna of semi-dry grasslands on the military training area of Dorbaum near Münster (North Rhine-Westphalia was investigated. From 2002 to 2003 a total of 11,194 mature spiders from 141 species and 20 families was caught by pitfall trapping and hand sampling. Among them are 18 species listed in the Red Data Book of North Rhine-Westphalia, four species are rare or previously rarely recorded. Most of the spiders are habitat generalists that extend their occurrence into all types of habitats, while the number of species which are stenotopic to sand habitats is noticeably low (n = 13. The spider data were analysed with Principal Component Analysis (PCA. It is possible to distinguish spider communities of neighbouring forested habitats from species groups of open habitats, but there is no uniform spider community which is characteristic for semi-dry grassland.

The sejugal furrow in camel spiders and acariform mites

Directory of Open Access Journals (Sweden)

Dunlop, Jason A.

2012-07-01

Full Text Available Camel spiders (Arachnida: Solifugae are one of the arachnid groups characterised by a prosomal dorsal shield composed of three distinct elements: the pro-, meso- and metapeltidium. These are associated respectively with prosomal appendages one to four, five, and six. What is less well known, although noted in the historical literature, is that the coxae of the 4th and 5th prosomal segments (i.e. walking legs 2 and 3 of camel spiders are also separated ventrally by a distinct membranous region, which is absent between the coxae of the other legs. We suggest that this essentially ventral division of the prosoma specifically between coxae 2 and 3 is homologous with the so-called sejugal furrow (the sejugal interval sensu van der Hammen. This division constitutes a fundamental part of the body plan in acariform mites (Arachnida: Acariformes. If homologous, this sejugal furrow could represent a further potential synapomorphy for (Solifugae + Acariformes; a relationship with increasing morphological and molecular support. Alternatively, outgroup comparison with sea spiders (Pycnogonida and certain early Palaeozoic fossils could imply that the sejugal furrow defines an older tagma, derived from a more basal grade of organisation. In this scenario the (still divided prosoma of acariform mites and camel spiders would be plesiomorphic. This interpretation challenges the textbook arachnid character of a peltidium (or ‘carapace’ covering an undivided prosoma.

Influence of Imidacloprid and Horticultural Oil on Spider Abundance on Eastern Hemlock in the Southern Appalachians.

Science.gov (United States)

Hakeem, A; Grant, J F; Lambdin, P L; Hale, F A; Rhea, J R; Wiggins, G J; Coots, C

2018-05-08

Hemlock woolly adelgid, Adelges tsugae Annand (Hemiptera: Adelgidae), is an exotic pest of eastern hemlock, Tsuga canadensis (L.) Carrière (Pinales: Pinaceae), in the eastern United States. Two commonly used insecticides to manage adelgid are imidacloprid, a systemic neonicotinoid insecticide, and horticultural oil, a refined petroleum oil foliar spray. We have investigated the influence of imidacloprid and horticultural oil on spider abundance at different canopy strata in eastern hemlock. In total, 2,084 spiders representing 11 families were collected from the canopies of eastern hemlock. In beat-sheet and direct observation samples, the families Theridiidae, Araneidae, Salticidae, and Anyphaenidae were the most abundant. Significantly higher numbers of spiders were recorded on untreated control trees compared with trees treated with imidacloprid using soil drench and soil injection applications. Spider abundance in trees injected with imidacloprid and horticultural oil applications did not significantly differ from control trees. Spider abundance was significantly greater in the top and middle strata of the canopy than in the bottom stratum, where imidacloprid concentrations were the highest. Regression analysis showed that spider abundance was inversely associated with imidacloprid concentration. This research demonstrates that imidacloprid, when applied with selected methods, has the potential to result in reductions of spider densities at different strata. However, slight reductions in spider abundance may be an acceptable short-term ecological impact compared with the loss of an untreated hemlock and all the associated ecological benefits that it provides. Future studies should include investigations of long-term impact of imidacloprid on spiders associated with eastern hemlock.

Competition between introduced and native spiders (Araneae: Linyphiidae)

Science.gov (United States)

Houser, J.D.; Ginsberg, Howard S.; Jakob, Elizabeth M.

2014-01-01

The European sheet-web spider Linyphia triangularis (Araneae: Linyphiidae) has become established in Maine, where it often reaches very high densities. Two lines of evidence from previous work suggest that L. triangularis affects populations of the native linyphiid spider Frontinella communis. First, F. communis individuals are relatively scarce in both forest and coastal habitat where L. triangularis is common, but more common where L. triangularis is at low density. Second, in field experiments, F. communis species are less likely to settle in experimental plots when L. triangularis is present, and F. communis disappears from study plots when L. triangularis is introduced. Here we test two mechanisms that may underlie these patterns. First, we tested whether L. triangularis invades and usurps the webs of F. communis. When spiders were released onto webs of heterospecifics, L. triangularis was more likely to take over or share webs of F. communis than the reverse. We also observed natural takeovers of F. communis webs. Second, we explored the hypothesis that L. triangularis reduces prey availability for native species. We sampled flying prey in areas with L. triangularis and those where it had been removed, and found no effect of spider presence on measured prey density. We also found no effect of prey supplementation on web tenacity in F. communis, suggesting that F. communis movements are not highly dependent on prey availability. We conclude that web takeover is likely more important than prey reduction in driving negative effects of L. triangularis on F. communis.

Enhanced discriminative fear learning of phobia-irrelevant stimuli in spider-fearful individuals

Directory of Open Access Journals (Sweden)

Carina eMosig

2014-10-01

Full Text Available Avoidance is considered as a central hallmark of all anxiety disorders. The acquisition and expression of avoidance which leads to the maintenance and exacerbation of pathological fear is closely linked to Pavlovian and operant conditioning processes. Changes in conditionability might represent a key feature of all anxiety disorders but the exact nature of these alterations might vary across different disorders. To date, no information is available on specific changes in conditionability for disorder-irrelevant stimuli in specific phobia (SP. The first aim of this study was to investigate changes in fear acquisition and extinction in spider-fearful individuals as compared to non-fearful participants by using the de novo fear conditioning paradigm. Secondly, we aimed to determine whether differences in the magnitude of context-dependent fear retrieval exist between spider-fearful and non-fearful individuals. Our findings point to an enhanced fear discrimination in spider-fearful individuals as compared to non-fearful individuals at both the physiological and subjective level. The enhanced fear discrimination in spider-fearful individuals was neither mediated by increased state anxiety, depression, nor stress tension. Spider-fearful individuals displayed no changes in extinction learning and/or fear retrieval. Surprisingly, we found no evidence for context-dependent modulation of fear retrieval in either group. Here we provide first evidence that spider-fearful individuals show an enhanced discriminative fear learning of phobia-irrelevant (de novo stimuli. Our findings provide novel insights into the role of fear acquisition and expression for the development and maintenance of maladaptive responses in the course of SP.

Abundant and rare spiders on tree trunks in German forests (Arachnida, Araneae

Directory of Open Access Journals (Sweden)

Blick, Theo

2011-01-01

Full Text Available The spider fauna active on the bark of trees in forests on eight sites in different regions in Germany was investigated. Trunk eclectors at about 2-4 meters height on living trees were used in different regions of Germany (SW Bavaria, Hesse, Brandenburg between 1990 and 2003. In Hesse eclectors were also used on dead beech trees (standing and lying. In this study data, mainly from beech (Fagus sylvatica and spruce (Picea abies, from May to October are compared – whole year samples (including winter are only available from Hesse. A total of 334 spider species were recorded with these bark traps, i.e. about one third of the spider species known from Germany. On average, each of the eight regions yielded 140.5 (± 26.2 species, each single tree 40.5 (± 12.2 species and 502 (± 452 adult spiders per season (i.e. May to Oct.. The 20 most abundant species are listed and characterised in detail. Six of the 20 species were not known to be abundant on bark, three prefer conifers and three beech/broadleaf. Even in winter (December-March there was a remarkably high activity on the trunks. However, only a few species occur exclusively or mainly in winter. Finally, the rarity of some bark spider species is discussed and details (all known records in Germany, phenology of four of them are presented (Clubiona leucaspis, Gongylidiellum edentatum, Kratochviliella bicapitata, Oreonetides quadridentatus. The diversity and importance of the spider fauna on bark in Central Europe is still underestimated.

Battre sa (super) coulpe : Spider-Man (1962)

OpenAIRE

Tomasovic, Dick

2016-01-01

L’édification est l'une des grandes fonctions traditionnelles de la littérature de jeunesse. Spider-Man, héros populaire s'il en est, s'est révélé bien sûr l'ambassadeur de nombreuses valeurs sociétales américaines (le do it yourself, l'esprit d'entreprise et d'indépendance, la tolérance, la fidélité , la célébration du système éducationnel, la transmission et la solidarité intergénérationnelle, le sens des responsabilités, évidemment, etc.). Spider-Man se bat moins qu'il ne se débat. Il est ...

Silkworms transformed with chimeric silkworm/spider silk genes spin composite silk fibers with improved mechanical properties

Science.gov (United States)

The development of a spider silk manufacturing process is of great interest. piggyBac vectors were used to create transgenic silkworms encoding chimeric silkworm/spider silk proteins. The silk fibers produced by these animals were composite materials that included chimeric silkworm/spider silk prote...

The Role of Silk in the Behaviour and Sociality of Spiders

Directory of Open Access Journals (Sweden)

Bertrand Krafft

2012-01-01

Full Text Available This article describes the links between the production of silk by spiders and their behaviour. Silk allows the spider to change its physical environment, which in turn leads to behavioural changes and impacts in the new environment. The feedback between silk and the animal producer can explain the architecture of spider webs and their adaptation to the environment, by referring only to stereotypic stimulus-response reactions without necessarily resorting to a “representation” by the animal of the structure it builds. Silk can act as a means of protection against environmental stress, a snare for prey, a means of locomotion, and also as support for chemical signals or to act as a vector of vibratory signals. These last two functions have undoubtedly played a key role in spider socialization and explains the phenomena of group cohesion, collective decision making, and the coordination of activities, without resorting to mental “representations” for the overall situation. The bulk of this review describes silk as the chief agent directing the construction of traps, communication, social cohesion, and cooperation amongst its producers.

7 CFR 3550.57 - Dwelling requirements.

Science.gov (United States)

2010-01-01

... 7 Agriculture 15 2010-01-01 2010-01-01 false Dwelling requirements. 3550.57 Section 3550.57... AGRICULTURE DIRECT SINGLE FAMILY HOUSING LOANS AND GRANTS Section 502 Origination § 3550.57 Dwelling requirements. (a) Modest dwelling. The property must be one that is considered modest for the area, must not be...

Active optical sensor assessment of spider mite damage on greenhouse beans and cotton.

Science.gov (United States)

Martin, Daniel E; Latheef, Mohamed A

2018-02-01

The two-spotted spider mite, Tetranychus urticae Koch, is an important pest of cotton in mid-southern USA and causes yield reduction and deprivation in fiber fitness. Cotton and pinto beans grown in the greenhouse were infested with spider mites at the three-leaf and trifoliate stages, respectively. Spider mite damage on cotton and bean canopies expressed as normalized difference vegetation index indicative of changes in plant health was measured for 27 consecutive days. Plant health decreased incrementally for cotton until day 21 when complete destruction occurred. Thereafter, regrowth reversed decline in plant health. On spider mite treated beans, plant vigor plateaued until day 11 when plant health declined incrementally. Results indicate that pinto beans were better suited as a host plant than cotton for rearing T. urticae in the laboratory.

Acoustic classification of dwellings

DEFF Research Database (Denmark)

Berardi, Umberto; Rasmussen, Birgit

2014-01-01

insulation performance, national schemes for sound classification of dwellings have been developed in several European countries. These schemes define acoustic classes according to different levels of sound insulation. Due to the lack of coordination among countries, a significant diversity in terms...... exchanging experiences about constructions fulfilling different classes, reducing trade barriers, and finally increasing the sound insulation of dwellings.......Schemes for the classification of dwellings according to different building performances have been proposed in the last years worldwide. The general idea behind these schemes relates to the positive impact a higher label, and thus a better performance, should have. In particular, focusing on sound...

Practicing the Attentional Dwell Away?

DEFF Research Database (Denmark)

Petersen, Anders; Kyllingsbæk, Søren; Bundesen, Claus

2007-01-01

Studies of the time course of visual attention have identified a temporary functional blindness to the second of two spatially separated targets: attending to one visual stimulus may lead to impairments in identifying a second stimulus presented about 200-500 ms later than the first. The phenomenon...... is known as the attentional dwell time (e.g. Duncan, Ward, Shapiro, 1994). Previous studies of attentional dwell time have all used naive subjects running few (.... The results suggest that the majority of subjects may learn to optimize their performance reducing the attentional dwell time effect substantially. Further, the reduction in the attentional dwell time effect seems to be closely linked to the ability of the subject to inhibit eye movements while performing...

An image filtering technique for SPIDER visible tomography

Energy Technology Data Exchange (ETDEWEB)

Fonnesu, N., E-mail: nicola.fonnesu@igi.cnr.it; Agostini, M.; Brombin, M.; Pasqualotto, R.; Serianni, G. [Consorzio RFX, Associazione EURATOM-ENEA sulla Fusione, Corso Stati Uniti 4, I-35127 Padova (Italy)

2014-02-15

The tomographic diagnostic developed for the beam generated in the SPIDER facility (100 keV, 50 A prototype negative ion source of ITER neutral beam injector) will characterize the two-dimensional particle density distribution of the beam. The simulations described in the paper show that instrumental noise has a large influence on the maximum achievable resolution of the diagnostic. To reduce its impact on beam pattern reconstruction, a filtering technique has been adapted and implemented in the tomography code. This technique is applied to the simulated tomographic reconstruction of the SPIDER beam, and the main results are reported.

An image filtering technique for SPIDER visible tomography

International Nuclear Information System (INIS)

Fonnesu, N.; Agostini, M.; Brombin, M.; Pasqualotto, R.; Serianni, G.

2014-01-01

The tomographic diagnostic developed for the beam generated in the SPIDER facility (100 keV, 50 A prototype negative ion source of ITER neutral beam injector) will characterize the two-dimensional particle density distribution of the beam. The simulations described in the paper show that instrumental noise has a large influence on the maximum achievable resolution of the diagnostic. To reduce its impact on beam pattern reconstruction, a filtering technique has been adapted and implemented in the tomography code. This technique is applied to the simulated tomographic reconstruction of the SPIDER beam, and the main results are reported

The endemic Patagonian vespertilionid assemblage is a depauperate ecomorphological vicariant of species-rich neotropical assemblages

Institute of Scientific and Technical Information of China (English)

Analía L.GIM(E)NEZ; Norberto P. GIANNINI

2017-01-01

Vespertilionidae is the most diverse chiropteran family,and its diversity is concentrated in warm regions of the World;however,due to physiological and behavioral adaptations,these bats also dominate bat faunas in temperate regions.Here we performed a comparative study of vespertilionid assemblages from two broad regions of the New World,the cold and harsh Patagonia,versus the remaining temperate-to-subtropical,extra-Patagonian eco-regions of the South American Southern Cone.We took an ecomorphological approach and analyzed the craniodental morphological structure of these assemblages within a phylogenetic framework.We measured 17 craniodental linear variables from 447 specimens of 22 currently recognized vespertilionid species of the study regions.We performed a multivariate analysis to define the morphofunctional space,and calculated the pattern and degree of species packing for each assemblage.We assessed the importance of phylogeny and biogeography,and their impact on depauperate (Patagonian) versus rich (extra-Patagonian) vespertilionid assemblages as determinants of morphospace structuring.We implemented a sensitivity analysis associated to small samples of rare species.The morphological patterns were determined chiefly by the evolutionary history of the family.The Patagonian assemblage can be described as a structurally similar but comparatively depauperate ecomorphological version of those assemblages from neighboring extra-Patagonian eco-regions.The Patagonian assemblage seems to have formed by successively adding populations from Northern regions that eventually speciated in the region,leaving corresponding sisters (vicariants) in extraPatagonian eco-regions that continued to be characteristically richer.Despite being structurally akin,degree of species packing in Patagonia was comparatively very low,which may reflect the effect of limited dispersal success into a harsh region for bat survival.

Exogenous attention to fear: Differential behavioral and neural responses to snakes and spiders.

Science.gov (United States)

Soares, Sandra C; Kessel, Dominique; Hernández-Lorca, María; García-Rubio, María J; Rodrigues, Paulo; Gomes, Nuno; Carretié, Luis

2017-05-01

Research has consistently shown that threat stimuli automatically attract attention in order to activate the defensive response systems. Recent findings have provided evidence that snakes tuned the visual system of evolving primates for their astute detection, particularly under challenging perceptual conditions. The goal of the present study was to measure behavioral and electrophysiological indices of exogenous attention to snakes, compared with spiders - matched for rated fear levels but for which sources of natural selection are less well grounded, and to innocuous animals (birds), which were presented as distracters, while participants were engaged in a letter discrimination task. Duration of stimuli, consisting in a letter string and a concurrent distracter, was either presented for 180 or 360ms to explore if the stimulus duration was a modulating effect of snakes in capturing attention. Results showed a specific early (P1) exogenous attention-related brain potential with maximal amplitude to snakes in both durations, which was followed by an enhanced late attention-related potential (LPP) showing enhanced amplitudes to spiders, particularly under the longer exposure durations. These results suggest that exogenous attention to different classes of threat stimuli follows a gradual process, with the most evolutionary-driven stimulus, i.e., snakes, being more efficient at attracting early exogenous attention, thus more dependent on bottom-up processes. Copyright © 2017 Elsevier Ltd. All rights reserved.

Subsocial behaviour and brood adoption in mixed-species colonies of two theridiid spiders

DEFF Research Database (Denmark)

Grinsted, Lena; Agnarsson, Ingi; Bilde, Trine

2012-01-01

, aggression and cooperation through behavioural experiments and examine the potential for adoption of foreign brood. Morphological and genetic analyses confirmed that colonies consisted of two related species Chikunia nigra (O.P. Cambridge, 1880) new combination (previously Chrysso nigra) and a yet...... as in territorial, colonial spiders. Mixed species spider colonies, involving closely related species, have rarely been documented. We examined social interactions in newly discovered mixed-species colonies of theridiid spiders on Bali, Indonesia. Our aim was to test the degree of intra- and interspecific tolerance...

fMRI neurofeedback facilitates anxiety regulation in females with spider phobia

Directory of Open Access Journals (Sweden)

Anna eZilverstand

2015-06-01

Full Text Available Background: Spider phobics show an exaggerated fear response when encountering spiders. This fear response is aggravated by negative and irrational beliefs about the feared object. Cognitive reappraisal can target these beliefs, and therefore has a fear regulating effect. The presented study investigated if neurofeedback derived from functional magnetic resonance imaging (fMRI would facilitate anxiety regulation by cognitive reappraisal, using spider phobia as a model of anxiety disorders. Feedback was provided based on activation in left dorsolateral prefrontal cortex and right insula, as indicators of engagement and regulation success, respectively.Methods: Eighteen female spider phobics participated in a randomized, controlled, single-blinded study. All participants completed a training session in the MRI scanner. Participants assigned to the neurofeedback condition were instructed to shape their regulatory strategy based on the provided feedback. Participants assigned to the control condition were asked to adapt their strategy intuitively.Results: Neurofeedback participants exhibited lower anxiety levels than the control group at the end of the training. In addition, only neurofeedback participants achieved down-regulation of insula activation levels by cognitive reappraisal. Group differences became more pronounced over time, supporting learning as a mechanism behind this effect. Importantly, within the neurofeedback group, achieved changes in insula activation levels during training predicted long-term anxiety reduction.Conclusions: The conducted study provides first evidence that fMRI neurofeedback has a facilitating effect on anxiety regulation in spider phobia.

Mediterranean Recluse Spider, Loxosceles rufescens (Araneae: Sicariidae from Charkhab Cave, Southern Iran

Directory of Open Access Journals (Sweden)

Saber Sadeghi

2017-04-01

Full Text Available Background: The best-known dangerous spiders belong to the six genera. The genus Loxosceles or violin spiders are well known for their ability to cause skin necrosis or loxoscelism. All Loxosceles species have medical im­portance due to their necrotizing venom. The present article reports the occurrence of L. rufescens in Charkhab Cave, south of Iran (Larestan.Methods: The specimens were collected from the Charkhab Cave using handling forceps, paintbrush and aspirator and preserved in 96% ethanol.Results: Loxosceles rufescens, a medically important spider, is recorded from Charkhab Cave in Fars Province (southwest of Iran. Identification of L. rufescens was performed based on external morphology and the features of male genitalia.Conclusion: Presence of L. rufescens in south of Iran especially in a cave confirmed that this species is a widely distributed species in Iran. Therefore, cavers or cave visitors should be aware of this poisonous spider in caves.

Eocene and not Cretaceous origin of spider wasps: Fossil evidence from amber

Directory of Open Access Journals (Sweden)

Juanita Rodriguez

2016-02-01

Full Text Available Spider wasps had long been proposed to originate in the mid-Cretaceous based on the Burmese amber fossil Bryopompilus interfector Engel and Grimaldi, 2006. We performed a morphological examination of this fossil and determined it does not belong to Pompilidae or any other described hymenopteran family. Instead, we place it in the new family Bryopompilidae. The oldest verifiable member of the Pompilidae is from Baltic amber, which suggests the family probably originated in the Eocene, not in the mid-Cretaceous as previously proposed. The origin of spider wasps appears to be correlated with an increase in spider familial diversity in the Cenozoic. We also we add two genera to the extinct pompilid fauna: Tainopompilus gen. nov., and Paleogenia gen. nov., and describe three new species of fossil spider wasps: Anoplius planeta sp. nov., from Dominican amber (Burdigalian to Langhian; Paleogenia wahisi sp. nov., from Baltic amber (Lutetian to Priabonian; and Tainopompilus argentum sp. nov, from Dominican amber (Chattian to Langhian.

Analysis of transcriptomes of three orb-web spider species reveals gene profiles involved in silk and toxin.

Science.gov (United States)

Zhao, Ying-Jun; Zeng, Yan; Chen, Lei; Dong, Yang; Wang, Wen

2014-12-01

As an ancient arthropod with a history of 390 million years, spiders evolved numerous morphological forms resulting from adaptation to different environments. The venom and silk of spiders, which have promising commercial applications in agriculture, medicine and engineering fields, are of special interests to researchers. However, little is known about their genomic components, which hinders not only understanding spider biology but also utilizing their valuable genes. Here we report on deep sequenced and de novo assembled transcriptomes of three orb-web spider species, Gasteracantha arcuata, Nasoonaria sinensis and Gasteracantha hasselti which are distributed in tropical forests of south China. With Illumina paired-end RNA-seq technology, 54 871, 101 855 and 75 455 unigenes for the three spider species were obtained, respectively, among which 9 300, 10 001 and 10 494 unique genes are annotated, respectively. From these annotated unigenes, we comprehensively analyzed silk and toxin gene components and structures for the three spider species. Our study provides valuable transcriptome data for three spider species which previously lacked any genetic/genomic data. The results have laid the first fundamental genomic basis for exploiting gene resources from these spiders. © 2013 Institute of Zoology, Chinese Academy of Sciences.

A verified spider bite and a review of the literature confirm Indian ornamental tree spiders (Poecilotheria species) as underestimated theraphosids of medical importance.

Science.gov (United States)

Fuchs, Joan; von Dechend, Margot; Mordasini, Raffaella; Ceschi, Alessandro; Nentwig, Wolfgang

2014-01-01

Literature on bird spider or tarantula bites (Theraphosidae) is rare. This is astonishing as they are coveted pets and interaction with their keepers (feeding, cleaning the terrarium or taking them out to hold) might increase the possibility for bites. Yet, this seems to be a rare event and might be why most theraphosids are considered to be harmless, even though the urticating hairs of many American species can cause disagreeable allergic reactions. We are describing a case of a verified bite by an Indian ornamental tree spider (Poecilotheria regalis), where the patient developed severe, long lasting muscle cramps several hours after the bite. We present a comprehensive review of the literature on bites of these beautiful spiders and conclude that a delayed onset of severe muscle cramps, lasting for days, is characteristic for Poecilotheria bites. We discuss Poecilotheria species as an exception from the general assumption that theraphosid bites are harmless to humans. Copyright © 2013 Elsevier Ltd. All rights reserved.

A Ground-Nesting Galliform's Response to Thermal Heterogeneity: Implications for Ground-Dwelling Birds.

Science.gov (United States)

Carroll, J Matthew; Davis, Craig A; Elmore, R Dwayne; Fuhlendorf, Samuel D

2015-01-01

The habitat selection choices that individuals make in response to thermal environments influence both survival and reproduction. Importantly, the way that organisms behaviorally respond to thermal environments depends on the availability and juxtaposition of sites affording tolerable or preferred microclimates. Although, ground nesting birds are especially susceptible to heat extremes across many reproductive stages (i.e., breeding, nesting, brood rearing), the mechanistic drivers of nest site selection for these species are not well established from a thermal perspective. Our goal was to assess nest site selection relative to the configuration of the thermal landscape by quantifying thermal environments available to a ground-nesting bird species inhabiting a climatically stressful environment. Using northern bobwhite (Colinus virginanus) as a model species, we measured black bulb temperature (Tbb) and vegetation parameters at 87 nests, 87 paired sites and 205 random landscape sites in Western Oklahoma during spring and summer 2013 and 2014. We found that thermal space within the study area exhibited differences in Tbb of up to 40°C during peak diurnal heating, resulting in a diverse thermal landscape available to ground-nesting birds. Within this thermally heterogeneous landscape, nest sites moderated Tbb by more than 12°C compared to random landscape sites. Furthermore, successful nests remained on average 6°C cooler than unsuccessful nests on days experiencing ambient temperatures ≥ 39°C. Models of future Tbb associated with 2080 climate change projections indicate that nesting bobwhites will face substantially greater Tbb throughout the landscape for longer durations, placing an even greater importance on thermal choices for nest sites in the future. These results highlight the capacity of landscape features to act as moderators of thermal extremes and demonstrate how thermal complexity at organism-specific scales can dictate habitat selection.

Radon in dwellings in Sweden

International Nuclear Information System (INIS)

Swedjemark, G.A.

1980-01-01

Studies on specific activities in building materials, gamma-radiation levels in dwellings, the concentrations of radon and daughters in the air indoors and the concentration of radon in tap water are in progress in Sweden. On the basis of these investigations and of the investigation of Hultqvist from the beginning of the 1950's, an attempt has been made to show how the radiation doses in dwellings have changed or may be changed by human activities and what these changes imply in terms of collective dose. The annual collective absorbed dose in the basal cells of the critical bronchial region have increased from 11 x 10 3 man-Gy for the occupants of dwellings existing in 1950 to 25 x 10 3 man-Gy for dwellings existing in 1975

Predator-Prey Interactions are Context Dependent in a Grassland Plant-Grasshopper-Wolf Spider Food Chain.

Science.gov (United States)

Laws, Angela N; Joern, Anthony

2015-06-01

Species interactions are often context dependent, where outcomes vary in response to one or more environmental factors. It remains unclear how abiotic conditions like temperature combine with biotic factors such as consumer density or food quality to affect resource availability or influence species interactions. Using the large grasshopper Melanoplus bivittatus (Say) and a common wolf spider [Rabidosa rabida (Walkenaer)], we conducted manipulative field experiments in tallgrass prairie to examine how spider-grasshopper interactions respond to manipulations of temperature, grasshopper density, and food quality. Grasshopper survival was density dependent, as were the effects of spider presence and food quality in context-dependent ways. In high grasshopper density treatments, predation resulted in increased grasshopper survival, likely as a result of reduced intraspecific competition in the presence of spiders. Spiders had no effect on grasshopper survival when grasshoppers were stocked at low densities. Effects of the experimental treatments were often interdependent so that effects were only observed when examined together with other treatments. The occurrence of trophic cascades was context dependent, where the effects of food quality and spider presence varied with temperature under high-density treatments. Temperature weakly affected the impact of spider presence on M. bivittatus survivorship when all treatments were considered simultaneously, but different context-dependent responses to spider presence and food quality were observed among the three temperature treatments under high-density conditions. Our results indicate that context-dependent species interactions are common and highlight the importance of understanding how key biotic and abiotic factors combine to influence species interactions. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Speciation on a conveyor belt: sequential colonization of the hawaiian islands by Orsonwelles spiders (Araneae, Linyphiidae).

Science.gov (United States)

Hormiga, Gustavo; Arnedo, Miquel; Gillespie, Rosemary G

2003-02-01

Spiders of the recently described linyphiid genus Orsonwelles (Araneae, Linyphiidae) are one of the most conspicuous groups of terrestrial arthropods of Hawaiian native forests. There are 13 known Orsonwelles species, and all are single- island endemics. This radiation provides an excellent example of insular gigantism. We reconstructed the cladistic relationships of Orsonwelles species using a combination of morphological and molecular characters (both mitochondrial and nuclear sequences) within a parsimony framework. We explored and quantified the contribution of different character partitions and their sensitivity to changes in the traditional parameters (gap, transition, and transversion costs). The character data show a strong phylogenetic signal, robust to parameter changes. The monophyly of the genus Orsonwelles is strongly supported. The parsimony analysis of all character evidence combined recovered a clade with of all the non-Kauai Orsonwelles species; the species from Kauai form a paraphyletic assemblage with respect to the latter former clade. The biogeographic pattern of the Hawaiian Orsonwelles species is consistent with colonization by island progression, but alternative explanations for our data exist. Although the geographic origin of the radiation remains unknown, it appears that the ancestral colonizing species arrived first on Kauai (or an older island). The ambiguity in the area cladogram (i.e., post-Oahu colonization) is not derived from conflicting or unresolved phylogenetic signal among Orsonwelles species but rather from the number of taxa on the youngest islands. Speciation in Orsonwelles occurred more often within islands (8 of the 12 cladogenic events) than between islands. A molecular clock was rejected for the sequence data. Divergence times were estimated by using the nonparametric rate smoothing method of Sanderson (1997, Mol. Biol. Evol. 14:1218-1231) and the available geological data for calibration. The results suggest that the

From Midges to Spiders: Mercury Biotransport in Riparian Zones Near the Buffalo River Area of Concern (AOC), USA.

Science.gov (United States)

Pennuto, C M; Smith, M

2015-12-01

Riparian communities can receive environmental contaminants from adjacent aquatic 'donor' habitats. We investigated mercury biotransport from aquatic to terrestrial habitats via aquatic insect emergence and uptake by riparian spiders at sites within and upstream of the Buffalo River Area of Concern (AOC), a site with known sediment Hg contamination. Mercury concentration in emerging midges was roughly 10× less than contaminated sediment levels with the AOC, but biomagnification factors from midges to spiders ranged from 2.0 to 2.65 between sites. There was a significantly negative body mass:total mercury relationship in spiders (p Spiders contained significantly more mercury than their midge prey and spiders upstream of the AOC had higher mercury concentrations than spiders from within the AOC. Collectively, these data indicate that riparian spiders can be good mercury sentinels in urban environments, and that riparian communities upstream from the AOC may be at greater risk to mercury than has been previously considered.

Studies on the occurrence of true spiders as natural enemies in many Egyptian fields

Directory of Open Access Journals (Sweden)

Amira A. Ibrahim

2012-01-01

Full Text Available True spiders represent one of the most important natural predatory species in Egyptian fields. In this work, common true spiders were surveyed in wheat, cotton and maize fields, and were counted weekly by using the direct method. For evaluating the feeding consumption of true spiders, five feeding cases were tested (as preys. These cases were: eggs of Ephestia kuehniella, eggs of Phthorimaea operculella, one day eggs and larvae of E. kuehniella, larvae of E. kuehniella and P. operculella and larvae of E. kuehniella only. Results obtained revealed that, the highest average daily consumption for each spider was recorded in case of feeding on eggs of P. operculella. While, the longest survival period was recorded in case of feeding on larvae of E. kuehniella.

Logic circuits based on molecular spider systems.

Science.gov (United States)

Mo, Dandan; Lakin, Matthew R; Stefanovic, Darko

2016-08-01

Spatial locality brings the advantages of computation speed-up and sequence reuse to molecular computing. In particular, molecular walkers that undergo localized reactions are of interest for implementing logic computations at the nanoscale. We use molecular spider walkers to implement logic circuits. We develop an extended multi-spider model with a dynamic environment wherein signal transmission is triggered via localized reactions, and use this model to implement three basic gates (AND, OR, NOT) and a cascading mechanism. We develop an algorithm to automatically generate the layout of the circuit. We use a kinetic Monte Carlo algorithm to simulate circuit computations, and we analyze circuit complexity: our design scales linearly with formula size and has a logarithmic time complexity. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

Reproductive Seasonality in Nesticus (Araneae: Nesticidae) Cave Spiders.

Science.gov (United States)

Carver, Linnea M; Perlaky, Patricia; Cressler, Alan; Zigler, Kirk S

2016-01-01

Spiders of the family Nesticidae are members of cave communities around the world with cave-obligate (troglobiotic) species known from North America, Europe, Asia and the Indo-Pacific. A radiation of Nesticus (Araneae: Nesticidae) in the southern Appalachians includes ten troglobiotic species. Many of these species are of conservation interest due to their small ranges, with four species being single-cave endemics. Despite conservation concerns and their important role as predators in cave communities, we know little about reproduction and feeding in this group. We addressed this knowledge gap by examining populations of two species on a monthly basis for one year. We made further observations on several other species and populations, totaling 671 individual spider observations. This more than doubled the reported observations of reproduction and feeding in troglobiotic Nesticus. Female Nesticus carry egg sacs, facilitating the determination of the timing and frequency of reproduction. We found that Nesticus exhibit reproductive seasonality. Females carried egg sacs from May through October, with a peak in frequency in June. These spiders were rarely observed with prey; only 3.3% (22/671) of individuals were observed with prey items. The frequency at which prey items were observed did not vary by season. Common prey items were flies, beetles and millipedes. Troglobiotic species constituted approximately half of all prey items observed. This result represents a greater proportion of troglobiotic prey than has been reported for various troglophilic spiders. Although our findings shed light on the life history of troglobiotic Nesticus and on their role in cave ecosystems, further work is necessary to support effective conservation planning for many of these rare species.

Differential predictive power of self report and implicit measures on behavioural and physiological fear responses to spiders

NARCIS (Netherlands)

van Bockstaele, B.; Verschuere, B.; Koster, E.H.W.; Tibboel, H.; de Houwer, J.; Crombez, G.

2011-01-01

In this study, we investigated to what extent indirect measures predict behavioural and physiological fear responses towards spiders. Implicit attitudes towards spiders were assessed using an implicit association test and attentional bias towards spiders was assessed using a dot probe task and a

Exploring of the first recorded spider (Arachenida: Aranae) species of Sheringal, Khyber Pakhtunkhwa, Pakistan

OpenAIRE

Farzana Perveen; Numan Khan

2015-01-01

The spiders (Arthropoada: Arachenida) are one of the groups of grasping animals. Their carapaces are found on the dorsal side of the cephalothorax, which is an important characteristic of spiders. The present study was conducted to explore the first recorded spider species (nti=75) of Sheringal, Dir Upper (DU), Khyber Pakhtunkhwa (KP), Dir Upper, Khyber Pakhtunkhwa, Pakistan. The 10 genera with 10 species under 7 families were recorded from June 2013-July 2014. According to length of legs, th...

SVM-based prediction of propeptide cleavage sites in spider toxins identifies toxin innovation in an Australian tarantula.

Directory of Open Access Journals (Sweden)

Emily S W Wong

Full Text Available Spider neurotoxins are commonly used as pharmacological tools and are a popular source of novel compounds with therapeutic and agrochemical potential. Since venom peptides are inherently toxic, the host spider must employ strategies to avoid adverse effects prior to venom use. It is partly for this reason that most spider toxins encode a protective proregion that upon enzymatic cleavage is excised from the mature peptide. In order to identify the mature toxin sequence directly from toxin transcripts, without resorting to protein sequencing, the propeptide cleavage site in the toxin precursor must be predicted bioinformatically. We evaluated different machine learning strategies (support vector machines, hidden Markov model and decision tree and developed an algorithm (SpiderP for prediction of propeptide cleavage sites in spider toxins. Our strategy uses a support vector machine (SVM framework that combines both local and global sequence information. Our method is superior or comparable to current tools for prediction of propeptide sequences in spider toxins. Evaluation of the SVM method on an independent test set of known toxin sequences yielded 96% sensitivity and 100% specificity. Furthermore, we sequenced five novel peptides (not used to train the final predictor from the venom of the Australian tarantula Selenotypus plumipes to test the accuracy of the predictor and found 80% sensitivity and 99.6% 8-mer specificity. Finally, we used the predictor together with homology information to predict and characterize seven groups of novel toxins from the deeply sequenced venom gland transcriptome of S. plumipes, which revealed structural complexity and innovations in the evolution of the toxins. The precursor prediction tool (SpiderP is freely available on ArachnoServer (http://www.arachnoserver.org/spiderP.html, a web portal to a comprehensive relational database of spider toxins. All training data, test data, and scripts used are available from

Inhibition of Return in Fear of Spiders: Discrepant Eye Movement and Reaction Time Data

Directory of Open Access Journals (Sweden)

Elisa Berdica

2014-01-01

Full Text Available Inhibition of return (IOR refers to a bias against returning the attention to a previously attended location. As a foraging facilitator it is thought to facilitate systematic visual search. With respect to neutral stimuli, this is generally thought to be adaptive, but when threatening stimuli appear in our environment, such a bias may be maladaptive. This experiment investigated the influence of phobia-related stimuli on the IOR effect using a discrimination task. A sample of 50 students (25 high, 25 low in spider fear completed an IOR task including schematic representations of spiders or butterflies as targets. Eye movements were recorded and to assess discrimination among targets, participants indicated with button presses if targets were spiders or butterflies. Reaction time data did not reveal a significant IOR effect but a significant interaction of group and target; spider fearful participants were faster to respond to spider targets than to butterflies. Furthermore, eye-tracking data showed a robust IOR effect independent of stimulus category. These results offer a more comprehensive assessment of the motor and oculomotor factors involved in the IOR effect.

Multivariate ordination identifies vegetation types associated with spider conservation in brassica crops

Directory of Open Access Journals (Sweden)

Hafiz Sohaib Ahmed Saqib

2017-10-01

Full Text Available Conservation biological control emphasizes natural and other non-crop vegetation as a source of natural enemies to focal crops. There is an unmet need for better methods to identify the types of vegetation that are optimal to support specific natural enemies that may colonize the crops. Here we explore the commonality of the spider assemblage—considering abundance and diversity (H—in brassica crops with that of adjacent non-crop and non-brassica crop vegetation. We employ spatial-based multivariate ordination approaches, hierarchical clustering and spatial eigenvector analysis. The small-scale mixed cropping and high disturbance frequency of southern Chinese vegetation farming offered a setting to test the role of alternate vegetation for spider conservation. Our findings indicate that spider families differ markedly in occurrence with respect to vegetation type. Grassy field margins, non-crop vegetation, taro and sweetpotato harbour spider morphospecies and functional groups that are also present in brassica crops. In contrast, pumpkin and litchi contain spiders not found in brassicas, and so may have little benefit for conservation biological control services for brassicas. Our findings also illustrate the utility of advanced statistical approaches for identifying spatial relationships between natural enemies and the land uses most likely to offer alternative habitats for conservation biological control efforts that generates testable hypotheses for future studies.

Affects and assemblages

DEFF Research Database (Denmark)

Samson, Kristine

the paper raises the questions where to locate aesthetics when planners and architects wishes to design for aesthetical experiences and sensations rather than formal objects. The paper will proceed through a brief outline of the recent notion of assemblage and affect in urban studies, planning theory...... happens to aesthetics and how does it change the existing social and geographical understanding of urban space? The paper sets out to reintroduce aesthetical aspects of affects and assemblages in relation to urban space and urban planning. It presupposes urban space as a continuous state of becoming where...

Raising the energy performance of historical dwellings

NARCIS (Netherlands)

van Krugten, L.T.F.; Hermans, L.M.C.; Havinga, L.C.; Pereira Roders, A.R.; Schellen, H.L.

2016-01-01

Purpose: Earlier studies assume that historical dwellings and post-war dwellings in particular, are less sustainable than modern dwellings, justifying its demolition. Over time, historical buildings have been transformed and their energy performance improved. However, there is little known on the

Exposure of Brown Recluse and Brown Widow Spiders (Araneae: Sicariidae, Theridiidae) to a Commercial Sulfuryl Fluoride Fumigation.

Science.gov (United States)

Vetter, Richard S; Hoddle, Mark S; Choe, Dong-Hwan; Thoms, Ellen

2014-10-01

The body of pesticide research on spiders is sparse with most studies using topical or residual applications to assess efficacy. Data on the effects of fumigation on spider survivorship are scarce in the scientific literature. In this study, we exposed adult male and female brown recluse spiders, Loxosceles reclusa Gertsch & Mulaik, and female brown widow spiders, Latrodectus geometricus C. L. Koch, to a commercial fumigation event using sulfuryl fluoride directed at termite control. General consensus from the pest control industry is that fumigation is not always effective for control of spiders for a variety of reasons, including insufficient fumigant dosage, particularly, for contents of egg sacs that require a higher fumigant dosage for control. We demonstrated that a sulfuryl fluoride fumigation with an accumulated dosage of 162 oz-h per 1,000 ft(3) at 21°C over 25 h (≈1.7 × the drywood termite dosage) directed at termites was sufficient to kill adult brown recluse and brown widow spiders. The effectiveness of commercial fumigation practices to control spiders, and particularly their egg sacs, warrants further study. © 2014 Entomological Society of America.

Meaning profiles of dwellings, pathways, and metaphors in design: implications for education

Science.gov (United States)

Casakin, Hernan; Kreitler, Shulamith

2017-11-01

The study deals with the roles and interrelations of the meaning-based assessments of dwellings, pathways and metaphors in design performance. It is grounded in the Meaning Theory [Kreitler, S., and H. Kreitler. 1990. The Cognitive Foundations of Personality Traits. New York: Plenum], which enables identifying the cognitive contents and processes underlying cognitive performance in different domains, thus rendering them more accessible to educational training. The objectives were to identify the components of the meaning profiles of dwellings, pathways, and metaphors as perceived by design students; to analyse their interrelations; and to examine which of the identified components of these constructs serve as best predictors of design performance aided by the use of metaphors. Participants were administered a design task and questionnaires about the Dimensional Profiles of Dwellings, Pathways, and Metaphors, based on the meaning system. Factors based on the factor analyses of the responses to the three questionnaires were used in regression analyses as predictors of the performance score in a design task. The following three factors of the dimensional meaning profiles of metaphors were significant predictors of design performance: sensory, functional, and structural evaluations. Implications for design education are discussed, primarily concerning the important role of metaphor in design problem-solving.

Final design of thermal diagnostic system in SPIDER ion source

Energy Technology Data Exchange (ETDEWEB)

Brombin, M., E-mail: matteo.brombin@igi.cnr.it; Dalla Palma, M.; Pasqualotto, R.; Pomaro, N. [Consorzio RFX, Corso Stati Uniti 4, I-35127 Padova (Italy)

2016-11-15

The prototype radio frequency source of the ITER heating neutral beams will be first tested in SPIDER test facility to optimize H{sup −} production, cesium dynamics, and overall plasma characteristics. Several diagnostics will allow to fully characterise the beam in terms of uniformity and divergence and the source, besides supporting a safe and controlled operation. In particular, thermal measurements will be used for beam monitoring and system protection. SPIDER will be instrumented with mineral insulated cable thermocouples, both on the grids, on other components of the beam source, and on the rear side of the beam dump water cooled elements. This paper deals with the final design and the technical specification of the thermal sensor diagnostic for SPIDER. In particular the layout of the diagnostic, together with the sensors distribution in the different components, the cables routing and the conditioning and acquisition cubicles are described.

Spider Silk Processing for Spidroin Recovery from Crossopriza Lyoni Web

Science.gov (United States)

Mohtar, J. A.; Ooi, W. L.; Yusuf, F.

2018-03-01

Spider silk is a potential biomaterial that can be used in various applications for its outstanding physicomechanical properties attributed by the spidroin composition. Efforts for commercializing spider silks have been mainly focused on the characterization of spidroins from the Entelegyne spiders for exceptional fibre construction. Hence, studies on silk proteins from the Haplogyne species remain neglected. The aim of this study is to isolate spidroin from Crossopriza lyoni web. Silk processing involved the pretreatment of fibres for the shell layer removal from the surface. A screening study was conducted to analyze the effect of temperature, incubation time and agitation speed on spidroin extraction using Ajisawa’s reagent by OFAT analysis followed by statistical optimization of the extraction process via RSM for maximal protein recovery. All parameters exerted significant effect on spidroin recovery (pspider silk to meet the demand for a variety of silk-based products in the near future.

Final design of thermal diagnostic system in SPIDER ion source

International Nuclear Information System (INIS)

Brombin, M.; Dalla Palma, M.; Pasqualotto, R.; Pomaro, N.

2016-01-01

The prototype radio frequency source of the ITER heating neutral beams will be first tested in SPIDER test facility to optimize H"− production, cesium dynamics, and overall plasma characteristics. Several diagnostics will allow to fully characterise the beam in terms of uniformity and divergence and the source, besides supporting a safe and controlled operation. In particular, thermal measurements will be used for beam monitoring and system protection. SPIDER will be instrumented with mineral insulated cable thermocouples, both on the grids, on other components of the beam source, and on the rear side of the beam dump water cooled elements. This paper deals with the final design and the technical specification of the thermal sensor diagnostic for SPIDER. In particular the layout of the diagnostic, together with the sensors distribution in the different components, the cables routing and the conditioning and acquisition cubicles are described.

The functional morphology of color changing in a spider: development of ommochrome pigment granules.

Science.gov (United States)

Insausti, Teresita C; Casas, Jérôme

2008-03-01

Studies on the formation of ommochrome pigment granules are very few, despite their generalized occurrence as screening pigments in insect eyes. This is particularly true for ommochrome granules responsible for epidermal coloration. The aims of this study were to characterize the localization of major body pigments in a color changing mimetic spider, Misumena vatia (Thomisidae), and to describe the formation and location of ommochrome pigment granules responsible for the spider's color change from white to yellow. The unpigmented cuticula of this spider is transparent. Both the guanine localized in guanine cells in the opisthosoma and the uric acid localized in epidermis cells in the prosoma are responsible for the white coloration. The bright yellow color is due to the combination of ommochrome pigment granules and the white reflectance from coincident guanine and/or uric acid. The formation of ommochrome pigment granules in epidermis cells proceeds via three distinctive steps. Translucent, UV fluorescent, progranules (type I) are produced by a dense network of endoplasmic reticulum associated with numerous mitochondria and glycogen rosettes. These progranules are present in white spiders only, and regularly distributed in the cytoplasm. The merging of several progranules of type I into a transient state (progranule type II) leads to the formation of granules (type III) characterized by their lack of fluorescence, their spherical sections and their osmophilic-electron-dense contents. They are found in yellow spiders and in the red stripes on the body sides. Their color varies from yellow to red. Thus, white spiders contain only type I granules, yellow tinted spiders contain type II and III granules and bright yellow spiders contain only type III granules. We present a synthetic view of the ontogeny of ommochrome granules. We discuss the physiology of color changing and the nature of the chemical compounds in the different types of granules. Extended studies on the

Extracellular fluid management and hypertension in urban dwelling versus rural dwelling hemodialysis patients.

Science.gov (United States)

Tonelli, Marcello; Lloyd, Anita; Pannu, Neesh; Klarenbach, Scott; Ravani, Pietro; Jindal, Kailash; MacRae, Jennifer; Unsworth, Larry; Manns, Braden; Hemmelgarn, Brenda

2018-02-01

Rural-dwelling hemodialysis patients have less frequent contact with nephrologists than urban-dwelling patients, and are known to have higher mortality. We hypothesized that rural-dwelling hemodialysis patients would have more evidence of poorly controlled extracellular fluid volume (ECVF) than otherwise similar urban-dwellers. We studied prevalent hemodialysis patients within a single renal program in Alberta, Canada and assessed ECFV using bioimpedance spectroscopy (BIS). Our primary outcome was impedance vector length (ohm/m) as assessed by BIS using the Xitron Hydra 4200 device, where shorter vector length indicated poorer ECFV control. Because poor ECFV control can lead to hypertension, we also assessed pre- and post-dialysis blood pressure. We measured outcomes at baseline. We studied 228 hemodialysis patients, of whom 115 (50.4 %) and 113 (49.6 %) were urban- and rural-dwelling, respectively. There were no differences in volume control in urban versus rural participants; odds ratio (OR) for vector length in the lowest sex-specific quartile of vector length was 0.93 (95 % CI 0.54, 1.59) after adjusting for age, sex, diabetic status, years since dialysis initiation and phase angle. The odds of very poor blood pressure control (pre-dialysis blood pressure ≥180/100) did not differ between urban and rural participants [fully adjusted OR 0.96 (0.36, 2.60)]. Differences in ECFV control do not appear to explain higher mortality among remote- and rural- dwelling hemodialysis patients, compared to urban-dwellers.

Characterisation of protein families in spider digestive fluids and their role in extra-oral digestion.

Science.gov (United States)

Walter, André; Bechsgaard, Jesper; Scavenius, Carsten; Dyrlund, Thomas S; Sanggaard, Kristian W; Enghild, Jan J; Bilde, Trine

2017-08-10

Spiders are predaceous arthropods that are capable of subduing and consuming relatively large prey items compared to their own body size. For this purpose, spiders have evolved potent venoms to immobilise prey and digestive fluids that break down nutrients inside the prey's body by means of extra-oral digestion (EOD). Both secretions contain an array of active proteins, and an overlap of some components has been anecdotally reported, but not quantified. We systematically investigated the extent of such protein overlap. As venom injection and EOD succeed each other, we further infer functional explanations, and, by comparing two spider species belonging to different clades, assess its adaptive significance for spider EOD in general. We describe the protein composition of the digestive fluids of the mygalomorph Acanthoscurria geniculata and the araneomorph Stegodyphus mimosarum, in comparison with previously published data on a third spider species. We found a number of similar hydrolases being highly abundant in all three species. Among them, members of the family of astacin-like metalloproteases were particularly abundant. While the importance of these proteases in spider venom and digestive fluid was previously noted, we now highlight their widespread use across different spider taxa. Finally, we found species specific differences in the protein overlap between venom and digestive fluid, with the difference being significantly greater in S. mimosarum compared to A. geniculata. The injection of venom precedes the injection with digestive fluid, and the overlap of proteins between venom and digestive fluid suggests an early involvement in EOD. Species specific differences in the overlap may reflect differences in ecology between our two study species. The protein composition of the digestive fluid of all the three species we compared is highly similar, suggesting that the cocktail of enzymes is highly conserved and adapted to spider EOD.

What is the relationship between built form and energy use in dwellings?

International Nuclear Information System (INIS)

Wright, Andrew

2008-01-01

Energy is used in dwellings to provide four services: space heating, hot water, lighting and to power appliances. This paper describes how the usage of energy in a UK home results from a complex interaction between built form, location, energy-using equipment, occupants and the affordability of fuel. Current models with standard occupancy predict that energy use will be strongly related to size and built form, but surveys of real homes show only weak correlations, across all types of dwelling. Recent research has given us insights into occupancy factors including preferred comfort, 'take-back' from thermal efficiency improvements, and patterns of electricity use. Space heating is on a downward trend and is low in new dwellings. Energy use for lights and appliances, which is only weakly related to built form, is increasing. Strong legislation, combined with low-carbon technologies, will be needed to counteract this trend. Future challenges discussed include increases in real energy prices and climate change mitigation efforts, which are likely to improve the existing stock. Challenging targets are now in place for new housing to move towards low or zero energy and carbon standards. In the longer term, dwellings will demand less energy. Alternatives to gas for space heating will be increasingly common, including ground source heat and local combined heat and power (CHP) from biomass, while electricity could come from a more decarbonised electricity system. However, these improvements must be set alongside a demand for many new homes, demographic trends towards smaller households, and a more holistic approach to overall carbon use including personal transport

The diet of the black widow spider Latrodectus mirabilis (Theridiidae in two cereal crops of central Argentina

Directory of Open Access Journals (Sweden)

Gabriel Pompozzi

2013-12-01

Full Text Available The spider Latrodectus mirabilis (Holmberg, 1876 is commonly found in cereals crops of central Argentina. We studied its diet composition at the field and capture rate on leaf-cutting ants based on laboratory experiments. This study comprises the first approach that documents the diet of L. mirabilis in wheat and oat fields of central Argentina. We identified 1,004 prey items collected from its webs during the last phenological stages of both cereal crops. The prey composition was variable but the spiders prey mainly on ants (Formicidae, Hymenoptera, who represented more than 86% of the total. Meanwhile, in the capture rate experiences we registered a high proportion of ants captured by spiders at the beginning of experiences, capturing the half of the ants from total in the first four hours. Summarizing, we reported a polyphagous diet of this spider species in wheat and oat fields. Ants were the most important prey item of this spider, as found in other Latrodectus spiders around the world.

Vibration transmission through sheet webs of hobo spiders (Eratigena agrestis) and tangle webs of western black widow spiders (Latrodectus hesperus).

Science.gov (United States)

Vibert, Samantha; Scott, Catherine; Gries, Gerhard

2016-11-01

Web-building spiders construct their own vibratory signaling environments. Web architecture should affect signal design, and vice versa, such that vibratory signals are transmitted with a minimum of attenuation and degradation. However, the web is the medium through which a spider senses both vibratory signals from courting males and cues produced by captured prey. Moreover, webs function not only in vibration transmission, but also in defense from predators and the elements. These multiple functions may impose conflicting selection pressures on web design. We investigated vibration transmission efficiency and accuracy through two web types with contrasting architectures: sheet webs of Eratigena agrestis (Agelenidae) and tangle webs of Latrodectus hesperus (Theridiidae). We measured vibration transmission efficiencies by playing frequency sweeps through webs with a piezoelectric vibrator and a loudspeaker, recording the resulting web vibrations at several locations on each web using a laser Doppler vibrometer. Transmission efficiencies through both web types were highly variable, with within-web variation greater than among-web variation. There was little difference in transmission efficiencies of longitudinal and transverse vibrations. The inconsistent transmission of specific frequencies through webs suggests that parameters other than frequency are most important in allowing these spiders to distinguish between vibrations of prey and courting males.