International Nuclear Information System (INIS)
Ebinger, M.H.; Hansen, W.R.
1996-10-01
This report documents the third risk assessment completed for the depleted uranium (DU) munitions testing range at Jefferson Proving Ground (JPG), Indiana, for the U.S. Army Test and Evaluation command. Jefferson Proving Ground was closed in 1995 under the Base Realignment and Closure Act and the testing mission was moved to Yuma Proving Ground. As part of the closure of JPG, assessments of potential adverse health effects to humans and the ecosystem were conducted. This report integrates recent information obtained from site characterization surveys at JPG with environmental monitoring data collected from 1983 through 1994 during DU testing. Three exposure scenarios were evaluated for potential adverse effects to human health: an occasional use scenario and two farming scenarios. Human exposure was minimal from occasional use, but significant risk were predicted from the farming scenarios when contaminated groundwater was used by site occupants. The human health risk assessments do not consider the significant risk posed by accidents with unexploded ordnance. Exposures of white-tailed deer to DU were also estimated in this study, and exposure rates result in no significant increase in either toxicological or radiological risks. The results of this study indicate that remediation of the DU impact area would not substantially reduce already low risks to humans and the ecosystem, and that managed access to JPG is a reasonable model for future land use options
Energy Technology Data Exchange (ETDEWEB)
Ebinger, M.H. [Los Alamos National Lab., NM (United States); Oxenburg, T.P. [Army Test and Evaluation Command, Aberdeen Proving Ground, MD (United States)
1997-02-01
Jefferson Proving Ground was used by the US Army Test and Evaluation Command for testing of depleted uranium munitions and closed in 1995 under the Base Realignment and Closure Act. As part of the closure of JPG, assessments of potential adverse health effects to humans and the ecosystem were conducted. This paper integrates recent information obtained from site characterization surveys at JPG with environmental monitoring data collected from 1983 through 1994 during DU testing. Three exposure scenarios were evaluated for potential adverse effects to human health: an occasional use scenario and two farming scenarios. Human exposure was minimal from occasional use, but significant risk were predicted from the farming scenarios when contaminated groundwater was used by site occupants. The human health risk assessments do not consider the significant risk posed by accidents with unexploded ordnance. Exposures of white-tailed deer to DU were also estimated in this study, and exposure rates result in no significant increase in either toxicological or radiological risks. The results of this study indicate that remediation of the DU impact area would not substantially reduce already low risks to humans and the ecosystem, and that managed access to JPG is a reasonable model for future land use options.
Depleted uranium human health risk assessment, Jefferson Proving Ground, Indiana
International Nuclear Information System (INIS)
Ebinger, M.H.; Hansen, W.R.
1994-01-01
The risk to human health from fragments of depleted uranium (DU) at Jefferson Proving Ground (JPG) was estimated using two types of ecosystem pathway models. A steady-state, model of the JPG area was developed to examine the effects of DU in soils, water, and vegetation on deer that were hunted and consumed by humans. The RESRAD code was also used to estimate the effects of farming the impact area and consuming the products derived from the farm. The steady-state model showed that minimal doses to humans are expected from consumption of deer that inhabit the impact area. Median values for doses to humans range from about 1 mrem (±2.4) to 0.04 mrem (±0.13) and translate to less than 1 x 10 -6 detriments (excess cancers) in the population. Monte Carlo simulation of the steady-state model was used to derive the probability distributions from which the median values were drawn. Sensitivity analyses of the steady-state model showed that the amount of DU in airborne dust and, therefore, the amount of DU on the vegetation surface, controlled the amount of DU ingested by deer and by humans. Human doses from the RESRAD estimates ranged from less than 1 mrem/y to about 6.5 mrem/y in a hunting scenario and subsistence fanning scenario, respectively. The human doses exceeded the 100 mrem/y dose limit when drinking water for the farming scenario was obtained from the on-site aquifer that was presumably contaminated with DU. The two farming scenarios were unrealistic land uses because the additional risk to humans due to unexploded ordnance in the impact area was not figured into the risk estimate. The doses estimated with RESRAD translated to less than 1 x 10 -6 detriments to about 1 x 10 -3 detriments. The higher risks were associated only with the farming scenario in which drinking water was obtained on-site
Bayless, E. Randall; Greeman, T.K.; Harvey, C.C.
1998-01-01
Slag is a by-product of steel manufacturing and a ubiquitous fill material in northwestern Indiana. Ground water associated with slag deposits generally is characterized by high pH and elevated concentrations of many inorganic water-quality constituents. The U.S. Geological Survey, in cooperation with the Indiana Department of Environmental Management, conducted a study in northwestern Indiana from June 1995 to September 1996 to improve understanding of the effects of slag deposits on the water quality of a glacial-outwash aquifer. The Bairstow Landfill, a slag-fill deposit overlying the Calumet aquifer near Hammond, Indiana, was studied to represent conditions in slag-deposit settings that are common in northwestern Indiana. Ground water from 10 observation wells, located in four nests at the site, and surface water from the adjacent Lake George were analyzed for values of field-measured parameters and concentrations of major ions, nutrients, trace elements, and bulk properties. Solid-phase samples of slag and aquifer sediment collected during drilling were examined with X-ray diffraction and geochemical digestion and analysis. Concentrations of calcium, potassium, sodium, and sulfate were highest in wells screened partly or fully in slag. Potassium concentrations in ground water ranged from 2.9 to 120 milligrams per liter (mg/L), were highest in water from slag deposits, and decreased with depth. The highest concentrations for aluminum, barium, molybdenum, nickel, and selenium were in water from the slag. Silica concentrations were highest in wells screened directly beneath the slag?aquifer interface, and magnesium concentrations were highest in intermediate and deep aquifer wells. Silica concentrations in shallow and intermediate aquifer wells ranged from 27 to 41 mg/L and were about 10 times greater than those in water from slag deposits. The highest concentrations for chromium, lead, and zinc were in ground water from immediately below the slag
Watson, Lee R.; Bayless, E. Randall; Buszka, Paul M.; Wilson, John T.
2002-01-01
The effects of highway-deicer application on ground-water quality were studied at a site in northwestern Indiana using a variety of geochemical indicators. Site characteristics such as high snowfall rates; large quantities of applied deicers; presence of a high-traffic highway; a homogeneous, permeable, and unconfined aquifer; a shallow water table; a known ground-water-flow direction; and minimal potential for other sources of chloride and sodium to complicate source interpretation were used to select a study area where ground water was likely to be affected by deicer application. Forty-three monitoring wells were installed in an unconfined sand aquifer (the Calumet aquifer) near Beverly Shores in northwestern Indiana. Wells were installed along two transects that approximately paralleled groundwater flow in the Calumet aquifer and crossed US?12. US?12 is a highway that receives Indiana?s highest level of maintenance to maintain safe driving conditions. Ground-water quality and water-level data were collected from the monitoring wells, and precipitation and salt-application data were compiled from 1994 through 1997. The water-quality data indicated that chloride was the most easily traced indicator of highway deicers in ground water. Concentration ratios of chloride to iodide and chloride to bromide and Stiff diagrams of major element concentrations indicated that the principal source of chloride and sodium in ground water from the uppermost one-third to one-half of the Calumet relative electromagnetic conductivity defined a distinct plume of deicer-affected water in the uppermost 8 feet of aquifer at about 9 feet horizontally from the paved roadway edge and a zone of higher conductivity than background in the lower one-third of the aquifer. Chloride and sodium in the deep parts of the aquifer originated from natural sources. Chloride and sodium from highway deicers were present in the aquifer throughout the year. The highest concentrations of chloride and sodium
Buszka, P M; Yeskis, D J; Kolpin, D W; Furlong, E T; Zaugg, S D; Meyer, M T
2009-06-01
Four wells downgradient from a landfill near Elkhart, Indiana were sampled during 2000-2002 to evaluate the presence of waste-indicator and pharmaceutical compounds in landfill-leachate-affected ground water. Compounds detected in leachate-affected ground water included detergent metabolites (p-nonylphenol, nonylphenol monoethoxylate, nonylphenol diethoxylate, and octylphenol monoethoxylate), plasticizers (ethanol-2-butoxy-phosphate and diethylphthalate), a plastic monomer (bisphenol A), disinfectants (1,4-dichlorobenzene and triclosan), an antioxidant (5-methyl-1H-benzotriazole), three fire-retardant compounds (tributylphosphate and tri(2-chloroethyl)phosphate, and tri(dichlorisopropyl)phosphate), and several pharmaceuticals and metabolites (acetaminophen, caffeine, cotinine, 1,7-dimethylxanthine, fluoxetine, and ibuprofen). Acetaminophen, caffeine, and cotinine detections confirm prior indications of pharmaceutical and nicotinate disposal in the landfill.
Duwelius, Richard F.; Yeskis, Douglas J.; Wilson, John T.; Robinson, Bret A.
2002-01-01
Geohydrologic and water-quality data collected during 1997 through 2000 in the vicinity of a former waste-oil refinery near Westville, Indiana, define a plume of 1,4-dioxane in ground water that extends to the southwest approximately 0.8 miles from the refinery site. Concentrations of 1,4-dioxane in the plume ranged from 3 to 31,000 micrograms per liter. Ground water containing 1,4-dioxane is discharged to Crumpacker Ditch, approximately one-half mile west of the refinery site. Concentrations of 1,4-dioxane detected in surface water ranged from 8 to 140 micrograms per liter; 1,4-dioxane also is transported in ground water beneath the ditch.
Program Contacts for Northwest Indiana Area (Indiana)
Northwest Indiana Area (Indiana) of the Urban Waters Federal Partnership (UWFP) reconnects urban communities with their waterways by improving coordination among federal agencies and collaborating with community-led efforts.
Buszka, Paul M.; Watson, Lee R.; Greeman, Theodore K.
2007-01-01
Assessments of the vulnerability to contamination of ground-water sources used by public-water systems, as mandated by the Federal Safe Drinking Water Act Amendments of 1996, commonly have involved qualitative evaluations based on existing information on the geologic and hydrologic setting. The U.S. Geological Survey National Water-Quality Assessment Program has identified ground-water-age dating; detailed water-quality analyses of nitrate, pesticides, trace elements, and wastewater-related organic compounds; and assessed natural processes that affect those constituents as potential, unique improvements to existing methods of qualitative vulnerability assessment. To evaluate the improvement from use of these methods, in 2002 and 2003, the U.S. Geological Survey, in cooperation with the City of Richmond, Indiana, compiled and interpreted hydrogeologic data and chemical analyses of water samples from seven wells in a part of the Whitewater Valley aquifer system in a former glacial valley near Richmond. This study investigated the application of ground-water-age dating, dissolved-gas analyses, and detailed water-quality analyses to quantitatively evaluate the vulnerability of ground water to contamination and to identify processes that affect the vulnerability to specific contaminants in an area of post-1972 greenfield development.
Koltunud Indiana Jones / Kutt Kommel
Kommel, Kutt
2008-01-01
Steven Spielbergi neljas Indiana Jones'i film Harrison Fordiga nimiosas "Indiana Jones ja kristallpealuu kuningriik" ("Indiana Jones and the Kingdom of the Crystal Skull") : Ameerika Ühendriigid 2008
Indiana Dzhons vozvrashtshajetsja / Melor Sturua
Sturua, Melor
2008-01-01
22 mail esilinastub Steven Spielbergi järjekordne Indiana Jones'i film, kaasstsenaristiks ja produtsendiks George Lucas ja Harrison Fordiga nimiosas "Indiana Jones ja kristallpealuu kuningriik" ("Indiana Jones and the Kingdom of the Crystal Skull")
Indiana Health Information Exchange
The Indiana Health Information Exchange is comprised of various Indiana health care institutions, established to help improve patient safety and is recognized as a best practice for health information exchange.
International Nuclear Information System (INIS)
Martin, J.D.; Duwelius, R.F.; Crawford, C.G.
1990-01-01
Coal has been and will continue to be a major source of energy in the United States for the foreseeable future. Surface mining is presently the most efficient method of extracting coal. The mining practice, however, usually has a detrimental effect on the environment by altering topography and ecologic systems. Surface coal mining also can degrade surface- and ground-water quality and quantity. The U.S. Geological Survey began a study in 1979 to identify changes in the quantity of surface- and ground-water resources caused by surface coal mining in Indiana. As part of the study, six small watersheds in west-central Indiana were instrumented for the collection of hydrologic and meteorologic data. The Water-Supply Paper comprises two reports resulting from the investigation. The physical environment and coal mining history of west-central Indiana and the six small watersheds selected for intensive study are described in chapter A. The surface- and ground-water systems of each of the small watersheds and the hydrologic effects of coal mining and reclamation are described in chapter B
A survey of bees (hymenoptera: Apoidea) of the Indiana dunes and Northwest Indiana, USA
Grundel, R.; Jean, R.P.; Frohnapple, K.J.; Gibbs, J.; Glowacki, G.A.; Pavlovic, N.B.
2011-01-01
The Indiana Dunes, and nearby natural areas in northwest Indiana, are floristically rich Midwest U.S. locales with many habitat types. We surveyed bees along a habitat gradient ranging from grasslands to forests in these locales, collecting at least 175 bee species along this gradient plus 29 additional species in other nearby habitats. About 25% of all species were from the genus Lasioglossum and 12% of the species were associated with sandy soils. Several bumblebee (Bombus) species of conservation concern that should occur in this region were not collected during our surveys. Similarity of the northwest Indiana bee fauna to other published U.S. faunas decreased about 1.3% per 100 km distance from northwest Indiana. Thirty percent of bees netted from flowers were males. Males and females differed significantly in their frequency of occurrence on different plant species. For bees collected in bowl traps, the percentage captured in fluorescent yellow traps declined and in fluorescent blue traps increased from spring to late summer. Capture rates for different bee genera varied temporally, with about a quarter of the genera being captured most frequently in late spring and a quarter in late summer. Capture rates for most genera were higher in more open than in more closed canopy habitats. The maximum number of plant species on which a single bee species was captured plateaued at 24, on average. Forty-nine percent of bee species known to occur in Indiana were found at these northwest Indiana sites. Having this relatively high proportion of the total Indiana bee fauna is consistent with Indiana Dunes existing at a biogeographic crossroads where grassland and forest biomes meet in a landscape whose climate and soils are affected by proximity to Lake Michigan. The resulting habitat, plant, edaphic, and climatic diversity likely produces the diverse bee community documented.
International Nuclear Information System (INIS)
Sargent, K.A.; Cook, J.R.; Fay, W.M.
1982-02-01
This report presents the results of ground water, stream water, and stream sediment reconnaissance in Illinois, Indiana, Kentucky, Tennessee, and Ohio. The following sample types were collected in each state: Illinois - 716 stream sediment, 1046 ground water, 337 stream water; Indiana - 126 stream sediment, 443 ground water, 111 stream water; Kentucky - 4901 stream sediment, 6408 ground water, 3966 stream water; Tennessee - 3309 stream sediment, 3574 ground water, 1584 stream water; Ohio - 1214 stream sediment, 2049 ground water, 1205 stream water. Neutron activation analyses are given for U, Br, Cl, F, Mn, Na, Al, V, and Dy in ground water and stream water, and for U, Th, Hf, Ce, Fe, Mn, Na, Sc, Ti, V, Al, Dy, Eu, La, Sm, Yb, and Lu in sediments. Supplementary analyses by other techniques are reported for U (extractable), Ag, As, Ba, Be, Ca, Co, Cr, Cu, K, Li, Mg, Mo, Nb, Ni, P, Pb, Se, Sn, Sr, W, Y, and Zn. These analyses were made on 248 sediment samples from Tennessee. Field measurements and observations are reported for each site. Oak Ridge National Laboratory analyzed sediment samples which were not analyzed by Savannah River Laboratory neutron activation
Indiana protiv KGB / Anna Fedina, Pjotr Obraztsov
Fedina, Anna
2008-01-01
Steven Spielbergi neljas Indiana Jones'i film Harrison Fordiga nimiosas "Indiana Jones ja kristallpealuu kuningriik" ("Indiana Jones and the Kingdom of the Crystal Skull") : Ameerika Ühendriigid 2008
Indiana Jones ja kristallpealuu kuningriik / Jaanus Noormets
Noormets, Jaanus
2008-01-01
Steven Spielbergi neljas Indiana Jones'i film Harrison Fordiga nimiosas "Indiana Jones ja kristallpealuu kuningriik" ("Indiana Jones and the Kingdom of the Crystal Skull") : Ameerika Ühendriigid 2008
"Salatoimikud" Indiana Jonesi moodi / Inna-Katrin Hein
Hein, Inna-Katrin
2008-01-01
Steven Spielbergi neljas Indiana Jones'i film Harrison Fordiga nimiosas "Indiana Jones ja kristallpealuu kuningriik" ("Indiana Jones and the Kingdom of the Crystal Skull") : Ameerika Ühendriigid 2008
Examining Adult Basic Education in Indiana
Hawkins, Alishea
2017-01-01
While it is known that over 500,000 individuals in the State of Indiana have not obtained a High School Diploma or Equivalency (StatsIndiana, 2015), limited empirical information exists on Indiana students pursuing adult basic education along with implications for a state that has changed its adult basic education high stakes high school…
Clean coal initiatives in Indiana
Bowen, B.H.; Irwin, M.W.; Sparrow, F.T.; Mastalerz, Maria; Yu, Z.; Kramer, R.A.
2007-01-01
Purpose - Indiana is listed among the top ten coal states in the USA and annually mines about 35 million short tons (million tons) of coal from the vast reserves of the US Midwest Illinois Coal Basin. The implementation and commercialization of clean coal technologies is important to the economy of the state and has a significant role in the state's energy plan for increasing the use of the state's natural resources. Coal is a substantial Indiana energy resource and also has stable and relatively low costs, compared with the increasing costs of other major fuels. This indigenous energy source enables the promotion of energy independence. The purpose of this paper is to outline the significance of clean coal projects for achieving this objective. Design/methodology/approach - The paper outlines the clean coal initiatives being taken in Indiana and the research carried out at the Indiana Center for Coal Technology Research. Findings - Clean coal power generation and coal for transportation fuels (coal-to-liquids - CTL) are two major topics being investigated in Indiana. Coking coal, data compilation of the bituminous coal qualities within the Indiana coal beds, reducing dependence on coal imports, and provision of an emissions free environment are important topics to state legislators. Originality/value - Lessons learnt from these projects will be of value to other states and countries.
Arihood, Leslie D.; Cohen, David A.
2006-01-01
The Safe Water Drinking Act of 1974 as amended in 1996 gave each State the responsibility of developing a Source-Water Assessment Plan (SWAP) that is designed to protect public-water supplies from contamination. Each SWAP must include three elements: (1) a delineation of the source-water protection area, (2) an inventory of potential sources of contaminants within the area, and (3) a determination of the susceptibility of the public-water supply to contamination from the inventoried sources. The Indiana Department of Environmental Management (IDEM) was responsible for preparing a SWAP for all public-water supplies in Indiana, including about 2,400 small public ground-water supplies that are designated transient, non-community (TNC) supplies. In cooperation with IDEM, the U.S. Geological Survey compiled information on conditions near the TNC supplies and helped IDEM complete source-water assessments for each TNC supply. The delineation of a source-water protection area (called the assessment area) for each TNC ground-water supply was defined by IDEM as a circular area enclosed by a 300-foot radius centered at the TNC supply well. Contaminants of concern (COCs) were defined by IDEM as any of the 90 contaminants for which the U.S. Environmental Protection Agency has established primary drinking-water standards. Two of these, nitrate as nitrogen and total coliform bacteria, are Indiana State-regulated contaminants for TNC water supplies. IDEM representatives identified potential point and nonpoint sources of COCs within the assessment area, and computer database retrievals were used to identify potential point sources of COCs in the area outside the assessment area. Two types of methods-subjective and subjective hybrid-were used in the SWAP to determine susceptibility to contamination. Subjective methods involve decisions based upon professional judgment, prior experience, and (or) the application of a fundamental understanding of processes without the collection and
Indiana Department of Education, 2015
2015-01-01
The "Foundations" (English/language arts, mathematics, social emotional skills, approaches to play and learning, science, social studies, creative arts, and physical health and growth) are Indiana's early learning development framework and are aligned to the 2014 Indiana Academic Standards. This framework provides core elements that…
78 FR 65590 - Approval and Promulgation of Air Quality Implementation Plans; Indiana; Indiana PM2.5
2013-11-01
... Indiana's state implementation plan as requested by the Indiana Department of Environmental Management....5 ) by establishing definitions related to PM 2.5 , defining PM 2.5 increment levels, and setting PM... changes define ``direct PM 2.5 ,'' addresses precursors to ozone and PM 2.5 , and revises existing...
Exploring Indiana's Private Education Sector. School Survey Series
Catt, Andrew D.
2014-01-01
Indiana is at the national forefront on private school choice. With the broadest eligibility guidelines among the country's 22 other school voucher programs, Indiana's Choice Scholarship Program has seen enrollment more than double each year since being enacted in 2011. Today, when compared with voucher programs in 12 other states, Indiana has the…
76 FR 40649 - Indiana Regulatory Program
2011-07-11
... improve operational efficiency. This document provides the times and locations that the Indiana program... hours at the following location: Division of Reclamation, Indiana Department of Natural Resources, R.R... read at the locations listed above under ADDRESSES or at http://www.regulations.gov . A. 312 IAC 25-1...
Fuel alcohol opportunities for Indiana
Energy Technology Data Exchange (ETDEWEB)
Greenglass, Bert
1980-08-01
Prepared at the request of US Senator Birch Bayh, Chairman of the National Alcohol Fuels Commission, this study may be best utilized as a guidebook and resource manual to foster the development of a statewide fuel alcohol plan. It examines sectors in Indiana which will impact or be impacted upon by the fuel alcohol industry. The study describes fuel alcohol technologies that could be pertinent to Indiana and also looks closely at how such a fuel alcohol industry may affect the economic and policy development of the State. Finally, the study presents options for Indiana, taking into account the national context of the developing fuel alcohol industry which, unlike many others, will be highly decentralized and more under the control of the lifeblood of our society - the agricultural community.
40 CFR 81.216 - Northeast Indiana Intrastate Air Quality Control Region.
2010-07-01
... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Northeast Indiana Intrastate Air... Air Quality Control Regions § 81.216 Northeast Indiana Intrastate Air Quality Control Region. The Northeast Indiana Intrastate Air Quality Control Region (Indiana) consists of the territorial area...
Forests of Indiana: Their Economic Importance
Stephen Bratkovich; Joey Gallion; Earl Leatherberry; William Hoover; William Reading; Glenn Durham
2007-01-01
Mental images of Indiana often range from corn, soybeans, and hogs, to high school basketball. The average Hoosier has little knowledge, however, of the scope, productivity, and economic impact of Indiana's forestland. The State's best-kept secret is that its beautiful forests that draw many visitors are also economically vital to the State's economy....
Vermont Center for Geographic Information — This dataset includes towns that contain documented hibernacula or summer range occupied by federally endangered Indiana bats. Survey data used to create this...
Alternative Fuels Data Center: Indiana Transportation Data for Alternative
(nameplate, MW) 1,430 Source: BioFuels Atlas from the National Renewable Energy Laboratory Case Studies Video Alternative Fuels Save Money in Indy April 1, 2012 More Case Studies Videos Text Version More Indiana Videos on YouTube Video thumbnail for Indiana Beverage Company Invests in Alternative Fuels Indiana Beverage
Spencer, Frank Darwyn
1953-01-01
The Indiana coal field forms the eastern edge of the eastern interior coal basin, which is near some of the most densely populated and highly productive manufacturing areas of the United States. (See fig. 1. ) For this reason Indiana coal reserves are an important State and National asset. In dollar value the coal mining industry is the largest of Indiana's natural-resource-producing industries. The total value of coil production for the year 1950 was more than 100 million dollars, or more than that of all other natural-resource industries in the State combined. As estimated herein, the original coal reserves of Indiana total 37,293 million tons, of which 27,320 million tons is contained in beds more than 42 inches thick; 7,632 million tons in beds 28 to 49. inches thick; and 2,341 million tons in beds 14 to 28 inches thick. The remaining reserves as of January 1951, total 35,806 million tons, of which 18,779 million tons is believed to be recoverable. The distribution of the reserves in these several categories is summarized by counties in table 1. Of the total original reserves of 37,293 million tons, 6,355 million tons can be classified as measured; 8,657 million tons as indicated; and 22,281 million tons as inferred. Strippable reserves constitute 3,524 million tons, or 9.5 percent of the total original reserves. The distribution of the strippable and nonstrippable original reserves is summarized in tables 2 and 3 by counties and by several categories, according to the thickness of the beds and the relative abundance and reliability of the information available for preparing the estimates. The distribution of the estimated 18,779 million tons of recoverable strippable and nonstrippable reserves in Indiana is further summarized by counties in table 4, and the information is presented graphically in figures 2 and 3. The tables i to 4 and figures 2 and 3 include beds in the 14- to 28-inch category, because thin beds have been mined in many places. However, many
Compromised Futures: Indiana's Children in Poverty. Occasional Paper No. 2.
Erickson, Judith B.
The number of poor children in the United States is high, and estimates suggest that poverty among Indiana's children is increasing at twice the national rate. Presently, Indiana does not have readily available, comprehensive information about the state's children and adolescents. There are few ways to link Indiana's poverty data to other…
Center for Applied Optics Studies: an investment in Indiana's future
Schuh, Delbert J., II; Khorana, Brij M.
1992-05-01
To understand the involvement of the State of Indiana with the Center for Applied Optics at Rose-Hulman Institute of Technology, it is best to start with an explanation of the Indiana Corporation for Science and Technology (CST), its basic charter and its programs. Established in 1982 as a private not-for-profit corporation, CST was formed to promote economic development within the State of Indiana. Two programs that were initially a part of CST's charter and supported with state dollars were a seed capital investment program, aimed at developing new products and processes, and the establishment of university centers of technology development. The former was conceived to create jobs and new, technologically advanced industries in Indiana. The latter was an attempt to encourage technology transfer from the research laboratories of the state universities to the production lines of Indiana industry. Recently, CST has undergone a name change to the Indiana Business Modernization and Technology Corporation (BMT) and adopted an added responsibility of proactive assistance to small- and medium-sized businesses in order to enhance the state's industrial competitiveness.
Sources of the Indiana hardwood industry's competitiveness
Silas Tora; Eva Haviarova
2008-01-01
The estimated 1,600 forest products-related firms in Indiana employ more than 56,000 workers. Hardwood manufacturers are the largest segment, adding approximately $2 billion per year of raw product value. A recent report by BioCrossroads ranked the hardwood industry as the most important in the agricultural sector in Indiana. Like most of the other forest products...
NSGIC State | GIS Inventory — INSTITUTIONAL_CONTROLS_IDEM_IN is a polygon shapefile that contains Institutional Control (IC) site locations in Indiana, provided by personnel of Indiana Department...
Väike psühhoanalüüs Indiana Jonesile / Aarne Ruben
Ruben, Aarne, 1971-
2008-01-01
Steven Spielbergi neljas Indiana Jones'i film Harrison Fordiga nimiosas "Indiana Jones ja kristallpealuu kuningriik" ("Indiana Jones and the Kingdom of the Crystal Skull") : Ameerika Ühendriigid 2008
The physician assistant workforce in Indiana: preparing to meet future health care needs.
Snyder, Jennifer; Zorn, Jennifer; Gjerde, Tom; Burkhart, Jennifer; Rosebrock, Lori
2011-12-01
This study identifies baseline demographic and descriptive statistics for physician assistants (PAs) in Indiana from 1978 to 2010. Data were obtained from Indiana Professional Licensing Agency applications, the Indiana State Department of Health, and PA educational programs. Descriptive statistics were used to characterize the PA workforce as well as their supervising physicians. Most PAs working in Indiana were born and educated outside the state. Of those educated in Indiana, 77% obtained an initial license in Indiana; as of May 2010, 62% were still licensed in the state. In the past 8 years, Indiana had a 97% increase in active licensed PAs. Only 24% of PAs work in primary care; 92% work in metropolitan areas. For 40 years, PAs have increasingly worked in areas that are medically underserved or experiencing a shortage of health professionals. However, the overall numbers of PAs working in those areas remain low. More PAs in Indiana are practicing in medical specialties than in primary care. As health care policy and regulatory changes evolve, future studies will be needed to understand the impact on the health care workforce of Indiana PAs. This study will serve as a baseline for those studies.
NSGIC State | GIS Inventory — COUNTY_STREET_CENTERLINES_IDHS_IN is a line feature class that contains street centerlines maintained by county agencies in Indiana, provided by personnel of Indiana...
Chicago, Indiana set for "world's largest scientific experiment"
2007-01-01
"The mission of The Hoosier Coefficient, which appears on MidestBusiness.com eveery Thursday, is to profile the often-overlooked rich technology development and commercialization in Indiana. The Hoosier state is home to four of the top technology research and engineering universities in the nation and tech pros ignore Indiana at their own peril." (1 page)
Transitions in midwestern ground water law
International Nuclear Information System (INIS)
Bowman, J.A.; Clark, G.R.
1989-01-01
The evolution of ground-water law in eight states in the Midwest (Illinois, Indiana, Iowa, Michigan, Minnesota, Missouri, Ohio, and Wisconsin) is examined, and a review of transitions in ground-water doctrines is presented. Two underlying themes in changing ground-water management are communicated. First, ground-water law is evolving from private property rules of capture based on the absolute ownership doctrines to rules requiring conservation and sharing of ground water as a public resource. Second, in both courts and state legislatures, a proactive role of ground-water management is emerging, again, with an emphasis on sharing. Both of these trends are apparent in the Midwest. In the last decade midwestern states have (1) seen significant shifts in court decisions on ground-water use with greater recognition of the reciprocal or mutually dependent nature of ground-water rights, and (2) seen increased legislative development of comprehensive ground-water management statutes that emphasize the reciprocal liabilities of ground-water use. These trends are examined and ground-water management programs discussed for eight states in the Midwest
Barger, Harry D.; And Others
Unit 3 of a six-unit series on Indiana state history designed to be taught in Indiana secondary schools tells the story of Indiana from 1829 to 1908. Chapter 1 discusses national issues in an Indiana context. The effects of social movements such as Abolition, the underground railroad, and the Fugitive Slave Law on Indiana politics are examined.…
Peters, J.G.
1987-01-01
The Indiana Department of Natural Resources (IDNR) is developing water-management policies designed to assess the effects of irrigation and other water uses on water supply in the basin. In support of this effort, the USGS, in cooperation with IDNR, began a study to evaluate appropriate methods for analyzing the effects of pumping on ground-water levels and streamflow in the basin 's glacial aquifer systems. Four analytical models describe drawdown for a nonleaky, confined aquifer and fully penetrating well; a leaky, confined aquifer and fully penetrating well; a leaky, confined aquifer and partially penetrating well; and an unconfined aquifer and partially penetrating well. Analytical equations, simplifying assumptions, and methods of application are described for each model. In addition to these four models, several other analytical models were used to predict the effects of ground-water pumping on water levels in the aquifer and on streamflow in local areas with up to two pumping wells. Analytical models for a variety of other hydrogeologic conditions are cited. A digital ground-water flow model was used to describe how a numerical model can be applied to a glacial aquifer system. The numerical model was used to predict the effects of six pumping plans in 46.5 sq mi area with as many as 150 wells. Water budgets for the six pumping plans were used to estimate the effect of pumping on streamflow reduction. Results of the analytical and numerical models indicate that, in general, the glacial aquifers in the basin are highly permeable. Radial hydraulic conductivity calculated by the analytical models ranged from 280 to 600 ft/day, compared to 210 and 360 ft/day used in the numerical model. Maximum seasonal pumping for irrigation produced maximum calculated drawdown of only one-fourth of available drawdown and reduced streamflow by as much as 21%. Analytical models are useful in estimating aquifer properties and predicting local effects of pumping in areas with
INDIANA: Beam dynamics experiments
International Nuclear Information System (INIS)
Anon.
1992-01-01
Beam dynamics experiments at the Indiana University Cooler Facility (IUCF) are helping to trace complicated non-linear effects in proton machines and could go on to pay important dividends in the detailed design of big new high energy proton storage rings
Indiana Underground Railroad Folklore: Western Route and Daviess County.
Shelton, Lois G.
Materials for teaching a unit about the Underground Railroad (the system set up to assist fleeing, runaway slaves heading north) in Indiana are presented. Specifically, the Western Route that passed through Daviess County in Indiana is examined. The materials provide background on the Underground Railroad and the Western Route, plans for teaching…
Economic Impacts from Indiana's First 1,000 Megawatts of Wind Power
Energy Technology Data Exchange (ETDEWEB)
Tegen, S.; Keyser, D.; Flores-Espino, F.; Hauser, R.
2014-08-01
The magnitude of Indiana's available wind resource indicates that the development of wind power infrastructure has the potential to support millions of dollars of economic activity in the state. The Jobs and Economic Development Impact (JEDI) models, developed by the National Renewable Energy Laboratory, are tools used to estimate some of the economic impacts of energy projects at the state level. JEDI calculates results in the form of jobs, earnings, and economic output in three categories: project development and onsite labor, local revenue and supply chain, and induced impacts. According to this analysis, the first 1,000 MW of wind power development in Indiana (projects built between 2008 and 2011): supported employment totaling more than 4,400 full-time-equivalent jobs in Indiana during the construction periods; supports approximately 260 ongoing Indiana jobs; supported nearly $570 million in economic activity for Indiana during the construction periods; supported and continues to support nearly $40 million in annual Indiana economic activity during the operating periods; generates more than $8 million in annual property taxes; generates nearly $4 million annually in income for Indiana landowners who lease their land for wind energy projects.
Resource selection by Indiana bats during the maternity season
Kathryn M. Womack; Sybill K. Amelon; Frank R. Thompson
2013-01-01
Little information exists on resource selection by foraging Indiana bats (Myotis sodalis) during the maternity season. Existing studies are based on modest sample sizes because of the rarity of this endangered species and the difficulty of radio-tracking bats. Our objectives were to determine resource selection by foraging Indiana bats during the maternity season and...
Indiana State Briefing Book for low-level radioactive-waste management
International Nuclear Information System (INIS)
Mitter, E.L.; Hume, R.D.; Briggs, H.R.; Feigenbaum, E.D.
1981-01-01
The Indiana State Briefing Book is one of a series of state briefing books on low-level radioactive waste management practices. It has been prepared to assist state and federal agency officials in planning for safe low-level radioactive waste disposal. The report contains a profile of low-level radioactive waste generators in Indiana. The profile is the result of a survey of NRC licensees in Indiana. The briefing book also contains a comprehensive assessment of low-level radioactive waste management issues and concerns as defined by all major interested parties including industry, government, the media, and interest groups. The assessment was developed through personal communications with representatives of interested parties, and through a review of media sources. Lastly, the briefing book provides demographic and socioeconomic data and a discussion of relevant government agencies and activities, all of which may impact waste management practices in Indiana
Indiana Education: English Learner Instruction at the Primary Level
Sullivan, Michael D.
2013-01-01
The number of students enrolled in United States public schools speaking a language other than English in their homes doubled over the last decade. In Indiana more than 60% of all public school districts reported having at least one English Learner student enrolled. It is projected that Indiana EL enrollment will increase 21% by the year 2021…
Geophysical investigations of the Western Ohio-Indiana region
International Nuclear Information System (INIS)
Ruff, L.; LaForge, R.; Thorson, R.; Wagner, T.; Goudaen, F.
1994-01-01
Earthquake activity in the Western Ohio-Indiana region has been monitored with a seismograph network consisting of nine stations located in west-central Ohio and four stations located in Indiana. Six local and regional earthquakes have been recorded from October 1990 to September 1992 with magnitudes ranging from 0.6 to 5.0. A total of 36 local and regional earthquakes have been recorded in the past 6-year period (October 1986 to September 1992). Overall a total of 78 local and regional earthquakes have been recorded since the network went into operation in 1977. There was a peak in seismicity in 1986, including the July 12, 1986 St. Marys' event (mb=4.5), followed by an anomalously low level of seismicity for about 2 years. The most unusual feature of the seismicity in the past.year is the occurrence of three earthquakes in Indiana. The locations of the felt earthquakes are scattered across central Indiana; an area that had been aseismic. Analysis of arrival time data accumulated over the past 14 years shows that the Anna region crustal structure is ''slower'' than the average mid-continent crustal structure. This implies that the proposed Keewenawan rift in the Anna region has a different structure than that of other Keewenawan rifts in the mid-continent
Regional bankfull-channel dimensions of non-urban wadeable streams in Indiana
Robinson, Bret A.
2013-01-01
During floods, damage to properties and community infrastructure may result from inundation and the processes of erosion. The damages imparted by erosion are collectively termed the fluvial erosion hazard (FEH), and the Indiana Silver Jackets Multi-agency Hazard Mitigation Taskforce is supporting a program to build tools that will assist Indiana property owners and communities with FEH-mitigation efforts. As part of that program, regional channel-dimension relations are identified for non-urban wadeable streams in Indiana. With a site-selection process that targeted the three largest physiographic regions of the state, field work was completed to measure channel-dimension and channel-geometry characteristics across Indiana. In total, 82 sites were identified for data collection; 25 in the Northern Moraine and Lake region, 31 in the Central Till Plain region, and 26 in the Southern Hills and Lowlands region. Following well established methods, for each data-collection site, effort was applied to identify bankfull stage, determine bankfull-channel dimensions, and document channel-geometry characteristics that allowed for determinations of channel classification. In this report, regional bankfull-channel dimension results are presented as a combination of plots and regression equations that identify the relations between drainage area and the bankfull-channel dimensions of width, mean depth, and cross-sectional area. This investigation found that the channel-dimension data support independent relations for each of the three physiographic regions noted above. Furthermore, these relations show that, for any given drainage area, northern Indiana channels have the smallest predicted dimensions, southern Indiana channels have the largest predicted dimensions, and central Indiana channels are intermediate in their predicted dimensions. When considering the suite of variables that influence bankfull-channel dimensions, it appears that contrasting runoff characteristics
Christopher W. Woodall; Mark N. Webb; Barry T. Wilson; Jeff Settle; Ron J. Piva; Charles H. Perry; Dacia M. Meneguzzo; Susan J. Crocker; Brett J. Butler; Mark Hansen; Mark Hatfield; Gary Brand; Charles. Barnett
2011-01-01
The second full annual inventory of Indiana's forests reports more than 4.75 million acres of forest land with an average volume of more than 2,000 cubic feet per acre. Forest land is dominated by the white oak/red oak/hickory forest type, which occupies nearly a third of the total forest land area. Seventy-six percent of forest land consists of sawtimber, 16...
Indiana Jones on tagasi ja näitab, kuidas käituda / Kristiina Davidjants
Davidjants, Kristiina, 1974-
2008-01-01
22 mail esilinastub Steven Spielbergi järjekordne Indiana Jones'i film, kaasstsenaristiks ja produtsendiks George Lucas ja Harrison Fordiga nimiosas "Indiana Jones ja kristallpealuu kuningriik" ("Indiana Jones and the Kingdom of the Crystal Skull"). Saaga varasemast kolmest filmist
Residential Energy Efficiency Potential: Indiana
Energy Technology Data Exchange (ETDEWEB)
Wilson, Eric J [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2017-11-02
Energy used by Indiana single-family homes that can be saved through cost-effective improvements. Prepared by Eric Wilson and Noel Merket, NREL, and Erin Boyd, U.S. Department of Energy Office of Energy Policy and Systems Analysis.
2013-02-08
...-FF03E00000] Endangered and Threatened Wildlife and Plants; Draft Revised Indiana Bat Summer Survey Guidelines... documents related to the draft revised summer survey guidelines for the Indiana bat (Myotis sodalis) for an... U.S. mail address; Email: indiana_bat@fws.gov ; or Fax: 812-334-4273. Include ``Indiana Bat Summer...
NSGIC State | GIS Inventory — From 1985 to 1994, a series of reports on coal resources of selected counties in Indiana was published as part of the Special Report series of the Indiana Geological...
NSGIC State | GIS Inventory — From 1985 to 1994, a series of reports on coal resources of selected counties in Indiana was published as part of the Special Report series of the Indiana Geological...
NSGIC State | GIS Inventory — From 1985 to 1994, a series of reports on coal resources of selected counties in Indiana was published as part of the Special Report series of the Indiana Geological...
NSGIC State | GIS Inventory — From 1988 to 1994, a series of reports on coal resources of selected counties in Indiana was published as part of the Special Report series of the Indiana Geological...
76 FR 43372 - Notice of Final Federal Agency Actions on Proposed Highway in Indiana
2011-07-20
... RPBO primarily based on the discovery of the disease White Nose Syndrome in the State of Indiana, including the action area (which is within the Indiana bat Midwest Recovery Unit). Additionally, one new... continued existence of the Indiana bat and was not likely to adversely modify the bat's designated Critical...
Probabilistic seismic hazard estimates incorporating site effects - An example from Indiana, U.S.A
Hasse, J.S.; Park, C.H.; Nowack, R.L.; Hill, J.R.
2010-01-01
The U.S. Geological Survey (USGS) has published probabilistic earthquake hazard maps for the United States based on current knowledge of past earthquake activity and geological constraints on earthquake potential. These maps for the central and eastern United States assume standard site conditions with Swave velocities of 760 m/s in the top 30 m. For urban and infrastructure planning and long-term budgeting, the public is interested in similar probabilistic seismic hazard maps that take into account near-surface geological materials. We have implemented a probabilistic method for incorporating site effects into the USGS seismic hazard analysis that takes into account the first-order effects of the surface geologic conditions. The thicknesses of sediments, which play a large role in amplification, were derived from a P-wave refraction database with over 13, 000 profiles, and a preliminary geology-based velocity model was constructed from available information on S-wave velocities. An interesting feature of the preliminary hazard maps incorporating site effects is the approximate factor of two increases in the 1-Hz spectral acceleration with 2 percent probability of exceedance in 50 years for parts of the greater Indianapolis metropolitan region and surrounding parts of central Indiana. This effect is primarily due to the relatively thick sequence of sediments infilling ancient bedrock topography that has been deposited since the Pleistocene Epoch. As expected, the Late Pleistocene and Holocene depositional systems of the Wabash and Ohio Rivers produce additional amplification in the southwestern part of Indiana. Ground motions decrease, as would be expected, toward the bedrock units in south-central Indiana, where motions are significantly lower than the values on the USGS maps.
NSGIC State | GIS Inventory — LANDFILL_BOUNDARIES_IDEM_IN.SHP is a polygon shapefile that contains boundaries for open dump sites, approved landfills, and permitted landfills in Indiana, provided...
Libraries in Indiana: MedlinePlus
... 3600 http://www.ecommunity.com/library Indiana University School of Dentistry Library 1121 West Michigan St. Indianapolis, IN 46202-5186 ... 502-4010 http://www.franciscanhealth.org St Elizabeth School of Nursing Sister Florianne Library 1501 Hartford Street Lafayette, IN 47904 765-423- ...
A Peek Into the Classrooms of Indiana's Best-Performing Charter Schools
Quick, Marilynn; Conrad, Amy L.
2013-01-01
This study focused on how successful Indiana charter schools implemented their planned goals and how their instructional strategies supported sound, research-based practices for improving student achievement. After identifying the three charter schools that consistently earned Indiana's academic designation of "exemplary progress" over a…
NSGIC State | GIS Inventory — This GIS layer shows the locations of ethanol production facilities in the state of Indiana. Attributes include the name and address of the facility, and information...
NSGIC State | GIS Inventory — HYDROGEOL_SETTINGS_IN is a polygon shapefile that shows hydrogeologic terrains and settings of Indiana. The methodology of the investigation and definitions of terms...
NSGIC State | GIS Inventory — From 1985 to 1994, a series of reports on coal resources of selected counties in Indiana was published as part of the Special Report series of the Indiana Geological...
Tael, Triin
2008-01-01
Steven Spielbergi neljas Indiana Jones'i film Harrison Fordiga nimiosas "Indiana Jones ja kristallpealuu kuningriik" ("Indiana Jones and the Kingdom of the Crystal Skull") : Ameerika Ühendriigid 2008. Indiana Jonesi tähestik
Cost-Effectiveness Analysis of the Residential Provisions of the 2015 IECC for Indiana
Energy Technology Data Exchange (ETDEWEB)
Mendon, Vrushali V.; Zhao, Mingjie; Taylor, Zachary T.; Poehlman, Eric A.
2016-02-15
The 2015 IECC provides cost-effective savings for residential buildings in Indiana. Moving to the 2015 IECC from the 2009 IECC base code is cost-effective for residential buildings in all climate zones in Indiana.
NSGIC State | GIS Inventory — Bedrock topography was converted from the original published map, Indiana Geological Survey Miscellaneous Map 36. The contours define the elevation/topography of the...
2013-05-15
...: FRL-9812-4] Approval and Promulgation of Air Quality Implementation Plans; Indiana; Lake and Porter...). ACTION: Direct final rule. SUMMARY: EPA is approving Indiana's request to revise the Lake and Porter... approving new MOVES2010a-based budgets for the Lake and Porter County, Indiana 1997 8-hour ozone maintenance...
2011-2013 Indiana Statewide Imagery and LiDAR Program: Lake Michigan Watershed Counties
National Oceanic and Atmospheric Administration, Department of Commerce — Indiana's Statewide LiDAR data is produced at 1.5-meter average post spacing for all 92 Indiana Counties covering more than 36,420 square miles. New LiDAR data was...
Residual CO2 trapping in Indiana limestone.
El-Maghraby, Rehab M; Blunt, Martin J
2013-01-02
We performed core flooding experiments on Indiana limestone using the porous plate method to measure the amount of trapped CO(2) at a temperature of 50 °C and two pressures: 4.2 and 9 MPa. Brine was mixed with CO(2) for equilibration, then the mixture was circulated through a sacrificial core. Porosity and permeability tests conducted before and after 884 h of continuous core flooding confirmed negligible dissolution. A trapping curve for supercritical (sc)CO(2) in Indiana showing the relationship between the initial and residual CO(2) saturations was measured and compared with that of gaseous CO(2). The results were also compared with scCO(2) trapping in Berea sandstone at the same conditions. A scCO(2) residual trapping end point of 23.7% was observed, indicating slightly less trapping of scCO(2) in Indiana carbonates than in Berea sandstone. There is less trapping for gaseous CO(2) (end point of 18.8%). The system appears to be more water-wet under scCO(2) conditions, which is different from the trend observed in Berea; we hypothesize that this is due to the greater concentration of Ca(2+) in brine at higher pressure. Our work indicates that capillary trapping could contribute to the immobilization of CO(2) in carbonate aquifers.
Penalizing recidivist drunk drivers in Indiana: impediments to implementation.
Foley, J P; Fricker, J D
1987-12-01
In 1983, Indiana enacted a law mandating that anyone convicted a second or subsequent time of Operating While Intoxicated (OWI) receive a minimum of 48 consecutive hours in jail or 10 days of community service. A representative random sample of Indiana counties was used to determine the extent of implementation of this law by the courts in 1984 and 1985. Analysis of the 1984 data concluded that nearly 70% of the cases did comply with the law in its first year of implementation. However, 13.8% of the recidivists received neither jail nor community service. Another 17.6% served some jail time and/or community service, but not of a sufficient length to comply with the law. Overall compliance increased to 75% in 1985, while the proportion who received neither jail nor community service increased to 17%. Several specific causes for noncompliance are identified and recommendations for their correction are offered. It is felt that the Indiana experience described in this paper will prove instructive to other states with newly-strengthened OWI laws.
2012-01-23
... Temporary Closure of the I-64 Sherman-Minton Bridge Over the Ohio River Between Indiana and Kentucky AGENCY... temporary closure of the I-64 Sherman-Minton Bridge over the Ohio River between Indiana and Kentucky for an... Bridge over the Ohio River between Indiana and Kentucky which the Indiana Governor closed on September 9...
78 FR 63093 - Approval and Promulgation of Air Quality Implementation Plans; Indiana
2013-10-23
... section into the Indiana SIP. 326 IAC 3-6-2 Source Sampling Protocols This section requires the owner or... Indiana SIP. 326 IAC 3-7-4 Fuel Oil Sampling; Analysis Methods This section specifies the test protocol... monitoring rules to EPA as a revision to its state implementation plan (SIP). The monitoring rules will be...
Indiana: Siberian Snake saves spin
Energy Technology Data Exchange (ETDEWEB)
Anon.
1990-01-15
A team working at the Indiana University Cooler Ring has used a 'Siberian Snake' system to accelerate a spin-polarized proton beam through two depolarizing resonances with no loss of spin. The Michigan/lndiana/Brookhaven team under Alan Krisch overcame their first imperfection resonance hurdle at 108 MeV, and in a subsequent run vanquished a further resonance at 177 MeV.
Loads of nitrate, phosphorus, and total suspended solids from Indiana watersheds
Bunch, Aubrey R.
2016-01-01
Transport of excess nutrients and total suspended solids (TSS) such as sediment by freshwater systems has led to degradation of aquatic ecosystems around the world. Nutrient and TSS loads from Midwestern states to the Mississippi River are a major contributor to the Gulf of Mexico Hypoxic Zone, an area of very low dissolved oxygen concentration in the Gulf of Mexico. To better understand Indiana’s contribution of nutrients and TSS to the Mississippi River, annual loads of nitrate plus nitrite as nitrogen, total phosphorus, and TSS were calculated for nine selected watersheds in Indiana using the load estimation model, S-LOADEST. Discrete water-quality samples collected monthly by the Indiana Department of Environmental Management’s Fixed Stations Monitoring Program from 2000–2010 and concurrent discharge data from the U. S. Geological Survey streamflow gages were used to create load models. Annual nutrient and TSS loads varied across Indiana by watershed and hydrologic condition. Understanding the loads from large river sites in Indiana is important for assessing contributions of nutrients and TSS to the Mississippi River Basin and in determining the effectiveness of best management practices in the state. Additionally, evaluation of loads from smaller upstream watersheds is important to characterize improvements at the local level and to identify priorities for reduction.
Jarman, Del W.; Boyland, Lori G.
2011-01-01
In recent years, economic downturn and changes to Indiana's school funding have resulted in significant financial reductions in General Fund allocations for many of Indiana's public school corporations. The main purpose of this statewide study is to examine the possible impacts of these budget reductions on class size and student achievement. This…
Floods of June-July 1957 in Indiana
Schoppenhorst, Charles E.
1958-01-01
The floods of June-July 1957 exceeded those previously known on some of the tributaries of the Wabash and White Rivers in central Indiana. Six lives were lost, 1,282 dwellings were damaged, and 125 business places were flooded. Heavy rains of June 27 and 28 resulted from remnants of Hurricane Audrey meeting a front that lay across central Indiana. Heaviest rainfall reported for the storm period at a U.S. Weather Bureau station was 10.15 inches at Rockville. Previous maximum stages during the period of record were exceeded at 12 gaging stations. The peak stage on Raccoon Creek at Mansfield exceeded the previous maximum known stage, which occurred in 1875. One of the notable rates of discharge recorded was 245 cfs per square mile from a drainage area of 440 square miles on Raccoon Creek at Coxville.
Debrewer, Linda M.; Rowe, Gary L.; Reutter, David C.; Moore, Rhett C.; Hambrook, Julie A.; Baker, Nancy T.
2000-01-01
The Great and Little Miami River Basins drain approximately 7,354 square miles in southwestern Ohio and southeastern Indiana and are included in the more than 50 major river basins and aquifer systems selected for water-quality assessment as part of the U.S. Geological Survey's National Water-Quality Assessment Program. Principal streams include the Great and Little Miami Rivers in Ohio and the Whitewater River in Indiana. The Great and Little Miami River Basins are almost entirely within the Till Plains section of the Central Lowland physiographic province and have a humid continental climate, characterized by well-defined summer and winter seasons. With the exception of a few areas near the Ohio River, Pleistocene glacial deposits, which are predominantly till, overlie lower Paleozoic limestone, dolomite, and shale bedrock. The principal aquifer is a complex buried-valley system of sand and gravel aquifers capable of supporting sustained well yields exceeding 1,000 gallons per min-ute. Designated by the U.S. Environmental Protection Agency as a sole-source aquifer, the Buried-Valley Aquifer System is the principal source of drinking water for 1.6 million people in the basins and is the dominant source of water for southwestern Ohio. Water use in the Great and Little Miami River Basins averaged 745 million gallons per day in 1995. Of this amount, 48 percent was supplied by surface water (including the Ohio River) and 52 percent was supplied by ground water. Land-use and waste-management practices influence the quality of water found in streams and aquifers in the Great and Little Miami River Basins. Land use is approximately 79 percent agriculture, 13 percent urban (residential, industrial, and commercial), and 7 percent forest. An estimated 2.8 million people live in the Great and Little Miami River Basins; major urban areas include Cincinnati and Dayton, Ohio. Fertilizers and pesticides associated with agricultural activity, discharges from municipal and
Indiana: Siberian Snake saves spin
International Nuclear Information System (INIS)
Anon.
1990-01-01
A team working at the Indiana University Cooler Ring has used a 'Siberian Snake' system to accelerate a spin-polarized proton beam through two depolarizing resonances with no loss of spin. The Michigan/lndiana/Brookhaven team under Alan Krisch overcame their first imperfection resonance hurdle at 108 MeV, and in a subsequent run vanquished a further resonance at 177 MeV
The High Cost of Failing to Reform Public Education in Indiana. School Choice Issues in the State
Gottlob, Brian J.
2006-01-01
This study documents the public costs of high school dropouts in Indiana, and examines how school choice would provide large public benefits by increasing the graduation rate in Indiana public schools. It calculates the annual cost of high school dropouts in Indiana due to lower state income tax payments, increased reliance on Medicaid, and…
2010-05-26
... hibernation, and possibly pesticides. An additional and emerging threat to Indiana bats is White-Nose Syndrome...] Endangered and Threatened Wildlife and Plants; Indiana Bat; Notice of Intent To Prepare a Draft Environmental... Indiana bat (Myotis sodalis), a Federal endangered species, from activities associated with the...
Summer ecology of Indiana bats in Ohio.
2011-05-01
The Indiana bat (Myotis sodalis) is a tree roosting species found throughout the eastern United States that is federally listed as endangered by the U.S. Fish and Wildlife Service. A more detailed understanding of summer roosting and foraging habitat...
Fire and the endangered Indiana bat
Matthew B. Dickinson; Michael J. Lacki; Daniel R. Cox
2009-01-01
Fire and Indiana bats (Myotis sodalis) have coexisted for millennia in the central hardwoods region, yet past declines in populations of this endangered species, and the imperative of fire use in oak silviculture and ecosystem conservation, call for an analysis of both the risks and opportunities associated with using fires on landscapes in...
Predicting the implementation of environmental education in Indiana K--8 schools
Yang, Li-Ling
The purpose of this study was to identify the factors from the literature that influence teachers' implementation of environmental education (EE), and to predict the implementation of EE in the Indiana K--8 Schools by knowledge of these factors. By adapting two earlier instruments, a complete EE assessment instrument was developed, consisting of scales measuring teachers' implementation of EE, their pre-/in-service environmental training, their attitudes toward and competencies in teaching EE, their perceived barriers in teaching EE, and their significant life experiences related to the environment or EE. A questionnaire was sent to 1,200 randomly selected K--8 teachers in public schools throughout Indiana in April 2003, and 385 completed surveys were returned (32.1% return rate). The demographic characteristics of the respondents and the Indiana teacher population were found to be similar. Thus, the results from this study can be generalized to the Indiana teacher population. The construct validity and reliability of each scale were examined after the completion and return of the questionnaires by using factor analysis, item-test correlation analysis, and ANOVA, and also by assessing their alpha indices. It was found that all nine scales were homogeneous, valid, and reliable. Multiple regression analysis was calculated to predict the level of EE implementation in Indiana K--8 schools. Regression analyses indicated that the extent of the teachers' exposure to EE during their pre- and in-service training, the teachers' attitudes toward and competencies in teaching EE, and the barrier "EE not relevant to what I teach" were significant in the full model. This model accounted for 63% of the variance in the teachers' implementation of EE. The teachers' attitudes toward EE had the greatest effect on the teachers' EE implementation when compared to the other significant predictors in the model. The net effects of the extent of the teachers' pre-service and in
Analyzing the attributes of Indiana's STEM schools
Eltz, Jeremy
"Primary and secondary schools do not seem able to produce enough students with the interest, motivation, knowledge, and skills they will need to compete and prosper in the emerging world" (National Academy of Sciences [NAS], 2007a, p. 94). This quote indicated that there are changing expectations for today's students which have ultimately led to new models of education, such as charters, online and blended programs, career and technical centers, and for the purposes of this research, STEM schools. STEM education as defined in this study is a non-traditional model of teaching and learning intended to "equip them [students] with critical thinking, problem solving, creative and collaborative skills, and ultimately establishes connections between the school, work place, community and the global economy" (Science Foundation Arizona, 2014, p. 1). Focusing on science, technology, engineering, and math (STEM) education is believed by many educational stakeholders to be the solution for the deficits many students hold as they move on to college and careers. The National Governors Association (NGA; 2011) believes that building STEM skills in the nation's students will lead to the ability to compete globally with a new workforce that has the capacity to innovate and will in turn spur economic growth. In order to accomplish the STEM model of education, a group of educators and business leaders from Indiana developed a comprehensive plan for STEM education as an option for schools to use in order to close this gap. This plan has been promoted by the Indiana Department of Education (IDOE, 2014a) with the goal of increasing STEM schools throughout Indiana. To determine what Indiana's elementary STEM schools are doing, this study analyzed two of the elementary schools that were certified STEM by the IDOE. This qualitative case study described the findings and themes from two elementary STEM schools. Specifically, the research looked at the vital components to accomplish STEM
Surficial Geologic Map of the Evansville, Indiana, and Henderson, Kentucky, Area
Moore, David W.; Lundstrom, Scott C.; Counts, Ronald C.; Martin, Steven L.; Andrews, William M.; Newell, Wayne L.; Murphy, Michael L.; Thompson, Mark F.; Taylor, Emily M.; Kvale, Erik P.; Brandt, Theodore R.
2009-01-01
deposits in the quadrangle are probably no older than about 55,000 years. Lithologic logs, shear-wave velocities, and other cone penetrometer data are used to interpret depositional environments and geologic history of the surficial deposits. This map, which includes an area of slightly more than seven 7.5-minute quadrangles, serves several purposes. It is a tool for assessing seismic and flood hazards of a major urban area; aids urban planning; conveys geologic history; and locates aggregate resources. The map was produced concurrently with research by seismologists to determine places where the surficial deposits may tend to liquefy and (or) to amplify ground motions during strong earthquakes. Such hazardous responses to shaking are related to the characteristics of the geologic materials and topographic position, which the geologic map depicts. The geologic map is an element in the cooperative seismic hazard assessment program among the States of Indiana, Kentucky, and Illinois and the U.S. Geological Survey, funded by the National Earthquake Hazards Reduction Program and National Cooperative Geologic Mapping Program of the U.S. Geological Survey.
NSGIC State | GIS Inventory — AQUIFER_SYSTEMS_BEDROCK_IDNR_IN is a polygon shapefile that shows bedrock aquifer systems of the State of Indiana. The source scale of the map depicting the aquifers...
NSGIC State | GIS Inventory — AQUIFER_SYSTEMS_UNCONSOLIDATED_IDNR_IN is a polygon shapefile that shows unconsolidated aquifer systems of the state of Indiana at a scale of 1:48,000. The following...
NSGIC State | GIS Inventory — SILURIAN_REEF_POLYGONS_MM54_IN is a polygon shapefile that shows the general locations of Silurian rock reef bank formations in Indiana. These data include two major...
Large-scale climate variation modifies the winter grouping behavior of endangered Indiana bats
Thogmartin, Wayne E.; McKann, Patrick C.
2014-01-01
Power laws describe the functional relationship between 2 quantities, such as the frequency of a group as the multiplicative power of group size. We examined whether the annual size of well-surveyed wintering populations of endangered Indiana bats (Myotis sodalis) followed a power law, and then leveraged this relationship to predict whether the aggregation of Indiana bats in winter was influenced by global climate processes. We determined that Indiana bat wintering populations were distributed according to a power law (mean scaling coefficient α = −0.44 [95% confidence interval {95% CI} = −0.61, −0.28). The antilog of these annual scaling coefficients ranged between 0.67 and 0.81, coincident with the three-fourths power found in many other biological phenomena. We associated temporal patterns in the annual (1983–2011) scaling coefficient with the North Atlantic Oscillation (NAO) index in August (βNAOAugust = −0.017 [90% CI = −0.032, −0.002]), when Indiana bats are deciding when and where to hibernate. After accounting for the strong effect of philopatry to habitual wintering locations, Indiana bats aggregated in larger wintering populations during periods of severe winter and in smaller populations in milder winters. The association with August values of the NAO indicates that bats anticipate future winter weather conditions when deciding where to roost, a heretofore unrecognized role for prehibernation swarming behavior. Future research is needed to understand whether the three-fourths–scaling patterns we observed are related to scaling in metabolism.
Space-time models for a panzootic in bats, with a focus on the endangered Indiana bat
Thogmartin, Wayne E.; King, R. Andrew; Szymanski, Jennifer A.; Pruitt, Lori
2012-01-01
Knowledge of current trends of quickly spreading infectious wildlife diseases is vital to efficient and effective management. We developed space-time mixed-effects logistic regressions to characterize a disease, white-nose syndrome (WNS), quickly spreading among endangered Indiana bats (Myotis sodalis) in eastern North America. Our goal was to calculate and map the risk probability faced by uninfected colonies of hibernating Indiana bats. Model covariates included annual distance from and direction to nearest sources of infection, geolocational information, size of the Indiana bat populations within each wintering population, and total annual size of populations known or suspected to be affected by WNS. We considered temporal, spatial, and spatiotemporal formulae through the use of random effects for year, complex (a collection of interacting hibernacula), and yearxcomplex. Since first documented in 2006, WNS has spread across much of the range of the Indiana bat. No sizeable wintering population now occurs outside of the migrational distance of an infected source. Annual rates of newly affected wintering Indiana bat populations between winter 2007 to 2008 and 2010 to 2011 were 4, 6, 8, and 12%; this rate increased each year at a rate of 3%. If this increasing rate of newly affected populations continues, all wintering populations may be affected by 2016. Our models indicated the probability of a wintering population exhibiting infection was a linear function of proximity to affected Indiana bat populations and size of the at-risk population. Geographic location was also important, suggesting broad-scale influences. For every 50-km increase in distance from a WNS-affected population, risk of disease declined by 6% (95% CI=5.2-5.7%); for every increase of 1,000 Indiana bats, there was an 8% (95% CI = 1-21%) increase in disease risk. The increasing rate of infection seems to be associated with the movement of this disease into the core of the Indiana bat range. Our
Risch, Martin R.; Ulberg, Amanda L.; Robinson, Bret A.
2007-01-01
An environmental assessment of the Muscatatuck Urban Training Center near Butlerville in Jennings County, Indiana, was completed during October and November 2005. As part of the Department of Defense Earth Science Program, the U.S. Geological Survey collected information about environmental conditions at the 825-acre former State of Indiana mental health facility prior to its conversion by the Indiana National Guard into an urban training center. The assessment was designed to investigate the type and extent of potential contamination associated with historical activities in selected areas of the facility.
Hopkins, Mark S.; Robinson, Bret A.
1997-01-01
The U.S. Geological Survey, in cooperation with the Indiana Department of Transportation, has collected data at 5,587 bridges in Indiana built with federal aid. These data, which can be useful for assessing Streambed scour and channel instability, are maintained in a computerized data base at the U.S. Geological Survey in Indianapolis, Indiana. The data elements are grouped under one of five headings: General Site Characteristics, Observed and Calculated Scour Characteristics, Bridge Characteristics, Stream Characteristics, and Debris Characteristics. The description of the data in each group includes the element name; examples of the data from bridge number 89-54 crossing Lick Creek in Wayne County, Indiana; and a brief description of each element. The data already have been used in Indiana to produce an observed-scour index and a potential-scour index and may be useful in other applications as well. For computers with Internet access, the files containing the data for all 5,587 sites are available for downloading at the following URL:
2011-02-15
..., financing, construction, operation and oversight of the Project, and an update to the major project finance... Indiana Ohio River Bridges (Project) in Clark County, Indiana and Jefferson County, Kentucky. FOR FURTHER INFORMATION CONTACT: Mr. Duane Thomas, Project Manager, Federal Highway Administration, John C. Watts Federal...
2011-05-23
... directly or formed secondarily through chemical reactions in the atmosphere. Sulfates are a type of..., Indiana submitted modeling intended to show that the Evansville area would attain and maintain the... particular, on December 7, 2009, Indiana submitted the results of modeling purporting to show PM 2.5...
NSGIC State | GIS Inventory — COUNTY_ADDRESS_POINTS_IDHS_IN is an ESRI Geodatabase point feature class that contains address points maintained by county agencies in Indiana, provided by personnel...
Rural Indiana Profile: Alcohol, Tobacco & Other Drugs.
Drug Strategies, Washington, DC.
This report examines alcohol, tobacco, and other drug use in rural parts of Indiana, as well as public and private initiatives to reduce these problems. The report is based on epidemiological, health, and criminal justice indicators; focus groups; and in-depth interviews with local officials, researchers, service providers, and civic leaders.…
2012-07-17
...-001-Kentucky and Indiana, Uniontown Hydroelectric Project; Newburgh Hydro, LLC, Project No. 12962-001-Kentucky and Indiana, Newburgh Hydroelectric Project; Notice of Revised Restricted Service List for a... licenses for the proposed Uniontown Hydroelectric Project and Newburgh Hydroelectric Project. The...
Tubular Adenoma in the Indiana Pouch of a Patient With a History of Bladder Exstrophy
Directory of Open Access Journals (Sweden)
Madeleine G. Manka
2015-09-01
Full Text Available An increased risk of neoplasm has been noted when bowel segments are used for urinary diversion. Particularly true for ureterosigmoidostomy, colonic adenocarcinoma has rarely been reported following Indiana Pouch diversion. This report describes a 42-year-old woman with a history of bladder exstrophy who developed a polyp in her Indiana Pouch 24 years after its creation. The polyp, found incidentally, was a tubular adenoma with high-grade dysplasia. Due to its malignant potential, the polyp was resected with preservation of the Indiana Pouch. This case highlights the need for lifetime surveillance in urinary reservoir patients who received diversions at a young age.
Travel Time Reliability in Indiana
Martchouk, Maria; Mannering, Fred L.; Singh, Lakhwinder
2010-01-01
Travel time and travel time reliability are important performance measures for assessing traffic condition and extent of congestion on a roadway. This study first uses a floating car technique to assess travel time and travel time reliability on a number of Indiana highways. Then the study goes on to describe the use of Bluetooth technology to collect real travel time data on a freeway and applies it to obtain two weeks of data on Interstate 69 in Indianapolis. An autoregressive model, estima...
Keynote Speech: 90th Anniversary Symposium Indiana University School of Social Work
Directory of Open Access Journals (Sweden)
Andrew Cuomo
2002-05-01
Full Text Available In celebration of 90 years of social work education at Indiana University, the School of Social Work sponsored an Anniversary Symposium on April 12, 2002. Andrew Cuomo, former U.S. Secretary of Housing and Urban Development and current candidate for New York State Governor, delivered the keynote address. In his address,Mr. Cuomo recognized the history and growth of Indiana University School of Social Work from its origin in 1911 to its current status as a state-wide, multi-campus enterprise. He discussed the formation of Project Help (Housing Enterprise for the Less Privileged and shared some of his experiences as Secretary of HUD. He also explored several contemporary social, political, and philosophical issues, including the potential long-term effects of the tragic events of September 11, 2001. Introduced by Ms. Jane Schlegel, M.S.W., Chair of the Indiana University School of Social Work Campaign Committee, Mr. Cuomo interspersed his prepared remarks with spontaneous reflections.His comments are presented here in unedited fashion.
USA valimiste võitja võib selguda varakult - kui Obama võtab Indiana / Kaivo Kopli
Kopli, Kaivo
2008-01-01
USA presidendivalimistel suletakse valimisjaoskonnad esimesena Indianas. Demokraatide kampaania konsultandi Doug Schoeni hinnangul viitab isegi tasavägine tulemus Indianas ilmselt Barack Obama suurele üleriigilisele võidule. Reutersi vaatlejate hinnanguid. Vt. samas: Kas populaarsusküsitlused ikka ennustavad valimistulemuse õigesti? Kaart, tabelid, graafikud: Barack Obama läheb võitma
2012-03-09
On June 20, 2011, the Indiana Department of Homeland Security notified the Indiana State Department of Health (ISDH) of an Indiana fire station that reported gastrointestinal illness among a substantial percentage of their workers, causing missed workdays and one hospitalization as a result of cryptosporidiosis. All ill firefighters had responded to a barn fire in Michigan, 15 miles from the Michigan-Indiana border on June 6; responding firefighters from Michigan also had become ill. ISDH immediately contacted the Michigan Department of Community Health (MDCH) concerning this outbreak. The investigation was led by MDCH in partnership with ISDH and the Michigan local health department (LHD). Among 34 firefighters who responded to the fire, 33 were interviewed, and 20 (61%) reported gastrointestinal illness ≤12 days after the fire. Cryptosporidium parvum was identified in human stool specimens, calf fecal samples, and a swimming pond. Based on these findings, the following public health recommendations were issued: 1) discontinue swimming in the pond, 2) practice thorough hygiene to reduce fecal contamination and fecal-oral exposures, and 3) decontaminate firefighting equipment properly. No additional primary or secondary cases associated with this exposure have been reported. The findings highlight a novel work-related disease exposure for firefighters and the need for public education regarding cryptosporidiosis prevention.
2012-03-01
... Promulgation of Air Quality Implementation Plans; Indiana; Lead Ambient Air Quality Standards AGENCY... Indiana State Implementation Plan (SIP) for lead (Pb) under the Clean Air Act (CAA). This submittal incorporates the National Ambient Air Quality Standards (NAAQS) for Pb promulgated by EPA in 2008. DATES...
2013-06-11
... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 62 [EPA-R05-OAR-2013-0372; FRL-9820-9] Proposal for Sewage Sludge Incinerators State Plan for Designated Facilities and Pollutants; Indiana AGENCY... direct final rulemaking, Indiana's State Plan to control air pollutants from Sewage Sludge Incinerators...
Patrice Loiez
2004-01-01
Russian Federation, Minister of Education and Science (0410049_03.jpg, 0410049_04.jpg) United States of America (0410049_05.jpg, 0410049_07.jpg) Israel, Ambassador, Permanent representative to the UN and other International Organisations in Geneva (0410049_09.jpg, 0410049_11.jpg) Japan, Advisor to the Minister of MEXT and Former Minister of MEXT (0410049_12.jpg, 0410049_15.jpg) Belgium, Ambassador in Geneva (0410049_16.jpg, 0410049_19.jpg)Greece, H.E. Mr. Dimitris Avramopoulos, Minister of Tourism (0410049_20.jpg, 0410049_22.jpg)Portugal, M. Pedro de Sampaio Nunes, Secretary of State for Science and Innovation (0410049_28.jpg, 0410049_30.jpg)Finland, H. E. Mr Mauri Pekkarinen, Minister of Trade and Industry (0410049_32.jpg, 0410049_33.jpg)
Space use and resource selection by foraging Indiana bats at the northern edge of their distribution
Jachowski, David S.; Johnson, Joshua B.; Dobony, Christopher A.; Edwards, John W.; Ford, W. Mark
2014-01-01
Despite 4 decades of conservation concern, managing endangered Indiana bat (Myotis sodalis) populations remains a difficult wildlife resource issue facing natural resource managers in the eastern United States. After small signs of population recovery, the recent emergence of white-nose syndrome has led to concerns of local and/or regional extirpation of the species. Where Indiana bats persist, retaining high-quality foraging areas will be critical to meet physiological needs and ensure successful recruitment and overwinter survival. However, insight into foraging behavior has been lacking in the Northeast of the USA. We radio-tracked 12 Indiana bats over 2 summers at Fort Drum, New York, to evaluate factors influencing Indiana bat resource selection during night-time foraging. We found that foraging space use decreased 2% for every 100 m increase in distance to water and 6% for every 100 m away from the forest edge. This suggests high use of riparian areas in close proximity to forest and is somewhat consistent with the species’ foraging ecology in the Midwest and upper South. Given the importance of providing access to high-quality foraging areas during the summer maternity season, Indiana bat conservation at the northern extent of the species’ range will be linked to retention of forested habitat in close proximity to riparian zones.
Flood-inundation maps for the East Fork White River at Columbus, Indiana
Lombard, Pamela J.
2013-01-01
Digital flood-inundation maps for a 5.4-mile reach of the East Fork White River at Columbus, Indiana, from where the Flatrock and Driftwood Rivers combine to make up East Fork White River to just upstream of the confluence of Clifty Creek with the East Fork White River, were created by the U.S. Geological Survey (USGS) in cooperation with the Indiana Department of Transportation. The inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science Web site at http://water.usgs.gov/osw/flood_inundation, depict estimates of the areal extent of flooding corresponding to selected water levels (stages) at USGS streamgage 03364000, East Fork White River at Columbus, Indiana. Current conditions at the USGS streamgage may be obtained on the Internet from the USGS National Water Information System (http://waterdata.usgs.gov/in/nwis/uv/?site_no=03364000&agency_cd=USGS&). The National Weather Service (NWS) forecasts flood hydrographs for the East Fork White River at Columbus, Indiana at their Advanced Hydrologic Prediction Service (AHPS) flood warning system Website (http://water.weather.gov/ahps/), that may be used in conjunction with the maps developed in this study to show predicted areas of flood inundation. In this study, flood profiles were computed for the stream reach by means of a one-dimensional step-backwater model. The hydraulic model was calibrated by using the most current stage-discharge relation at USGS streamgage 03364000, East Fork White River at Columbus, Indiana. The calibrated hydraulic model was then used to determine 15 water-surface profiles for flood stages at 1-foot (ft) intervals referenced to the streamgage datum and ranging from bankfull to approximately the highest recorded water level at the streamgage. The simulated water-surface profiles were then combined with a geographic information system digital elevation model (derived from Light Detection and Ranging (LiDAR) data), having a 0.37-ft vertical accuracy and a 1.02 ft
Michel Blanc
2004-01-01
Russian Federation, Minister of Education and Science (0410050_01.jpg, 0410050_02.jpg) United States of America (0410050_03.jpg, 0410050_04.jpg, 0410050_05.jpg) Israel, Ambassador, Permanent representative to the UN and other International Organisations in Geneva (0410050_06.jpg, 0410050_07.jpg) Japan, Advisor to the Minister of MEXT and Former Minister of MEXT (0410050_08.jpg, 0410050_09.jpg) Belgium, Ambassador in Geneva (0410050_11.jpg, 0410050_12.jpg)Greece, H.E. Mr. Dimitris Avramopoulos, Minister of Tourism (0410050_14.jpg, 0410050_15.jpg)Portugal, M. Pedro de Sampaio Nunes, Secretary of State for Science and Innovation (0410050_19.jpg)Finland, H. E. Mr Mauri Pekkarinen, Minister of Trade and Industry (0410050_20.jpg)
Indiana and the Kansas-Nebraska Act of 1854.
Medland, William J.; Rosenberg, Morton M.
1984-01-01
The Kansas-Nebraska Act, which repealed the ban against slavery in the North, served as a catalyst to activate numerous groups which were unhappy with the Indiana Democratic Party. From this period emerged the new Republican party and also a revitalized Democratic party with new leadership. (IS)
Hetler, Angela Dawn
2010-01-01
This qualitative case study examines teachers' perspectives on testing accommodations for Limited English Proficient (LEP) students taking Indiana's Graduation Qualifying Exam (GQE). The Indiana Department of Education (IDOE) states that the purpose of testing accommodations is to "level the playing field" between LEP students and their…
2011-09-27
...] Approval and Promulgation of Air Quality Implementation Plans; Indiana; Redesignation of Lake and Porter... redesignation of the Lake and Porter Counties, Indiana portion (Lake and Porter Counties) of the Chicago-Gary... or standard). EPA is proposing to approve the redesignation request for Lake and Porter Counties...
Lloyd, O.B.; Davis, R.W.
1989-01-01
Preliminary interpretation of available hydrogeologic data suggests that some areas underlying eastern Indiana, north-central Kentucky, and western Ohio might be worthy of further study regarding the disposal of high-level radioactive waste in Precambrian crystalline rocks buried beneath Paleozoic sedimentary rocks in the area. The data indicate that (1) largest areas of deepest potential burial and thickest sedimentary rock cover occur in eastern Indiana; (2) highest concentrations of dissolved solids in the basal sandstone aquifer, suggesting the most restricted circulation, are found in the southern part of the area near the Kentucky-Ohio State line and in southeastern Indiana; (3) largest areas of lowest porosity in the basal sandstone aquifer, low porosity taken as an indicator of the lowest groundwater flow velocity and contaminant migration, are found in northeastern Indiana and northwestern Ohio, central and southeastern Indiana, and central Kentucky; (4) the thickest confining units that directly overlie the basal sandstone aquifer are found in central Kentucky and eastern Indiana where their thickness exceeds 500 ft; (5) steeply dipping faults that form potential hydraulic connections between crystalline rock, the basal sandstone aquifer, and the freshwater circulation system occur on the boundaries of the study area mainly in central Kentucky and central Indiana. Collectively, these data indicate that the hydrogeology of the sedimentary rocks in the western part of the study area is more favorably suited than that in the remainder of the area for the application of the buried crystalline-rock concept. (USGS)
NSGIC State | GIS Inventory — COUNTY_GOVERNMENT_BOUNDARIES_IDHS_IN is a polygon feature class that contains governmental boundaries maintained by county agencies in Indiana, provided by personnel...
2010-07-01
... 40 Protection of Environment 17 2010-07-01 2010-07-01 false South Bend-Elkhart (Indiana)-Benton Harbor (Michigan) Interstate Air Quality Control Region. 81.73 Section 81.73 Protection of Environment... PLANNING PURPOSES Designation of Air Quality Control Regions § 81.73 South Bend-Elkhart (Indiana)-Benton...
Flood-inundation maps for White River at Petersburg, Indiana
Fowler, Kathleen K.
2015-08-20
Digital flood-inundation maps for a 7.7-mile reach of the White River at Petersburg, Indiana, were created by the U.S. Geological Survey (USGS), in cooperation with the Indiana Office of Community and Rural Affairs. The inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science Web site at http://water.usgs.gov/osw/flood_inundation/, depict estimates of the areal extent and depth of flooding corresponding to selected water levels (stages) at the USGS streamgage at White River at Petersburg, Ind. (03374000). Near-real-time stages at this streamgage may be obtained from the USGS National Water Information System at http://waterdata.usgs.gov/ or the National Weather Service (NWS) Advanced Hydrologic Prediction Service at http:/water.weather.gov/ahps/, which also forecasts flood hydrographs at this site (PTRI3).
NSGIC State | GIS Inventory — LAND_COVER_PRESETTLEMENT_IDNR_IN.SHP is a polygon shapefile showing generalized presettlement vegetation types of Indiana, circa 1820. The work was based on original...
Indiana intelligent transportation systems commercial vehicle operations business plan
1997-12-31
This business plan was developed by the Motor Carrier Services (MCS) division of the Indiana Department of Revenue. It is the result of a nine month study of the various state departments and agencies that directly and indirectly support the intersta...
International Nuclear Information System (INIS)
1993-02-01
On December 1, 1992, the Indiana Regional Cancer Center reported to the US Nuclear Regulatory Commission's (NRC) Region I that they believed a 1.37 E + 11 becquerel (3.7-curie) iridium-192 source from their Omnitron 2000 high dose rate remote brachytherapy afterloader had been found at a biohazard waste transfer station in Carnegie, Pennsylvania. After notifying the NRC, this cancer center, one of several operated by the licensee, Oncology Services Corporation, retrieved the source, and Region I dispatched an inspector and a supervisor to investigate the event. The source was first detected when it triggered radiation alarms at a waste incinerator facility in. Warren, Ohio. The licensee informed the NRC that the source wire had apparently broken during treatment of a patient on November 16, 1992, leaving the source in the patient. On the basis of the seriousness of the incident, the NRC elevated its response to an Incident Investigation. The Incident Investigation Team initiated its investigation on December 3, 1992. The investigation team concluded that the patient received a serious misadministration and died on November 21, 1992, and that over 90 individuals were exposed to radiation from November 16 to December 1, 1992. In a press release dated January 26, 1993, the Indiana County Coroner stated that the cause of death listed in the official autopsy report was ''Acute Radiational Exposure and Consequences Thereof'' An almost identical source wire failure occurred with an afterloader in Pittsburgh, Pennsylvania, on December 7, 1992, but with minimal radiological consequences. This incident was included in the investigation. This report discusses the Omnitron 2000 high dose rate afterloader source-wire failure, the reasons why the failure was not detected by Indiana Regional Cancer Center, the potential consequences to the patient, the estimated radiological doses to workers and the public, and regulatory aspects associated with this incident
International Nuclear Information System (INIS)
Lloyd, O.B.; Davis, R.W.
1989-01-01
Preliminary interpretation of available hydrogeologic data suggests that some areas underlying eastern Indiana, north-central Kentucky, and western Ohio might be worthy of further study regarding the disposal of high-level radioactive waste in Precambrian crystalline rocks buried beneath Paleozoic sedimentary rocks in the area. The data indicate that (1) largest areas of deepest potential burial and thickest sedimentary rock cover occur in eastern Indiana; (2) highest concentrations of dissolved solids in the basal sandstone aquifer, suggesting the most restricted circulation, are found in the southern part of the area near the Kentucky-Ohio State line and in southeastern Indiana; (3) largest areas of lowest porosity in the basal sandstone aquifer, low porosity taken as an indicator of the lowest groundwater flow velocity and contaminant migration, are found in northeastern Indiana and northwestern Ohio, central and southeastern Indiana, and central Kentucky; (4) the thickest confining units that directly overlie the basal sandstone aquifer are found in central Kentucky and eastern Indiana where their thickness exceeds 500 ft; (5) steeply dipping faults that form potential hydraulic connections between crystalline rock, the basal sandstone aquifer, and the freshwater circulation system occur on the boundaries of the study area mainly in central Kentucky and central Indiana. Collectively, these data indicate that the hydrogeology of the sedimentary rocks in the western part of the study area is more favorably suited than that in the remainder of the area for the application of the buried crystalline-rock concept. 39 refs., 9 figs., 3 tabs
Feasibility Study of Residential Grid-Connected Solar Photovoltaic Systems in the State of Indiana
Al-Odeh, Mahmoud
This study aims to measure the financial viability of installing and using a residential grid-connected PV system in the State of Indiana while predicting its performance in eighteen geographical locations within the state over the system's expected lifetime. The null hypothesis of the study is that installing a PV system for a single family residence in the State of Indiana will not pay for itself within 25 years. Using a systematic approach consisting of six steps, data regarding the use of renewable energy in the State of Indiana was collected from the website of the US Department of Energy to perform feasibility analysis of the installation and use of a standard-sized residential PV system. The researcher was not able to reject the null hypothesis that installing a PV system for a single family residence in the State of Indiana will not pay for itself within 25 years. This study found that the standard PV system does not produce a positive project balance and does not pay for itself within 25 years (the life time of the system) assuming the average cost of a system. The government incentive programs are not enough to offset the cost of installing the system against the cost of the electricity that would not be purchased from the utility company. It can be concluded that the cost of solar PV is higher than the market valuation of the power it produces; thus, solar PV did not compete on the cost basis with the traditional competitive energy sources. Reducing the capital cost will make the standard PV system economically viable in Indiana. The study found that the capital cost for the system should be reduced by 15% - 56%.
Indiana University High Energy Physics Group, Task C
International Nuclear Information System (INIS)
Heinz, R.M.; Mufson, S.L.; Musser, J.
1991-01-01
The Indiana University High Energy Physics Group, Task C has been actively involved in the MACRO experiment at Gran Sasso and the SSC experiment L during the current contract year. MACRO is a large US-Italian Monopole, Astrophysics, and Cosmic Ray Observatory being built under the Gran Sasso Mountain outside of Rome. Indiana University is in charge of organizing the United States software effort. We have built a state-of-the-art two-meter spectrophotometer for the MACRO liquid scintillator. We are in charge of ERP, the Event Reconstruction Processor online trigger processor for muons and stellar collapse. We are designing an air Cerenkov array to be placed on top of the Gran Sasso. Our other activity involves participation in the SSC experiment L. As long-standing members of L we have done proposal writing and have worked on important L planning and organization matters. We are now doing development work on the L Central Tracker straw drift tubes, including gas optimization, readout, and Monte Carlos. 12 refs., 20 figs., 1 tab
Indiana University High Energy Physics Group, Task C
Energy Technology Data Exchange (ETDEWEB)
Heinz, R.M.; Mufson, S.L.; Musser, J.
1991-01-01
The Indiana University High Energy Physics Group, Task C has been actively involved in the MACRO experiment at Gran Sasso and the SSC experiment L during the current contract year. MACRO is a large US-Italian Monopole, Astrophysics, and Cosmic Ray Observatory being built under the Gran Sasso Mountain outside of Rome. Indiana University is in charge of organizing the United States software effort. We have built a state-of-the-art two-meter spectrophotometer for the MACRO liquid scintillator. We are in charge of ERP, the Event Reconstruction Processor online trigger processor for muons and stellar collapse. We are designing an air Cerenkov array to be placed on top of the Gran Sasso. Our other activity involves participation in the SSC experiment L. As long-standing members of L we have done proposal writing and have worked on important L planning and organization matters. We are now doing development work on the L Central Tracker straw drift tubes, including gas optimization, readout, and Monte Carlos. 12 refs., 20 figs., 1 tab.
Exploring the Link Between Streamflow Trends and Climate Change in Indiana, USA
Kumar, S.; Kam, J.; Thurner, K.; Merwade, V.
2007-12-01
Streamflow trends in Indiana are evaluated for 85 USGS streamflow gaging stations that have continuous unregulated streamflow records varying from 10 to 80 years. The trends are analyzed by using the non-parametric Mann-Kendall test with prior trend-free pre-whitening to remove serial correlation in the data. Bootstrap method is used to establish field significance of the results. Trends are computed for 12 streamflow statistics to include low-, medium- (median and mean flow), and high-flow conditions on annual and seasonal time step. The analysis is done for six study periods, ranging from 10 years to more than 65 years, all ending in 2003. The trends in annual average streamflow, for 50 years study period, are compared with annual average precipitation trends from 14 National Climatic Data Center (NCDC) stations in Indiana, that have 50 years of continuous daily record. The results show field significant positive trends in annual low and medium streamflow statistics at majority of gaging stations for study periods that include 40 or more years of records. In seasonal analysis, all flow statistics in summer and fall (low flow seasons), and only low flow statistics in winter and spring (high flow seasons) are showing positive trends. No field significant trends in annual and seasonal flow statistics are observed for study periods that include 25 or fewer years of records, except for northern Indiana where localized negative trends are observed in 10 and 15 years study periods. Further, stream flow trends are found to be highly correlated with precipitation trends on annual time step. No apparent climate change signal is observed in Indiana stream flow records.
Directory of Open Access Journals (Sweden)
Yan Lu
Full Text Available A total of 310 Salmonella isolates were isolated from 6 broiler farms in Eastern China, serotyped according to the Kauffmann-White classification. All isolates were examined for susceptibility to 17 commonly used antimicrobial agents, representative isolates were examined for resistance genes and class I integrons using PCR technology. Clonality was determined by pulsed-field gel electrophoresis (PFGE. There were two serotypes detected in the 310 Salmonella strains, which included 133 Salmonella enterica serovar Indiana isolates and 177 Salmonella enterica serovar Enteritidis isolates. Antimicrobial sensitivity results showed that the isolates were generally resistant to sulfamethoxazole, ampicillin, tetracycline, doxycycline and trimethoprim, and 95% of the isolates sensitive to amikacin and polymyxin. Among all Salmonella enterica serovar Indiana isolates, 108 (81.2% possessed the blaTEM, floR, tetA, strA and aac (6'-Ib-cr resistance genes. The detected carriage rate of class 1 integrons was 66.5% (206/310, with 6 strains carrying gene integron cassette dfr17-aadA5. The increasing frequency of multidrug resistance rate in Salmonella was associated with increasing prevalence of int1 genes (rs = 0.938, P = 0.00039. The int1, blaTEM, floR, tetA, strA and aac (6'-Ib-cr positive Salmonella enterica serovar Indiana isolates showed five major patterns as determined by PFGE. Most isolates exhibited the common PFGE patterns found from the chicken farms, suggesting that many multidrug-resistant isolates of Salmonella enterica serovar Indiana prevailed in these sources. Some isolates with similar antimicrobial resistance patterns represented a variety of Salmonella enterica serovar Indiana genotypes, and were derived from a different clone.
Education Technology Services at Indiana University: A Case Study.
Bichelmeyer, B. A.; Hara, Noriko; Yi, Jessi; Dennen, Vanessa; Avers, Dale; Tzeng, Jeng-Yi
1998-01-01
This paper, based on a qualitative research study, describes the technology resources available in the Indiana University School of Education, explains the range of services provided by Education Technology Services (ETS), documents the organizational structure of ETS, and describes the key processes and culture of ETS. (Author/AEF)
Summer ecology of Indiana bats in Ohio : executive summary report.
2011-05-01
The Indiana bat (Myotis sodalis) is a small, tree roosting species found throughout the eastern United States that is federally listed as endangered by the U.S. Fish and Wildlife Service. Although their major hibernacula are protected, information on...
Digital Learning Compass: Distance Education State Almanac 2017. Indiana
Seaman, Julia E.; Seaman, Jeff
2017-01-01
This brief report uses data collected under the U.S. Department of Education's National Center for Educational Statistics (NCES) Integrated Postsecondary Education Data System (IPEDS) Fall Enrollment survey to highlight distance education data in the state of Indiana. The sample for this analysis is comprised of all active, degree-granting…
76 FR 27973 - Approval and Promulgation of Air Quality Implementation Plans; Indiana
2011-05-13
... makes a minor revision to the definition of ``Nonphotochemically reactive hydrocarbons'' or ``negligibly... submission revises the Indiana Administrative Code (IAC) by amending and updating the definition of...
Making better babies: public health and race betterment in Indiana, 1920-1935.
Stern, Alexandra Minna
2002-05-01
In 1920, Indiana's Division of Infant and Child Hygiene inaugurated its first Better Babies Contest at the state fair. For the next 12 years, these contests were the centerpiece of a dynamic infant and maternal welfare program that took shape in Indiana during the decade of the federal Sheppard-Towner act. More than just a lively spectacle for fairgoers, these contests brought public health, "race betterment," and animal breeding together in a unique manner. This article describes one of the most popular expressions of public health and race betterment in rural America. It also raises questions about the intersections between hereditarian and medical conceptions of human improvement during the early 20th century, especially with respect to child breeding and rearing.
Indiana Advanced Electric Vehicle Training and Education Consortium (I-AEVtec)
Energy Technology Data Exchange (ETDEWEB)
Caruthers, James; Dietz, J.; Pelter, Libby; Chen, Jie; Roberson, Glen; McGinn, Paul; Kizhanipuram, Vinodegopal
2013-01-31
The Indiana Advanced Electric Vehicle Training and Education Consortium (I-AEVtec) is an educational partnership between six universities and colleges in Indiana focused on developing the education materials needed to support electric vehicle technology. The I-AEVtec has developed and delivered a number of degree and certificate programs that address various aspects of electric vehicle technology, including over 30 new or significantly modified courses to support these programs. These courses were shared on the SmartEnergyHub. The I-AEVtec program also had a significant outreach to the community with particular focus on K12 students. Finally, the evGrandPrix was established which is a university/college student electric go-kart race, where the students get hands-on experience in designing, building and racing electric vehicles. The evGrandPrix now includes student teams from across the US as well as from Europe and it is currently being held on Opening Day weekend for the Indy500 at the Indianapolis Motor Speedway.
Jiang, Yi; Li, Shou; Shamo, Daniel E.
2003-01-01
Since the 1980s, traffic volumes have experienced a rapid growth of approximately 30% in Indiana. Traffic data indicates that more than 70% of vehicles travel in platoons on Indiana highway corridors in the vicinity of urban areas. At a rural highway intersection consisting of a major road with high traffic volume and a minor road with low traffic volume, it is very common that the green time cannot be used efficiently, especially when the vehicle detectors on the major road are imbedded clos...
Middle Holocene Changes in Midwestern Precipitation Intensity Captured by Indiana Stalagmites
Akers, P. D.; Brook, G. A.; Liang, F.; Cheng, H.; Edwards, R. L.
2017-12-01
Three stalagmites collected from Upper Porter Cave in southern Indiana provide a record of Midwestern hydroclimate changes for the period 2.3-8.4 ka BP. Our record spans the Middle Holocene, known as a time of mid-continental drying for North America and used as an analog for warmer future climates. The spatial extent of this drying is not well constrained, and some eastern North American records show wetter conditions coinciding with the drying of the continental interior. Southern Indiana is located on the eastern periphery of mid-continental North America, and our stalagmite records can help constrain the eastern extent of drying. Upper Porter Cave floods easily during heavy rain events, and modern observations suggest frequent cave flooding prevents stalagmite growth. Thus, we view periods of stalagmite growth as a proxy for a less intense and possibly drier precipitation regime that limits cave flooding. All three stalagmites began growing 8.4 ka BP and stopped growing 7.5 ka BP. This hiatus at 7.5 ka BP is associated with laminae dissolution and greater sediment incorporation (see image), supporting increased precipitation intensity and cave flooding at this time. This contrasts with concurrent drying in the mid-continent and suggests a Middle Holocene with a steeper east-west precipitation gradient than present. This period of greater precipitation intensity extended until 4.9 ka BP when one stalagmite re-initiated growth, possibly due to mid-continental dryness expanding eastward into southern Indiana. This renewed growth was intermittent at 4.7-4.9, 3.6-4.2, and 2.3-3.1 ka BP, and multi-century flood-driven hiatuses separate these drier periods. A more intense precipitation regime that lasts until present provoked final growth cessation at 2.3 ka BP. Combined with other regional hydroclimate records, our stalagmite suggests that the transition from the Middle to Late Holocene was a period of unstable precipitation regimes for the eastern mid
Shaffer, Kimberly H.
2009-01-01
This report contains an analysis of water withdrawal and return-flow data for Ohio and withdrawal data for Indiana and Wisconsin to compute consumptive-use coefficients and to describe monthly variability of withdrawals and consumptive use. Concurrent data were available for most water-use categories from 1999 through 2004. Average monthly water withdrawals are discussed for a variety of water-use categories, and average water use per month is depicted graphically for Ohio, Indiana, and Wisconsin (public supply only). For most water-use categories, the summer months were those of highest withdrawal and highest consumptive use. For public supply, average monthly withdrawals ranged from 1,380 million gallons per day (Mgal/d) (November) to 1,620 Mgal/d (July) in Ohio, 621 Mgal/d (December) to 816 Mgal/d (July) in Indiana, and 515 Mgal/d (December) to 694 Mgal/d (July) in Wisconsin. Ohio and Indiana thermoelectric facilities had large increases in average monthly withdrawals in the summer months (5,520 Mgal/d in March to 7,510 Mgal/d in August for Indiana; 7,380 Mgal/d in February to 10,040 Mgal/d in July for Ohio), possibly because of increased electricity production in the summer, a need for additional cooling-water withdrawals when intake-water temperature is high, or use of different types of cooling methods during different times of the year. Average industrial withdrawals ranged from 2,220 Mgal/d (December) to 2,620 Mgal/d (August) in Indiana and from 707 Mgal/d (January) to 787 Mgal/d (August) in Ohio. The Ohio and Indiana irrigation data showed that most withdrawals were in May through October for golf courses, nurseries, and crop irrigation. Commercial water withdrawals ranged from 30.4 Mgal/d (January) to 65.0 Mgal/d (September) in Indiana and from 23.2 Mgal/d (November) to 49.5 Mgal/d (August) in Ohio; commercial facilities that have high water demand in Ohio and Indiana are medical facilities, schools, amusement facilities, wildlife facilities, large stores
Elementary Lessons from Indiana's Underground Railroad Institute (July 22-27, 2001).
Indiana Univ.-Purdue Univ., Indianapolis. Geography Educators' Network of Indiana.
The Geography Educators' Network of Indiana's 2001 Exploring and Teaching Institute led 23 educators from around the state on a six day traveling adventure. Participants explored art, literature/folklore, historical sites and archives, physical environments, architecture, economics, politics, and cultures associated with the Underground Railroad…
Secondary Lessons from Indiana's Underground Railroad Institute (July 22-27, 2001).
Indiana Univ.-Purdue Univ., Indianapolis. Geography Educators' Network of Indiana.
The Geography Educator's Network of Indiana's 2001 Exploring and Teaching Institute series led 23 educators from around the state on a six day traveling adventure. Participants explored art, literature/folklore, historical sites and archives, physical environments, architecture, economics, politics, and cultures associated with the Underground…
Energy Technology Data Exchange (ETDEWEB)
Keller, John B.
2007-12-06
The smartDESKTOP Initiative at the Indiana Humanities Council received critical support in building and delivering a digital desktop for Indiana educators through the Department of Energy Grant DE-FG02-06ER64282. During the project period September 2006 through October of 2007, the number of Indiana educators with accounts on the smartDESKTOP more than tripled from under 2,000 to more than 7,000 accounts. An external review of the project conducted for the purposes of understanding the impact of the service in Indiana schools revealed that the majority of respondents felt that using the smartDESKTOP did reduce the time they spent managing paper. The same study revealed the challenges of implementing a digital desktop meant to help teachers leverage technology to improve their teaching and ultimately student learning. The most significant outcome of this project is that the Indiana Department of Education expressed interest in assuming responsibility for sustaining this project. The transition of the smartDESKTOP to the Indiana Department of Education was effective on November 1, 2007.
Spradlin, Terry; Cierniak, Katherine; Shi, Dingjing; Chen, Minge
2012-01-01
This Education Policy Brief summarizes the research and data analysis completed by the Center for Evaluation and Education Policy (CEEP) on Indiana's student attendance and absenteeism data. The study was initiated by The Indiana Partnerships Center and conducted by CEEP with funding from USA Funds and State Farm. Additional partners in the study…
Making Better Babies: Public Health and Race Betterment in Indiana, 1920–1935
Stern, Alexandra Minna
2002-01-01
In 1920, Indiana's Division of Infant and Child Hygiene inaugurated its first Better Babies Contest at the state fair. For the next 12 years, these contests were the centerpiece of a dynamic infant and maternal welfare program that took shape in Indiana during the decade of the federal Sheppard–Towner act. More than just a lively spectacle for fairgoers, these contests brought public health, “race betterment,” and animal breeding together in a unique manner. This article describes one of the most popular expressions of public health and race betterment in rural America. It also raises questions about the intersections between hereditarian and medical conceptions of human improvement during the early 20th century, especially with respect to child breeding and rearing. PMID:11988439
NSGIC State | GIS Inventory — IDNR documentation states - ÂThis dataset contains locations of cemetery sites in Indiana, regardless of age, number of graves, or size of the cemetery. Is it not...
NSGIC State | GIS Inventory — IDNR documentation states - ÂThis dataset contains locations of cemetery sites in Indiana, regardless of age, number of graves, or size of the cemetery. Is it not...
Flood-inundation maps for the St. Marys River at Decatur, Indiana
Strauch, Kellan R.
2015-08-24
Digital flood-inundation maps for an 8.9-mile reach of the St. Marys River at Decatur, Indiana, were developed by the U.S. Geological Survey (USGS), in cooperation with the Indiana Office of Community and Rural Affairs. The inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science Web site (http://water.usgs.gov/osw/flood_inundation/), depict estimates of the areal extent and depth of flooding corresponding to selected water levels (stages) of the St. Marys River at Decatur (USGS station number 04181500). The maps are useful for estimating near-real-time areas of inundation by referencing concurrent USGS streamgage information at http://waterdata.usgs.gov/. In addition, the streamgage information was provided to the National Weather Service (NWS) for incorporation into their Advanced Hydrologic Prediction Service flood warning system (http:/water.weather.gov/ahps/). NWS-forecasted peak-stage information may be used in conjunction with the maps developed during this study to show predicted areas of flood inundation.
Flood-inundation maps for the White River at Indianapolis, Indiana, 2014
Nystrom, Elizabeth A.
2015-01-01
Digital flood-inundation maps for a 6.4-mile reach of the White River in Indianapolis, Indiana, from 0.3 miles upstream of Michigan Street to the Harding Street Generating Station dam (at the confluence with Lick Creek), were created by the U.S. Geological Survey (USGS) in cooperation with the Indiana Office of Community and Rural Affairs. The flood-inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science Web site at http://water.usgs.gov/osw/flood_inundation/, depict estimates of the areal extent and depth of flooding corresponding to selected water levels (stages) at the USGS streamgage on the White River at Indianapolis, Ind. (station number 03353000). Near-real-time stages at this streamgage may be obtained on the Internet from the USGS National Water Information System at http://waterdata.usgs.gov/or the National Weather Service (NWS) Advanced Hydrologic Prediction Service athttp://water.weather.gov/ahps/, which also forecasts flood hydrographs at this site.
Social Vulnerability Index (SoVI) for Indiana based on 2000 Census Block Groups
National Oceanic and Atmospheric Administration, Department of Commerce — This data depicts the social vulnerability of Indiana census block groups to environmental hazards. Data were culled primarily from the 2000 Decennial Census.
DeWalt, R. Edward; South, Eric J.; Robertson, Desiree R.; Marburger, Joy E.; Smith, Wendy W.; Brinson, Victoria
2016-01-01
Abstract United States National Parks have protected natural communities for one hundred years. Indiana Dunes National Lakeshore (INDU) is a park unit along the southern boundary of Lake Michigan in Indiana, USA. An inventory of 19 sites, consisting of a seep, 12 streams, four marshes, a bog, and a fen were examined for mayflies (Ephemeroptera), stoneflies (Plecoptera), and caddisflies (Trichoptera) (EPT taxa). Volunteers and authors collect 35 ultraviolet light traps during summer 2013 and supplementary benthic and adult sampling added species not attracted by lights or that were only present in colder months. Seventy-eight EPT species were recovered: 12 mayflies, two stoneflies, and 64 caddisflies. The EPT richness found at INDU was a low proportion of the number of species known from Indiana: caddisflies contributed only 32.7% of known state fauna, mayflies and stoneflies contributed 8.4% and 2.3%, respectively. Site EPT richness ranged from one for a seep to 34 for an 8 m-wide stream. Richness in streams generally increased with stream size. Seven new state records and rare species are reported. The number of EPT species at INDU is slightly larger than that found at Isle Royale National Park in 2013, and the community composition and evenness between orders were different. PMID:26877693
Death in Indiana: "The Massacre at Fall Creek" by Jessamyn West.
Rout, Kathleen
1985-01-01
Interpreted is the novel, "The Massacre at Fall Creek," that dramatizes an event that occurred in Indiana in 1824 in which White men killed unarmed Seneca Indians. The Whites were brought to trial, convicted, and hanged. The novel demonstrates the moral ambiguity that often characterizes responses toward crime and punishment. (RM)
Case: The Ethics and Economics of Expanding Interstate 69 in Indiana.
Clapp-Itnyre, Alisa
2000-01-01
Presents and discusses a case used in a business communication class that centers on an interstate highway extension in southern Indiana. Describes the rationale for teaching the case, and student responses. Notes that, in confronting these issues, students learn to see that facts yield to different interpretations based on differing perspectives…
Mexican American Women's Activism at Indiana University in the 1990s
Hernandez, Ebelia
2013-01-01
This article offers a historical analysis of documents and narratives from Mexican American women that reflect the tumultuous 1990s at Indiana University. Their recollections reveal how they became activists, the racist incidents that compelled them into activism, and the racial tensions and backlash towards identity politics felt by students of…
Competencies in Entomology Needed by Agribusiness Teachers and Extension Agents in Indiana
Hamilton, William H.; Walker, Leon
1975-01-01
The analysis of the data from an 84.2 percent questionnaire response by Indiana extension agents and agribusiness teachers provides 12 conclusions regarding their competency needs and five recommendations regarding inservice teacher training and courses needed in the areas of entomology. (BP)
NSGIC State | GIS Inventory — IDNR documentation states - ÂThis dataset contains point locations of historic bridges in Indiana. It includes buildings, districts, sites, structures and objects...
2013-06-14
cohesion and morale of the 46th Indiana. The monotony of camp life, severe weather, illness and disease , high casualty rates, and lack of food and...sickness and disease were a common cause of casualties during the war and the regiment experienced the same hardships caused by the harsh conditions... Carrion Crow Bayou. 161Bernard F. Schermerhorn, letter to wife, 9 November 1863, Bernard Schermerhorn Papers, 1862-1864, Indiana Historical Society
The history of human disturbance in forest ecosystems of southern Indiana
Michael A. Jenkins
2013-01-01
The forests of southern Indiana have been shaped and defined by anthropogenic disturbance. Native Americans influenced composition and structure through land clearing and burning, but the scale and rate of human disturbance intensified with European settlement. Sustained settlement led to the loss of forest land to agriculture and livestock grazing. Forests were also...
New Chicago-Indiana computer network will handle dataflow from world's largest scientific experiment
2006-01-01
"Massive quantities of data will soon begin flowing from the largest scientific instrument ever built into an international netword of computer centers, including one operated jointly by the University of Chicago and Indiana University." (1,5 page)
Priorities and Practices of Career and Technical Education Directors in Indiana
Herrin, Cory D.
2013-01-01
The purpose of this quantitative study was to determine the importance and priority of practices for directors of career and technical education in the state of Indiana. An analysis was prepared to determine the rankings and correlations of importance and priorities of 50 leadership practices as well as 11 categories of practices for the career…
Building a stakeholder network for the Indiana Climate Change Impacts Assessment
Dukes, J. S.; Widhalm, M.
2017-12-01
The Indiana Climate Change Impacts Assessment (IN CCIA) is a stakeholder-informed, service-driven resource developed under the coordination of the Purdue Climate Change Research Center (PCCRC) and with involvement from a diverse mix of contributors throughout the state. The IN CCIA brings together the best available climate change research into a series of reports aimed at helping Hoosiers better understand climate change-related risks so they can prepare for challenges and capitalize on opportunities. The IN CCIA development process aims to 1) increase the dialogue about climate change across the state, 2) provide Indiana decision makers with accessible, credible climate impact information, and 3) build a network of experts and stakeholders to support ongoing assessment efforts and knowledge sharing. This presentation will report on our experience with developing and maintaining a diverse stakeholder network. We will describe our efforts to connect with stakeholders before, during, and after the development of assessment reports and share the top themes that emerged from our pre-assessment inquires and other interactions.
Vulnerable transportation and utility assets near actively migrating streams in Indiana
Sperl, Benjamin J.
2017-11-02
An investigation was completed by the U.S. Geological Survey in cooperation with the Indiana Office of Community and Rural Affairs that found 1,132 transportation and utility assets in Indiana are vulnerable to fluvial erosion hazards due to close proximity to actively migrating streams. Locations of transportation assets (bridges, roadways, and railroad lines) and selected utility assets (high-capacity overhead power-transmission lines, underground pipelines, water treatment facilities, and in-channel dams) were determined using aerial imagery hosted by the Google Earth platform. Identified assets were aggregated by stream reach, county, and class. Accompanying the report is a polyline shapefile of the stream reaches documented by Robinson. The shapefile, derived from line work in the National Hydrography Dataset and attributed with channel migration rates, is released with complete Federal Geographic Data Committee metadata. The data presented in this report are intended to help stakeholders and others identify high-risk areas where transportation and utility assets may be threatened by fluvial erosion hazards thus warranting consideration for mitigation strategies.
Issues in third party attacks on SMCRA permits. [USA - Indiana
Energy Technology Data Exchange (ETDEWEB)
Kelley, G.D. Jr. (Ice Miller Donadio Ryan, Indianapolis, IN (USA))
1990-01-01
Legal issues which have occurred in third party attacks on SMCRA (Surface Mining Control and Reclamation Act) permit, mainly in Indiana, are discussed. Problems that can occur with the interrelationship of common law nuisance/injunction actions, the permit process, enforcement proceedings and collateral estoppel from administrative agency action, as well as finality issues in the permit process as related to other provisions of SMCRA. 37 refs.
Indiana University High Energy Physics Group, Task C
International Nuclear Information System (INIS)
Bower, C.; Heinz, R.; Mufson, S.; Musser, J.
1993-01-01
The Indiana University Task C group is participating in the experiments GEM at the SSC and MACRO at the Gran Sasso. After an introduction to GEM in paragraph II, a detailed report is presented on the work done during the current contract period on the design of the outer region of the GEM Central Tracker. The Central Tracker Monte Carlo, which was the other significant GEM activity by the group, is included. In paragraph III is introduced MACRO and a brief status report is given. Muon Astronomy analysis done using MACRO data is also presented
Tree regeneration response to the group selection method in southern Indiana
Dale R. Weigel; George R. Parker
1997-01-01
Tree regeneration response following the use of the group selection method was studied within 36 group openings on the Naval Surface Warfare Center, Crane Division in south central Indiana. Two different aspects and three time periods since cutting were examined. The objectives were to determine whether aspect, age, species group, location within the opening, or their...
Indiana bat summer maternity distribution: effects of current and future climates
Susan C. Loeb; Eric A. Winters
2013-01-01
Temperate zone bats may be more sensitive to climate change than other groups of mammals because many aspects of their ecology are closely linked to temperature. However, few studies have tried to predict the responses of bats to climate change. The Indiana bat (Myotis sodalis) is a federally listed endangered species that is found in the eastern...
Dominant height-based height-diameter equations for trees in southern Indiana
John A., Jr. Kershaw; Robert C. Morrissey; Douglass F. Jacobs; John R. Seifert; James B. McCarter
2008-01-01
Height-diameter equations are developed based on dominant tree data collected in 1986 in 8- to 17-year-old clearcuts and the phase 2 Forest Inventory and Analysis plots on the Hoosier National Forest in south central Indiana. Two equation forms are explored: the basic, three-parameter Chapman-Richards function, and a modification of the three-parameter equation...
Energy Technology Data Exchange (ETDEWEB)
Roberts, Joseph Owen [National Renewable Energy Lab. (NREL), Golden, CO (United States); Mosey, Gail [National Renewable Energy Lab. (NREL), Golden, CO (United States)
2013-11-01
The U.S. Environmental Protection Agency (EPA), in accordance with the RE-Powering America's Land initiative, selected the Newport Indiana Chemical Depot site in Newport, Indiana, for a feasibility study of renewable energy production. The National Renewable Energy Laboratory (NREL) was contacted to provide technical assistance for this project. The purpose of this report is to assess the sitefor possible wind turbine electrical generator installation and estimate the cost, performance, and site impacts of different wind energy options. In addition, the report recommends financing options that could assist in the implementation of a wind system at the site.
2010-08-17
... Promulgation of Air Quality Implementation Plans; Indiana; Transportation Conformity Consultation Requirement... consists of transportation conformity criteria and procedures related to interagency consultation and... meet a requirement of the Clean Air Act and Transportation Conformity regulations. DATES: Comments must...
2012-09-13
... writing or picked up in person at Indiana Dunes National Lakeshore, 1100 N. Mineral Springs Road, Porter... for public inspection in their entirety. Dated: July 27, 2012. Michael T. Reynolds, Regional Director...
Energy Technology Data Exchange (ETDEWEB)
Harris, David; Ellett, Kevin; Rupp, John; Leetaru, Hannes
2014-09-30
Research documented in this report includes (1) refinement and standardization of regional stratigraphy across the 3-state study area in Illinois, Indiana, and Kentucky, (2) detailed core description and sedimentological interpretion of Knox cores from five wells in western Kentucky, and (3) a detailed calculation of carbon storage volumetrics for the Knox using three different methodologies. Seven regional cross sections document Knox formation distribution and thickness. Uniform stratigraphic nomenclature for all three states helps to resolve state-to-state differences that previously made it difficult to evaluate the Knox on a basin-wide scale. Correlations have also refined the interpretation of an important sandstone reservoir interval in southern Indiana and western Kentucky. This sandstone, a CO2 injection zone in the KGS 1 Blan well, is correlated with the New Richmond Sandstone of Illinois. This sandstone is over 350 ft (107 m) thick in parts of southern Indiana. It has excellent porosity and permeability at sufficient depths, and provides an additional sequestration target in the Knox. The New Richmond sandstone interval has higher predictability than vuggy and fractured carbonates, and will be easier to model and monitor CO2 movement after injection.
Information Summary, Area of Concern: Grand Calumet River, Indiana
1991-03-01
Page 179-183) 56 Waste Fill and Lagoon Sites Mapped Within the Grand Calumet Watershed (Source R13, Table 2-15) 57 Waste Fills of Greatest Concern...Percent Response for Single Species Sediment Bioassays from Indiana Harbor (Source RI, Table 18) 78 Aquatic Macroinvertebrates Collected from Stations 1, 2...3, 4, 5, and 12a, 3-4 May 88 (Source Rl, Table 22) 79 Aquatic Macroinvertebrates Collected from Stations 6, 7, 8, 9a, 10a, and 11, 3-4 and 19 May 88
Isochronization calculations for the Indiana University cyclotron
International Nuclear Information System (INIS)
Jones, W.P.
1975-01-01
A series of calculations using measured magnetic fields was performed to determine the optimal gradient coil currents for the wide range of operating conditions to be experienced by the Indiana University main stage cyclotron. Depending on the particle type to be accelerated and final energy desired, the required radial field increase varies from 0.5 percent to 22 percent. An iterative least squares fitting technique is used to minimize orbit time variations. For the acceleration of 200 MeV protons (330 revolutions, fourth harmonic), the maximum phase excursion is predicted to be less than two rf degrees. The technique used can be adapted to using measured phase histories to predict corrections to gradient coil currents. (auth)
2013-05-21
...-AM82 Prevailing Rate Systems; Definition of Vanderburgh County, Indiana, to a Nonappropriated Fund... County, IN; and Jefferson and Pulaski Counties, MO. The Federal Prevailing Rate Advisory Committee, the... as follows: [[Page 29658
Succession of insects on unreclaimed coal strip mine spoil banks in Indiana
Energy Technology Data Exchange (ETDEWEB)
Schrock, J.R.
1984-01-01
Selected sites at a western Indiana unreclaimed coal strip mine and adjacent undisturbed area sampled by Munsee in 1964 were restudied in 1981. Slope and exposure, soil pH and texture, vegetation and tree tallies, on-site rainfall and local weather records were used to characterize 18 spoilbanks and two unmined sites. Surface-active arthropods were sampled by replicated pitfall taps the summer of 1981 at the same locations and dates trapped by Munsee in 1964. Plant cover was sampled by a modified point-contact method. Trees over one inch dbh were tallied and measured for basal area. Clustering by similarity based on chi-square differences was performed for plants, trees, ants, springtails and ground beetles, using the undisturbed forest and a highly acid un-revegetated mined site as the extremes. Soil pH and texture changed rapidly on one moist spoilbank. Soil moisture levels generally decreased between 1964 and 1981 and depth of water penetration generally increased. Ant, springtail and carabid populations changed on revegetating sites. Myrmica spatulata and Smithistruma clypeata were major new ants on the sites in 1981. Iridomyrmex pruinosus analis and Pheidole bicarinata characteristic of barren spoilbanks in 1964 survived on only one remaining barren site in 1981. The collembolan Entomobrya quadrilineata decreased while Hypogastrura denticulata increased on the revegetating sites. Known habitat preference of some of these insects matched their occurrence on the spoilbanks.
International Nuclear Information System (INIS)
Bower, C.R.; Heinz, R.M.; Mufson, S.L.
1988-01-01
The Indiana University High Energy Physics Group, Task C has been actively involved in the MACRO experiment at Gran Sasso during the current contract year. MACRO is a large US-Italian Monopole, Astrophysics, and Cosmic Ray Observatory being built under the Gran Sasso Mountain outside of Rome. Indiana University is in charge of the US software effort. We have been performing extensive Monte Carlo design and data analysis calculations. We are also doing development work on the MACRO liquid scintillator. We are setting up a Quality Assurance liquid scintillator laboratory in Frascati, Italy. We are producing vertical scintillator tank endplates and calibration boats in our machine shop
Water-resources programs and hydrologic-information needs, Marion County, Indiana, 1987
Duwelius, R.F.
1990-01-01
Water resources are abundant in Marion County, Indiana, and have been developed for public and industrial supply, energy generation, irrigation, and recreation. The largest water withdrawals are from surface water, and the two largest water uses are public supply and cooling water for electrical-generating plants. Water-resources programs in the county are carried out by Federal, State and local agencies to address issues of surface and groundwater availability and quality. The programs of each agency are related to the functions and goals of the agency. Although each agency has specific information needs to fulfill its functions, sometimes these needs overlap, and there are times when the same hydrologic information benefits all. Overlapping information needs and activities create opportunities for interagency coordination and cooperation. Such cooperation could lead to a savings of dollars spent on water-resources programs and could assure an improved understanding of the water resources of the county. Representatives from four agencies-- the Indiana Department of Environmental Management, the Indiana Department of Natural Resources, the Indianapolis Department of Public Works, and the U.S. Geological Survey--met four times in 1987 to describe their own water-resources programs, to identify hydrologic-information needs, and to contact other agencies with related programs. This report presents the interagency findings and is intended to further communication among water resource agencies by identifying current programs and common needs for hydrologic information. Hydrologic information needs identified by the agency representatives include more precise methods for determining the volume of water withdrawals and for determining the volume of industrial and municipal discharges to surface water. Maps of flood-prone areas need to be updated as more of the county is developed. Improved aquifer maps of the inter-till aquifers are needed, and additional observation
The Coping Strategies of Nontraditional Female Students in Southwest Michigan and Northern Indiana
Davis, Desiree
2017-01-01
Problem: The purpose of this research study was to examine the coping strategies of nontraditional female students in a private university in Southwest Michigan, and a public university in Northern Indiana. According to Carney-Compton & Tan (2002), nontraditional female students characterize the leading emergent set of students beginning…
Fire and human history of a barren-forest mosaic in Southern Indiana
Richard P. Guyette; Daniel C. Dey; Michael C. Stambaugh
2002-01-01
The purpose of this paper is to provide quantitative fire history information from a historically unique region, the oak barrens of the Interior Low Plateau Ecoregion. We sampled 27 post oak (Quercus stellata Wangenh.) trees from the Boone Creek watershed in southern Indiana. The period of tree-ring record ranged in calendar years from 1654 to 1999...
Martin, Jeffrey D.; Crawford, Charles G.; Duwelius, Richard F.; Renn, Danny E.
1990-01-01
This report describes the physical and human environment and coal-mining history of west-central Indiana, with emphasis on six small watersheds selected for study of the hydrologic effects of surface coal mining. The report summarizes information on the geology, geomorphology, soils, climate, hydrology, water use, land use, population, and coal-mining history of Clay, Owen, Sullivan, and Vigo Counties in Indiana. Site-specific information is given on the morphology, geology, soils, land use, coal-mining history, and hydrologic instrumentation of the six watersheds, which are each less than 3 square miles in area.
Flood-inundation maps for the Elkhart River at Goshen, Indiana
Strauch, Kellan R.
2013-01-01
The U.S. Geological Survey (USGS), in cooperation with the Indiana Office of Community and Rural Affairs, created digital flood-inundation maps for an 8.3-mile reach of the Elkhart River at Goshen, Indiana, extending from downstream of the Goshen Dam to downstream from County Road 17. The inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science Web site at http://water.usgs.gov/osw/flood_inundation/, depict estimates of the areal extent and depth of flooding corresponding to nine selected water levels (stages) at the USGS streamgage at Elkhart River at Goshen (station number 04100500). Current conditions for the USGS streamgages in Indiana may be obtained on the Internet at http://waterdata.usgs.gov/. In addition, stream stage data have been provided to the National Weather Service (NWS) for incorporation into their Advanced Hydrologic Prediction Service (AHPS) flood warning system (http://water.weather.gov/ahps/). The NWS forecasts flood hydrographs at many places that are often colocated with USGS streamgages. NWS-forecasted peak-stage information may be used in conjunction with the maps developed in this study to show predicted areas of flood inundation. In this study, flood profiles were computed for the stream reach by means of a one-dimensional step-backwater model. The model was calibrated using the most current stage-discharge relation at the Elkhart River at Goshen streamgage. The hydraulic model was then used to compute nine water-surface profiles for flood stages at 1-foot (ft) intervals referenced to the streamgage datum and ranging from approximately bankfull (5 ft) to greater than the highest recorded water level (13 ft). The simulated water-surface profiles were then combined with a geographic information system (GIS) digital-elevation model (DEM), derived from Light Detection and Ranging (LiDAR) data having a 0.37-ft vertical accuracy and 3.9-ft horizontal resolution in order to delineate the area flooded at each
Downs, Philip G.
2012-01-01
This study examines the impact of the school accountability laws "No Child Left Behind" and Indiana's Public Law 221 on Superintendents' perception of their relationship with the Teachers' Union Leader in their mandatory discussion meetings. Both school accountability laws contain provisions for the Indiana's Department of Education to…
2010-08-17
... during the Regional Office normal hours of operation, and special arrangements should be made for... Background for This Action? On August 10, 2005, the Safe, Accountable, Flexible, Efficient Transportation... Indiana portions of the Cincinnati area have combined motor vehicle emissions budgets and thus must work...
2012-06-29
... compound (VOC) emissions limits and other restrictions on consumer products that are sold, supplied.... This supplementary information section is arranged as follows: I. Background II. Contents of Indiana's... approval is based on the model rule developed by the Ozone Transport Commission (OTC) for consumer products...
International Nuclear Information System (INIS)
1991-11-01
The Clean Water Act Amendments of 1987 mandate the development of biological criteria for evaluating the nation's surface waters. The requirements of Section 304(a) was implemented in Indiana to determine water resource degradation. A total of 197 headwater and wading stream sites were sampled in the Central Corn Belt Plain ecoregion in order to develop and calibrate an Index of Biotic Integrity for use in Indiana. Based on inherent variance within the ecoregion, sub-basins were established based on the concept of natural areas as recognized by Homoya et al. (1985). Site specific data; locality information; and species specific scoring criteria for tolerance classification, trophic guilds, and reproductive guilds are included in the appendix
Tsang, Hector W H; Wong, Alvin
2005-06-01
Job satisfaction has been increasingly regarded as an important outcome of vocational rehabilitation programs among people with mental illness. Chinese measures of job satisfaction for individuals with mental illness are however extremely scarce. The aim of this study was to translate the 32-item Indiana Job Satisfaction Scale to Chinese. By means of the expert panel method, the culturally relevant 28-item Chinese Version of Indiana Job Satisfaction Scale (CV-IJSS) was then finalized. A validation study among a group of 125 individuals with mental illness showed that the scale had acceptable psychometric properties. Coefficient alpha of the total score was 0.81 with subscales ranging from 0.63 to 0.87. Test re-test reliability as measured by ICC was 0.77 for the total score and ranged from 0.54 to 0.72 for the subscales. Factorial analysis yielded a four factor solution (general satisfaction, job ambiguity and stress, advancement and security, and job recognition) accounting for 44% of the total variance. The factor solution had similarities as well as differences when compared with the Indiana Job Satisfaction Scale. The differences are discussed in the light of cultural differences. Relationship between scores of CV-IJSS and work performance, quality of life and self-esteem was positive in general which may act as evidence to its concurrent validity. The Chinese Version of Indiana Job Satisfaction Scale is ready for use by rehabilitation professionals to assess vocational rehabilitation outcome for individuals with mental illness in Hong Kong and other Chinese societies. Directions for further studies are suggested.
Marshall, Edwin C; Meetz, Richard E; Harmon, L'erin L
2010-02-01
The vision screening of preschool and school children is a widely accepted procedure to detect vision problems that can interfere with learning. The Indiana General Assembly requires the annual vision screening with the Modified Clinical Technique (MCT) of all children upon their enrollment in either kindergarten or the first grade, with the exception of schools that apply for and receive waivers to conduct only a distance Snellen chart screening. In association with the Indiana State Department of Health, the Indiana University School of Optometry conducted an analysis of statewide school screening data on 36,967 grade 1 children from 139 of the 294 Indiana school corporations that submitted data for the 2000-2001 school year to examine differences in referral rate by screening method, the socioeconomic status of children screened, and academic performance. The MCT was used by 125 of the school corporations, and some other technique was used by 14 school corporations. Significant differences were seen when comparing the mean referral rates of school corporations that conduct the MCT against school corporations that do not conduct the MCT (P = 0.001) and in the rate of referral by median family income of the children screened (P = 0.050). A median family income of $46,500 was identified as the level at which the income-specific difference in referral rates ceased to be significant (P = 0.074). In spite of an observed tendency toward a higher referral rate for children who performed below average on the standardized Indiana Statewide Testing for Educational Progress Plus (ISTEP+) exam, results were found to be not significant (P = 0.116) when comparing the percentage of grade 1 children referred to an eye care provider in 2000-2001 with their percentages of passing both the English/language arts and mathematics components of the 2002-2003 ISTEP+ exam (in grade 3). Schools using the highly sensitive and specific MCT identified more visually at-risk children than
2010-04-13
... Station Unit 7. The scrubber adds moisture to the exhaust gas, which condenses as the gas stream cools. According to Indiana Department of Environmental Management (IDEM), the condensation causes unreliable... impairment caused by particulate and light impairment caused by moisture. The scrubber also removes some PM...
2010-02-24
...; Richard Wilson, on behalf of Radius Indiana; Citizens Against Rails-to-Trails; and several landowners..., Lawrence County Tourism Commission Executive Director; Gene McCracken, Lawrence County Economic Growth...
THE INDIANA ENTERPRISE ZONE PROGRAM: FISCAL IMPACT OF A JOB CREATION TAX CREDIT
Low, Sarah A.
2004-01-01
This paper estimated the fiscal impact of a job creation tax credit, a proposed incentive for establishments participating in the Indiana enterprise zone program. State unemployment insurance files were utilized with GIS to obtain enterprise zone data. Labor demand and labor supply were estimated. Job creation due to the credit was calculated from empirical results.
Dreams and Despair: The Early Years of the Great Depression in Gary, Indiana.
Indiana Historian, 1993
1993-01-01
Based on official reports, newspapers, the memories of citizens, and historical studies, a description of Gary, Indiana during the Great Depression shows how many people in Gary were affected by the Depression. Gary began to grow rapidly beginning in 1906 with the organization of two steel companies. Black, European, and Mexican immigrants came to…
Lu, Christine Y; Law, Michael R; Soumerai, Stephen B; Graves, Amy Johnson; LeCates, Robert F; Zhang, Fang; Ross-Degnan, Dennis; Adams, Alyce S
2011-01-01
Some Medicaid programs have adopted prior-authorization (PA) policies that require prescribers to request approval from Medicaid before prescribing drugs not included on a preferred drug list. This study examined the association between PA policies for lipid-lowering agents in Michigan and Indiana and the use and cost of this drug class among dual enrollees in Medicare and Medicaid. Michigan and Indiana claims data from the Centers for Medicare and Medicaid Services were assessed. Michigan Medicaid instituted a PA requirement for several lipid-lowering medications in March 2002; Indiana implemented a PA policy for drugs in this class in September 2002. Although the PA policies affected some statins, they predominantly targeted second-line treatments, including bile acid sequestrants, fibrates, and niacins. Individuals aged ≥18 years who were continuously dually enrolled in both Medicare and Medicaid from July 2000 through September 2003 were included in this longitudinal, population-based study, which included a 20-month observation period before the implementation of PA in Michigan and a 12-month follow-up period after the Indiana PA policy was initiated. Interrupted time series analysis was used to examine changes in prescription rates and pharmacy costs for lipid-lowering drugs before and after policy implementation. A total of 38,684 dual enrollees in Michigan and 29,463 in Indiana were included. Slightly more than half of the cohort were female (Michigan, 53.3% [20,614/38,684]; Indiana, 56.3% [16,595/29,463]); nearly half were aged 45 to 64 years (Michigan, 43.7% [16,921/38,684]; Indiana, 45.2% [13,321/29,463]). Most subjects were white (Michigan, 77.4% [29,957/38,684]; Indiana: 84.9% [25,022/29,463]). The PA policy was associated with an immediate 58% reduction in prescriptions for nonpreferred medications in Michigan and a corresponding increase in prescriptions for preferred agents. However, the PA policy had no apparent effect in Indiana, where there had
Challa, Sowmya
2017-01-01
The purpose of this study is to identify any trends in personality traits of students at a mid-western university along with the influence of gender, choice of STEM or non-STEM academic major, and level of education on personality traits. The chosen mid-western university is Indiana State University (ISU) located in Terre Haute, Indiana. This…
Spatial and Temporal Relationships of Old-Growth and Secondary Forests in Indiana, USA
Martin A. Spetich; George R. Parker; Eric J. Gustafson
1997-01-01
We examined the spatial pattern of forests in Indiana to: (1) determine the extent, connectivity and percent edge of all forests, (2) examine the change in connectivity among these forests if all riparian zones were replanted to forest or other native vegetation, (3) determine the location, spatial dispersion and percent edge of current old-growth forest remnants, (4)...
Predicting stump sprouting and competitive success of five oak species in southern Indiana
Dale R. Weigel; Chao-Ying Joanne Peng
2002-01-01
We measured 2188 oak trees (Quercus spp.) on the Hoosier National Forest in southern Indiana before and 1, 5, and 10 years after clear-cutting to determine the influence of parent tree age, diameter breast height, and site index on the probability that there was one or more living sprouts per stump: (i) 1 year after clear-cutting (sprouting...
Wier, C. E.; Wobber, F. J. (Principal Investigator); Russell, O. R.; Amato, R. V.; Leshendok, T. V.
1974-01-01
The author has identified the following significant results. New fracture detail of Indiana has been observed and mapped from ERTS-1 imagery. Studies so far indicate a close relationship between the directions of fracture traces mapped from the imagery, fractures measured on bedrock outcrops, and fractures measured in the underground mines. First hand observations and discussions with underground mine operators indicate good correlation of mine hazard maps prepared from ERTS-1/aircraft imagery and actual roof falls. The inventory of refuse piles/slurry ponds of the coal field of Indiana has identified over 225 such sites from past mining operations. These data will serve the State Legislature in making tax decisions on coal mining which take on increased importance because of the energy crisis.
Who knew? First Myotis sodalis (Indiana Bat) maternity colony in the coastal plain of Virginia
St. Germain, Michael J.; Kniowski, Andrew B.; Silvis, Alexander; Ford, W. Mark
2017-01-01
We report the first confirmed Myotis sodalis (Indiana Bat) maternity colony in Virginia, discovered at Fort A.P. Hill Military Reservation in Caroline County along the Piedmont-Coastal Plain Fall Line. Acoustic surveys conducted in 2014 indicated likely presence of Indiana Bats on the installation. Subsequent focal mist-netting during May–June 2015 resulted in capture of 4 lactating females that we subsequently radio tracked to a maternity colony site containing at least 20 individuals. The core roosting-area was comprised of Pinus taeda (Loblolly Pine) snags with abundant exfoliating bark and high solar exposure. This forest patch was adjacent to a large emergentshrub wetland and within a larger matrix of mature, mid-Atlantic hardwood forests. The site where we found the colony location is 140 km east of the nearest known hibernaculum and is outside of the previously documented extent of this species' occurrence.
Martin, Jeffrey D.; Crawford, Charles G.; Duwelius, R.F.; Renn, D.E.
1987-01-01
Information on the geology, geomorphology, soils, climate, hydrology, water use, land use, population, and coal mining history of Clay, Owen, Sullivan, and Vigo Counties in Indiana is summarized. Site-specific information is given on the morphology , geology, soils, land use, coal mining history, and hydrologic instrumentation of the six watersheds which are each less than 3 sq mi in area. The Wabash, White, and Eel Rivers are the major drainages in west-central Indiana. Average annual precipitation is about 39.5 in/yr and average annual runoff is about 13 in/yr. The most productive aquifers are confined or unconfined outwash aquifers located along the major rivers. Bedrock aquifers are regionally insignificant but are the sole source of groundwater for areas that lack outwash, alluvium, or sand and gravel lenses in till. Indiana has more than 17 billion short tons of recoverable coal reserves; about 11% can be mined by surface methods. Almost half of Indiana 's surface reserves are in Clay, Owen, Sullivan, and Vigo Counties. More than 50,000 acres in west-central Indiana have been disturbed by surface coal mining from 1941 through 1980. Big Slough and Hooker Creek are streams that drain unmined, agricultural watersheds. Row-crop corn and soybeans are the principal crops. Soils are moderately well drained silt loams, and the watersheds well developed dendritic drainage systems. Unnamed tributaries drain mined and reclaimed watersheds. Ridges of mine spoil have been graded to a gently rolling topography. Soils are well drained and consist of 6 to 12 inches of silt-loam topsoil that was stockpiled and then replaced over shale and sandstone fragments of the graded mine spoil. Grasses and legumes form the vegetative cover in each watershed. Pond Creek and an unnamed tributary to Big Branch are streams that drain mined and unreclaimed watersheds. Soils are very well drained shaly silty loams that have formed on steeply sloping banks. Both watersheds contain numerous
Flood-inundation maps for the Tippecanoe River near Delphi, Indiana
Menke, Chad D.; Bunch, Aubrey R.; Kim, Moon H.
2013-01-01
Digital flood-inundation maps for an 11-mile reach of the Tippecanoe River that extends from County Road W725N to State Road 18 below Oakdale Dam, Indiana (Ind.), were created by the U.S. Geological Survey (USGS) in cooperation with the Indiana Department of Transportation. The inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science Web site at http://water.usgs.gov/osw/flood_inundation/, depict estimates of the areal extent of flooding corresponding to selected water levels (stages) at USGS streamgage 03333050, Tippecanoe River near Delphi, Ind. Current conditions at the USGS streamgages in Indiana may be obtained online at http://waterdata.usgs.gov/in/nwis/current/?type=flow. In addition, the information has been provided to the National Weather Service (NWS) for incorporation into their Advanced Hydrologic Prediction Service (AHPS) flood warning system (http://water.weather.gov/ahps/). The NWS forecasts flood hydrographs at many places that are often co-located at USGS streamgages. That forecasted peak-stage information, also available on the Internet, may be used in conjunction with the maps developed in this study to show predicted areas of flood inundation. In this study, water-surface profiles were simulated for the stream reach by means of a hydraulic one-dimensional step-backwater model. The model was calibrated by using the most current stage-discharge relation at USGS streamgage 03333050, Tippecanoe River near Delphi, Ind., and USGS streamgage 03332605, Tippecanoe River below Oakdale Dam, Ind. The hydraulic model was then used to simulate 13 water-surface profiles for flood stages at 1-foot intervals reference to the streamgage datum and ranging from bankfull to approximately the highest recorded water level at the streamgage. The simulated water-surface profiles were then combined with a geographic information system digital elevation model (derived from Light Detection and Ranging (LiDAR) data) in order to delineate the
2013-08-19
... ensure that the structural components of each state's air quality management program are adequate to meet... SIP. The Indiana Department of Environmental Management (IDEM) has requested that EPA approve these... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 52 [EPA-R05-OAR-2011-0888; EPA-R05-OAR-2011-0969; EPA...
77 FR 3975 - Approval and Promulgation of Air Quality Implementation Plans; Indiana; Regional Haze
2012-01-26
... visibility for the worst days over the approximately 10-year period of the SIP and ensure no degradation in... Plastics (formerly GE Plastics), and Mittal Steel USA Inc.-Burns Harbor. Indiana did not consider EGUs in... (ESSROC Cement Corporation, SABIC Innovative Plastics, and Mittal Steel USA Inc.-- Burns Harbor) showed...
2013-09-10
... satisfy Indiana's VOC RACT requirements for the Lake and Porter County portion of the Chicago-Gary-Lake... revised its Industrial Solvent Cleaning rule, 326 IAC 8-17, for sources in Lake and Porter Counties as... emissions because there are no coating, ink, adhesive and resin manufacturers in Lake and Porter Counties...
The Impact of Educational Policy on English Learners in a Rural Indiana School Corporation
Burke, April M.
2015-01-01
Indiana English learners (ELs) constitute a rapidly growing portion of the state's school-aged population, and those classified as limited English proficient are low performers on the state test. The purpose of this embedded mixed methods study was to understand how school personnel respond to accountability mandates, interpret test scores, and…
2010-09-14
... addition to the sites listed in the table above, three sites, Barret Avenue, Cannons Lane, and Indiana... period. The first of these three sites, Barret Avenue (site number 21-111- 0048), ended operation at the... this period, the Barret Avenue site monitored an average annual concentration of 14.1 [micro]g/m\\3...
Las remesas indianas en Gran Canaria en el primer cuarto del siglo XVII
Directory of Open Access Journals (Sweden)
Elisa TORRES SANTANA
2009-12-01
Full Text Available El estudio de las remesas indianas, del dinero que bien en efectivo o en joyas afluía a la isla de Gran Canaria procedente del continente americano, ha sido un problema que ha preocupado en gran medida a los historiadores canarios. Sin embargo, su análisis siempre ha resultado problemático, por varias razones.
Kumar, Indraneel
In the last decade, Midwestern states including Indiana have experienced an unprecedented growth in utility scale wind energy farms. For example, by end of 2013, Indiana had 1.5 GW of wind turbines installed, which could provide electrical energy for as many as half-a-million homes. However, there is no statewide systematic framework available for the evaluation of wind farm impacts on endangered species, required necessary setbacks and proximity standards to infrastructure, and life cycle costs. This research is guided to fill that gap and it addresses the following questions. How much land is suitable for wind farm siting in Indiana given the constraints of environmental, ecological, cultural, settlement, physical infrastructure and wind resource parameters? How much wind energy can be obtained? What are the life cycle costs and economic and financial feasibility? Is wind energy production and development in a state an emission free undertaking? The framework developed in the study is applied to a case study of Indiana. A fuzzy logic based AHP (Analytic Hierarchy Process) spatial site suitability analysis for wind energy is formulated. The magnitude of wind energy that could be sited and installed comprises input for economic and financial feasibility analysis for 20-25 years life cycle of wind turbines in Indiana. Monte Carlo simulation is used to account for uncertainty and nonlinearity in various costs and price parameters. Impacts of incentives and cost variables such as production tax credits, costs of capital, and economies of scale are assessed. Further, an economic input-output (IO) based environmental assessment model is developed for wind energy, where costs from financial feasibility analysis constitute the final demand vectors. This customized model for Indiana is used to assess emissions for criteria air pollutants, hazardous air pollutants and greenhouse gases (GHG) across life cycle events of wind turbines. The findings of the case study include
2010-02-24
... for Lake and Porter Counties in Indiana AGENCY: Environmental Protection Agency (EPA). ACTION: Final... available control technology (RACT) requirements for the Lake and Porter County portion of the Chicago-Gary... subsequently submitted the required VOC RACT rules for the Lake and Porter County portion of that nonattainment...
Toh, Evelyn; Gangaiah, Dharanesh; Batteiger, Byron E; Williams, James A; Arno, Janet N; Tai, Albert; Batteiger, Teresa A; Nelson, David E
2017-02-01
At a clinic in Indianapolis, Indiana, USA, we observed an increase in Neisseria gonorrhoeae-negative men with suspected gonococcal urethritis who had urethral cultures positive for N. meningitidis. We describe genomes of 2 of these N. meningitidis sequence type 11 complex urethritis isolates. Clinical evidence suggests these isolates may represent an emerging urethrotropic clade.
Population-level impact of white-nose syndrome on the endangered Indiana bat
Thogmartin, Wayne E.; King, R. Andrew; McKann, Patrick C.; Szymanski, Jennifer A.; Pruitt, Lori
2012-01-01
Establishing status and trend for an endangered species is critical to recovery, especially when it is faced with a nascent extinction agent. We calculated, with hierarchical log-linear change-point models, hibernaculum-level population trends between 1983 and 2009 for the endangered Indiana bat (Myotis sodalis) now subjected to the fast-spreading fungal disease white-nose syndrome. We combined trends from 222 wintering populations before and after onset of the disease to determine trend for clusters of interacting wintering populations, recovery units, and the species. Before onset of the disease, a west-to-east gradient in trends existed, with westernmost populations declining and easternmost populations increasing in abundance. The species as a whole, however, was stationary between 1983 and 2005 (-0.5% mean annual change; 95% confidence interval [CI] = -2.8, +1.8%). Estimated mean population size in 2009 was 377,124 bats (195,398-957,348), with large variance apparently caused by white-nose syndrome. With the onset of white-nose syndrome (2006-2009), the species exhibited a 10.3% annual decline (95% CI = -21.1, +2.0%). White-nose syndrome is having an appreciable influence on the status and trends of Indiana bat populations, stalling and in some cases reversing population gains made in recent years.
2013-01-29
... document that growth and control strategy assumptions for non-motor vehicle sources continue to be valid... the projections need to be made. Ohio and Indiana find that growth and control strategy assumptions... original submittal for the years 2005, 2015, and 2020. As a result, the growth and control strategy...
David J. Nowak; Eric J. Greenfield
2010-01-01
This report details how land cover and urbanization vary within the states of Illinois, Indiana, Michigan, Ohio, and Wisconsin by community (incorporated and census designated places), county subdivision, and county. Specifically this report provides critical urban and community forestry information for each state including human population characteristics and trends,...
2012-10-26
... emissions model. Once this proposal is finalized, future transportation conformity determinations would use... Motor Vehicle Emissions Simulator (MOVES) 2010a emissions model. Indiana submitted this request to EPA... Regional Office official hours of business are Monday through Friday, 8:30 a.m. to 4:30 p.m., excluding...
2010-03-12
... the Clean Air Act (CAA) affecting the Indiana portion (Lake and Porter Counties) of the Chicago-Gary... Oxides (NO X ) in Lake and Porter Counties from CAA Reasonably Available Control Technology (RACT... Lake and Porter Counties, also published in today's Federal Register, the Chicago-Gary-Lake County, IL...
NSGIC State | GIS Inventory — HOSPITALS_HAZUS_IN is a point shapefile that shows locations of hospitals and clinics in Indiana. HOSPITALS_HAZUS_IN was derived from the shapefile named "HOSPITAL."...
Feasibility of a low-cost hearing screening in rural Indiana
Directory of Open Access Journals (Sweden)
Khalid M. Khan
2017-09-01
Full Text Available Abstract Background Hearing loss remains a neglected public health issue in the rural and agricultural communities in the United States and therefore, promotion of a low-cost hearing screening may be important for these underserved populations. The major objectives of our study were to assess feasibility of a low-cost telephone-administered hearing test in rural Indiana and to identify the challenges, barriers and viable implementation strategies associated with this test. Also, we evaluated whether a focus group session could change the hearing health attitude of rural residents. Methods We recruited 126 adults from six rural Indiana counties who participated in study activities in the following order: 1 a pre-focus group demographic, knowledge and attitude survey, 2 a focus group for discussing the feasibility of a telephone-administered hearing screening, 3 a post focus group attitude survey and 4 hearing was screened using an audiometer and self-assessment scale. These activities generated both qualitative and quantitative data, which were subsequently analyzed. Results Hearing impairment was perceived as an important public health issue. Many participants expressed interests to try the low-cost National Hearing Test (NHT. However, participants recommended NHT to be facilitated by community organizations to provide access to landline phones. The focus group turned out to be an excellent awareness building activity producing significant improvement in hearing health attitudes. Comparison of self and audiometric evaluations indicated underestimation of hearing handicap in our rural study population. Conclusions The study results underscore the urgent need for an effective strategy to promote low-cost hearing screening in rural US communities.
MICHIGAN/INDIANA: Siberian Snakes strike again
International Nuclear Information System (INIS)
Anon.
1993-01-01
Full text: Siberian snakes are showing themselves to be even more deadly than expected in killing their prey, the depolarizing resonances which would make it very difficult to accelerate polarized protons to TeV energies at accelerators such as the Tevatron, UNK, LHC, and SSC. The snake concept was proposed in the mid-1970s by Siberians Yaroslav Derbenev and Anatoly Kondratenko at Novosibirsk, but the snakes lay almost dormant until Owen Chamberlain, Ernest Courant, Alan Krisch, and the late Kent Terwilliger organized the 1985 Superconducting Supercollider (SSC) polarized beam workshop in Ann Arbor, which highlighted the need to test the concept. The idea is to rotate the spin through 180° on each turn in the ring. With such successive spin flips, the depolarizing effects seen in one turn should be cancelled by an equal and opposite perturbation on the subsequent turn. The new Cooler Ring at the Indiana University Cyclotron Facility then seemed an excellent test site for these eager but untested serpents. The Michigan/lndiana/Brookhaven team led by Krisch constructed the world's first snake and found that it could easily overcome its initial enemy, the imperfection depolarizing resonances caused by ring magnet imperfections (January/February 1990, page 20). In the next few years the growing team of ''herpetologists'' showed that Siberian snakes could overcome all kinds of depolarizing resonances, including the intrinsic kind (caused by the vertical betatron oscillations which keep the beam focused) and the synchrotron resonances (caused by synchrotron oscillations in energy). The team also discovered a new type of snake that was inadvertently built into the cooling section. This socalled type-3 snake rotates the spin around the vertical direction. A full type-1 snake (such as the team's superconducting solenoid magnet) rotates the spin by 180° around the beam direction; a type-2 snake rotates the spin around the radial direction
Status of the low energy neutron source at Indiana University
International Nuclear Information System (INIS)
Baxter, D.V.; Cameron, J.M.; Derenchuk, V.P.; Lavelle, C.M.; Leuschner, M.B.; Lone, M.A.; Meyer, H.O.; Rinckel, T.; Snow, W.M.
2005-01-01
The National Science Foundation has recently approved funding for LENS (the low energy neutron source) at Indiana University and construction of this facility has begun. LENS represents a new paradigm for economically introducing neutron scattering into a university or industrial setting. In this design, neutrons are produced in a long-pulse (1 ms) mode through (p,n) reactions on a water-cooled Be target and the target is tightly coupled to a cryogenic moderator with a water reflector. This design gives a facility suitable for materials research, the development of new neutron instrumentation, and the education of new neutron scientists
Flood-inundation maps for the Mississinewa River at Marion, Indiana, 2013
Coon, William F.
2014-01-01
Digital flood-inundation maps for a 9-mile (mi) reach of the Mississinewa River from 0.75 mi upstream from the Pennsylvania Street bridge in Marion, Indiana, to 0.2 mi downstream from State Route 15 were created by the U.S. Geological Survey (USGS) in cooperation with the Indiana Office of Community and Rural Affairs. The flood inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science Web site at http://water.usgs.gov/osw/flood_inundation, depict estimates of the areal extent and depth of flooding corresponding to selected water levels (stages) at the USGS streamgage on the Mississinewa River at Marion (station number 03326500). Near-real-time stages at this streamgage may be obtained on the Internet from the USGS National Water Information System at http://waterdata.usgs.gov/ or the National Weather Service (NWS) Advanced Hydrologic Prediction Service at http://water.weather.gov/ahps/, which also forecasts flood hydrographs at this site. Flood profiles were computed for the stream reach by means of a one-dimensional step-backwater model. The model was calibrated by using the current stage-discharge relation at the Mississinewa River streamgage, in combination with water-surface profiles from historic floods and from the current (2002) flood-insurance study for Grant County, Indiana. The hydraulic model was then used to compute seven water-surface profiles for flood stages at 1-fo (ft) intervals referenced to the streamgage datum and ranging from 10 ft, which is near bankfull, to 16 ft, which is between the water levels associated with the estimated 10- and 2-percent annual exceedance probability floods (floods with recurrence interval between 10 and 50 years) and equals the “major flood stage” as defined by the NWS. The simulated water-surface profiles were then combined with a Geographic Information System digital elevation model (derived from light detection and ranging (lidar) data having a 0.98 ft vertical accuracy and 4.9 ft
2012-03-01
... Promulgation of Air Quality Implementation Plans; Indiana; Lead Ambient Air Quality Standards AGENCY... incorporates the National Ambient Air Quality Standards (NAAQS) for Pb promulgated by EPA in 2008. DATES: This... FR 66964) and codified at 40 CFR 50.16, ``National primary and secondary ambient air quality...
2012-10-10
... Northeastern Railroad Company--Abandonment Exemption--In Branch and St. Joseph Counties, MI Indiana... Branch County, Mich., and milepost 100.69 near Sturgis in St. Joseph County, Mich. (the Line). The Line... .'' Decided: October 2, 2012. By the Board, Rachel D. Campbell, Director, Office of Proceedings. Derrick A...
75 FR 34450 - Filing Dates for the Indiana Special Election in the 3rd Congressional District
2010-06-17
... 3rd Congressional District AGENCY: Federal Election Commission. ACTION: Notice of filing dates for special election. SUMMARY: Indiana has scheduled a Special General Election on November 2, 2010, to fill.... Committees required to file reports in connection with the Special General Election on November 2, 2010...
The 3D Elevation Program: summary for Indiana
Carswell, William J.
2014-01-01
Elevation data are essential to a broad range of applications, including forest resources management, wildlife and habitat management, national security, recreation, and many others. For the State of Indiana, elevation data are critical for flood risk management, agriculture and precision farming, natural resources conservation, infrastructure and construction management, aviation navigation and safety, and other business uses. Today, high-density light detection and ranging (lidar) data are the primary sources for deriving elevation models and other datasets. Federal, State, Tribal, and local agencies work in partnership to (1) replace data that are older and of lower quality and (2) provide coverage where publicly accessible data do not exist. A joint goal of State and Federal partners is to acquire consistent, statewide coverage to support existing and emerging applications enabled by lidar data.
Paleozoic stratigraphy of two areas in southwestern Indiana
International Nuclear Information System (INIS)
Droste, J.B.
1976-09-01
Two areas recommended for evaluation as solid waste disposal sites lie along the strike of Paleozoic rocks in southwestern Indiana. Thin Pennsylvanian rocks and rocks of the upper Mississippian are at the bedrock surface in maturely dissected uplands in both areas. The gross subsurface stratigraphy beneath both areas is the same, but facies and thickness variation in some of the subsurface Paleozoic units provide for some minor differences between the areas. Thick middle Mississippi carbonates grade downward into clastics of lower Mississippian (Borden Group) and upper Devonian (New Albany Shale) rocks. Middle Devonian and Silurian rocks are dominated by carbonate lithologies. Upper Ordovician (Maquoketa Group) overly carbonates of middle Ordovician age. Thick siltstone and shale of the Borden Group-New Albany Shale zone and Maquoketa Group rocks should be suitable for repository development
New Chicago-Indiana computer network prepared to handle massive data flow
2006-01-01
"The Chicago-Indiana system is ont of five Tier-2 (regional) centers in the United States that will receive data from one of four massive detectors at the Large Hadron Collider at CERN, the European particle physics laboratory in Geneva. When the new instrument begins operating late next year, beams of protons will collide 40 million times a second. When each of those proton beams reaches full intensity, each collision will produce approximately 23 interactions between protons that will create various types of subatomic particles." (1,5 page)
2013-04-19
... addressing the NAAQS for nitrogen dioxide (NO 2 ), sulfur dioxide (SO 2 ), PM 10 and PM 2.5 . EPA will be... IDEM's requested removal of the annual PM 10 NAAQS is approvable. Indiana also requests in its... into the SIP, specifically at 326 IAC 1-4-1. These terms include ``SO 2 '', ``CO'' (carbon monoxide...
International Nuclear Information System (INIS)
Olyphant, G.A.; Harper, D.
1998-01-01
Bedrock strata of the mining district of Indiana (Indiana Coal Mining District, ICMD) include numerous coalbeds of economic importance, together with underclays, roof shales, limestones, and sandstones of Pennsylvanian age. These are typically poor aquifers with low hydraulic conductivities and specific yields. Surficial materials include loess, till, alluvium, and other deposits of pleistocene age. The loess and till also have low hydraulic conductivities, so that very few shallow aquifers exist in the vicinities of abandoned mine land (AML) sites, except where they are close to the alluvial fill of large bedrock valleys. The hydrologic cascade at AML sites in Indiana is strongly conditioned by the existence of elevated deposits of coarse-grained coal-preparation refuse and flooded underground mine workings. Flooded mines are the principal conduits of groundwater flow in the area, but their boundaries, flowpaths, and mechanisms of recharge and discharge are very different from those of natural aquifers and are poorly understood. Acidic mine drainage often emerges as seepages and springs on the edges of the elevated refuse deposits, but the low permeability of the natural surficial materials and bedrock inhibits the development of off-site groundwater contaminant plumes. The water balance across the surface of the refuse deposits is critical to reclamation planning and success. Enhancing runoff through reduction of infiltration capacity has the beneficial effect of reducing recharge through the acid-generating refuse, but the excess runoff may be accompanied by soil erosion that can lead to reclamation failure. Furthermore, during cool seasons and stormy periods, a well vegetated surface promotes recharge through increased infiltration, resulting in greater rates of acidic baseflow seepage. Passive Anoxic Limestone Drains (PALDs) have been successfully coupled with wetland treatment systems to improve surface waters that discharge from AML sites. Storm runoff from
2012-04-25
... National Lakeshore, 1100 North Mineral Springs Road, Porter, Indiana 46304; telephone 219-395- 1550. A copy... time to ensure that the local deer population does not become a dominant force that negatively... populations that provides multi-year (three to five years) efficacy for does. Alternative C would include all...
Indiana Wesleyan University SPS Physics Outreach to Rural Middle School and High School Students
Ostrander, Joshua; Rose, Heath; Burchell, Robert; Ramos, Roberto
2013-03-01
The Society of Physics Students chapter at Indiana Wesleyan University is unusual in that it has no physics major, only physics minors. Yet while just over a year old, IWU-SPS has been active in performing physics outreach to middle school and high school students, and the rural community of Grant County. Our year-old SPS chapter consists of majors from Chemistry, Nursing, Biology, Exercise Science, Computer Science, Psychology, Pastoral Studies, and Science Education, who share a common interest in physics and service to the community. IWU currently has a physics minor and is currently working to build a physics major program. Despite the intrinsic challenges, our multi-disciplinary group has been successful at using physics demonstration equipment and hands-on activities and their universal appeal to raise the interest in physics in Grant County. We report our experience, challenges, and successes with physics outreach. We describe in detail our two-pronged approach: raising the level of physics appreciation among the IWU student community and among pre-college students in a rural community of Indiana. Acknowledgements: We acknowledge the support of the Society of Physics Students through a Marsh White Outreach Award and a Blake Lilly Prize.
National Research Council Canada - National Science Library
Preston, Kurt
1998-01-01
...), and octahydro-1,3,5,7-tetranitro-1,3,5,7- tetrazocine (HMX). The Naval Surface Warfare Center (NSWC), Crane, Indiana, provides material and logistic support to the Navy's weapon systems, including expendable and nonexpendable ordnance items...
Economic and policy analysis for solar PV systems in Indiana
International Nuclear Information System (INIS)
Jung, Jinho; Tyner, Wallace E.
2014-01-01
In recent years, the energy market in the US and globally is expanding the production of renewable energy. Solar energy for electricity is also expanding in the US. Indiana is one of the states expanding solar energy with solar photovoltaic (PV) systems. Therefore, we conduct benefit cost analysis with several uncertain input variables to determine the economics of adopting solar PV systems in Indiana based on policy instruments that could increase adoption of solar PV systems. The specific objectives are analyses of the cost distribution of solar PV systems compared with grid electricity in homes and estimating the probability that solar can be cheaper than electricity from grids under different policy combinations. We first do the analysis under current policy and then the analysis under potential policy options for a variety of scenarios. Also, the results inform government policy makers on how effective the alternative policies for encouraging solar PV systems are. The results show that current policies are important in reducing the cost of solar PV systems. However, with current policies, there is only 50–50 chance of solar being cheaper than electricity from grids. If potential policies are implemented, solar PV systems can be more economical than grid electricity. - Highlights: • We investigate the economics of solar PV systems based on policy instruments. • We do scenario analyses under different combinations of policies. • We examine the probability of solar being cheaper than grid electricity for each scenario. • With current policies, there is 50–50 chance of solar being cheaper than the grid. • With depreciation and carbon tax, solar is much more economical than the grid
Habitat use by bats in two Indiana forests prior to silvicultural treatments for oak regeneration
Jeremy J. Sheets; Joseph E. Duchamp; Megan K. Caylor; Laura D' Acunto; John O. Whitaker; Virgil Jr. Brack; Dale W. Sparks
2013-01-01
As part of a study examining the effects of silvicultural treatments for oak regeneration on habitat use by bats, we surveyed forest stands prior to the implementation of treatments in two state forests in Indiana. Interior forest sites corresponding to areas designated for silvicultural treatments were surveyed for 2 nights each during the summers of 2007 and 2008....
Susan Loeb; Joy O' Keefe
2014-01-01
The Indiana bat (Myotis sodalist) is an endangered species and the northern long-eared bat (M. septentrionalis) has been proposed for listing as endangered. Both species are found throughout the Appalachians, and they commonly inhabit fire-dependent ecosystems such as pine and pine-oak forests. Due to their legal status, prescribed burns in areas where these species...
Toh, Evelyn; Gangaiah, Dharanesh; Batteiger, Byron E.; Williams, James A.; Arno, Janet N.; Tai, Albert; Batteiger, Teresa A.
2017-01-01
At a clinic in Indianapolis, Indiana, USA, we observed an increase in Neisseria gonorrhoeae–negative men with suspected gonococcal urethritis who had urethral cultures positive for N. meningitidis. We describe genomes of 2 of these N. meningitidis sequence type 11 complex urethritis isolates. Clinical evidence suggests these isolates may represent an emerging urethrotropic clade. PMID:28098538
2013-05-15
... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 52 [EPA-R05-OAR-2013-0021;EPA-R05-OAR-2013-0022; FRL-9812-3] Approval and Promulgation of Air Quality Implementation Plans; Indiana; Lake and Porter... Porter State Implementation Plans (SIPs) for the 1997 8-hour ozone standard, and the 1997 annual fine...
2011-12-07
...] Approval and Promulgation of Air Quality Implementation Plans; Indiana; Redesignation of Lake and Porter...). ACTION: Final rule. SUMMARY: EPA is taking several related actions affecting Lake and Porter Counties and... redesignation of Lake and Porter Counties to attainment of the 1997 annual PM 2.5 standard. EPA is approving, as...
An overview of experiments at the Indiana University Cyclotron Facility
International Nuclear Information System (INIS)
Foster, C.C.
1981-01-01
The research program of the Indiana University Cyclotron Facility (IUCF) is a product of many factors. Among these factors are the properties of the beams of charged particles available from the cyclotrons, the facilities and personnel available to support experiments, the guidance of the Program Advisory Committee, the decisions of the directors and the ideas and work of the users of the facility. It is the author's purpose, in this brief overview paper, to provide a summary of features and properties of accelerator operation, beams, experimental facilities and the user interaction of interest to a perspective experimental user and a discussion of recent results of measurements made at IUCF
Mercury and methylmercury in reservoirs in Indiana
Risch, Martin R.; Fredericksen, Amanda L.
2015-01-01
Mercury (Hg) is an element that occurs naturally, but evidence suggests that human activities have resulted in increased amounts being released to the atmosphere and land surface. When Hg is converted to methylmercury (MeHg) in aquatic ecosystems, MeHg accumulates and increases in the food web so that some fish contain levels which pose a health risk to humans and wildlife that consume these fish. Reservoirs unlike natural lakes, are a part of river systems that are managed for flood control. Data compiled and interpreted for six flood-control reservoirs in Indiana showed a relation between Hg transport, MeHg formation in water, and MeHg in fish that was influenced by physical, chemical, and biological differences among the reservoirs. Existing information precludes a uniform comparison of Hg and MeHg in all reservoirs in the State, but factors and conditions were identified that can indicate where and when Hg and MeHg levels in reservoirs could be highest.
Risch, M.R.; Robinson, B.A.
2001-01-01
Borehole and surface geophysics were used to investigate ground-water quality affected by a road-deicing salt-storage facility located near a public water-supply well field. From 1994 through 1998, borehole geophysical logs were made in an existing network of monitoring wells completed near the bottom of a thick sand aquifer. Logs of natural gamma activity indicated a uniform and negligible contribution of clay to the electromagnetic conductivity of the aquifer so that the logs of electromagnetic conductivity primarily measured the amount of dissolved solids in the ground water near the wells. Electromagneticconductivity data indicated the presence of a saltwater plume near the bottom of the aquifer. Increases in electromagnetic conductivity, observed from sequential logging of wells, indicated the saltwater plume had moved north about 60 to 100 feet per year between 1994 and 1998. These rates were consistent with estimates of horizontal ground-water flow based on velocity calculations made with hydrologic data from the study area.
Flood-inundation maps for the Driftwood River and Sugar Creek near Edinburgh, Indiana
Fowler, Kathleen K.; Kim, Moon H.; Menke, Chad D.
2012-01-01
Digital flood-inundation maps for an 11.2 mile reach of the Driftwood River and a 5.2 mile reach of Sugar Creek, both near Edinburgh, Indiana, were created by the U.S. Geological Survey (USGS) in cooperation with the Camp Atterbury Joint Maneuver Training Center, Edinburgh, Indiana. The inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science Web site at http://water.usgs.gov/osw/flood_inundation/, depict estimates of the areal extent of flooding corresponding to selected water levels (stages) at the USGS streamgage 03363000 Driftwood River near Edinburgh, Ind. Current conditions at the USGS streamgage in Indiana may be obtained on the Internet at http://waterdata.usgs.gov/in/nwis/current/?type=flow. In addition, the information has been provided to the National Weather Service (NWS) for incorporation into their Advanced Hydrologic Prediction Service (AHPS) flood warning system at http://water.weather.gov/ahps/. The NWS forecasts flood hydrographs at many places that are often collocated at USGS streamgages. That forecasted peak-stage information, also available on the Internet, may be used in conjunction with the maps developed in this study to show predicted areas of flood inundation. For this study, flood profiles were computed for the stream reaches by means of a one-dimensional step-backwater model. The model was calibrated using the most current stage-discharge relations at the USGS streamgage 03363000 Driftwood River near Edinburgh, Ind. The hydraulic model was then used to determine elevations throughout the study reaches for nine water-surface profiles for flood stages at 1-ft intervals referenced to the streamgage datum and ranging from bankfull to nearly the highest recorded water level at the USGS streamgage 03363000 Driftwood River near Edinburgh, Ind. The simulated water-surface profiles were then combined with a geospatial digital elevation model (derived from Light Detection and Ranging (LiDAR) data) in order to
International Nuclear Information System (INIS)
Schwartz, S.Y.; Lay, T.; Young, C.J.
1988-12-01
Earthquake activity in the Western Ohio--Indiana region has been monitored with a precision seismograph network consisting of nine stations located in west-central Ohio and four stations located in Indiana. No local earthquakes have been recorded during this report period. The low level of local seismicity in the last two years suggests that the occurrence of the m/sub b/ = 4.5 earthquake, in St. Marys, Ohio, on July 12, 1986, released most of the crustal strain accumulated. Four regional events were well recorded by the array stations during this year. Their magnitudes range from m/sub bLg/ = 3. 2--4.5. The largest of these events (7 September 1988 in northeastern Kentucky, m/sub b/ = 4.5) had minor damage reported. Upper mantle P wave (P/sub n/) velocities beneath the array stations have been investigated using relative time differences of arrivals recorded by stations located at similar back azimuth from given regional earthquake epicenters. Apparent P/sub n/ velocities determined from arrival times of earthquakes in northeastern Ohio (back azimuths of 50--70/degree/) reveal similar values to those obtained from earthquakes in southern Illinois and southeastern Missouri (back azimuths of 230--250/degree/). Comparable apparent P/sub n/ velocities obtained for rays traveling both to the northeast and to the southwest requires that the Moho not dip in either of these directions beneath the stations. The average P/sub n/ velocity of 8.41 km/s is similar to the values of 8.5 and 8.4 km/s that we obtained previously from the slope of P/sub n/ travel time curves constructed for earthquakes from northeastern Ohio and southeastern Illinois respectively. These values were slightly higher than the value of 8.2 km/s obtained previously from earthquakes in southwestern Indiana, northeastern Kentucky, and northeastern Missouri. 13 refs., 11 figs., 5 tabs
Naylor, S.; Gustin, A. R.; Ellett, K. M.
2012-12-01
Weather stations that collect reliable, sustained meteorological data sets are becoming more widely distributed because of advances in both instrumentation and data server technology. However, sites collecting soil moisture and soil temperature data remain sparse with even fewer locations where complete meteorological data are collected in conjunction with soil data. Thanks to the advent of sensors that collect continuous in-situ thermal properties data for soils, we have gone a step further and incorporated thermal properties measurements as part of hydrologic instrument arrays in central and northern Indiana. The coupled approach provides insights into the variability of soil thermal conductivity and diffusivity attributable to geologic and climatological controls for various hydrogeologic settings. These data are collected to facilitate the optimization of ground-source heat pumps (GSHPs) in the glaciated Midwest by establishing publicly available data that can be used to parameterize system design models. A network of six monitoring sites was developed in Indiana. Sensors that determine thermal conductivity and diffusivity using radial differential temperature measurements around a heating wire were installed at 1.2 meters below ground surface— a typical depth for horizontal GSHP systems. Each site also includes standard meteorological sensors for calculating reference evapotranspiration following the methods by the Food and Agriculture Organization (FAO) of the United Nations. Vadose zone instrumentation includes time domain reflectometry soil-moisture and temperature sensors installed at 0.3-meter depth intervals down to a 1.8-meter depth, in addition to matric potential sensors at 0.15, 0.3, 0.6, and 1.2 meters. Cores collected at 0.3-meter intervals were analyzed in a laboratory for grain size distribution, bulk density, thermal conductivity, and thermal diffusivity. Our work includes developing methods for calibrating thermal properties sensors based on
Austin, Megan J.
2015-01-01
Little is known about the supply side of voucher programs, despite schools' central role in program effectiveness. Using survey and interview data on the Indiana Choice Scholarship Program (ICSP), I analyze schools' participation decisions and early implementation experiences to understand better how schools respond to program regulations. I find…
National Research Council Canada - National Science Library
Antweiler, Ronald C; Smith, Richard L; Voytek, Mary A; Boehlke, John-Karl; Richards, Kevin D
2004-01-01
Methods of data collection and results of analyses are presented for Lagrangian and synoptic water-quality data collected from two agricultural drainages, the Iroquois River in northwestern Indiana...
International Nuclear Information System (INIS)
Martin, J.D.; Crawford, C.G.; Duwelius, R.F.; Renn, D.E.
1990-01-01
West-central Indiana is underlain by coal-bearing Pennsylvanian rocks. Nearly all of the area has been glaciated at least once and is characterized by wide flood plains and broad, flat uplands. The most productive aquifers are confined or unconfined outwash aquifers located along the major rivers. Bedrock aquifers are regionally insignificant but are the sole source of groundwater for areas that lack outwash, alluvium, or sand and gravel lenses in till. Indiana has > 17 billion short tons of recoverable coal reserves; about 11% can be mined by surface methods. More than 50,000 acres in west-central Indiana were disturbed by surface coal mining from 1941 through 1980. Ridges of mine spoil have been graded to a gently rolling topography. Soils are well drained and consist of 6 to 12 inches of silt-loam topsoil that was stockpiled and then replaced over shale and sandstone fragments of the graded mine spoil. Grasses and legumes form the vegetative cover in each watershed. Pond Creek and the unnamed tributary to Big Branch are streams that drain mined and unreclaimed watersheds. Approximately one-half of the Pond Creek watershed is unmined,agricultural land. Soils are very well drained shaly silty loams that have formed on steeply sloping spoil banks. Both watersheds contain numerous impoundments of water and have enclosed areas that do not contribute surface runoff to streamflow. The ridges of mine spoil are covered with pine trees, but much of the soil surface is devoid of vegetation
Indiana's New and (Somewhat) Improved K-12 School Finance System. School Choice Issues in the State
Aud, Susan L.
2005-01-01
Education finance policy has become an urgent concern in many state legislatures. Demands for greater equity and accountability have forced states to review, and in many cases to revise, the method by which schools are funded. This study sheds light on Indiana's financing of public K-12 education by providing a clear explanation of the components…
2013-09-13
... ENVIRONMENTAL PROTECTION AGENCY [FRL-9900-95--Region 5] Proposed Listing of Additional Waters To Be Included on Indiana's 2010 List of Impaired Waters Under the Clean Water Act AGENCY: Environmental Protection Agency (EPA). ACTION: Reopening of comment period. SUMMARY: EPA is reopening the comment period...
Dechausay, Nadine; Anzelone, Caitlin
2016-01-01
This report describes a collaboration between the Indiana Office of Early Childhood and Out-of-School Learning (OECOSL) and the Behavioral Interventions to Advance Self-Sufficiency (BIAS) team. The OECOSL is the lead agency responsible for administering the state's Child Care and Development Fund (CCDF), which provides child care subsidies to…
Rivera, Rebecca L; Maulding, Melissa K; Abbott, Angela R; Craig, Bruce A; Eicher-Miller, Heather A
2016-11-01
Food insecurity is negatively associated with US children's dietary intake and health. The Supplemental Nutrition Assistance Program-Education (SNAP-Ed) aims to alleviate food insecurity by offering nutrition, budgeting, and healthy lifestyle education to low-income individuals and families. The objective of this study was to evaluate the long-term impact of the Indiana SNAP-Ed on food security among households with children. A randomized, controlled, parallel study design with SNAP-Ed as an intervention was carried out during a 4- to 10-wk intervention period. Intervention group participants received the first 4 Indiana SNAP-Ed curriculum lessons. Study participants (n = 575) were adults aged ≥18 y from low-income Indiana households with ≥1 child living in the household. Both treatment groups completed an assessment before and after the intervention period and 1 y after recruitment. The 18-item US Household Food Security Survey Module was used to classify the primary outcomes of food security for the household and adults and children in the household. A linear mixed model was used to compare intervention with control group effects over time on food security. Mean ± SEM changes in household food security score and food security score among household adults from baseline to 1-y follow-up were 1.2 ± 0.4 and 0.9 ± 0.3 units lower, respectively, in the intervention group than in the control group (P security score from baseline to 1-y follow-up among household children was not significantly different in the intervention group compared with the control group. SNAP-Ed improved food security over a longitudinal time frame among low-income Indiana households with children in this study. SNAP-Ed may be a successful intervention to improve food security. © 2016 American Society for Nutrition.
1994-09-01
and the surrounding portions of central Indiana consists of level plains or gently rolling hills, with streams and small closed depressions ...in enclosed areas, such as basements. The cancer risk caused by exposure, through the inhalation of radon, is currently a topic of concern. 3-70...enter quality should he Implemented. Additional mitigative eggecimnetely 20 Fredetral endeavored, thraetened and candidate mamas should alao he
2011-11-18
..., and his principal place of business, the Pain Management and Surgery Center (Respondent PMSC), holder... Certificate of Registration, BP4917413, issued to Respondent Pain Management and Surgery Center of Southern..., M.D. and Pain Management and Surgery Center of Southern Indiana, to renew or modify such...
Gibbs, Vanita M., Comp.; Waterman, David C., Comp.
Intended for reading teachers, this pamphlet contains the presentations of the 14th annual reading conference at Indiana State University, beginning with opening remarks by David C. Waterman and welcoming comments by J. Stephen Hazlett. In the opening address, "What Good is Comprehension without Composition?" by Sharon and David Moore, the role of…
The Expanded Core Curriculum at the Indiana School for the Blind and Visually Impaired: A Case Study
Ringwalt, Gail Mulholland
2013-01-01
This case study investigated how the Expanded Core Curriculum (ECC) was taught to high school students who are blind or visually impaired at the Indiana School for the Blind and Visually Impaired (ISBVI). The study focused on three students pursing different academic tracks with varying degrees of vision. The students were observed throughout…
NSGIC State | GIS Inventory — URBAN_AREAS_TIGER00_IN contains major urban areas in Indiana identified by the US Bureau of the Census. Data is from U.S. Department of Commerce, U.S. Census Bureau,...
The Indiana University proton radiation therapy project
International Nuclear Information System (INIS)
Bloch, C.; Derenchuk, V.; Cameron, J.; Fasano, M.; Gilmore, J.; Hashemian, R.; Hornback, N.; Low, D.A.; Morphis, J.; Peterson, C.; Rosselot, D.; Sandison, G.; Shen, R.N.; Shidnia, H.
1993-01-01
A fixed horizontal beam line at the Indiana University cyclotron facility (IUCF) has been equipped for proton radiation therapy treatment of head, neck, and brain tumors. The complete system will be commissioned and ready to treat patients early in 1993. IUCF can produce external proton beams from 45 to 200 MeV in energy, which corresponds to a maximum range in water of 26 cm. Beam currents over 100 nA are easily attained, allowing dose rates in excess of 200 cGy/min, even for large fields. Beam spreading systems have been tested which provide uniform fields up to 20 cm in diameter. Range modulation is accomplished with a rotating acrylic device, which provides uniform depth dose distributions from 3 to 18 cm in extent. Tests have been conducted on detectors which monitor the beam position and current, and the dose symmetry. This report discusses those devices, as well as the cyclotron characteristics, measured beam properties, safety interlocks, computerized dose delivery/monitoring system, and future plans. (orig.)
Ecosystem level assessment of the Grand Calumet Lagoons, Indiana Dunes National Lakeshore
Energy Technology Data Exchange (ETDEWEB)
Stewart, P.M. [National Biological Service, Porter, IN (United States)
1995-12-31
The Grand Calumet Lagoons make up the eastern section of the Grand Calumet River (GCR), Indiana Harbor and Ship Canal and nearshore Lake Michigan Area of Concern (AOC). The GCR AOC is the only one of the 42 Great Lakes Areas of Concern identified by the International Joint Commission with all 14 designated uses classified as impaired. Included within the boundaries of the Indiana Dunes National Lakeshore (INDU), is the central section of the Grand Calumet Lagoons. A number of biotic and abiotic factors were tested to determine the effects of an industrial landfill that borders the lagoons to assess the potential impact on park resources. Analysis included water quality testing, assessments of macroinvertebrate, fish, algae and aquatic plant communities and contaminant concentrations in water, sediment and plant and fish tissue. Surface water testing found very few contaminants, but significantly higher nutrient levels were found in the water column closest to the landfill. Macroinvertebrate, aquatic plant and fish communities all showed significant impairment in relationship to their proximity to the landfill. Aquatic plant growth habit became limited next to the landfill with certain growth habits disappearing entirely. Aquatic plants collected close to the landfill had high concentrations of several heavy metals in their stems and shoots. Using the index of biotic integrity (IBI), fish community assessment indicated impairment in the areas adjacent to the landfill. Sediments tested at one site had over 12% polycyclic aromatic hydrocarbons (PAH) and carp (Cyprinus carpio) collected from this site had whole fish tissue concentrations over 1 mg/kg PAH.
Joy M. O' Keefe; Susan C. Loeb
2017-01-01
The Indiana bat (Myotis sodalis), a species that is federally endangered in the U.S., is being impacted by white-nose  yndrome and habitat loss across much of its range. A better understanding of summer roost ecology of the species will enable us to develop management strategies that promote summer survival for breeding adult females and their pups. We conducted a 5...
Indiana pouch continent urinary reservoir in patients with previous pelvic irradiation
International Nuclear Information System (INIS)
Mannel, R.S.; Braly, P.S.; Buller, R.E.
1990-01-01
Little information exists on the use of continent urinary reservoirs in patients with previous pelvic irradiation. We report the use of the Indiana pouch urinary reservoir in ten women with a history of pelvic irradiation for cervical cancer, of whom eight underwent a total pelvic exenteration for recurrent pelvic tumor and two had diversion for radiation-induced vesicovaginal fistula. All ten women achieved daytime continence, with a median time between catheterizations of 4.5 hours and a median pouch capacity of 500 mL. There was no evidence of leakage from the reservoir or significant ureteral reflux or obstruction on postoperative radiographic evaluation. No patient has required reoperation or had significant postoperative complications with the technique described
Gentry, Patrick L.; Hirth, Marilyn
2017-01-01
There has been debate among states as to how to properly fund schools. The debate has been focused on how much funding is supplied through property tax and is motivated by tax payer anger over fluctuating tax bills. Many of the policies have been implemented without looking at the effects that they will have on schools, especially in Indiana,…
Roosting and foraging social structure of the endangered Indiana bat (Myotis sodalis.
Directory of Open Access Journals (Sweden)
Alexander Silvis
Full Text Available Social dynamics are an important but poorly understood aspect of bat ecology. Herein we use a combination of graph theoretic and spatial approaches to describe the roost and social network characteristics and foraging associations of an Indiana bat (Myotis sodalis maternity colony in an agricultural landscape in Ohio, USA. We tracked 46 bats to 50 roosts (423 total relocations and collected 2,306 foraging locations for 40 bats during the summers of 2009 and 2010. We found the colony roosting network was highly centralized in both years and that roost and social networks differed significantly from random networks. Roost and social network structure also differed substantially between years. Social network structure appeared to be unrelated to segregation of roosts between age classes. For bats whose individual foraging ranges were calculated, many shared foraging space with at least one other bat. Compared across all possible bat dyads, 47% and 43% of the dyads showed more than expected overlap of foraging areas in 2009 and 2010 respectively. Colony roosting area differed between years, but the roosting area centroid shifted only 332 m. In contrast, whole colony foraging area use was similar between years. Random roost removal simulations suggest that Indiana bat colonies may be robust to loss of a limited number of roosts but may respond differently from year to year. Our study emphasizes the utility of graphic theoretic and spatial approaches for examining the sociality and roosting behavior of bats. Detailed knowledge of the relationships between social and spatial aspects of bat ecology could greatly increase conservation effectiveness by allowing more structured approaches to roost and habitat retention for tree-roosting, socially-aggregating bat species.
Flood-inundation maps for the White River near Edwardsport, Indiana
Fowler, Kathleen K.
2014-01-01
Digital flood-inundation maps for a 3.3-mile reach of the White River near Edwardsport, (Ind.), were created by the U.S. Geological Survey (USGS) in cooperation with the Indiana Department of Transportation. The inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science Web site at http://water.usgs.gov/osw/flood_inundation/, depict estimates of the areal extent and depth of flooding corresponding to selected water levels (stages) at USGS streamgage 03360730, White River near Edwardsport, Ind. Near-real-time stages at this streamgage may be obtained from the USGS National Water Information System at http://waterdata.usgs.gov/ or the National Weather Service Advanced Hydrologic Prediction Service at http://water.weather.gov/ahps/, which also forecasts flood hydrographs at this site (site EDWI3.)
The Impact of an Indiana (United States Drug Court on Criminal Recidivism
Directory of Open Access Journals (Sweden)
John R. Gallagher
2014-07-01
Full Text Available This study evaluated a drug court located in a metropolitan area of Indiana (United States, focusing specifically on identifying variables that predicted recidivism among drug court participants and comparing criminal recidivism patterns among drug court and probation participants. Drug court participants were most likely to recidivate if they were younger, had a violation within the first 30 days of the program, had a previous criminal record, and were terminated unsuccessfully from the program. Furthermore, drug court participants were less likely to recidivate than probationers who had similar offense and demographic characteristics. Implications for drug court practice, policy advocacy, and future research are discussed.
2011-10-27
... Temporary Closure of the I-64 Sherman-Minton Bridge Over the Ohio River Between Indiana and Kentucky... Transportation to continue temporary closure of the I-64 Sherman-Minton Bridge over the Ohio River between... Administration (FHWA) announces the continued closure of the I-64 Sherman-Minton Bridge over the Ohio River...
Kim, Moon H.; Morlock, Scott E.; Arihood, Leslie D.; Kiesler, James L.
2011-01-01
Near-real-time and forecast flood-inundation mapping products resulted from a pilot study for an 11-mile reach of the White River in Indianapolis. The study was done by the U.S. Geological Survey (USGS), Indiana Silver Jackets hazard mitigation taskforce members, the National Weather Service (NWS), the Polis Center, and Indiana University, in cooperation with the City of Indianapolis, the Indianapolis Museum of Art, the Indiana Department of Homeland Security, and the Indiana Department of Natural Resources, Division of Water. The pilot project showed that it is technically feasible to create a flood-inundation map library by means of a two-dimensional hydraulic model, use a map from the library to quickly complete a moderately detailed local flood-loss estimate, and automatically run the hydraulic model during a flood event to provide the maps and flood-damage information through a Web graphical user interface. A library of static digital flood-inundation maps was created by means of a calibrated two-dimensional hydraulic model. Estimated water-surface elevations were developed for a range of river stages referenced to a USGS streamgage and NWS flood forecast point colocated within the study reach. These maps were made available through the Internet in several formats, including geographic information system, Keyhole Markup Language, and Portable Document Format. A flood-loss estimate was completed for part of the study reach by using one of the flood-inundation maps from the static library. The Federal Emergency Management Agency natural disaster-loss estimation program HAZUS-MH, in conjunction with local building information, was used to complete a level 2 analysis of flood-loss estimation. A Service-Oriented Architecture-based dynamic flood-inundation application was developed and was designed to start automatically during a flood, obtain near real-time and forecast data (from the colocated USGS streamgage and NWS flood forecast point within the study reach
K.R. Hammond; J.M. O’Keefe; S.P. Aldrich; Susan Loeb
2016-01-01
We know little about how forest bats, which are cryptic and mobile, use roosts on a landscape scale. For widely distributed species like the endangered Indiana bat Myotis sodalis, identifying landscape-scale roost habitat associations will be important for managing the species in different regions where it occurs. For example, in the southern Appalachian Mountains, USA...
Schnoebelen, Douglas J.; Fenelon, Joseph M.; Baker, Nancy T.; Martin, Jeffrey D.; Bayless, E. Randall; Jacques, David V.; Crawford, Charles G.
1999-01-01
The White River Basin drains 11,349 square miles of central and southern Indiana and is one of 59 Study Units selected for water-quality assessment as part of the U.S. Geological Survey's National WaterQuality Assessment Program. Defining the environmental setting of the basin and identifying the natural factors and human influences that affect water quality are important parts of the assessment.
E.R. Britzke; S.C. Loeb; C.S. Romanek; K.A. Hobson; M.J. Vonhof
2013-01-01
Understanding seasonal movements of bats is important for effective conservation efforts. Although female Indiana bats (Myotis sodalis Miller and Allen, 1928) have been documented to migrate >500 km, knowledge of their migratory patterns is still extremely limited. We used the relationship between latitude and stable hydrogen isotope ratio in bat hair (δ...
Indiana University receives grant from National Science Foundation to help build global grid network
2001-01-01
The NSF awarded a consortium of 15 universities $13.65 million to build the International Virtual Data Grid Laboratory, or iVDGL. The iVDGL will consist of a seamless network of thousands of computers at 40 locations in the US, Europe and Asia. These computers will work together as a powerful grid capable of handling petabytes of data. Indiana University will make significant contributions to this project by providing a prototype Tier-2 Data Center for the ATLAS high energy physics experiment and the International Grid Operations Center.
Viramontez Anguiano, Ruben P.; Lopez, Anayeli
2012-01-01
This study explored how different ecological factors, within and outside the family, affected the educational success of the children of undocumented families. The sample consisted of 63 immigrant Latino parents (40 families) who resided in North Central Indiana. This study utilized an ethnographic research design. Findings demonstrated that…
Ronald A. Rathfon; Nathanael I. Lichti; Robert K. Swihart
2008-01-01
We disked using small-scale equipment in the understory of three mature upland oak (Quercus) forests in southern Indiana immediately following acorn dispersal in an aboveaverage seed crop year as a means of improving oak seedling establishment. Three different mid- and understory removal treatments were also applied to create favorable light...
Selection of tree roosts by male Indiana bats during the autumn swarm in the Ozark Highlands, USA
Roger W. Perry; Stephen C. Brandebura; Thomas S. Risch
2016-01-01
We identified 162 roosts for 36 male Indiana bats (Myotis sodalis) across 3 study areas in the Ozarks of northern Arkansas, USA, during the autumn swarm (late Aug to late Oct, 2005 and 2006). Bats utilized 14 tree species; snags of shortleaf pine (Pinus echinata) were the most utilized (30% of roosts) and pines were selected over hardwoods. Diameter of trees and snags...
NSGIC State | GIS Inventory — RIVERS_OUTSTANDING_NRC_IN represents river and stream segments on the NRCÂs Outstanding Rivers list for Indiana. The source data was last updated in October 1997....
Flood-Inundation Maps for Sugar Creek at Crawfordsville, Indiana
Martin, Zachary W.
2016-06-06
Digital flood-inundation maps for a 6.5-mile reach of Sugar Creek at Crawfordsville, Indiana, were created by the U.S. Geological Survey (USGS) in cooperation with the Indiana Office of Community and Rural Affairs. The flood-inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science Web site at http://water.usgs.gov/osw/flood_inundation/, depict estimates of the areal extent and depth of flooding corresponding to selected water levels (stages) at the USGS streamgage 03339500, Sugar Creek at Crawfordsville, Ind. Near-real-time stages at this streamgage may be obtained on the Internet from the USGS National Water Information System at http://waterdata.usgs.gov/ or the National Weather Service (NWS) Advanced Hydrologic Prediction Service at http://water.weather.gov/ahps/, which also forecasts flood hydrographs at this site (NWS site CRWI3).Flood profiles were computed for the USGS streamgage 03339500, Sugar Creek at Crawfordsville, Ind., reach by means of a one-dimensional step-backwater hydraulic modeling software developed by the U.S. Army Corps of Engineers. The hydraulic model was calibrated using the current stage-discharge rating at the USGS streamgage 03339500, Sugar Creek at Crawfordsville, Ind., and high-water marks from the flood of April 19, 2013, which reached a stage of 15.3 feet. The hydraulic model was then used to compute 13 water-surface profiles for flood stages at 1-foot (ft) intervals referenced to the streamgage datum ranging from 4.0 ft (the NWS “action stage”) to 16.0 ft, which is the highest stage interval of the current USGS stage-discharge rating curve and 2 ft higher than the NWS “major flood stage.” The simulated water-surface profiles were then combined with a Geographic Information System digital elevation model (derived from light detection and ranging [lidar]) data having a 0.49-ft root mean squared error and 4.9-ft horizontal resolution) to delineate the area flooded at each stage.The availability
Flood-inundation maps for the White River at Noblesville, Indiana
Martin, Zachary W.
2017-11-02
Digital flood-inundation maps for a 7.5-mile reach of the White River at Noblesville, Indiana, were created by the U.S. Geological Survey (USGS) in cooperation with the Indiana Department of Transportation. The flood-inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science website at https://water.usgs.gov/osw/flood_inundation/, depict estimates of the areal extent and depth of flooding corresponding to selected water levels (stages) at the White River at Noblesville, Ind., streamgage (USGS station number 03349000). Real-time stages at this streamgage may be obtained from the USGS National Water Information System at https://waterdata.usgs.gov/nwis or the National Weather Service (NWS) Advanced Hydrologic Prediction Service at http:/water.weather.gov/ahps/, which also forecasts flood hydrographs at the same site as the USGS streamgage (NWS site NBLI3).Flood profiles were computed for the stream reach by means of a one-dimensional, step-backwater hydraulic modeling software developed by the U.S. Army Corps of Engineers. The hydraulic model was calibrated using the current (2016) stage-discharge rating at the USGS streamgage 03349000, White River at Noblesville, Ind., and documented high-water marks from the floods of September 4, 2003, and May 6, 2017. The hydraulic model was then used to compute 15 water-surface profiles for flood stages at 1-foot (ft) intervals referenced to the streamgage datum ranging from 10.0 ft (the NWS “action stage”) to 24.0 ft, which is the highest stage interval of the current (2016) USGS stage-discharge rating curve and 2 ft higher than the NWS “major flood stage.” The simulated water-surface profiles were then combined with a geographic information system digital elevation model (derived from light detection and ranging data having a 0.98-ft vertical accuracy and 4.9-ft horizontal resolution) to delineate the area flooded at each stage.The availability of these maps, along with internet
The art, history, and geoscience of hindustan whetstone gravestones in Indiana
Kvale, E.P.; Powell, R.L.; McNerney, M.J.
2000-01-01
Cemeteries can be intriguing places to people, in part because of a fascination with death but also because of the quiet solitude and artistic beauty found there. Many grave monuments are really works of art and can be appreciated on that basis alone. Cemeteries can also serve as teaching laboratories for geologists. Monument types, carving styles, ornamentation, and durability are all related, to some extent, to the type of rock used. The older the monument dates the more variability one can see in the character of the stones. Pioneer cemeteries in southern Indiana, some of which date back to the early 1800s, can be used to teach concepts in mineralogy, depositional environments, and paleoastronomy. This can be very useful to someone teaching some of the basic concepts of geology.
The art, history, and geoscience of Hindostan whetstone gravestones in Indiana
Kvale, E.P.; Powell, R.L.; McNerney, M.J.
2000-01-01
Cemeteries can be intriguing places to people, in part because of a fascination with death but also because of the quiet solitude and artistic beauty found there. Many grave monuments are really works of art and can be appreciated on that basis alone. Cemeteries can also serve as teaching laboratories for geologists. Monument types, carving styles, ornamentation, and durability are all related, to some extent, to the type of rock used. The older the monument dates the more variability one can see in the character of the stones. Pioneer cemeteries in southern Indiana, some of which date back to the early 1800s, can be used to teach concepts in mineralogy, depositional environments, and paleoastronomy. This can be very useful to someone teaching some of the basic concepts of geology.
NSGIC State | GIS Inventory — QUADRANGLES_24K_USGS_IN is a polygon shapefile defining the boundaries of the USGS 7.5-minute (1:24,000-scale) quadrangles which cover the state of Indiana. Dates of...
Low-flow characteristics for selected streams in Indiana
Fowler, Kathleen K.; Wilson, John T.
2015-01-01
The management and availability of Indiana’s water resources increase in importance every year. Specifically, information on low-flow characteristics of streams is essential to State water-management agencies. These agencies need low-flow information when working with issues related to irrigation, municipal and industrial water supplies, fish and wildlife protection, and the dilution of waste. Industrial, municipal, and other facilities must obtain National Pollutant Discharge Elimination System (NPDES) permits if their discharges go directly to surface waters. The Indiana Department of Environmental Management (IDEM) requires low-flow statistics in order to administer the NPDES permit program. Low-flow-frequency characteristics were computed for 272 continuous-record stations. The information includes low-flow-frequency analysis, flow-duration analysis, and harmonic mean for the continuous-record stations. For those stations affected by some form of regulation, low-flow frequency curves are based on the longest period of homogeneous record under current conditions. Low-flow-frequency values and harmonic mean flow (if sufficient data were available) were estimated for the 166 partial-record stations. Partial-record stations are ungaged sites where streamflow measurements were made at base flow.
Purdue Univ., Lafayette, IN. Office of Manpower Studies.
The purpose of this study was to identify the trained manpower needed to cope with Indiana's mounting problems in air and water pollution control, liquid and solid waste disposal, and water supply and resources. This report contains data concerning the present employment, current job opportunities, and projected manpower needs for related…
NSGIC State | GIS Inventory — WATERSHEDS_HUC06_USGS_IN is a polygon shapefile showing the boundaries of accounting units (HUA) in Indiana. Accounting units are noted by a 6-digit hydrologic unit....
Physiological ecology of heterotrophic bacteria in two Indiana lakes
International Nuclear Information System (INIS)
Lovell, C.R.
1984-01-01
Rates of bacterial production of particulate organic carbon in two hardwater Indiana lakes were studied. Primary production rates were calculated from rates of photosynthetic H 14 CO 3 - incorporation and bacterial (secondary) production from rates of 3 H-(methyl)-thymidine incorporation by natural samples. The relationship of thymidine incorporation to rates of bacterial growth in diluted natural samples was used to calculate the conversion factor 2.2 x 10 18 cells produced (mole thymidine incorporated) -1 . Bacteria in Little Crooked Lake were found to be growing at suboptimal temperatures throughout most of the water column, even during the summer months. Even rapidly growing metalimnetic populations displayed no noticable adaptation to low environmental temperatures. This indicates that temperature could have limited the growth of bacteria in this lake throughout the period of thermal stratification. The extracellular release of photosynthetically fixed organic carbon by healthy phytoplankton was not found to be an important carbon source for planktonic bacteria. Slow carbon release mechanisms, such as algal decomposition, seem to have been more important
Adding Theoretical Grounding to Grounded Theory: Toward Multi-Grounded Theory
Göran Goldkuhl; Stefan Cronholm
2010-01-01
The purpose of this paper is to challenge some of the cornerstones of the grounded theory approach and propose an extended and alternative approach for data analysis and theory development, which the authors call multi-grounded theory (MGT). A multi-grounded theory is not only empirically grounded; it is also grounded in other ways. Three different grounding processes are acknowledged: theoretical, empirical, and internal grounding. The authors go beyond the pure inductivist approach in GT an...
Radiological Final Status Survey of the Hammond Depot, Hammond, Indiana
International Nuclear Information System (INIS)
Vitkus, T.J.
2008-01-01
ORISE conducted extensive scoping, characterization, and final status surveys of land areas and structures at the DNSC's Hammond Depot located in Hammond, Indiana in multiple phases during 2005, 2006 and 2007. This report provides a detailed discussion of the radiological survey planning, survey implementation, remediation, and the results for these activities supporting the conclusion that radioactive contamination previously identified at the Hammond Depot (HD) has been reduced to levels such that the site may be released without radiological restrictions. The objective of the radiological final status survey (FSS) was to obtain the data necessary to demonstrate compliance with the U.S. Nuclear Regulatory Commission (NRC)-approved site-specific derived concentration guideline levels (DCGLs) for both structural surfaces and outdoor areas (ORISE 2006a and NRC 2007). The DCGLs were modeled such that any residual licensed material would not exceed the NRC's basic dose limit for license termination of 25 millirem per year (mrem/y)
Noureldin, Menna; Fricker, Jon D.; Sinha, Kumares C.
2015-01-01
Cost-Effective Pavement Performance Management of Indiana's Enhanced National Highway System through Strategic Modification of the Pavement Rehabilitation Treatment Trigger Values Presented during Session 3: Policy and Funding, moderated by Magdy Mikhail, at the 9th International Conference on Managing Pavement Assets (ICMPA9) in Alexandria, VA. Includes conference paper and PowerPoint slides.
Hiller, Stephen C.; Spradlin, Terry E.
2011-01-01
The May primary election added seven school district referenda to the total number occurring in Indiana since 2008, three of which passed and four of which were rejected by voters. In the 2011 primary election, there were five General Fund referenda and two construction referenda. Of General Fund referenda, two passed (Crown Point Community School…
Botulism associated with commercially canned chili sauce--Texas and Indiana, July 2007.
2007-08-03
On July 7 and July 11, 2007, public health officials in Texas and Indiana, respectively, reported to CDC four suspected cases of foodborne botulism, two in each state. Investigations conducted by state and local health departments revealed that all four patients had eaten brands of Castleberry's hot dog chili sauce before illness began. Botulinum toxin type A was detected in the serum of one Indiana patient and in a leftover chili mixture obtained from his home. CDC informed the Food and Drug Administration (FDA) of the apparent link between illness and consumption of the chili sauce. On July 18, FDA issued a consumer advisory, and the manufacturer, Castleberry's Food Company (Augusta, Georgia), subsequently recalled the implicated brand and several other products produced in the same set of retorts (commercial-scale pressure cookers for processing canned foods) at the same canning facility. Examination of the canning facility in Georgia during the outbreak investigation had identified deficiencies in the canning process. On July 19, the U.S. Department of Agriculture Food Safety and Inspection Service (FSIS) issued a press release that announced a recall of chili and certain meat products from the Castleberry canning facility and provided recommendations to consumers. That recall was expanded on July 21 to include additional canned products. A fifth case of botulism potentially linked to one of the recalled products is under investigation in California. This report describes the ongoing investigation by members of OutbreakNet and others and the measures undertaken to control the outbreak, which is the first outbreak of foodborne botulism in the United States associated with a commercial canning facility in approximately 30 years. Clinicians should be vigilant for symptoms of botulism, including symmetric cranial nerve palsies, especially if accompanied by descending flaccid paralysis. Consumers should not eat any of the recalled chili sauce or other recalled
Stuit, David
2009-01-01
Indiana legislators are currently debating the merits of a proposal to adopt a statewide tuition scholarship tax credit program. The proposed program would make available $5 million in tax credits that businesses and individuals could claim by making donations to non-profit Scholarship Granting Organizations (SGOs). SGO donations would be matched…
Assessing the value of collaboration in tourism networks: A case study of Elkhart County, Indiana
DEFF Research Database (Denmark)
Zach, Florian; Racherla, Pradeep
2011-01-01
This study explores the determinants of perceived value derived from interorganizational collaborations in a tourism destination. The authors propose a theoretical model of perceived value drawing upon the rich stream of literature related to strategic collaborations and interorganizational...... networks. The model was tested using a cross section of tourism organizations operating within Elkhart County, Indiana. The results indicate that a significant positive value of collaboration is achieved from dyadic relationships. Importantly, the results suggest that the positive effect achieved from one......-to-one partnerships decreases once an organization collaborates with several other organizations. The article discusses various implications for managing strategic tourism partnerships....
Brokaw, James J.; O'Loughlin, Valerie D.
2015-01-01
In 2008, the Indiana University School of Medicine, in collaboration with the School of Education, admitted its first student to a newly approved PhD program in Anatomy and Cell Biology focusing on educational research rather than biomedical research. The goal of the program is twofold: (1) to provide students with extensive training in all of the…
Flood-inundation maps for North Fork Salt Creek at Nashville, Indiana
Martin, Zachary W.
2017-11-13
Digital flood-inundation maps for a 3.2-mile reach of North Fork Salt Creek at Nashville, Indiana, were created by the U.S. Geological Survey (USGS) in cooperation with the Indiana Department of Transportation. The flood-inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science website at http://water.usgs.gov/osw/flood_inundation/, depict estimates of the areal extent and depth of flooding that correspond to selected water levels (stages) at the North Fork Salt Creek at Nashville, Ind., streamgage (USGS station number 03371650). Real-time stages at this streamgage may be obtained from the USGS National Water Information System at http://waterdata.usgs.gov/nwis or the National Weather Service (NWS) Advanced Hydrologic Prediction Service at http:/water.weather.gov/ahps/, which also shows observed USGS stages at the same site as the USGS streamgage (NWS site NFSI3).Flood profiles were computed for the stream reach by means of a one-dimensional, step-backwater hydraulic modeling software developed by the U.S. Army Corps of Engineers. The hydraulic model was calibrated using the current (2015) stage-discharge rating at the USGS streamgage 03371650, North Fork Salt Creek at Nashville, Ind. The hydraulic model was then used to compute 12 water-surface profiles for flood stages at 1-foot (ft) intervals, except for the highest profile of 22.9 ft, referenced to the streamgage datum ranging from 12.0 ft (the NWS “action stage”) to 22.9 ft, which is the highest stage of the current (2015) USGS stage-discharge rating curve and 1.9 ft higher than the NWS “major flood stage.” The simulated water-surface profiles were then combined with a geographic information system digital elevation model (derived from light detection and ranging data having a 0.98-ft vertical accuracy and 4.9-ft horizontal resolution) to delineate the area flooded at each stage.The availability of these maps, along with information regarding current stage from the USGS
Flood-inundation maps for the Wabash River at Lafayette, Indiana
Kim, Moon H.
2018-05-10
Digital flood-inundation maps for an approximately 4.8-mile reach of the Wabash River at Lafayette, Indiana (Ind.) were created by the U.S. Geological Survey (USGS) in cooperation with the Indiana Office of Community and Rural Affairs. The inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science web site at https://water.usgs.gov/osw/flood_inundation/, depict estimates of the areal extent and depth of flooding corresponding to selected water levels (stages) at USGS streamgage 03335500, Wabash River at Lafayette, Ind. Current streamflow conditions for estimating near-real-time areas of inundation using USGS streamgage information may be obtained on the internet at https://waterdata.usgs.gov/in/nwis/uv?site_no=03335500. In addition, information has been provided to the National Weather Service (NWS) for incorporation into their Advanced Hydrologic Prediction Service (AHPS) flood-warning system (https://water.weather.gov/ahps/). The NWS AHPS forecasts flood hydrographs at many places that are often colocated with USGS streamgages, including the Wabash River at Lafayette, Ind. NWS AHPS-forecast peak-stage information may be used with the maps developed in this study to show predicted areas of flood inundation.For this study, flood profiles were computed for the Wabash River reach by means of a one-dimensional step-backwater model. The hydraulic model was calibrated by using the most current stage-discharge relations at USGS streamgage 03335500, Wabash River at Lafayette, Ind., and high-water marks from the flood of July 2003 (U.S. Army Corps of Engineers [USACE], 2007). The calibrated hydraulic model was then used to determine 23 water-surface profiles for flood stages at 1-foot intervals referenced to the streamgage datum and ranging from bankfull to the highest stage of the current stage-discharge rating curve. The simulated water-surface profiles were then combined with a geographic information system digital elevation model derived
Faber, Ardis R.
2010-01-01
The purpose of this study was to investigate factors that influence first-year nonmusic majors' decisions regarding participation in music ensembles at small liberal arts colleges in Indiana. A survey questionnaire was used to gather data. The data collected was analyzed to determine significant differences between the nonmusic majors who have…
36Cl in shallow, perched aquifers from central Indiana
Vogt, S.; Elmore, D.; Fritz, S. J.
1994-06-01
36Cl/Cl ratios and chloride concentrations were measured in several shallow, perched aquifers situated within glacial till in west-central Indiana (USA). Most of these aquifers show 36Cl/Cl ratios which have to be attributed to admixed 36Cl from nuclear weapons tests in the 1950s and 1960s. Two wells from Purdue's Horticultural Farm tap perched aquifers uninfluenced by anthropogenic sources of chloride, and their 36Cl/Cl ratios are comparable with ratios measured in modern, local precipitation. As such, the chloride contents of these wells (1 to 3 ppm) reflect evaporative concentration of the precipitation's chloride contents (averaging 0.17 ppm) in the vadose zone. Since one of these two wells (HA-2a) does not contain any detectable tritium, we conclude that recent pre-bomb 36Cl/Cl ratios and 36Cl deposition in precipitation are quite similar to those in modern precipitation. We attribute the slight 36Cl excess of about 20% in both of these wells largely to 36Cl deposition associated with dry fall-out. As much as 2 × 10 4 at. 36Cl/cm 2 might reach the surface via dry fall-out annually.
Environmental Setting of the Sugar Creek and Leary Weber Ditch Basins, Indiana, 2002-04
Lathrop, Timothy R.
2006-01-01
The Leary Weber Ditch Basin is nested within the Sugar Creek Basin in central Indiana. These basins make up one of the five study sites in the Nation selected for the Agricultural Chemicals: Sources, Transport, and Fate topical study, a part of the U.S. Geological Survey’s National Water-Quality Assessment Program. In this topical study, identifying the natural factors and human influences affecting water quality in the Leary Weber Ditch and Sugar Creek Basins are the focus of the assessment. A detailed comparison between the environmental settings of these basins is presented. Specifics of the topical study design as implemented in the Leary Weber Ditch and Sugar Creek Basins are described.
Rodriguez, Jessica Y; Camp, Joseph W; Lenz, Stephen D; Kazacos, Kevin R; Snowden, Karen F
2016-04-01
A 1-year-old castrated male dog residing in Indiana was examined because of intermittent vomiting of 4 months' duration. The dog's condition did not resolve with medication. Diagnostic imaging revealed a possible partial obstruction at the ileocecal junction. An exploratory laparotomy was performed. The jejunum contained diffusely distributed, nodular, intramural lesions; 2 biopsy specimens were collected from representative lesions. The pancreas was grossly swollen, and pancreatitis was presumed present. No other abnormalities were observed in the abdomen. Histologic examination of the submitted biopsy specimens revealed infection with Heterobilharzia americana. After diagnosis, the dog was treated with fenbendazole suspension (48 mg/kg [21.8 mg/lb], PO, q 24 h) for 10 days. This treatment was subsequently repeated 11 and 80 days later. One week after the end of the last fenbendazole treatment, several H americana eggs were detected in a fecal sample via saline sedimentation, and the dog was given praziquantel (25 mg/kg [11.4 mg/lb], PO, q 8 h) for 2 days. No gastrointestinal signs were evident 4 months after that treatment. The dog described in this report was the first autochthonous canine case of H americana infection in Indiana, to the authors' knowledge; this case has confirmed that the distribution of this parasite in the Midwestern United States is broader than previously known. Increased awareness of the distribution of H americana should aid veterinarians in early, noninvasive diagnosis and appropriate treatment of affected animals. Repeated treatments and recheck fecal examinations may be necessary when managing these cases.
Osborn, Elizabeth
In the Rene v. Reed case, Meghan Rene and other disabled students argued that their due process rights were violated in regard to the Indiana Statewide Testing for Educational Progress (ISTEP) graduation examination. This set of four lesson plans uses the case of Rene v. Reed, which was first argued before the Indiana Supreme Court, to study the…
International Nuclear Information System (INIS)
Brabson, B.B.; Crittenden, R.R.; Dzierba, A.R.; Heinz, R.M.; Martin, H.J.; Ogren, H.O.
1983-01-01
The Indiana University High-Energy Physics Group has been actively involved in a variety of research programs during the current contract period. These programs are associated with major experiments conducted by our group at SLAC, Fermilab, Brookhaven and CERN. The physics areas under investigation include studies of psi meson production in hadron interactions (CERN WA-11), a study of low-p/sub t/ and high-p/sub t/ collisions utilizing the Multiparticle Spectrometer at Fermilab (E110/557/672), a glueball search (Brookhaven E771), and a high resolution study of e + e - interactions at high energy at SLAC (PEP HRS experiment). The status of the various efforts are discussed
Pawan, Faridah; Thomalla, Therese Groff
2005-01-01
This article describes a responsive evaluation study of ESL services and Spanish language services for immigrants in a rural county in Indiana. An ESL specialist led the evaluation of language services in the county from the perspectives of language providers and recipients. The responsive evaluation--a form of action research that uses…
The Northwest Indiana Robotic Telescope
Slavin, Shawn D.; Rengstorf, A. W.; Aros, J. C.; Segally, W. B.
2011-01-01
The Northwest Indiana Robotic (NIRo) Telescope is a remote, automated observing facility recently built by Purdue University Calumet (PUC) at a site in Lowell, IN, approximately 30 miles from the PUC campus. The recently dedicated observatory will be used for broadband and narrowband optical observations by PUC students and faculty, as well as pre-college students through the implementation of standards-based, middle-school modules developed by PUC astronomers and education faculty. The NIRo observatory and its web portal are the central technical elements of a project to improve astronomy education at Purdue Calumet and, more broadly, to improve science education in middle schools of the surrounding region. The NIRo Telescope is a 0.5-meter (20-inch) Ritchey-Chrétien design on a Paramount ME robotic mount, featuring a seven-position filter wheel (UBVRI, Hα, Clear), Peltier (thermoelectrically) cooled CCD camera with 3056 x 3056, square, 12 μm pixels, and off-axis guiding. It provides a coma-free imaging field of 0.5 degrees square, with a plate scale of 0.6 arcseconds per pixel. The observatory has a wireless internet connection, local weather station which publishes data to an internet weather site, and a suite of CCTV security cameras on an IP-based, networked video server. Control of power to every piece of instrumentation is maintained via internet-accessible power distribution units. The telescope can be controlled on-site, or off-site in an attended fashion via an internet connection, but will be used primarily in an unattended mode of automated observation, where queued observations will be scheduled daily from a database of requests. Completed observational data from queued operation will be stored on a campus-based server, which also runs the web portal and observation database. Partial support for this work was provided by the National Science Foundation's Course, Curriculum, and Laboratory Improvement (CCLI) program under Award No. 0736592.
2016-10-05
A new toll road exit is proposed at the intersection of I-80/90 and SR 327 in Orland, : Indiana. The new exit is needed to facilitate travel for a proposed manufacturing plant to be : established on a 500-acre site east of SR 327 and south of I-80/90...
Bayless, E. Randall; Cinotto, Peter J.; Ulery, Randy L.; Taylor, Charles J.; McCombs, Gregory K.; Kim, Moon H.; Nelson, Hugh L.
2014-01-01
The U.S. Geological Survey (USGS), in cooperation with the U.S. Army Corps of Engineers (USACE) and the Indiana Office of Community and Rural Affairs (OCRA), conducted a study of the upper Lost River watershed in Orange County, Indiana, from 2012 to 2013. Streamflow and groundwater data were collected at 10 data-collection sites from at least October 2012 until April 2013, and a preliminary Water Availability Tool for Environmental Resources (WATER)-TOPMODEL based hydrologic model was created to increase understanding of the complex, karstic hydraulic and hydrologic system present in the upper Lost River watershed, Orange County, Ind. Statistical assessment of the optimized hydrologic-model results were promising and returned correlation coefficients for simulated and measured stream discharge of 0.58 and 0.60 and Nash-Sutcliffe efficiency values of 0.56 and 0.39 for USGS streamflow-gaging stations 03373530 (Lost River near Leipsic, Ind.), and 03373560 (Lost River near Prospect, Ind.), respectively. Additional information to refine drainage divides is needed before applying the model to the entire karst region of south-central Indiana. Surface-water and groundwater data were used to tentatively quantify the complex hydrologic processes taking place within the watershed and provide increased understanding for future modeling and management applications. The data indicate that during wet-weather periods and after certain intense storms, the hydraulic capacity of swallow holes and subsurface conduits is overwhelmed with excess water that flows onto the surface in dry-bed relic stream channels and karst paleovalleys. Analysis of discharge data collected at USGS streamflow-gaging station 03373550 (Orangeville Rise, at Orangeville, Ind.), and other ancillary data-collection sites in the watershed, indicate that a bounding condition is likely present, and drainage from the underlying karst conduit system is potentially limited to near 200 cubic feet per second. This
Flood-inundation maps for the St. Marys River at Fort Wayne, Indiana
Menke, Chad D.; Kim, Moon H.; Fowler, Kathleen K.
2012-01-01
Digital flood-inundation maps for a 9-mile reach of the St. Marys River that extends from South Anthony Boulevard to Main Street at Fort Wayne, Indiana, were created by the U.S. Geological Survey (USGS) in cooperation with the City of Fort Wayne. The inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science Web site, depict estimates of the areal extent of flooding corresponding to selected water levels (stages) at the USGS streamgage 04182000 St. Marys River near Fort Wayne, Ind. Current conditions at the USGS streamgages in Indiana may be obtained from the National Water Information System: Web Interface. In addition, the information has been provided to the National Weather Service (NWS) for incorporation into their Advanced Hydrologic Prediction Service (AHPS) flood warning system. The NWS forecasts flood hydrographs at many places that are often collocated at USGS streamgages. That forecasted peak-stage information, also available on the Internet, may be used in conjunction with the maps developed in this study to show predicted areas of flood inundation. In this study, water-surface profiles were simulated for the stream reach by means of a hydraulic one-dimensional step-backwater model. The model was calibrated using the most current stage-discharge relation at the USGS streamgage 04182000 St. Marys River near Fort Wayne, Ind. The hydraulic model was then used to simulate 11 water-surface profiles for flood stages at 1-ft intervals referenced to the streamgage datum and ranging from bankfull to approximately the highest recorded water level at the streamgage. The simulated water-surface profiles were then combined with a geographic information system digital elevation model (derived from Light Detection and Ranging (LiDAR) data) in order to delineate the area flooded at each water level. A flood inundation map was generated for each water-surface profile stage (11 maps in all) so that for any given flood stage users will be
Flood-inundation maps for the Wabash River at Terre Haute, Indiana
Lombard, Pamela J.
2013-01-01
Digital flood-inundation maps for a 6.3-mi reach of the Wabash River from 0.1 mi downstream of the Interstate 70 bridge to 1.1 miles upstream of the Route 63 bridge, Terre Haute, Indiana, were created by the U.S. Geological Survey (USGS) in cooperation with the Indiana Department of Transportation. The inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science Web site at http://water.usgs.gov/osw/flood_inundation/, depict estimates of the areal extent of flooding corresponding to select water levels (stages) at the USGS streamgage Wabash River at Terre Haute (station number 03341500). Current conditions at the USGS streamgage may be obtained on the Internet from the USGS National Water Information System (http://waterdata.usgs.gov/in/nwis/uv/?site_no=03341500&agency_cd=USGS&p"). In addition, the same data are provided to the National Weather Service (NWS) for incorporation into their Advanced Hydrologic Prediction Service (AHPS) flood warning system (http://water.weather.gov/ahps//). Within this system, the NWS forecasts flood hydrographs for the Wabash River at Terre Haute that may be used in conjunction with the maps developed in this study to show predicted areas of flood inundation. In this study, flood profiles were computed for the stream reach by means of a one-dimensional step-backwater model. The model was calibrated using the most current stage-discharge relation at the Wabash River at the Terre Haute streamgage. The hydraulic model was then used to compute 22 water-surface profiles for flood stages at 1-ft interval referenced to the streamgage datum and ranging from bank-full to approximately the highest recorded water level at the streamgage. The simulated water-surface profiles were then combined with a geographic information system digital elevation model (derived from Light Detection and Ranging (LiDAR) data having a 0.37-ft vertical accuracy and a 1.02-ft horizontal accuracy) to delineate the area flooded at each water
Flood-inundation maps for the Flatrock River at Columbus, Indiana, 2012
Coon, William F.
2013-01-01
Digital flood-inundation maps for a 5-mile reach of the Flatrock River on the western side of Columbus, Indiana, from County Road 400N to the river mouth at the confluence with Driftwood River, were created by the U.S. Geological Survey (USGS) in cooperation with the Indiana Department of Transportation. The inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science Web site at http://water.usgs.gov/osw/flood_inundation/ and the Federal Flood Inundation Mapper Web site at http://wim.usgs.gov/FIMI/FloodInundationMapper.html, depict estimates of the areal extent and depth of flooding corresponding to selected water levels (stages) at the USGS streamgage on the Flatrock River at Columbus (station number 03363900). Near-real-time stages at this streamgage may be obtained on the Internet from the USGS National Water Information System at http://waterdata.usgs.gov/ or the National Weather Service (NWS) Advanced Hydrologic Prediction Service, which also presents the USGS data, at http:/water.weather.gov/ahps/. Flood profiles were computed for the stream reach by means of a one-dimensional step-backwater model. The model was calibrated by using the most current stage-discharge relation at the Flatrock River streamgage, high-water marks that were surveyed following the flood of June 7, 2008, and water-surface profiles from the current flood-insurance study for the City of Columbus. The hydraulic model was then used to compute 12 water-surface profiles for flood stages at 1-foot (ft) intervals referenced to the streamgage datum and ranging from 9 ft or near bankfull to 20 ft, which exceeds the stages that correspond to both the estimated 0.2-percent annual exceedance probability flood (500-year recurrence interval flood) and the maximum recorded peak flow. The simulated water-surface profiles were then combined with a Geographic Information System digital elevation model (derived from Light Detection and Ranging (LiDAR) data having a 0.37 ft
TFTR grounding scheme and ground-monitor system
International Nuclear Information System (INIS)
Viola, M.
1983-01-01
The Tokamak Fusion Test Reactor (TFTR) grounding system utilizes a single-point ground. It is located directly under the machine, at the basement floor level, and is tied to the building perimeter ground. Wired to this single-point ground, via individual 500 MCM insulated cables, are: the vacuum vessel; four toroidal field coil cases/inner support structure quadrants; umbrella structure halves; the substructure ring girder; radial beams and columns; and the diagnostic systems. Prior to the first machine operation, a ground-loop removal program was initiated. It required insulation of all hangers and supports (within a 35-foot radius of the center of the machine) of the various piping, conduits, cable trays, and ventilation systems. A special ground-monitor system was designed and installed. It actively monitors each of the individual machine grounds to insure that there are no inadvertent ground loops within the machine structure or its ground and that the machine grounds are intact prior to each pulse. The TFTR grounding system has proven to be a very manageable system and one that is easy to maintain
Kerr, Zachary Y; Dalton, Sara L; Roos, Karen G; Djoko, Aristarque; Phelps, Jennifer; Dompier, Thomas P
2016-05-01
In Indiana, high school football coaches are required to complete a coaching education course with material related to concussion awareness, equipment fitting, heat emergency preparedness, and proper technique. Some high schools have also opted to implement a player safety coach (PSC). The PSC, an integral component of USA Football's Heads Up Football (HUF) program, is a coach whose primary responsibility is to ensure that other coaches are implementing proper tackling and blocking techniques alongside other components of the HUF program. To compare injury rates in Indiana high school football teams by their usage of a PSC or online coaching education only. Cohort study; Level of evidence, 2. Athletic trainers (ATs) evaluated and tracked injuries at each practice and game during the 2015 high school football season. Players were drawn from 6 teams in Indiana. The PSC group, which used the PSC component, was comprised of 204 players from 3 teams. The "education only" group (EDU), which utilized coaching education only, was composed of 186 players from 3 teams. Injury rates and injury rate ratios (IRRs) were reported with 95% confidence intervals (CIs). During 25,938 athlete-exposures (AEs), a total of 149 injuries were reported, of which 54 (36.2%) and 95 (63.8%) originated from the PSC and EDU groups, respectively. The practice injury rate was lower in the PSC group than the EDU group (2.99 vs 4.83/1000 AEs; IRR, 0.62; 95% CI, 0.40-0.95). The game injury rate was also lower in the PSC group than the EDU group (11.37 vs 26.37/1000 AEs; IRR, 0.43; 95% CI, 0.25-0.74). When restricted to concussions only, the rate was lower in the PSC group (0.09 vs 0.73/1000 AEs; IRR, 0.12; 95% CI, 0.01-0.94), although only 1 concussion was reported in the PSC group. No differences were found in game concussion rates (0.60 vs 4.39/1000 AEs; IRR, 0.14; 95% CI, 0.02-1.11). Findings support the PSC as an effective method of injury mitigation in high school football. Future research
International Nuclear Information System (INIS)
Scheller, Kent W.; Elliott, William S.
2015-01-01
Radon ( 222 Rn) is a radioactive gas that results from the decay of uranium ( 238 U) in the Earth's crust. This study characterizes the presence and relative quantity of radon precursors in the Pennsylvanian black shales of southwest Indiana. Cores were drilled on the campus of the University of Southern Indiana to a depth of 237.7 m (780 ft) during exploration for coal-bed methane. Gamma ray logs were taken to measure radioactive activity as a function of depth in the bore hole. Activity readings of 270, 467, 555, and 388 GAPI (American Petroleum Institute γ ray units) were measured at depths of 124.3 m (408 ft), 154.0 m (505 ft), 187.1 m (614 ft) and 214.0 m (702 ft) in four separate shale layers of the Pennsylvanian stratigraphic column. GAPI units are used in the petroleum industry when drilling to represent the relative intensities of γ radiation from 40 K, 232 Th, and 238 U in bore holes (Belknap et al., 1959). For purposes of this study, the high activity readings on the gamma ray logs were used only to identify at which depths further gamma ray spectroscopy of the cores would be completed in the laboratory. Gamma ray spectroscopic studies of these cores were conducted with a large volume NaI crystal detector to observe γ rays of specific energies. Characteristic γ rays from various isotopes were identified confirming the presence and relative quantity of radon precursors in core samples. Geochemical analysis of cores was also conducted to measure presence and quantity of trace metals and radon precursors. Of 744 homes tested in Vanderburgh County from 2007 to 2013, 169 homes (22.7 percent) had elevated radon levels greater than 148 mBq L −1 (4.0 pCi L −1 ). Additionally, 246 homes (33.1 percent) had measured radon levels of 74–145 mBq L −1 (2.0–3.9 pCi L −1 ). About 80 percent of elevated radon levels greater than 148 mBq L −1 (4.0 pCi L −1 ) are located in proximity to depositional contacts between the Dugger
Ecological Risk Assessment of Perchlorate in Avian Species, Rodents, Amphibians and Fish
2003-04-01
http://www .indiana.edu/- axolotl ). 10.0 JUSTIFICATION OF TEST SYSTEM Perchlorate occurs in ground and surface waters in 44 states in the USA... axolotl ). * Sequentially numbered in order of the date that the change is effective Dept. of Biological Sciences (DBS) Box 43131 Lubbock, TX 79409...KCl, 0.025 giL; CaCh2 H20, 0.65 g/L; MgS04·7H20, 0.1 giL (http://www.indiana.edu/~ axolotl ). *Sequentially numbered in order of the date that the
Origin of discontinuities in coal-bearing strata at Roaring Creek (Basal Pennsylvanian of Indiana)
Energy Technology Data Exchange (ETDEWEB)
Nelson, W J; Eggert, D L; Dimichele, W A; Stecyk, A C
1985-05-01
Basal Pennsylvanian coal-bearing strata exposed along Roaring Creek, west-central Indiana, exhibit extreme lateral discontinuity. Coal seams abruptly change in thickness and elevation; they split, grade into shale, are cut out by channels and disrupted by soft-sediment deformational structures. Initial sediments were laid down by a network of southwest- flowing streams that traversed a deeply channelized upland surface of Mississippian carbonate rocks. Channels aggraded rapidly as uplands were worn down, so the region changed through time from uplands to upper deltaic plain. Local environments included channels, localized point bars, small natural levees and crevasse splays, overbank deposits, and swamps. Differential compaction and subsidence, slumping stream banks, and possibly collapsing sinkholes influenced sedimentation. As a consequence, coals are too discontinuous for economical mining, although they are locally thick and high in quality. 16 references.
Flood-inundation maps for the Wabash River at Memorial Bridge at Vincennes, Indiana
Fowler, Kathleen K.; Menke, Chad D.
2017-08-23
Digital flood-inundation maps for a 10.2-mile reach of the Wabash River from Sevenmile Island to 3.7 mile downstream of Memorial Bridge (officially known as Lincoln Memorial Bridge) at Vincennes, Indiana, were created by the U.S. Geological Survey (USGS) in cooperation with the Indiana Office of Community and Rural Affairs. The inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science Web site at http://water.usgs.gov/osw/flood_inundation/ depict estimates of the areal extent and depth of flooding corresponding to selected water levels (stages) at USGS streamgage 03343010, Wabash River at Memorial Bridge at Vincennes, Ind. Near-real-time stages at this streamgage may be obtained on the Internet from the USGS National Water Information System at http://waterdata.usgs.gov/ or the National Weather Service (NWS) Advanced Hydrologic Prediction Service at http:/water.weather.gov/ahps/, which also forecasts flood hydrographs at this site.For this study, flood profiles were computed for the Wabash River reach by means of a one-dimensional stepbackwater model. The hydraulic model was calibrated by using the most current stage-discharge relations at USGS streamgage 03343010, Wabash River at Memorial Bridge at Vincennes, Ind., and preliminary high-water marks from a high-water event on April 27, 2013. The calibrated hydraulic model was then used to determine 19 water-surface profiles for flood stages at 1-foot intervals referenced to the streamgage datum and ranging from 10 feet (ft) or near bankfull to 28 ft, the highest stage of the current stage-discharge rating curve. The simulated water-surface profiles were then combined with a Geographic Information System (GIS) digital elevation model (DEM, derived from Light Detection and Ranging [lidar] data having a 0.98-ft vertical accuracy and 4.9-ft horizontal resolution) in order to delineate the area flooded at each water level.The availability of these maps—along with Internet information
Flood-inundation maps for Cedar Creek at 18th Street at Auburn, Indiana
Fowler, Kathleen K.
2018-02-27
Digital flood-inundation maps for a 1.9-mile reach of Cedar Creek at Auburn, Indiana (Ind.), from the First Street bridge, downstream to the streamgage at 18th Street, then ending approximately 1,100 feet (ft) downstream of the Baltimore and Ohio railroad, were created by the U.S. Geological Survey (USGS) in cooperation with the Indiana Department of Transportation. The flood-inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science web site at https://water.usgs.gov/osw/flood_inundation/, depict estimates of the areal extent and depth of flooding corresponding to selected water levels (stages) at the USGS streamgage on Cedar Creek at 18th Street at Auburn, Ind. (station number 04179520). Near-real-time stages at this streamgage may be obtained from the USGS National Water Information System at https://waterdata.usgs.gov/ or the National Weather Service Advanced Hydrologic Prediction Service at http://water.weather.gov/ahps/, although forecasts of flood hydrographs are not available at this site (ABBI3).Flood profiles were computed for the stream reach by means of a one-dimensional step-backwater model. The hydraulic model was calibrated by using the most current stage-discharge relation at the Cedar Creek at 18th Street at Auburn, Ind. streamgage and the documented high-water marks from the flood of March 11, 2009. The calibrated hydraulic model was then used to compute seven water-surface profiles for flood stages referenced to the streamgage datum and ranging from 7 ft, or near bankfull, to 13 ft, in 1-foot increments. The simulated water-surface profiles were then combined with a geographic information system digital elevation model (derived from light detection and ranging [lidar] data having a 0.98-ft vertical accuracy and 4.9-ft horizontal resolution) to delineate the area flooded at each water level.The availability of these maps, along with internet information regarding current stage from the USGS streamgage at Cedar Creek
Flood-inundation maps for the Patoka River in and near Jasper, southwestern Indiana
Fowler, Kathleen K.
2018-01-23
Digital flood-inundation maps for a 9.5-mile reach of the Patoka River in and near the city of Jasper, southwestern Indiana (Ind.), from the streamgage near County Road North 175 East, downstream to State Road 162, were created by the U.S. Geological Survey (USGS) in cooperation with the Indiana Department of Transportation. The flood-inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science web site at https://water.usgs.gov/osw/flood_inundation/, depict estimates of the areal extent and depth of flooding corresponding to selected water levels (stages) at the USGS streamgage Patoka River at Jasper, Ind. (station number 03375500). The Patoka streamgage is located at the upstream end of the 9.5-mile river reach. Near-real-time stages at this streamgage may be obtained from the USGS National Water Information System at https://waterdata.usgs.gov/ or the National Weather Service Advanced Hydrologic Prediction Service at http://water.weather.gov/ahps/, although flood forecasts and stages for action and minor, moderate, and major flood stages are not currently (2017) available at this site (JPRI3).Flood profiles were computed for the stream reach by means of a one-dimensional step-backwater model. The hydraulic model was calibrated by using the most current stage-discharge relation at the Patoka River at Jasper, Ind., streamgage and the documented high-water marks from the flood of April 30, 2017. The calibrated hydraulic model was then used to compute five water-surface profiles for flood stages referenced to the streamgage datum ranging from 15 feet (ft), or near bankfull, to 19 ft. The simulated water-surface profiles were then combined with a geographic information system digital elevation model (derived from light detection and ranging [lidar] data having a 0.98 ft vertical accuracy and 4.9 ft horizontal resolution) to delineate the area flooded at each water level.The availability of these flood-inundation maps, along with real
Giraldo, Juan S.
Anaerobic digestion is a process that is a common part of organic waste management systems and is used in concentrated animal feeding operations (CAFOs), wastewater treatment plants (WWTPs), and municipal solid waste (MSW) landfills. The process produces biogas, which contains methane, and it can be burned to generate electricity. Previous reports have indicated that based on the availability of feedstocks there is a large potential for biogas production and use for electricity generation in the state of Indiana. However, these reports varied in their consideration of important factors that affect the technical and economic feasibility of being able to develop the resources available. The goal of this thesis is to make a more targeted assessment of the electricity generation potential from biogas resources at CAFOs, WWTPs, and MSW landfills in Indiana. A capital budgeting model is used to estimate the net present value (NPV) of biogas electricity projects at facilities that are identified as technically suitable. A statewide estimate of the potential generation capacity is made by estimating the number of facilities that could profitably undertake a biogas electricity project. In addition this thesis explored the impact that different incentive policies would have on the economic viability of these projects. The results indicated that the electricity generation potential is much smaller when technical and economic factors are taken into account in addition to feedstock availability. In particular it was found that projects at hog farms are unlikely to be economically feasible in the present even when financial incentives are considered. In total, 47.94 MW of potential generating capacity is estimated from biogas production at CAFOs, WWTPs, and MSW landfills. Though results indicated that 37.10 MW of capacity are economically feasible under current operating conditions, sensitivity analysis reveals that these projects are very sensitive to capital cost assumptions
Watson, Dennis P; Ray, Bradley; Robison, Lisa; Huynh, Philip; Sightes, Emily; Walker, La Shea; Brucker, Krista; Duwve, Joan
2018-04-06
To reduce fatal drug overdoses, two approaches many states have followed is to pass laws expanding naloxone access and Good Samaritan protections for lay persons with high likelihood to respond to an opioid overdose. Most prior research has examined attitudes and knowledge among lay responders in large metropolitan areas who actively use illicit substances. The present study addresses current gaps in knowledge related to this issue through an analysis of data collected from a broader group of lay responders who received naloxone kits from 20 local health departments across Indiana. Postcard surveys were included inside naloxone kits distributed in 20 Indiana counties, for which 217 returned cards indicated the person completing it was a lay responder. The survey captured demographic information and experiences with overdose, including the use of 911 and knowledge about Good Samaritan protections. Few respondents had administered naloxone before, but approximately one third had witnessed a prior overdose and the majority knew someone who had died from one. Those who knew someone who had overdosed were more likely to have obtained naloxone for someone other than themselves. Also, persons with knowledge of Good Samaritan protections or who had previously used naloxone were significantly more likely to have indicated calling 911 at the scene of a previously witnessed overdose. Primary reasons for not calling 911 included fear of the police and the person who overdosed waking up on their own. Knowing someone who has had a fatal or non-fatal overdose appears to be a strong motivating factor for obtaining naloxone. Clarifying and strengthening Good Samaritan protections, educating lay persons about these protections, and working to improve police interactions with the public when they are called to an overdose scene are likely to improve implementation and outcomes of naloxone distribution and opioid-related Good Samaritan laws.
Czuba, J. A.; David, S. R.; Edmonds, D. A.
2017-12-01
High resolution topography reveals that meandering river floodplains in Indiana commonly have networks of channels. These floodplain channel networks are most prevalent in agricultural, low-gradient, wide floodplains. It appears that these networks are formed when floodplain channels connect oxbows to each other and the main river channel. Collectively, the channels in the floodplain create an interconnected network of pathways that convey water beginning at flows less than bankfull, and as stage increases, more of the floodplain becomes dissected by floodplain channels. In this work, we quantify the hydrodynamics and connectivity of the flow on the floodplain and in the main channel of the East Fork White River near Seymour, Indiana, USA. We constructed a two-dimensional numerical model using HECRAS of the river-floodplain system from LiDAR data and from main-channel river bathymetry to elucidate the behaviour of these floodplain channels across a range of flows. Model calibration and verification data included stage from a USGS gage, high-water marks at a high and medium flow, and an aerial photograph of inundation in the floodplain channels. The numerical model simulated flow depth and velocity, which was used to quantify connectivity of the floodplain channels, exchange between the main channel and floodplain channels, and residence time of water on the floodplain. Model simulations suggest that the floodplain channels convey roughly 50% of the total flow at what is typically considered "bankfull" flow. Overall, we present a process-based approach for analyzing complex floodplain-river systems where an individual floodplain-river system can be distilled down to a set of characteristic curves. Notably, we map the East Fork White River system to exchange-residence time space and argue that this characterization forms the basis for thinking about morphologic evolution (e.g., sediment deposition and erosion) and biogeochemistry (e.g., nitrate removal) in floodplain
Organic geochemistry in Pennsylvanian tidally influenced sediments from SW Indiana
Mastalerz, Maria; Kvale, E.P.; Stankiewicz, B.A.; Portle, K.
1999-01-01
Tidal rhythmites are vertically stacked small-scale sedimentary structures that record daily variations in tidal current energy and are known to overlie some low-sulfur coals in the Illinois Basin. Tidal rhythmites from the Pennsylvanian Brazil Formation in Indiana have been analyzed sedimentologically, petrographically, and geochemically in order to understand the character and distribution of organic matter (OM) preserved in an environment of daily interactions between marine and fresh waters. The concentration of organic matter (TOC) ranges from traces to 6.9% and sulfur rarely exceeds 0.1% in individual laminae. Angular vitrinite is the major organic matter type, accounting for 50-90% of total OM. The C/S ratio decreases as the verfical distance from the underlying coal increases. A decreasing C/S ratio coupled with decreases in Pr/Ph, Pr/n-C17, Ph/n-C18 ratios and a shift of carbon isotopic composition towards less negative values suggest an increase in salinity from freshwater in the mudflat tidal rhythmite facies close to the coal to brackish/marine in the sandflat tidal rhythmite facies further above from the coal. Within an interval spanning one year of deposition, TOC and S values show monthly variability. On a daily scale, TOC and S oscillations are still detectable but they are of lower magnitude than on a monthly scale. These small-scale variations are believed to reflect oscillations in water salinity related to tidal cycles.Tidal rhythmites are vertically stacked small-scale sedimentary structures that record daily variations in tidal current energy and are known to overlie some low-sulfur coals in the Illinois Basin. Tidal rhythmites from the Pennsylvanian Brazil Formation in Indiana have been analyzed sedimentologically, petrographically, and geochemically in order to understand the character and distribution of organic matter (OM) preserved in an environment of daily interactions between marine and fresh waters. The concentration of organic matter
White-nose syndrome is likely to extirpate the endangered Indiana bat over large parts of its range
Thogmartin, Wayne E.; Sanders-Reed, Carol A.; Szymanski, Jennifer A.; McKann, Patrick C.; Pruitt, Lori; King, R. Andrew; Runge, Michael C.; Russell, Robin E.
2013-01-01
White-nose syndrome, a novel fungal pathogen spreading quickly through cave-hibernating bat species in east and central North America, is responsible for killing millions of bats. We developed a stochastic, stage-based population model to forecast the population dynamics of the endangered Indiana bat (Myotis sodalis) subject to white-nose syndrome. Our population model explicitly incorporated environmentally imposed annual variability in survival and reproductive rates and demographic stochasticity in predictions of extinction. With observed rates of disease spread, >90% of wintering populations were predicted to experience white-nose syndrome within 20 years, causing the proportion of populations at the quasi-extinction threshold of less than 250 females to increase by 33.9% over 50 years. At the species’ lowest median population level, ca. year 2022, we predicted 13.7% of the initial population to remain, totaling 28,958 females (95% CI = 13,330; 92,335). By 2022, only 12 of the initial 52 wintering populations were expected to possess wintering populations of >250 females. If the species can acquire immunity to the disease, we predict 3.7% of wintering populations to be above 250 females after 50 years (year 2057) after a 69% decline in abundance (from 210,741 to 64,768 [95% CI = 49,386; 85,360] females). At the nadir of projections, we predicted regional quasi-extirpation of wintering populations in 2 of 4 Recovery Units while in a third region, where the species is currently most abundant, >95% of the wintering populations were predicted to be below 250 females. Our modeling suggests white-nose syndrome is capable of bringing about severe numerical reduction in population size and local and regional extirpation of the Indiana bat.
Flood-inundation maps for the East Fork White River near Bedford, Indiana
Fowler, Kathleen K.
2014-01-01
Digital flood-inundation maps for an 1.8-mile reach of the East Fork White River near Bedford, Indiana (Ind.) were created by the U.S. Geological Survey (USGS) in cooperation with the Indiana Department of Transportation. The inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science Web site at http://water.usgs.gov/osw/flood_inundation/ depict estimates of the areal extent and depth of flooding corresponding to selectedwater levels (stages) at USGS streamgage 03371500, East Fork White River near Bedford, Ind. Current conditions for estimating near-real-time areas of inundation using USGS streamgage information may be obtained on the Internet at http://waterdata.usgs.gov/in/nwis/uv?site_no=03371500. In addition, information has been provided to the National Weather Service (NWS) for incorporation into their Advanced Hydrologic Prediction Service (AHPS) flood warning system (http://water.weather.gov/ahps/). The NWS forecasts flood hydrographs at many places that are often colocated with USGS streamgages, including the East Fork White River near Bedford, Ind. NWS-forecasted peak-stage information may be used in conjunction with the maps developed in this study to show predicted areas of flood inundation. For this study, flood profiles were computed for the East Fork White River reach by means of a one-dimensional step-backwater model. The hydraulic model was calibrated by using the most current stage-discharge relations at USGS streamgage 03371500, East Fork White River near Bedford, Ind., and documented high-water marks from the flood of June 2008. The calibrated hydraulic model was then used to determine 20 water-surface profiles for flood stages at 1-foot intervals referenced to the streamgage datum and ranging from bankfull to the highest stage of the current stage-discharge rating curve. The simulated water-surface profiles were then combined with a geographic information system (GIS) digital elevation model (DEM, derived from
Lab Streaming Layer Enabled Myo Data Collection Software User Manual
2017-06-07
SECURITY CLASSIFICATION OF: 17. LIMITATION OF ABSTRACT UU 18. NUMBER OF PAGES 32 19a. NAME OF RESPONSIBLE PERSON...www.tumsenahopayga.com/ wp-content/uploads/2015/12/Myo- By-Thalmic-Labs-Gesture-Sensor-Controller-Armbad-For-iPhone- Android -Mac-and-PC.jpg...uploads/2015/12/Myo-By-Thalmic-Labs- Gesture-Sensor-Controller-Armbad-For-iPhone- Android -Mac-and-PC.jpg) LSL is an open source system for transmitting
2009-05-01
There was an attempt to provide oversight , foster inclusion and develop an integrated healthcare delivery system within the current Service cultures...IT in the NCR. The “J6 JPG provides oversight of IM/IT initiatives for the Joint Operating Area (JOA).” (Rowland, 2009) Membership for the JPG...lateral violence; 3) supporting professional development; and 4) offering services such as child and elder care programs, telecommuting , flexible work
Oyler-McCance, Sara J.; Fike, Jennifer A.
2011-01-01
Primers for 10 microsatellite loci were developed specifically to amplify low quantity and quality DNA in the endangered Indiana Bat (Myotis sodalis). In a screen of 20 individuals from a population in Missouri, the 10 loci were found to have levels of variability ranging from seven to 18 alleles. No loci were found to be linked, although two loci revealed significant departures from Hardy–Weinberg equilibrium. These microsatellite loci will be applicable for population genetic analyses and for use in mark-recapture studies that utilize DNA collected non-invasively from fecal pellets, which will ultimately aid in management efforts.
Hitt, William D.; And Others
Existing education and training (E&T) programs at the Terre Haute Penitentiary, Indiana, and the Milan Federal Correctional Institution, Michigan, were described and evaluated. Needs, objectives, inmate classification and placement, staff, and other aspects were covered. Reports, staff and inmate interviews, study of instructional materials, and…
Waterman, David C., Comp.; Gibbs, Vanita M., Comp.
Focusing on reading for enjoyment, the seven articles in this collection were drawn from the Tenth Annual Reading Conference held at Indiana State University. Topics discussed in the articles are: (1) reading aloud to students, (2) how to have fun while teaching vocabulary, (3) the enjoyment and affective dimensions of "EAS into Reading," (4)…
Cancer Research Center Indiana University School of Medicine
Energy Technology Data Exchange (ETDEWEB)
1994-08-01
The Department of Energy (DOE) proposes to authorize the Indiana School of Medicine to proceed with the detailed design, construction and equipping of the proposed Cancer Research Center (CRC). A grant was executed with the University on April 21, 1992. A four-story building with basement would be constructed on the proposed site over a 24-month period. The proposed project would bring together, in one building, three existing hematology/oncology basic research programs, with improved cost-effectiveness through the sharing of common resources. The proposed site is currently covered with asphaltic pavement and is used as a campus parking lot. The surrounding area is developed campus, characterized by buildings, walkways, with minimal lawns and plantings. The proposed site has no history of prior structures and no evidence of potential sources of prior contamination of the soil. Environmental impacts of construction would be limited to minor increases in traffic, and the typical noises associated with standard building construction. The proposed CRC project operation would involve the use radionuclides and various hazardous materials in conducting clinical studies. Storage, removal and disposal of hazardous wastes would be managed under existing University programs that comply with federal and state requirements. Radiological safety programs would be governed by Nuclear Regulatory Commission (NRC) license and applicable Environmental Protection Agency (EPA) regulations. There are no other NEPA reviews currently active which are in relationship to this proposed site. The proposed project is part of a Medical Campus master plan and is consistent with applicable local zoning and land use requirements.
Cancer Research Center Indiana University School of Medicine
International Nuclear Information System (INIS)
1994-08-01
The Department of Energy (DOE) proposes to authorize the Indiana School of Medicine to proceed with the detailed design, construction and equipping of the proposed Cancer Research Center (CRC). A grant was executed with the University on April 21, 1992. A four-story building with basement would be constructed on the proposed site over a 24-month period. The proposed project would bring together, in one building, three existing hematology/oncology basic research programs, with improved cost-effectiveness through the sharing of common resources. The proposed site is currently covered with asphaltic pavement and is used as a campus parking lot. The surrounding area is developed campus, characterized by buildings, walkways, with minimal lawns and plantings. The proposed site has no history of prior structures and no evidence of potential sources of prior contamination of the soil. Environmental impacts of construction would be limited to minor increases in traffic, and the typical noises associated with standard building construction. The proposed CRC project operation would involve the use radionuclides and various hazardous materials in conducting clinical studies. Storage, removal and disposal of hazardous wastes would be managed under existing University programs that comply with federal and state requirements. Radiological safety programs would be governed by Nuclear Regulatory Commission (NRC) license and applicable Environmental Protection Agency (EPA) regulations. There are no other NEPA reviews currently active which are in relationship to this proposed site. The proposed project is part of a Medical Campus master plan and is consistent with applicable local zoning and land use requirements
NSGIC State | GIS Inventory — The following is excerpted from the metadata provided by NASS (USDA) for the source data set CDL_AWIFS_R_IN_2006.tif: "The USDA-NASS 2006 Indiana Cropland Data Layer...
Cost Effectiveness of ASHRAE Standard 90.1-2013 for the State of Indiana
Energy Technology Data Exchange (ETDEWEB)
Hart, Philip R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Athalye, Rahul A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Xie, YuLong [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Zhuge, Jing Wei [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Halverson, Mark A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Loper, Susan A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Rosenberg, Michael I. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Richman, Eric E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2015-12-01
Moving to the ASHRAE Standard 90.1-2013 (ASHRAE 2013) edition from Standard 90.1-2010 (ASHRAE 2010) is cost-effective for the State of Indiana. The table below shows the state-wide economic impact of upgrading to Standard 90.1-2013 in terms of the annual energy cost savings in dollars per square foot, additional construction cost per square foot required by the upgrade, and life-cycle cost (LCC) per square foot. These results are weighted averages for all building types in all climate zones in the state, based on weightings shown in Table 4. The methodology used for this analysis is consistent with the methodology used in the national cost-effectiveness analysis. Additional results and details on the methodology are presented in the following sections. The report provides analysis of two LCC scenarios: Scenario 1, representing publicly-owned buildings, considers initial costs, energy costs, maintenance costs, and replacement costs—without borrowing or taxes. Scenario 2, representing privately-owned buildings, adds borrowing costs and tax impacts.
Communication grounding facility
International Nuclear Information System (INIS)
Lee, Gye Seong
1998-06-01
It is about communication grounding facility, which is made up twelve chapters. It includes general grounding with purpose, materials thermal insulating material, construction of grounding, super strength grounding method, grounding facility with grounding way and building of insulating, switched grounding with No. 1A and LCR, grounding facility of transmission line, wireless facility grounding, grounding facility in wireless base station, grounding of power facility, grounding low-tenton interior power wire, communication facility of railroad, install of arrester in apartment and house, install of arrester on introduction and earth conductivity and measurement with introduction and grounding resistance.
Community Energy Systems and the Law of Public Utilities. Volume Sixteen. Indiana
Energy Technology Data Exchange (ETDEWEB)
Feurer, D A; Weaver, C L
1981-01-01
A detailed description is given of the laws and programs of the State of Indiana governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Managing the risks: An analysis of bird strike reporting at Part 139 Airports in Indiana 2001-2014
Directory of Open Access Journals (Sweden)
Flavio Mendonca
2017-04-01
Full Text Available Purpose: The purpose of the current study was fourfold: to identify bird strike reporting trends at Part 139 airports in Indiana (2001-2014 for comparison to national data; to determine which quarter of the year yields the most bird strike data; to gain a clearer understanding of the relationship between altitude and bird strikes, and to develop information based upon the data analyzed that can be used for the safety management of birds including comparisons to national data. Design/methodology: The researchers in this study answered the research questions by reviewing, sorting, and analyzing existing data. The data collection took place from March 01 to May 02, 2016. Two data sets were utilized for data collection. The National Wildlife Strike Database (NWSD and the FAA Air Traffic Activity System (ATADS. Findings: When compared to national data, Indiana Part 139 airports have seen a faster increase in bird strike reporting during 2012 and 2014. Aggregate data indicated June through September (Quarter 3 had a significantly higher frequency of bird strikes reported. When examining bird strikes and altitude of occurrences, the exponential equation explained 95 % of the variation in number of strikes by 1,000-foot intervals from 1000 to 10,000 feet. Not surprisingly, the risk of bird strikes appears to decrease as altitude increases. Originality/value: This study adds to the body of knowledge by addressing the lack of published bird strike report analyses at a regional level. It also connects data analyses to safety management system (SMS concepts and Wildlife Hazards Management Programs (WHMP. The aviation community can use regional bird strike data and information to develop or enhance existing wildlife hazard management programs, increase pilot awareness, and offers airport managerial implications.
International Nuclear Information System (INIS)
Oh, Jong Min; Bae, Jae Geun
1997-08-01
This book deals with ground pollution science and soil science, classification of soil and fundamentals, ground pollution and human, ground pollution and organic matter, ground pollution and city environment, environmental problems of the earth and ground pollution, soil pollution and development of geological features of the ground, ground pollution and landfill of waste, case of measurement of ground pollution.
Waterman, David C., Ed.; Gibbs, Vanita M., Ed.
This pamphlet is a collection of the speeches given at the Third Annual Reading Conference at Indiana State University, Terre Haute. The theme of the conference was "Oral Language and Reading." The contents include: "Official Program"; opening remarks, "They Led and Followed," by William G. McCarthy; opening address, "Strategies for Reading…
Kerr, Zachary Y.; Dalton, Sara L.; Roos, Karen G.; Djoko, Aristarque; Phelps, Jennifer; Dompier, Thomas P.
2016-01-01
Background: In Indiana, high school football coaches are required to complete a coaching education course with material related to concussion awareness, equipment fitting, heat emergency preparedness, and proper technique. Some high schools have also opted to implement a player safety coach (PSC). The PSC, an integral component of USA Football’s Heads Up Football (HUF) program, is a coach whose primary responsibility is to ensure that other coaches are implementing proper tackling and blocking techniques alongside other components of the HUF program. Purpose: To compare injury rates in Indiana high school football teams by their usage of a PSC or online coaching education only. Study Design: Cohort study; Level of evidence, 2. Methods: Athletic trainers (ATs) evaluated and tracked injuries at each practice and game during the 2015 high school football season. Players were drawn from 6 teams in Indiana. The PSC group, which used the PSC component, was comprised of 204 players from 3 teams. The “education only” group (EDU), which utilized coaching education only, was composed of 186 players from 3 teams. Injury rates and injury rate ratios (IRRs) were reported with 95% confidence intervals (CIs). Results: During 25,938 athlete-exposures (AEs), a total of 149 injuries were reported, of which 54 (36.2%) and 95 (63.8%) originated from the PSC and EDU groups, respectively. The practice injury rate was lower in the PSC group than the EDU group (2.99 vs 4.83/1000 AEs; IRR, 0.62; 95% CI, 0.40-0.95). The game injury rate was also lower in the PSC group than the EDU group (11.37 vs 26.37/1000 AEs; IRR, 0.43; 95% CI, 0.25-0.74). When restricted to concussions only, the rate was lower in the PSC group (0.09 vs 0.73/1000 AEs; IRR, 0.12; 95% CI, 0.01-0.94), although only 1 concussion was reported in the PSC group. No differences were found in game concussion rates (0.60 vs 4.39/1000 AEs; IRR, 0.14; 95% CI, 0.02-1.11). Conclusion: Findings support the PSC as an effective
1982-04-12
EPA regulations to protect human health and the environment from the improper management of hazardous waste were published in the Federal Register on May 19, 1980 (45 FR 33063). These regulations include provisions for authorization of State programs to operate in lieu of the Federal program. Today EPA is announcing the availability for public review of the Indiana application for Phase I Interim Authorization, inviting public comment, and giving notice of a public hearing to be held on the application.
Microbial ecology of acid strip mine lakes in southern Indiana
International Nuclear Information System (INIS)
Gyure, R.A.
1986-01-01
In this study, the author examined the limnology and microbial ecology of two acid strip mine lakes in the Greene-Sullivan State Forest near Dugger, Indiana. Reservoir 29 is a larger lake (225 ha) with water column pH of 2.7 and sediment pH of 3.8. Lake B, a smaller (20 ha) lake to the south of Reservoir 29, also has an acidic water column (pH 3.4) but more neutral sediments (pH 6.2). Both have very high sulfate concentrations: 20-30 mM in the water column and as high as 100 mM in the hypolimnion of Lake B. Low allochthonous carbon and nutrient input characterize these lakes as oligotrophic, although algal biomass is higher than would be expected for this trophic status. In both lakes, algal populations are not diverse, with a few species of single-celled Chlorophyta and euglenoids dominating. Algal biomass is concentrated in a thin 10 cm layer at the hypolimnion/metalimnion interface, although light intensity at this depth is low and severely limits productivity. Bacterial activity based on 14 C-glucose incorporation is highest in the hypolimnion of both lakes, and sulfate-reduction is a dominant process in the sediments. Rates of sulfate-reduction compare with those in other freshwater environments, but are not as high as rates measured in high sulfate systems like saltmarsh and marine sediments
Fahie, Monique
With most of the energy produced in the state of Indiana coming from coal, the implementation of policy instruments such as cap-and-trade, which is included in the most recent climate bill, will have significant effects. This thesis provides an analysis of the effects that a cap-and-trade policy might have on the investment decisions for alternative technologies in the power plant sector in Indiana. Two economic models of representative coal-fired power plants, Gallagher (600MW) and Rockport (2600MW), are selected and used to evaluate the repowering decision of a plant for several technologies: integrated gasification combined cycle (IGCC), wind farm combined with natural gas combined cycle (NGCC) and supercritical pulverized coal (SCPC). The firm will make its decisions based on the net present value (NPV) of cost estimates for these CO2 reducing technologies, the cost of purchasing offsets and CO 2 allowances. This model is applied to a base case and three American Clean Energy and Security Act of 2009 cases derived from the Energy Information Administration (EIA, 2009b). A sensitivity analysis is done on the discount rate and capital costs. The results of the study indicate that a SCPC plant without carbon capture and storage (CCS) is the least costly compliance option for both plants under all of the cases while retrofitting the existing plant with CCS is the most expensive. Gallagher's three least expensive options across most scenarios were SCPC without CCS, the operation of the existing plant as is and investment in wind plus NGCC. Rockport's three least expensive compliance options across most scenarios were SCPC without CCS, the operation of the existing plant as is and IGCC without CCS. For both plants, when a 12% discount rate is utilized, NPV of costs are generally lower and the operation of the existing plant technology with the aid of allowances and offsets to be in compliance is the cheapest option. If capital costs were to decrease by 30%, a SCPC
Harris, Tina
2015-04-29
Grounded theory is a popular research approach in health care and the social sciences. This article provides a description of grounded theory methodology and its key components, using examples from published studies to demonstrate practical application. It aims to demystify grounded theory for novice nurse researchers, by explaining what it is, when to use it, why they would want to use it and how to use it. It should enable nurse researchers to decide if grounded theory is an appropriate approach for their research, and to determine the quality of any grounded theory research they read.
Grau, L; Laulagnet, B
2015-05-01
An analytical approach is investigated to model ground-plate interaction based on modal decomposition and the two-dimensional Fourier transform. A finite rectangular plate subjected to flexural vibration is coupled with the ground and modeled with the Kirchhoff hypothesis. A Navier equation represents the stratified ground, assumed infinite in the x- and y-directions and free at the top surface. To obtain an analytical solution, modal decomposition is applied to the structure and a Fourier Transform is applied to the ground. The result is a new tool for analyzing ground-plate interaction to resolve this problem: ground cross-modal impedance. It allows quantifying the added-stiffness, added-mass, and added-damping from the ground to the structure. Similarity with the parallel acoustic problem is highlighted. A comparison between the theory and the experiment shows good matching. Finally, specific cases are investigated, notably the influence of layer depth on plate vibration.
Competition-strength-dependent ground suppression in figure-ground perception.
Salvagio, Elizabeth; Cacciamani, Laura; Peterson, Mary A
2012-07-01
Figure-ground segregation is modeled as inhibitory competition between objects that might be perceived on opposite sides of borders. The winner is the figure; the loser is suppressed, and its location is perceived as shapeless ground. Evidence of ground suppression would support inhibitory competition models and would contribute to explaining why grounds are shapeless near borders shared with figures, yet such evidence is scarce. We manipulated whether competition from potential objects on the ground side of figures was high (i.e., portions of familiar objects were potentially present there) or low (novel objects were potentially present). We predicted that greater competition would produce more ground suppression. The results of two experiments in which suppression was assessed via judgments of the orientation of target bars confirmed this prediction; a third experiment showed that ground suppression is short-lived. Our findings support inhibitory competition models of figure assignment, in particular, and models of visual perception entailing feedback, in general.
Regional analysis of ground and above-ground climate
1981-12-01
The regional suitability of underground construction as a climate control technique is discussed with reference to (1) a bioclimatic analysis of long term weather data for 29 locations in the United States to determine appropriate above ground climate control techniques, (2) a data base of synthesized ground temperatures for the coterminous United States, and (3) monthly dew point ground temperature comparisons for identifying the relative likelihood of condensation from one region to another. It is concluded that the suitability of Earth tempering as a practice and of specific Earth sheltered design stereotypes varies geographically; while the subsurface almost always provides a thermal advantage on its own terms when compared to above ground climatic data, it can, nonetheless, compromise the effectiveness of other, regionally more important climate control techniques. Reviews of above and below ground climate mapping schemes related to human comfort and architectural design, and detailed description of a theoretical model of ground temperature, heat flow, and heat storage in the ground are included. Strategies of passive climate control are presented in a discussion of the building bioclimatic analysis procedure which has been applied in a computer analysis of 30 years of weather data for each of 20 locations in the United States.
Regional analysis of ground and above-ground climate
Energy Technology Data Exchange (ETDEWEB)
1981-12-01
The regional suitability of underground construction as a climate control technique is discussed with reference to (1) a bioclimatic analysis of long-term weather data for 29 locations in the United States to determine appropriate above ground climate control techniques, (2) a data base of synthesized ground temperatures for the coterminous United States, and (3) monthly dew point ground temperature comparisons for identifying the relative likelihood of condensation from one region to another. It is concluded that the suitability of earth tempering as a practice and of specific earth-sheltered design stereotypes varies geographically; while the subsurface almost always provides a thermal advantage on its own terms when compared to above ground climatic data, it can, nonetheless, compromise the effectiveness of other, regionally more important climate control techniques. Also contained in the report are reviews of above and below ground climate mapping schemes related to human comfort and architectural design, and detailed description of a theoretical model of ground temperature, heat flow, and heat storage in the ground. Strategies of passive climate control are presented in a discussion of the building bioclimatic analysis procedure which has been applied in a computer analysis of 30 years of weather data for each of 29 locations in the United States.
International Nuclear Information System (INIS)
1989-01-01
The proceedings of the 5th biennial symposium of the Ground Water Division of the Geological Society of South Africa are presented. The theme of the symposium was ground water and mining. Papers were presented on the following topics: ground water resources; ground water contamination; chemical analyses of ground water and mining and its influece on ground water. Separate abstracts were prepared for 5 of the papers presented. The remaining papers were considered outside the subject scope of INIS
Flood inundation maps for the Wabash and Eel Rivers at Logansport, Indiana
Fowler, Kathleen K.
2014-01-01
Digital flood-inundation maps for an 8.3-mile reach of the Wabash River and a 7.6-mile reach of the Eel River at Logansport, Indiana (Ind.), were created by the U.S. Geological Survey (USGS) in cooperation with the Indiana Office of Community and Rural Affairs. The inundation maps, which can be accessed through the USGS Flood Inundation Mapping Science Web site at http://water.usgs.gov/osw/flood_inundation/, depict estimates of the areal extent and depth of flooding corresponding to selected water levels (stages) at USGS streamgage Wabash River at Logansport, Ind. (sta. no. 03329000) and USGS streamgage Eel River near Logansport, Ind. (sta. no. 03328500). Current conditions for estimating near-real-time areas of inundation using USGS streamgage information may be obtained on the Internet at http://waterdata.usgs.gov/. In addition, information has been provided to the National Weather Service (NWS) for incorporation into their Advanced Hydrologic Prediction Service (AHPS) flood warning system http:/water.weather.gov/ahps/). The NWS forecasts flood hydrographs at many places that are often colocated with USGS streamgages. NWS-forecasted peak-stage information may be used in conjunction with the maps developed in this study to show predicted areas of flood inundation. For this study, flood profiles were computed for the stream reaches by means of a one-dimensional step-backwater model developed by the U.S. Army Corps of Engineers. The hydraulic model was calibrated by using the most current stage-discharge relations at USGS streamgages 03329000, Wabash River at Logansport, Ind., and 03328500, Eel River near Logansport, Ind. The calibrated hydraulic model was then used to determine five water-surface profiles for flood stage at 1-foot intervals referenced to the Wabash River streamgage datum, and four water-surface profiles for flood stages at 1-foot intervals referenced to the Eel River streamgage datum. The stages range from bankfull to approximately the highest
Disney, R Henry L; Copeland, Robert S; Murrell, Ebony
2009-07-01
Among the insects reported by Copeland (1989) breeding in the waters retained by treeholes in Indiana was a scuttle fly identified by W. H. Robinson as Megaselia scalaris (Loew). It is here reported that in fact this fly, along with fresh material from Illinois and Missouri, is M. imitatrix Borgmeier, whose type series was from Puerto Rico. An aquatic species reported from Texas is recognized as a sibling species of M. imitatrix and is named M. hansonix Disney, sp. nov. A single female from Brazil represents a third species of this complex, thus raising doubts about the identity of specimens from Brazil attributed to M. imitatrix by Benton and Claugher (2000).
International Education Policies and the Boundaries of Global Citizenship in the US
Frey, Christopher J.; Whitehead, Dawn Michele
2009-01-01
This paper analyses recent policy statements around international education produced by US state boards of education and their international education advisory councils, and investigates policy developments in two US states, Ohio and Indiana, to better ground the discussion of education policy-making in the local political, economic, and…
An ecological classification system for the central hardwoods region: The Hoosier National Forest
James E. Van Kley; George R. Parker
1993-01-01
This study, a multifactor ecological classification system, using vegetation, soil characteristics, and physiography, was developed for the landscape of the Hoosier National Forest in Southern Indiana. Measurements of ground flora, saplings, and canopy trees from selected stands older than 80 years were subjected to TWINSPAN classification and DECORANA ordination....
Targets, Effects, and Perpetrators of Sexual Harassment in Newsrooms.
Brown, Cindy M.; Flatow, Gail M.
1997-01-01
Surveys Indiana journalists, finding that two models tested (the sociocultural model and the organizational model, both grounded in conception of power differences between harassed and harasser) have explanatory power, but that they explain the same results in different ways and sometimes combinations of the models provide better explanations of…
Survey of forensic mental health experts on pro se competence after Indiana v. Edwards.
Kaufman, Andrew R; Knoll, James L; Way, Bruce B; Leonard, Cecilia; Widroff, Jacob
2011-01-01
In Indiana v. Edwards (2008) the U.S. Supreme Court held that a higher standard may be required for pro se competence (PSC) than for competence to stand trial (CST), but provided little guidance for the trial court judge. This survey of forensic mental health experts studied potential PSC criteria. Sixty-eight (22.7%) forensic evaluators replied. Three McGarry criteria were reported as requiring a much higher standard for PSC: to appraise the available legal defenses (45.6%), to plan a legal strategy (51.5%), and to question and challenge witnesses (44.1%). Sixty percent agreed that standby counsel should be mandatory. Respondents opined that average abilities were sufficient for intelligence (77.9%), literacy (69.1%), and verbal ability (70.6%) were sufficient. PSC examiners may wish to assess appraisal of available legal defenses, planning a legal strategy, and questioning and challenging witnesses for a higher standard than CST. Evaluators should also assess the defendant's willingness to accept standby counsel (SBC) and the defendant's motivation for attempting a pro se defense.
Detecting Subsurface Agricultural Tile Drainage using GIS and Remote Sensing Technique
Budhathoki, M.; Gokkaya, K.; Tank, J. L.; Christopher, S. F.; Hanrahan, B.
2015-12-01
Subsurface tile drainage is a common practice in many of the row crop dominated agricultural lands in the Upper Midwest, which increases yield by making the soil more productive. It is reported that nearly half of all cropland in Indiana benefits from some sort of artificial drainage. However, subsurface tile has a significant negative impact on surface water quality by providing a fast means of transport for nutrients from fertilizers. Therefore, generating spatial data of tile drainage in the field is important and useful for agricultural landscape and hydrological studies. Subsurface tile drains in Indiana's croplands are not widely mapped. In this study, we will delineate subsurface tile drainage in agricultural land in Shatto Ditch watershed, located in Kosciusko County, Indiana. We will use geo-spatial methodology, which was purposed by earlier researchers to detect tile drainage. We will use aerial color-infrared and satellite imagery along with Light Detection and Ranging (LiDAR) data. In order to map tile lines with possible accuracy, we will use GIS-based analysis in combination with remotely sensed data. This research will be comprised of three stages: 1) masking out the potential drainage area using a decision tree rule based on land cover information, soil drainage category, surface slope, and satellite image differencing technique, 2) delineate tile lines using image processing techniques, and 3) check the accuracy of mapped tile lines with ground control points. To our knowledge, this study will be the first to check the accuracy of mapping with ground truth data. Based on the accuracy of results, we will extend the methodology to greater spatial scales. The results are expected to contribute to better characterizing and controlling water pollution sources in Indiana, which is a major environmental problem.
Traditional behaviour and fidelity to caribou calving grounds by barren-ground caribou
Directory of Open Access Journals (Sweden)
Anne Gunn
1986-06-01
Full Text Available Evidence for the fidelity of female barren-ground caribou (Rangifer tarandus spp. of each herd to specific calving grounds is convincing. Involvement of learned behaviour in the annual return of those cows to the same calving grounds implies such actions are a form of «traditional» behaviour. Even wide variations in population size have not yet knowingly led to marked changes in size or location of calving grounds or prolonged abandonment of established ones. Rarely is the adoption of new calving grounds reported and emigration to another herd's calving ground or interchange between calving grounds has not yet been unequivocally documented. The calving experience of individual caribou and environmental pressures may modify the cow's use patterns of her calving grounds. The current definition of herds based on traditional calving grounds may require modification, if increasing caribou numbers result in changes in traditions. However, current data do not contradict either the fidelity to traditional calving grounds or the concept of herd identity based on that fidelity.
Do Wind Turbines Affect Weather Conditions?: A Case Study in Indiana
Directory of Open Access Journals (Sweden)
Meghan F. Henschen
2011-01-01
Full Text Available Wind turbines are becoming increasingly widespread in the United States as the world looks for cleaner sources of energy. Scientists, policymakers, and citizens have strong opinions regarding the positive and negative effects of wind energy projects, and there is a great deal of misinformation about wind energy circulating on the Web and other media sources. The purpose of this study is to gain a better understanding of how the rotation of hundreds of turbines can influence local weather conditions within a wind farm and in the surrounding areas. This experiment measures temperature, atmospheric pressure, wind speed, wind direction, relative humidity, and evaporation with five weather instruments at Meadow Lake Wind Farm located in White, Jasper, and Benton Counties, Indiana, from November 4 through November 18, 2010. The data show that as wind passes throughout the wind farm, the air warms during the overnight and early morning hours and cools during daytime hours. Observed lower humidity rates and higher evaporation rates downwind also demonstrate that the air dries out as it travels through the wind farm. Further research over multiple seasons is necessary to examine the effects of warmer nighttime temperatures and drier conditions progressively downwind of the installation. Nevertheless, wind turbines did not negatively affect local weather patterns in our small-scale research and may actually prevent frost, which could have important positive implications for farmers by potentially prolonging the growing season.
Lee, Dong-Hun; Torchetti, Mia Kim; Killian, Mary Lea; Swayne, David E
2017-07-01
In mid-January 2016, an outbreak of H7N8 high-pathogenicity avian influenza virus (HPAIV) in commercial turkeys occurred in Indiana. Surveillance within the 10km control zone identified H7N8 low-pathogenicity avian influenza virus (LPAIV) in nine surrounding turkey flocks but no other HPAIV-affected premises. We sequenced four of the H7N8 HPAIV isolated from the single farm and nine LPAIV identified during control zone surveillance. Evaluation included phylogenetic network analysis indicating close relatedness across the HPAIV and LPAIV, and that the progenitor H7N8 LPAIV spread among the affected turkey farms in Indiana, followed by spontaneous mutation to HPAIV on a single premise through acquisition of three basic amino acids at the hemagglutinin cleavage site. Deep sequencing of the available viruses failed to identify subpopulations in either the HPAIV or LPAIV suggesting mutation to HPAIV likely occurred on a single farm and the HPAIV did not spread to epidemiologically linked LPAIV-affected farms. Published by Elsevier Inc.
Challa, Sowmya
The purpose of this study is to identify any trends in personality traits of students at a mid-western university along with the influence of gender, choice of STEM or non-STEM academic major, and level of education on personality traits. The chosen mid-western university is Indiana State University (ISU) located in Terre Haute, Indiana. This study investigated the personality traits of student's through administering Goldberg's (1999) International Personality Item Pool of the Big Five Broad Domains of Personality. The personality profiles of students at ISU who have taken the questionnare are summarized. The personality profiles of female students were analyzed further with special focus to identify the role of level of education and choice of major among female students. Based on the responses of the study's subjects, there are significant relationships found between gender and all of the big five personality traits. Level of education, graduate or undergraduate, had significant impact on extraversion, agreeability, concientiousness, and emotional stability. Choice of STEM and non-STEM major impacted emotional stability for subjects in general but its influence is not significant among female subjects. Choice of STEM or non-STEM major had a significant influence on the intelligence/imagination trait for both male and female subjects. Level of education did not have any significant influence on intellegence/imagination. Overall, this study found a few significant relationships between Big-Five personality traits and identified categorizations.
GROUNDED THEORY METHODOLOGY and GROUNDED THEORY RESEARCH in TURKEY
ARIK, Ferhat; ARIK, Işıl Avşar
2016-01-01
This research discusses the historical development of the Grounded Theory Methodology, which is one of the qualitative research method, its transformation over time and how it is used as a methodology in Turkey. The Grounded Theory which was founded by Strauss and Glaser, is a qualitative methodology based on inductive logic to discover theories in contrast with the deductive understanding which is based on testing an existing theory in sociology. It is possible to examine the Grounded Theory...
International Nuclear Information System (INIS)
Patil, A.
1984-01-01
In response to a request arising out of employee concerns over the medical surveillance program at the Chrysler Corporation Foundry located in Indianapolis, Indiana, an evaluation was made of chest radiographs evaluated by the program with specific concern directed to disagreement on the radiographic diagnosis of pneumoconiosis. The request was made by the Chrysler Corporation and the United Auto Workers National Joint Committee on Health and Safety. Three NIOSH certified B-readers independently interpreted a set of 78 systematically sampled posteroanterior (PA) chest radiographs from the system files. These interpretations were compared among themselves and with company interpretations. While none of the radiographs was deemed unreadable, 35% were classified as having poor technical quality. Only one film was found which had a profusion of small opacities, and the company had interpreted the film as positive. Overall, agreement on proportion of positive readings and agreement on individual films was as good between the company and B-readers as it was between any two of the individual B-readers. The author recommends, however, that in order to avoid future complaints of the nature, the company should use standard radiographic equipment and techniques, NIOSH certified B-readers, and current international classifications of radiographs for pneumoconioses in their medical surveillance program
A report on the Indiana University Workshop on future U.S. hadron facilities
International Nuclear Information System (INIS)
Syphers, M.J.
1995-01-01
In July 1994 a workshop was held at Indiana University to study and discuss options for future hadron collider facilities in the United States, and to identify related R ampersand D programs. The workshop was conducted under the auspices of the Accelerator Physics, Technologies, and Facilities Working Group of the DPF Long Term Planning Study. Roughly 50 participants from 17 institutions in the U.S. and Europe (CERN) were organized into six working groups to study magnets, cryogenics and vacuum, antiproton sources, injectors, interaction regions, and lattice and beam dynamics. Upgrades to existing facilities (namely, Fermilab) and a post-LHC facility were discussed at the workshop. In this paper, the discussion will focus on the post-LHC facility. One of the specific goals of the workshop was to develop a defensible parameters list for a 30 TeV x 30 TeV hadron collider with luminosity of 1 x 10 34 cm -2 sec -1 . While this accelerator would have only 50% higher energy than the SSC design, it was realized that the role of synchrotron radiation at this energy would significantly enhance the design and operation of the machine. Radiation damping times of a few hours, rather than one day, can be realized thus allowing less intense, but brighter proton beams
Brewer, Jeffrey L; Taber-Doughty, Teresa; Kubik, Sara
2010-01-01
We investigated the perceptions of people about the safety, security and privacy of a telecare monitoring system for adults with developmental disabilities living in residential settings. The telecare system was used by remote caregivers overnight, when staff were not present in the homes. We surveyed 127 people from different stakeholder groups in the state of Indiana. The people surveyed included those with knowledge or experience of telecare, and those without. The stakeholders were clients, their advocates, service provider administrators and independent case coordinators. The responses in each category for every group were positive except one: only 4 of the 11 telecare case coordinators agreed that the telecare system provided a secure environment. Overall, the telecare system was perceived to be as safe, secure and private as the conventional alternative of having staff in the home.
Ambers, Clifford P.
2001-09-01
A minor, normal fault related to compaction of the grainstone shoal facies of the Salem Limestone in south-central Indiana provides an unusual opportunity to test the pressure and temperature of both faulting and associated stylolitization. Syn-deformational sphalerite occurs in voids along the fault where it intersects an organic-rich shale parting in the sand flat facies overlying the grainstone. The sphalerite contains fluid inclusions that can be used for microthermobaric measurements. Most fluid inclusions in the sphalerite are demonstrably cogenetic with the host sphalerite and of the two-phase aqueous type common in Indiana, although many contain petroleum and others contain gas. Crushing tests in kerosene indicate that the aqueous inclusions contain dissolved methane in varying amounts as high as 1000 ppm. Microthermometry shows that late sphalerite growth, late fault movement, and late stylolitization all occurred as conditions approached 108°C and 292 bars. This pressure is in accord with a normal, basinal, geothermal gradient of 32.5°C/km that would produce the observed temperature under hydrostatic conditions at a burial depth of 2.7 km using an average fluid density of 1.1 g/cm 3. These results serve as a reminder that fluid inclusions in diagenetic minerals hold important temperature and pressure information regarding burial diagenesis of Paleozoic rocks across the North American midcontinent. Detailed study of dissolved gases in fluids trapped in disseminated sphalerite that is common across the midcontinent could help resolve the enigma of sedimentary rocks with high thermal maturity exposed at the surface across the region.
USAF Summer Faculty Research Program. 1981 Research Reports. Volume II.
1981-10-01
Spec ialty : IIS F ,re ign Policy ; American Indiana State University Nat ioinal Security Policy Dept. of Political Science A. si ,niled: A! Terre Haute...0 C-4 44 C E) I IC C z)~ w z . 0 cnCd d CCC C’) 0-4-9- ..- E-4 (-4 7-A.A).)).) (QUADI) was constructed in the same manner as for the plate bending...IV modifications in accordance with current policy . They are to expedite safety modifications that could ground airborne systems or inactivate ground
Grounding-Induced Sectional Forces and Residual Strength of Grounded Ship Hulls
DEFF Research Database (Denmark)
Paik, Jeom Kee; Pedersen, Preben Terndrup
1996-01-01
The aim of the present study is to determine the sectional forces induced by ship grounding and also to assess the residual strength of groundedship hulls. An analytical approach is used to estimate the grounding-induced sectional forces of ships. The extent and location of structural damage due...... to grounding is defined based on the ABS Safe Hull guide. The residual strength of damaged hulls is calculated by using a simple analytical formula. The method is applied to residual strength assessment of a damaged double hull tanker of 38,400 dwt due to grounding....
Constructivist Grounded Theory?
Directory of Open Access Journals (Sweden)
Barney G. Glaser, PhD, Hon. PhD
2012-06-01
Full Text Available AbstractI refer to and use as scholarly inspiration Charmaz’s excellent article on constructivist grounded theory as a tool of getting to the fundamental issues on why grounded theory is not constructivist. I show that constructivist data, if it exists at all, is a very, very small part of the data that grounded theory uses.
Lifescience Database Archive (English)
Full Text Available Molecule: Ubiquitin Conjugating Enzyme; Chain: Null; Synonym: Ubc1; Engineered: Yes Ubiquitin Conjugation 6....TPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMYSESKREYNRRVRDVVEQSWTAD arabi_2AAK.jpg ...
76 FR 15042 - Transfer of Federally Assisted Land or Facility
2011-03-18
... the City of Terre Haute by and through its Board of Public Works intends to transfer a portion of a... Board of Trustees and leased to the City of Terre Haute under a forty (40) year ground lease dated January 1, 2006. The facility is located at 750 Cherry Street, Terre Haute, Indiana and is bounded on the...
International Nuclear Information System (INIS)
Brabson, B.B.; Crittenden, R.R.; Dzierba, A.R.; Heinz, R.M.; Neal, H.A.; Ogren, H.O.
1977-01-01
Since the beginning of the ERDA contract year (Dec. 1, 1976), the Indiana High Energy Physics Group has been actively participating in experimental programs at SLAC, Fermilab, CERN, and the Argonne ZGS. The SLAC effort (E103) is a search for exotic mesons. The polarization program at Fermilab's internal target (CO) area involves polarization measurements in pp → pp (E313) and pp → pX (E522). The contribution to the Multiparticle Spectrometer at Fermilab is a major ingredient in a series of experiments (E110/260/523/557) studying low-p/sub t/ and high-p/sub t/ hadron-hadron collisions. At CERN work is carried out with a Saclay group at the SPS to investigate properties of psi meson production in experiment WAll. The Argonne ZGS endeavor (E399) is to measure various inclusive polarizations, complementing Fermilab E522 work. Also participation is given in design work on a PEP proposal. A discussion of these experiments is given
Energy Technology Data Exchange (ETDEWEB)
1980-11-01
This national workshop on ground water and energy was conceived by the US Department of Energy's Office of Environmental Assessments. Generally, OEA needed to know what data are available on ground water, what information is still needed, and how DOE can best utilize what has already been learned. The workshop focussed on three areas: (1) ground water supply; (2) conflicts and barriers to ground water use; and (3) alternatives or solutions to the various issues relating to ground water. (ACR)
Cooney, Adeline
2011-01-01
This paper explores ways to enhance and demonstrate rigour in a grounded theory study. Grounded theory is sometimes criticised for a lack of rigour. Beck (1993) identified credibility, auditability and fittingness as the main standards of rigour for qualitative research methods. These criteria were evaluated for applicability to a Straussian grounded theory study and expanded or refocused where necessary. The author uses a Straussian grounded theory study (Cooney, In press) to examine how the revised criteria can be applied when conducting a grounded theory study. Strauss and Corbin (1998b) criteria for judging the adequacy of a grounded theory were examined in the context of the wider literature examining rigour in qualitative research studies in general and grounded theory studies in particular. A literature search for 'rigour' and 'grounded theory' was carried out to support this analysis. Criteria are suggested for enhancing and demonstrating the rigour of a Straussian grounded theory study. These include: cross-checking emerging concepts against participants' meanings, asking experts if the theory 'fit' their experiences, and recording detailed memos outlining all analytical and sampling decisions. IMPLICATIONS FOR RESEARCH PRACTICE: The criteria identified have been expressed as questions to enable novice researchers to audit the extent to which they are demonstrating rigour when writing up their studies. However, it should not be forgotten that rigour is built into the grounded theory method through the inductive-deductive cycle of theory generation. Care in applying the grounded theory methodology correctly is the single most important factor in ensuring rigour.
My Most Memorable AAS Meeting-December 1957, Butler University, Indianapolis, Indiana
Edmondson, F. K.
1999-05-01
My attendance at AAS meetings began with the 46th meeting in September 1931 at the brand new Perkins Observatory. This was the first semester of my junior year at Indiana University. Professor Wilbur Cogshall, my astronomy professor, took me to the meeting, and paid my expenses for dormitory accommodations and meals. Hence, my attendance at AAS meetings covers a span of nearly 68 years. There have been so many "memorable" meetings that it is hard to pick just one. However, the 99th meeting in December 1957 at Butler University in Indianapolis, a joint meeting with the AAAS, is memorable because I was in a wheel chair and using crutches, following an injury to my right knee cap. I was a member of the AAAS Committee to select the "best paper" presented at the meeting to receive the Newcomb Cleveland Prize, and Martin Schwarzschild's first report of results from Project Stratoscope was on the program. I showed up at the Committee meeting in my wheel chair, and nominated Martin's paper for the "best paper" award. The Committee asked a lot of questions and then approved the paper by a unanimous vote. The wheel chair and crutches obviously played a role in convincing the Committee that I had strong feelings about the merits of Martin's paper. Allan Sandage was the Warner Prize Lecturer, and reported on the current status of his revision of the cosmic distance scale. Hubble's 1936 distances needed to be increased by a factor of five to ten.
Patel, Puja; Hemmeger, Heather; Kozak, Mary Ann; Gernant, Stephanie A; Snyder, Margie E
2015-01-01
To describe the experiences and opinions of pharmacists serving as site coordinators for the Medication Safety Research Network of Indiana (Rx-SafeNet). Retail chain, independent, and hospital/health system outpatient community pharmacies throughout Indiana, with a total of 127 pharmacy members represented by 26 site coordinators. Rx-SafeNet, a statewide practice-based research network (PBRN) formed in 2010 and administered by the Purdue University College of Pharmacy. Barriers and facilitators to participation in available research studies, confidence participating in research, and satisfaction with overall network communication. 22 of 26 site coordinators participated, resulting in an 85% response rate. Most (72.2%) of the respondents had received a doctor of pharmacy degree, and 13.6% had postgraduate year (PGY)1 residency training. The highest reported benefits of PBRN membership were an enhanced relationship with the Purdue University College of Pharmacy (81% agreed or strongly agreed) and enhanced professional development (80% agreed or strongly agreed). Time constraints were identified as the greatest potential barrier to network participation, reported by 62% of respondents. In addition, the majority (59%) of survey respondents identified no prior research experience. Last, respondents' confidence in performing research appeared to increase substantially after becoming network members, with 43% reporting a lack of confidence in engaging in research before joining the network compared with 90% reporting confidence after joining the network. In general, Rx-SafeNet site coordinators appeared to experience increased confidence in research engagement after joining the network. While respondents identified a number of benefits associated with network participation, concerns about potential time constraints remained a key barrier to participation. These findings will assist network leadership in identifying opportunities to positively increase member participation
DEFF Research Database (Denmark)
Rasmussen, Thomas Bruun; Uttenthal, Åse; Fernandez, Jovita
2005-01-01
In order to establish a rapid and reliable system for the detection of vesicular stomatitis virus (VSV), we developed a quantitative reverse transcription-PCR assay for the detection, quantification, and differentiation of the major serotypes, VSV Indiana and VSV New Jersey, using a closed......-tube multiplex format. The detection system is based on the recently invented primer-probe energy transfer (PriProET) system. A region of the gene encoding the RNA-dependent RNA polymerase was amplified by using VSV-specific primers in the presence of two serotype-specific fluorescent probes. By incorporating...... probes. The limits of detection ware found to be less than 10 50% tissue culture infective doses/ml for both serotypes. The diagnostic value of the new method was tested with clinical materials from experimentally infected pigs, and it is concluded that the method is a powerful tool for the rapid...
Grounding of SNS Accelerator Structure
Holik, Paul S
2005-01-01
Description of site general grounding network. RF grounding network enhancement underneath the klystron gallery building. Grounding network of the Ring Systems with ground breaks in the Ring Tunnel. Grounding and Bonding of R&D accelerator equipment. SNS Building lightning protection.
Voelker, David C.; Bunch, Aubrey R.; Dobrowolski, Edward G.; Shoda, Megan E.
2015-01-01
Intermittently, during 1981–2012, the U.S. Geological Survey sampled sites in the White River and several tributaries in the Indianapolis metropolitan area of Indiana for benthic invertebrates and fish communities. During 1981–87, one study focused on benthic-invertebrate data collection at three sites along the White River. During 1994–96, 21 sites were sampled for benthic invertebrates; after 1999, up to 13 sites were sampled for benthic invertebrates and fish communities. The information collected during these studies was used in conjunction with the Indianapolis Department of Public Works and CWA Authority, Inc., programs to help improve overall health of the White River and its tributaries by reducing combined sewer overflows and other point and non-point sources of pollution in the Indianapolis area.
Rodol, Liban; Epson, Martin F; Bloom, Joseph D
2013-01-01
There has been a long-standing link between the civil and criminal commitment procedures for individuals found incompetent to stand trial (IST). In the criminal system, when restoration of competency fails to be realized in a reasonable time, the civil commitment process becomes the default system for commitment. While there have been recent calls for improved mechanisms for predicting competence restorability, there has been little attention paid to individuals who can oscillate indefinitely between commitment in both the criminal and civil systems. We provide an example of one such case where an individual falls into the legal space that sits outside of the judicial guidance outlined in the landmark case Jackson v. Indiana. This review of Oregon public documents surrounding an ongoing murder case highlights the potential for indefinite detention of individuals who have been charged with serious crimes that do not have a statute of limitations, who are unlikely to be restored to competency to stand trial, and who are inconsistently found to be dangerous under civil commitment standards.
Travel to Steel Warehouse Inc., Southbend, Indiana. Trip report, May 4, 1995
International Nuclear Information System (INIS)
Hill, N.F.
1995-01-01
On May 4, 1995 the author visited a steel plate and coil, cold reduction facility at Steel Warehouse Inc. located in South Bend, Indiana about 150 miles from Argonne. Some very interesting facts were learned about cold reduction of hot rolled steel during this visit. The company selected is only a cold reduction mill and buys steel from a number of steel producers. The author spent a total of about three hours with these people, and this included a tour of their pickling line, the small cold reduction mill which at present is limited to 15.5 in width maximum, and their large cold reduction mill which produces sheet and coil up to 72 in. wide. Some of the things that were learned, that will have an impact on the production of the Atlas steel plates are given here. (1) Hot rolled coils have some inherent, interesting, characteristics that must be taken into consideration when being cold reduced. (2) The monitoring of the coil thickness is only done along the center line of the coil, this has a serious impact on QC of plates cut from this coil for a number of reasons. (3) Hot rolled coils of steel in this particular instance may come from a number of different sources. This could cause problems if magnetic permeability is a serious issue. It was the author's impression that this facility is fairly typical of what one might expect from any similar facility
Jung's equation of the ground of being with the ground of psyche.
Dourley, John
2011-09-01
The paper amplifies Jung's psychology of ground associated with the culmination of the alchemical process in the unus mundus. It argues that Jung and Dorn identify the experience of the ground with the experience of divinity as the common originary source of individual and totality. It notes the monistic and pantheistic implications of the experience and goes on to amplify the experience through Eckhart's mediaeval mysticism of ground and Paul Tillich's modern philosophical/theological understanding of ground. It concludes that the Jung/Dorn psychological understanding of ground supersedes monotheistic consciousness. Their vision supports the emergence of a societal myth based on the identification of the ground as the source of all divinities and faith in them. This source currently urges a mythic consciousness that would surpass its past and current concretions and so alleviate the threat that monotheistic consciousness in any domain now poses to human survival. © 2011, The Society of Analytical Psychology.
Ground Water in the Anchorage Area, Alaska--Meeting the Challenges of Ground-Water Sustainability
Moran, Edward H.; Galloway, Devin L.
2006-01-01
Ground water is an important component of Anchorage's water supply. During the 1970s and early 80s when ground water extracted from aquifers near Ship Creek was the principal source of supply, area-wide declines in ground-water levels resulted in near record low streamflows in Ship Creek. Since the importation of Eklutna Lake water in the late 1980s, ground-water use has been reduced and ground water has contributed 14-30 percent of the annual supply. As Anchorage grows, given the current constraints on the Eklutna Lake water availability, the increasing demand for water could place an increasing reliance on local ground-water resources. The sustainability of Anchorage's ground-water resources challenges stakeholders to develop a comprehensive water-resources management strategy.
[Introduction to grounded theory].
Wang, Shou-Yu; Windsor, Carol; Yates, Patsy
2012-02-01
Grounded theory, first developed by Glaser and Strauss in the 1960s, was introduced into nursing education as a distinct research methodology in the 1970s. The theory is grounded in a critique of the dominant contemporary approach to social inquiry, which imposed "enduring" theoretical propositions onto study data. Rather than starting from a set theoretical framework, grounded theory relies on researchers distinguishing meaningful constructs from generated data and then identifying an appropriate theory. Grounded theory is thus particularly useful in investigating complex issues and behaviours not previously addressed and concepts and relationships in particular populations or places that are still undeveloped or weakly connected. Grounded theory data analysis processes include open, axial and selective coding levels. The purpose of this article was to explore the grounded theory research process and provide an initial understanding of this methodology.
Full Text Available ... Spouse About Sexual Dysfunction? Attachment: consultation.jpg OHSU - Therapeutic Approaches for PD: Depression, Anxiety & Psychosis CareMAP: Travel and Transportation: Part 2 ...
Davis, Holly S.
This study examines the correlation between absence, cognitive skills index (CSI), and various achievement indicators such as the Indiana Statewide Testing for Educational Progress (ISTEP) test scores, discrepancies, and school-based English and mathematics tests for 64 seventh-grade students from one middle school. Scores for each of the subtests…
Waters, John K.
2012-01-01
In the case of higher education, the hills are more like mountains of data that "we're accumulating at a ferocious rate," according to Gerry McCartney, CIO of Purdue University (Indiana). "Every higher education institution has this data, but it just sits there like gold in the ground," complains McCartney. Big Data and the new tools people are…
Directory of Open Access Journals (Sweden)
Dr. Alvita Nathaniel, DSN, APRN, BC
2005-06-01
Full Text Available The Grounded Theory Perspective III: Theoretical Coding, Barney G. Glaser (Sociology Press, 2005. Not intended for a beginner, this book further defi nes, describes, and explicates the classic grounded theory (GT method. Perspective III lays out various facets of theoretical coding as Glaser meticulously distinguishes classic GT from other subsequent methods. Developed many years after Glaser’s classic GT, these methods, particularly as described by Strauss and Corbin, adopt the grounded theory name and engender ongoing confusion about the very premises of grounded theory. Glaser distinguishes between classic GT and the adscititious methods in his writings, referring to remodeled grounded theory and its offshoots as Qualitative Data Analysis (QDA models.
Stochastic ground motion simulation
Rezaeian, Sanaz; Xiaodan, Sun; Beer, Michael; Kougioumtzoglou, Ioannis A.; Patelli, Edoardo; Siu-Kui Au, Ivan
2014-01-01
Strong earthquake ground motion records are fundamental in engineering applications. Ground motion time series are used in response-history dynamic analysis of structural or geotechnical systems. In such analysis, the validity of predicted responses depends on the validity of the input excitations. Ground motion records are also used to develop ground motion prediction equations(GMPEs) for intensity measures such as spectral accelerations that are used in response-spectrum dynamic analysis. Despite the thousands of available strong ground motion records, there remains a shortage of records for large-magnitude earthquakes at short distances or in specific regions, as well as records that sample specific combinations of source, path, and site characteristics.
Communication, concepts and grounding
van der Velde, Frank; van der Velde, F.
2015-01-01
This article discusses the relation between communication and conceptual grounding. In the brain, neurons, circuits and brain areas are involved in the representation of a concept, grounding it in perception and action. In terms of grounding we can distinguish between communication within the brain
Lifescience Database Archive (English)
Full Text Available Synonym: 3-Ketoacyl-Acyl Carrier Protein Synthase, Mitochondrial Beta-Ketoacyl-Acyl Carrier Protein Synthase; Chai...VIVLEEYEHAKRRGAKIYAELCGYGMSGDAHHITQPPEDGKGAVLAMTRALRQSGLCPNQIDYVNAHATSTPIGDAVEARAI...KTVFSEHATSGTLAFSSTKGATGHLLGAAGAVEAIFSILAIHHGVAPMTLNVKNPDPIFDKRFMPLTTSKKMLVRTAMSNSFGFGGTNASLLFASI arabi_1W0I.jpg ...
International Nuclear Information System (INIS)
1989-01-01
The paper presents a report of ''The Ground Based Plan'' of the United Kingdom Science and Engineering Research Council. The ground based plan is a plan for research in astronomy and planetary science by ground based techniques. The contents of the report contains a description of:- the scientific objectives and technical requirements (the basis for the Plan), the present organisation and funding for the ground based programme, the Plan, the main scientific features and the further objectives of the Plan. (U.K.)
Maximilien Brice
2005-01-01
Secretary-General; Mrs Juan Martabit. 0502017_07.jpg His Excellency Mr Juan Martabit, Ambassador,Permanent Representative of Chile to the United Nations Office in Geneva and other international organisations in Switzerland visiting the ATLAS building site. From left to right: Prof. Giora Mikenberg, ATLAS Collaboration; Mr Maximilian Metzger, Secretary-General and His Excellency Mr Juan Martabit. 0502017_08.jpg His Excellency Mr Juan Martabit, Ambassador,Permanent Representative of Chile to the United Nations Office in Geneva and other international organisations in Switzerland visiting the ATLAS cavern. From left to right: From left to right: Prof. Giora Mikenberg, ATLAS Collaboration; Mr Maximilian Metzger, Secretary-General; His Excellency Mr Juan Martabit and Mrs Juan Martabit.
Energy Technology Data Exchange (ETDEWEB)
Phillips, T.L.; DiMichele, W.A. [University of Illinois, Urbana, IL (United States). Dept. of Plant Biology
1998-04-01
Permineralized fossil plants in coal balls were collected along a kilometer transect through an organic-rich shale in the Springifled Coal in southwestern Indiana. The organic shale is an upper bench of the Springfield Coal in an area where the coal is split into an upper and lower bench by a complex system of clastics that originated as a splay. The clastic wedge, described as the Folsomville Member/Leslie Cemetery paleochannel, is up to 6 km wide and 15 m thick. The transect being approximately 100 m from the edge of the clastic wedge that splits the coal seam and follows the upper bench of coal over and toward the center of the clastic wedge. The dominant elements of the vegetation were the lycopsid tree Paralycopodites brevifolius and several species of medullosan pteridosperms. This report confirms the ecotonal habitats of this vegetation.
Lifescience Database Archive (English)
Full Text Available Molecule: Sulfolipid Biosynthesis (Sqd1) Protein; Chain: A; Engineered: Yes Isomerase A.M.Mulichak, M.J.Thei...IASIHDRISRWKALTGKSIELYVGDICDFEFLAESFKSFEPDSVVHFGEQRSAPYSMIDRSRAVYTQHNNVIGTLNVLFAIKEFGEECHLVKLGTMGEYGTPNIDIEE...LNRFCVQAAVGHPLTVYGKGGQTRGYLDIRDTVQCVEIAIANPAKAGEFRVFNQFTEQFSVNELASLVTKAGSKLGLDVKKMTVPNPRVEAEEHYYNAKHTKLMELGLEPHYLSDSLLDSLLNFAVQFKDRVDTKQIMPSVSWKKIGVKTKSMTT arabi_1QRR.jpg ...
Electrochemical stabilization of clayey ground
Rzhanitzin, B.A.; Sokoloff, V.P.
1947-01-01
Recently developed new methods of stabilization of weak grounds (e.g. the silicate treatment) are based on injection of chemical solutions into the ground. Such methods are applicable accordingly only to the kinds of ground that have the coefficient of filtration higher than 2 meters per 24 hours and permit penetration of the chemical solutions under pressure. This limit, however, as it is shown by our experience in construction, excludes a numerous and an important class of grounds, stabilization of which is indispensable in many instances. For example, digging of trenches and pits in clayey, silty, or sandy ground shows that all these types act like typical "floaters" (sluds? -S) in the presence of the ground water pressure. There were several instances in the canalization of the city of Moskow where the laying of trenches below the ground water level has led to extreme difficulties with clayey and silty ground. Similar examples could be cited in mining, engineering hydrology, and railroad construction. For these reasons, the development of methods of stabilizing such difficult types of ground has become an urgent problem of our day. In 1936, the author began his investigations, at the ground Stabilization Laboratory of VODGEO Institute, with direct electrical current as the means of stabilization of grounds. Experiments had shown that a large number of clayey types, following passage of direct electrical current, undergoes a transformation of its physico-chemical properties. It was established that the (apparent -S) density of the ground is substantially increased in consequence of the application of direct electrical current. The ground loses also its capacity to swell and to soften in water. Later, after a more detailed study of the physico-chemical mechanism of the electrical stabilization, it became possible to develop the method so as to make it applicable to sandy and silty as well as to clayey ground. By this time (1941, S.), the method has already been
Application of ERTS-A imagery to fracture related mine safety hazards in the coal mining industry
Wier, C. E.; Wobber, F. J. (Principal Investigator)
1973-01-01
The author has identified the following significant results. The most important result to date is the demonstration of the special value of repetitive ERTS-1 multiband coverage for detecting previously unknown fracture lineaments despite the presence of a deep glacial overburden. The Illinois Basin is largely covered with glacial drift and few rock outcrops are present. A contribution to the geological understanding of Illinois and Indiana has been made. Analysis of ERTS-1 imagery has provided useful information to the State of Indiana concerning the surface mined lands. The contrast between healthy vegetation and bare ground as imaged by Band 7 is sharp and substantial detail can be obtained concerning the extent of disturbed lands, associated water bodies, large haul roads, and extent of mined lands revegetation. Preliminary results of analysis suggest a reasonable correlation between image-detected fractures and mine roof fall accidents for a few areas investigated. ERTS-1 applications to surface mining operations appear probable, but further investigations are required. The likelihood of applying ERTS-1 derived fracture data to improve coal mine safety in the entire Illinois Basin is suggested from studies conducted in Indiana.
Modeling habitat distributions of bats using GIS: wind energy and Indiana bats
Energy Technology Data Exchange (ETDEWEB)
Jones, Jason; Jansen, Erik; Friedel, Robert
2011-07-01
Full text: Post-construction monitoring indicates that commercial wind energy facilities are a source of bat mortality resulting from collisions or other negative interactions with operational turbines. An understanding of the potential distribution and movement of bats on the landscape is essential to minimizing these impacts. Using remote sensing and Geographic Information Systems software, we present a modelling approach that evaluates the distribution of bat roosting and foraging habitat and potential flight paths at a landscape scale which may be used to assess the risk to bats from the development of a wind energy facility. Accurate assessment of these risks can minimize schedule delays and unexpected costs. Applied to the behaviour and ecology of the United States federally endangered Indiana bat (Myotis sodalis) at two hypothetical wind farms, this method predicts the areas where the species is likely to travel while foraging, thereby highlighting the riskiest areas within a project area. The results of our modelling indicate that risk to bats is not directly proportional to habitat availability or suitability, in part because risk is associated with areas where bats are travelling. This modelling approach will assist wind energy developers in making both large-scale (e.g., choosing between different development locations) and small-scale decisions (e.g., choosing where to locate turbines) aimed at minimizing impacts to bats. Using habitat models can provide a cost-effective method for evaluating bat risk, satisfying requirements of regulatory agencies, and limiting the more intensive survey methods to projects that absolutely require them. (Author)
30 CFR 75.803 - Fail safe ground check circuits on high-voltage resistance grounded systems.
2010-07-01
... High-Voltage Distribution § 75.803 Fail safe ground check circuits on high-voltage resistance grounded systems. [Statutory Provisions] On and after September 30, 1970, high-voltage, resistance grounded systems... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Fail safe ground check circuits on high-voltage...
Ground rubber: Sorption media for ground water containing benzene and O-xylene
International Nuclear Information System (INIS)
Kershaw, D.S.; Pamukcu, S.
1997-01-01
The purpose of the current study is to examine the ability of ground rubber to sorb benzene and O-xylene from water contained with aromatic hydrocarbons. The study consisted of running both batch and packed bed column tests to determine the sorption capacity, the required sorption equilibration time, and the flow through utilization efficiency of ground rubber under various contact times when exposed to water contaminated with various amounts of benzene or O-xylene. Initial batch test results indicate that ground rubber can attain equilibrium sorption capacities up to 1.3 or 8.2 mg of benzene or O-xylene, respectively, per gram of tire rubber at solution equilibrium concentrations of 10 mg/L. Packed bed column tests indicate that ground tire rubber has on the average a 40% utilization rate when a hydraulic residence time of 15 min is used. Possible future uses of round rubber as a sorption media could include, but are not limited to, the use of ground rubber as an aggregate in slurry cutoff walls that are in contact with petroleum products. Ground rubber could also be used as a sorption media in pump-and-treat methodologies or as a sorption media in in-situ reactive permeable barriers
Lifescience Database Archive (English)
Full Text Available 1JB9 トウモロコシ Corn Zea mays L. Ferredoxin-Nadp Reductase Precursor Zea Mays Molecule:...SLLYDEEFTSYLKQYPDNFRYDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVAERRGESWDQKLAQLKKNKQWHVEVY corn_1JB9.jpg ...
Martin, Royce Ann
The purpose of this study was to determine the extent that student scores on a researcher-constructed quantitative and document literacy test, the Aviation Documents Delineator (ADD), were associated with (a) learning styles (imaginative, analytic, common sense, dynamic, and undetermined), as identified by the Learning Type Measure, (b) program curriculum (aerospace administration, professional pilot, both aerospace administration and professional pilot, other, or undeclared), (c) overall cumulative grade point average at Indiana State University, and (d) year in school (freshman, sophomore, junior, or senior). The Aviation Documents Delineator (ADD) was a three-part, 35 question survey that required students to interpret graphs, tables, and maps. Tasks assessed in the ADD included (a) locating, interpreting, and describing specific data displayed in the document, (b) determining data for a specified point on the table through interpolation, (c) comparing data for a string of variables representing one aspect of aircraft performance to another string of variables representing a different aspect of aircraft performance, (d) interpreting the documents to make decisions regarding emergency situations, and (e) performing single and/or sequential mathematical operations on a specified set of data. The Learning Type Measure (LTM) was a 15 item self-report survey developed by Bernice McCarthy (1995) to profile an individual's processing and perception tendencies in order to reveal different individual approaches to learning. The sample used in this study included 143 students enrolled in Aerospace Technology Department courses at Indiana State University in the fall of 1996. The ADD and the LTM were administered to each subject. Data collected in this investigation were analyzed using a stepwise multiple regression analysis technique. Results of the study revealed that the variables, year in school and GPA, were significant predictors of the criterion variables, document
International Nuclear Information System (INIS)
Whitaker, J.O. Jr.; Schlueter, R.A.; Proffitt, M.A.
1973-12-01
This report is based upon data gathered from June, 1971 through October, 1972, as part of continuing studies initiated to determine the effects of heated water on aquatic resources of the White River at Petersburg, Indiana. The heated effluent is discharged into the river by an electric generating station. Emphasis was placed on the distribution and abundance of smaller fish and invertebrates. A primary concern was to determine if the heated water affected the food habits, external parasites, or reproduction of the fishes. Sampling was continued through the winter to determine effects of heated discharge during the colder parts of the year. Results showed that differences can be found between heated and unheated water. However, the differences are rather minor and it is not always clear that they relate to temperature. Some may relate to other habitat factors. Other than in the effluent canal itself, where populations of organisms are much depressed, no evidence of major harmful effects caused by heated water were found
Directory of Open Access Journals (Sweden)
Vivian B. Martin, Ph.D.
2005-03-01
Full Text Available Bookshelf will provide critical reviews and perspectives on books on theory and methodology of interest to grounded theory. This issue includes a review of Heaton’s Reworking Qualitative Data, of special interest for some of its references to grounded theory as a secondary analysis tool; and Goulding’s Grounded Theory: A practical guide for management, business, and market researchers, a book that attempts to explicate the method and presents a grounded theory study that falls a little short of the mark of a fully elaborated theory.Reworking Qualitative Data, Janet Heaton (Sage, 2004. Paperback, 176 pages, $29.95. Hardcover also available.
Grounded theory in music therapy research.
O'Callaghan, Clare
2012-01-01
Grounded theory is one of the most common methodologies used in constructivist (qualitative) music therapy research. Researchers use the term "grounded theory" when denoting varying research designs and theoretical outcomes. This may be challenging for novice researchers when considering whether grounded theory is appropriate for their research phenomena. This paper examines grounded theory within music therapy research. Grounded theory is briefly described, including some of its "contested" ideas. A literature search was conducted using the descriptor "music therapy and grounded theory" in Pubmed, CINAHL PsychlNFO, SCOPUS, ERIC (CSA), Web of Science databases, and a music therapy monograph series. A descriptive analysis was performed on the uncovered studies to examine researched phenomena, grounded theory methods used, and how findings were presented, Thirty music therapy research projects were found in refereed journals and monographs from 1993 to "in press." The Strauss and Corbin approach to grounded theory dominates the field. Descriptors to signify grounded theory components in the studies greatly varied. Researchers have used partial or complete grounded theory methods to examine clients', family members', staff, music therapy "overhearers," music therapists', and students' experiences, as well as music therapy creative products and professional views, issues, and literature. Seven grounded theories were offered. It is suggested that grounded theory researchers clarify what and who inspired their design, why partial grounded theory methods were used (when relevant), and their ontology. By elucidating assumptions underpinning the data collection, analysis, and findings' contribution, researchers will continue to improve music therapy research using grounded theory methods.
Communication, concepts and grounding.
van der Velde, Frank
2015-02-01
This article discusses the relation between communication and conceptual grounding. In the brain, neurons, circuits and brain areas are involved in the representation of a concept, grounding it in perception and action. In terms of grounding we can distinguish between communication within the brain and communication between humans or between humans and machines. In the first form of communication, a concept is activated by sensory input. Due to grounding, the information provided by this communication is not just determined by the sensory input but also by the outgoing connection structure of the conceptual representation, which is based on previous experiences and actions. The second form of communication, that between humans or between humans and machines, is influenced by the first form. In particular, a more successful interpersonal communication might require forms of situated cognition and interaction in which the entire representations of grounded concepts are involved. Copyright © 2014 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Bentley, H.; Grisak, G.
1985-01-01
The Containment and Isolation Working Group considered issues related to the postclosure behavior of repositories in crystalline rock. This working group was further divided into subgroups to consider the progress since the 1978 GAIN Symposium and identify research needs in the individual areas of regional ground-water flow, ground-water travel time, fractional release, and cumulative release. The analysis and findings of the Ground-Water Travel Time Subgroup are presented
International Nuclear Information System (INIS)
Long, J.
1985-01-01
The Containment and Isolation Working Group considered issues related to the postclosure behavior of repositories in crystalline rock. This working group was further divided into subgroups to consider the progress since the 1978 GAIN Symposium and identify research needs in the individual areas of regional ground-water flow, ground-water travel time, fractional release, and cumulative release. The analysis and findings of the Ground-Water Regime Subgroup are presented
Pendley, R. D.; Scheidker, E. J.; Levitt, D. S.; Myers, C. R.; Werking, R. D.
1994-11-01
This analysis defines a complete set of ground support functions based on those practiced in real space flight operations during the on-orbit phase of a mission. These functions are mapped against ground support functions currently in use by NASA and DOD. Software components to provide these functions can be hosted on RISC-based work stations and integrated to provide a modular, integrated ground support system. Such modular systems can be configured to provide as much ground support functionality as desired. This approach to ground systems has been widely proposed and prototyped both by government institutions and commercial vendors. The combined set of ground support functions we describe can be used as a standard to evaluate candidate ground systems. This approach has also been used to develop a prototype of a modular, loosely-integrated ground support system, which is discussed briefly. A crucial benefit to a potential user is that all the components are flight-qualified, thus giving high confidence in their accuracy and reliability.
Congress of the U.S., Washington, DC. House Committee on Education and the Workforce.
This is a congressional hearing on how vocational and technical education and job training work together to better prepare workers for the 21st century workforce and on successful educational and job training activities and initiatives in Indiana (IN). Testimony includes statements from United States representatives (Howard P. "Buck"…
SLG(Single-Line-to-Ground Fault Location in NUGS(Neutral Un-effectively Grounded System
Directory of Open Access Journals (Sweden)
Zhang Wenhai
2018-01-01
Full Text Available This paper reviews the SLG(Single-Line-to-Ground fault location methods in NUGS(Neutral Un-effectively Grounded System, including ungrounded system, resonant grounded system and high-resistance grounded system which are widely used in Northern Europe and China. This type of fault is hard to detect and location because fault current is the sum of capacitance current of the system which is always small(about tens of amperes. The characteristics of SLG fault in NUGS and the fault location methods are introduced in the paper.
Korbmacher, J.
2015-01-01
We show that any predicational theory of partial ground that extends a standard theory of syntax and that proves some commonly accepted principles for partial ground is inconsistent. We suggest a way to obtain a consistent predicational theory of ground.
A Mixed Prediction Model of Ground Subsidence for Civil Infrastructures on Soft Ground
Directory of Open Access Journals (Sweden)
Kiyoshi Kobayashi
2012-01-01
Full Text Available The estimation of ground subsidence processes is an important subject for the asset management of civil infrastructures on soft ground, such as airport facilities. In the planning and design stage, there exist many uncertainties in geotechnical conditions, and it is impossible to estimate the ground subsidence process by deterministic methods. In this paper, the sets of sample paths designating ground subsidence processes are generated by use of a one-dimensional consolidation model incorporating inhomogeneous ground subsidence. Given the sample paths, the mixed subsidence model is presented to describe the probabilistic structure behind the sample paths. The mixed model can be updated by the Bayesian methods based upon the newly obtained monitoring data. Concretely speaking, in order to estimate the updating models, Markov Chain Monte Calro method, which is the frontier technique in Bayesian statistics, is applied. Through a case study, this paper discussed the applicability of the proposed method and illustrated its possible application and future works.
Ground penetrating radar system and method for detecting an object on or below a ground surface
De Jongth, R.; Yarovoy, A.; Schukin, A.
2001-01-01
Ground penetrating radar system for detecting objects (17) on or below a ground surface (18), comprising at least one transmit antenna (13) having a first foot print (14) at the ground surface, at least one receive antenna (15) having a second foot print (16) at the ground surface, and processing
Electrical Ground System Design of PEFP
International Nuclear Information System (INIS)
Mun, Kyeong Jun; Jeon, Gye Po; Park, Sung Sik; Min, Yi Sub; Nam, Jung Min; Cho, Jang Hyung; Kim, Jun Yeon
2010-01-01
Since host site host site was selected Gyeong-ju city in January, 2006. we need design revision of Proton Accelerator research center to reflect on host site characteristics and several conditions. In this paper, electrical grounding and lightning protection design scheme is introduced. In electrical grounding system design of PEFP, we classified electrical facilities into 4 groups; equipment grounding (type A), instrument grounding (Type A), high frequency instrument grounding (Type C) and lightning arrestor grounding (Type D). Lightning protection system is designed in all buildings of proton accelerator research center of PEFP, including switchyard
Electrical Ground System Design of PEFP
Energy Technology Data Exchange (ETDEWEB)
Mun, Kyeong Jun; Jeon, Gye Po; Park, Sung Sik; Min, Yi Sub; Nam, Jung Min; Cho, Jang Hyung; Kim, Jun Yeon [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2010-10-15
Since host site host site was selected Gyeong-ju city in January, 2006. we need design revision of Proton Accelerator research center to reflect on host site characteristics and several conditions. In this paper, electrical grounding and lightning protection design scheme is introduced. In electrical grounding system design of PEFP, we classified electrical facilities into 4 groups; equipment grounding (type A), instrument grounding (Type A), high frequency instrument grounding (Type C) and lightning arrestor grounding (Type D). Lightning protection system is designed in all buildings of proton accelerator research center of PEFP, including switchyard
Energy Technology Data Exchange (ETDEWEB)
Ts' ai, T H
1977-11-01
Chinese folk wisdom has long seen a relationship between ground water and earthquakes. Before an earthquake there is often an unusual change in the ground water level and volume of flow. Changes in the amount of particulate matter in ground water as well as changes in color, bubbling, gas emission, and noises and geysers are also often observed before earthquakes. Analysis of these features can help predict earthquakes. Other factors unrelated to earthquakes can cause some of these changes, too. As a first step it is necessary to find sites which are sensitive to changes in ground stress to be used as sensor points for predicting earthquakes. The necessary features are described. Recording of seismic waves of earthquake aftershocks is also an important part of earthquake predictions.
Kashchuk, A
2006-01-01
My goal is to study how a big MWPC system, in particular the LHCb muon system, can be protected against unstable operation and multiple spurious hits, produced by incorrect or imperfect grounding in the severe EM environment of the LHCb experiment. A mechanism of penetration of parasitic current from the ground loop to the input of the front-end amplifier is discussed. A new model of the detector cell as the electrical bridge is considered. As shown, unbalance of the bridge makes detector to be sensitive to the noise in ground loop. Resonances in ground loop are specified. Tests of multiple-point and single-point grounding conceptions made on mock-up are presented.
Exogenous spatial attention influences figure-ground assignment.
Vecera, Shaun P; Flevaris, Anastasia V; Filapek, Joseph C
2004-01-01
In a hierarchical stage account of vision, figure-ground assignment is thought to be completed before the operation of focal spatial attention. Results of previous studies have supported this account by showing that unpredictive, exogenous spatial precues do not influence figure-ground assignment, although voluntary attention can influence figure-ground assignment. However, in these studies, attention was not summoned directly to a region in a figure-ground display. In three experiments, we addressed the relationship between figure-ground assignment and visuospatial attention. In Experiment 1, we replicated the finding that exogenous precues do not influence figure-ground assignment when they direct attention outside of a figure-ground stimulus. In Experiment 2, we demonstrated that exogenous attention can influence figure-ground assignment if it is directed to one of the regions in a figure-ground stimulus. In Experiment 3, we demonstrated that exogenous attention can influence figure-ground assignment in displays that contain a Gestalt figure-ground cue; this result suggests that figure-ground processes are not entirely completed prior to the operation of focal spatial attention. Exogenous spatial attention acts as a cue for figure-ground assignment and can affect the outcome of figure-ground processes.
Lifescience Database Archive (English)
Full Text Available tic Subunit Name=Irx3; Synonyms=T10b6_80; Arabidopsis Thaliana Molecule: Cellulose Synthase, Catalytic Subunit (Irx3); Chai...GDKEHLMSEMNFEKTFGQSSIFVTSTLMEEGGVPPSSSPAVLLKEAIHVISCGYEDKTEWGTELGWIYGSITEDILTGFKMHCRGWRSIYCMPKRPAFKGSAPINLSD...RLNQVLRWALGSVEIFFSRHSPLWYGYKGGKLKWLERFAYANTTIYPFTSIPLLAYCILPAICLLTDKFIMPPISTFASLFFISLFMSIIVTGILELRWSGVSIEEWW...RNEQFWVIGGISAHLFAVVQGLLKILAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTVLIINIVGVVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTSKCGINC arabi_1WEO.jpg ...
Transverse Myelitis Association
... INSPIRATION What is Anti-Myelin Oligodendrocyte Glycoprotein (MOG)? https://myelitis.org/wp-content/uploads/2015/05/blog_research.jpg 999 1500 The TMA https://myelitis.org/wp-content/uploads/2015/06/TMA- ...
Directory of Open Access Journals (Sweden)
Maria Obiminda L. Cambaliza
2017-07-01
Full Text Available Large spatial and temporal uncertainties for landfill CH4 emissions remain unresolved by short-term field campaigns and historic greenhouse gas (GHG inventory models. Using four field methods (aircraft-based mass balance, tracer correlation, vertical radial plume mapping, static chambers and a new field-validated process-based model (California Landfill Methane Inventory Model, CALMIM 5.4, we investigated the total CH4 emissions from a central Indiana landfill as well as the partitioned emissions inclusive of methanotrophic oxidation for the various cover soils at the site. We observed close agreement between whole site emissions derived from the tracer correlation (8 to 13 mol s–1 and the aircraft mass balance approaches (7 and 17 mol s–1 that were statistically indistinguishable from the modeling result (12 ± 2 mol s–1 inclusive of oxidation. Our model calculations indicated that approximately 90% of the annual average CH4 emissions (11 ± 1 mol s–1; 2200 ± 250 g m–2 d–1 derived from the small daily operational area. Characterized by a thin overnight soil cover directly overlying a thick sequence of older methanogenic waste without biogas recovery, this area constitutes only 2% of the 0.7 km2 total waste footprint area. Because this Indiana landfill is an upwind source for Indianapolis, USA, the resolution of m2 to km2 scale emissions at various temporal scales contributes to improved regional inventories relevant for addressing GHG mitigation strategies. Finally, our comparison of measured to reported CH4 emissions under the US EPA National GHG Reporting program suggests the need to revisit the current IPCC (2006 GHG inventory methodology based on CH4 generation modeling. The reasonable prediction of emissions at individual U.S. landfills requires incorporation of both cover-specific landfill climate modeling (e.g., soil temperature/moisture variability over a typical annual cycle driving CH4 transport and oxidation rates as
Ground-motion prediction from tremor
Baltay, Annemarie S.; Beroza, Gregory C.
2013-01-01
The widespread occurrence of tremor, coupled with its frequency content and location, provides an exceptional opportunity to test and improve strong ground-motion attenuation relations for subduction zones. We characterize the amplitude of thousands of individual 5 min tremor events in Cascadia during three episodic tremor and slip events to constrain the distance decay of peak ground acceleration (PGA) and peak ground velocity (PGV). We determine the anelastic attenuation parameter for ground-motion prediction equations (GMPEs) to a distance of 150 km, which is sufficient to place important constraints on ground-motion decay. Tremor PGA and PGV show a distance decay that is similar to subduction-zone-specific GMPEs developed from both data and simulations; however, the massive amount of data present in the tremor observations should allow us to refine distance-amplitude attenuation relationships for use in hazard maps, and to search for regional variations and intrasubduction zone differences in ground-motion attenuation.
Ground Control System Description Document
International Nuclear Information System (INIS)
Eric Loros
2001-01-01
The Ground Control System contributes to the safe construction and operation of the subsurface facility, including accesses and waste emplacement drifts, by maintaining the configuration and stability of the openings during construction, development, emplacement, and caretaker modes for the duration of preclosure repository life. The Ground Control System consists of ground support structures installed within the subsurface excavated openings, any reinforcement made to the rock surrounding the opening, and inverts if designed as an integral part of the system. The Ground Control System maintains stability for the range of geologic conditions expected at the repository and for all expected loading conditions, including in situ rock, construction, operation, thermal, and seismic loads. The system maintains the size and geometry of operating envelopes for all openings, including alcoves, accesses, and emplacement drifts. The system provides for the installation and operation of sensors and equipment for any required inspection and monitoring. In addition, the Ground Control System provides protection against rockfall for all subsurface personnel, equipment, and the engineered barrier system, including the waste package during the preclosure period. The Ground Control System uses materials that are sufficiently maintainable and that retain the necessary engineering properties for the anticipated conditions of the preclosure service life. These materials are also compatible with postclosure waste isolation performance requirements of the repository. The Ground Control System interfaces with the Subsurface Facility System for operating envelopes, drift orientation, and excavated opening dimensions, Emplacement Drift System for material compatibility, Monitored Geologic Repository Operations Monitoring and Control System for ground control instrument readings, Waste Emplacement/Retrieval System to support waste emplacement operations, and the Subsurface Excavation System
Transonic and supersonic ground effect aerodynamics
Doig, G.
2014-08-01
A review of recent and historical work in the field of transonic and supersonic ground effect aerodynamics has been conducted, focussing on applied research on wings and aircraft, present and future ground transportation, projectiles, rocket sleds and other related bodies which travel in close ground proximity in the compressible regime. Methods for ground testing are described and evaluated, noting that wind tunnel testing is best performed with a symmetry model in the absence of a moving ground; sled or rail testing is ultimately preferable, though considerably more expensive. Findings are reported on shock-related ground influence on aerodynamic forces and moments in and accelerating through the transonic regime - where force reversals and the early onset of local supersonic flow is prevalent - as well as more predictable behaviours in fully supersonic to hypersonic ground effect flows.
Ground reaction forces during level ground walking with body weight unloading
Barela, Ana M. F.; de Freitas, Paulo B.; Celestino, Melissa L.; Camargo, Marcela R.; Barela, José A.
2014-01-01
Background: Partial body weight support (BWS) systems have been broadly used with treadmills as a strategy for gait training of individuals with gait impairments. Considering that we usually walk on level ground and that BWS is achieved by altering the load on the plantar surface of the foot, it would be important to investigate some ground reaction force (GRF) parameters in healthy individuals walking on level ground with BWS to better implement rehabilitation protocols for individuals with gait impairments. Objective: To describe the effects of body weight unloading on GRF parameters as healthy young adults walked with BWS on level ground. Method: Eighteen healthy young adults (27±4 years old) walked on a walkway, with two force plates embedded in the middle of it, wearing a harness connected to a BWS system, with 0%, 15%, and 30% BWS. Vertical and horizontal peaks and vertical valley of GRF, weight acceptance and push-off rates, and impulse were calculated and compared across the three experimental conditions. Results: Overall, participants walked more slowly with the BWS system on level ground compared to their normal walking speed. As body weight unloading increased, the magnitude of the GRF forces decreased. Conversely, weight acceptance rate was similar among conditions. Conclusions: Different amounts of body weight unloading promote different outputs of GRF parameters, even with the same mean walk speed. The only parameter that was similar among the three experimental conditions was the weight acceptance rate. PMID:25590450
Ground reaction forces during level ground walking with body weight unloading
Directory of Open Access Journals (Sweden)
Ana M. F. Barela
2014-12-01
Full Text Available Background: Partial body weight support (BWS systems have been broadly used with treadmills as a strategy for gait training of individuals with gait impairments. Considering that we usually walk on level ground and that BWS is achieved by altering the load on the plantar surface of the foot, it would be important to investigate some ground reaction force (GRF parameters in healthy individuals walking on level ground with BWS to better implement rehabilitation protocols for individuals with gait impairments. Objective: To describe the effects of body weight unloading on GRF parameters as healthy young adults walked with BWS on level ground. Method: Eighteen healthy young adults (27±4 years old walked on a walkway, with two force plates embedded in the middle of it, wearing a harness connected to a BWS system, with 0%, 15%, and 30% BWS. Vertical and horizontal peaks and vertical valley of GRF, weight acceptance and push-off rates, and impulse were calculated and compared across the three experimental conditions. Results: Overall, participants walked more slowly with the BWS system on level ground compared to their normal walking speed. As body weight unloading increased, the magnitude of the GRF forces decreased. Conversely, weight acceptance rate was similar among conditions. Conclusions: Different amounts of body weight unloading promote different outputs of GRF parameters, even with the same mean walk speed. The only parameter that was similar among the three experimental conditions was the weight acceptance rate.
14 CFR 417.109 - Ground safety.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Ground safety. 417.109 Section 417.109... TRANSPORTATION LICENSING LAUNCH SAFETY Launch Safety Responsibilities § 417.109 Ground safety. (a) Ground safety... 417.115(c), and subpart E of this part provide launch operator ground safety requirements. ...
Iwaki, A.; Fujiwara, H.
2012-12-01
Broadband ground motion computations of scenario earthquakes are often based on hybrid methods that are the combinations of deterministic approach in lower frequency band and stochastic approach in higher frequency band. Typical computation methods for low-frequency and high-frequency (LF and HF, respectively) ground motions are the numerical simulations, such as finite-difference and finite-element methods based on three-dimensional velocity structure model, and the stochastic Green's function method, respectively. In such hybrid methods, LF and HF wave fields are generated through two different methods that are completely independent of each other, and are combined at the matching frequency. However, LF and HF wave fields are essentially not independent as long as they are from the same event. In this study, we focus on the relation among acceleration envelopes at different frequency bands, and attempt to synthesize HF ground motion using the information extracted from LF ground motion, aiming to propose a new method for broad-band strong motion prediction. Our study area is Kanto area, Japan. We use the K-NET and KiK-net surface acceleration data and compute RMS envelope at four frequency bands: 0.5-1.0 Hz, 1.0-2.0 Hz, 2.0-4.0 Hz, .0-8.0 Hz, and 8.0-16.0 Hz. Taking the ratio of the envelopes of adjacent bands, we find that the envelope ratios have stable shapes at each site. The empirical envelope-ratio characteristics are combined with low-frequency envelope of the target earthquake to synthesize HF ground motion. We have applied the method to M5-class earthquakes and a M7 target earthquake that occurred in the vicinity of Kanto area, and successfully reproduced the observed HF ground motion of the target earthquake. The method can be applied to a broad band ground motion simulation for a scenario earthquake by combining numerically-computed low-frequency (~1 Hz) ground motion with the empirical envelope ratio characteristics to generate broadband ground motion
Electrical Subsurface Grounding Analysis
International Nuclear Information System (INIS)
J.M. Calle
2000-01-01
The purpose and objective of this analysis is to determine the present grounding requirements of the Exploratory Studies Facility (ESF) subsurface electrical system and to verify that the actual grounding system and devices satisfy the requirements
Custer, T.W.; Sparks, D.W.; Sobiech, S.A.; Hines, R.K.; Melancon, M.J.
1996-01-01
Farm-raised l2-month-old female mallards (Anas platyrhynchos) were released at the Winston-Thomas sewage treatment plant, Bloomington, Indiana. Five mallards were sacrificed at the start of the study and at approximately 10-day intervals through day 100. Concentrations of polychlorinated biphenyls (PCBs) in carcasses increased linearly with time of exposure and exceeded 16 mcg/g wet weight by day 100; PCBs in breast muscle exceeded 3.9 mcg/g by day 100. These PCB values are among the highest recorded for wild or sentinel waterfowl. PCB concentrations in breast muscle (26-523 mcg/g lipid weight) were 50-1,000 times greater than human consumption guidelines for edible poultry in Canada (0.5 mcg/g lipid weight) and 9-176 times greater than consumption guidelines for edible poultry in the United States (3.0 mcg/g lipid weight). Additionally, PCB concentrations in carcass and breast muscle exceeded the threshold of the Great Lakes Sport Fish Consumption Advisory 'do not eat' category (1.9 mcg/g wet weight) by day 20 and day 50, respectively. Hepatic cytochrome P450-associated monooxygenases including BROD (benzyloxyresorufin-O-dealkylase), EROD (ethoxyresorufin-O-dealkylase), and PROD (pentoxyresorufin-O-dealkylase) were induced over 5-fold compared to reference mallards. BROD, EROD, and PROD were each significantly correlated to total PCBs and to the toxicity of selected PCB congeners, relative to 2,3,7,8-tetrachlorodibenzo-p-dioxin.
Wier, C. E.; Wobber, F. J.; Amato, R. V.; Russell, O. R. (Principal Investigator)
1974-01-01
The author has identified the following significant results. All Skylab 2 imagery received to date has been analyzed manually and data related to fracture analysis and mined land inventories has been summarized on map-overlays. A comparison of the relative utility of the Skylab image products for fracture detection, soil tone/vegetation contrast mapping, and mined land mapping has been completed. Numerous fracture traces were detected on both color and black and white transparencies. Unique fracture trace data which will contribute to the investigator's mining hazards analysis were noted on the EREP imagery; these data could not be detected on ERTS-1 imagery or high altitude aircraft color infrared photography. Stream segments controlled by fractures or joint systems could be identified in more detail than with ERTS-1 imagery of comparable scale. ERTS-1 mine hazards products will be modified to demonstrate the value of this additional data. Skylab images were used successfully to update a mined land map of Indiana made in 1972. Changes in mined area as small as two acres can be identified. As the Energy Crisis increases the demand for coal, such demonstrations of the application of Skylab data to coal resources will take on new importance.
The World of Virtual Exhibitions
Directory of Open Access Journals (Sweden)
Irena Eiselt
2013-09-01
Full Text Available EXTENDED ABSTRACTSpecial collections of the National and University Library (NUK hide a lot of items of precious value. The Slovenian cultural heritage is stored on paper or on other media as a part of the library’s Manuscripts, Incunabula and Rare Books Collection, Old Prints Collection, Maps and Pictorial Collection, Music Collection, Ephemera Collection, Serials Collection, and Slovenian Diaspora Publications Collection. Only a small part of the treasures is temporary revealed to the public on special exhibitions. The idea of virtual exhibitions of library treasures was born in 2005. The library aimed to exhibit precious items of special collections of high historical or artistic value. In 2008 the first two virtual exhibitions were created in-house offering access to the rich collections of old postcards of Ljubljana at the beginning of 20th century kept in the Maps and Pictorial Collection of NUK. They were soon followed by other virtual exhibitions. At the beginning they were organised in the same way as physical exhibitions, afterwards different programs were used for creation of special effects (for ex. 3D wall. About two years ago it was decided that the creation of virtual exhibitions will be simplified. Files of digitised and borndigital library materials in jpg format are imported to MS PowerPoint 2010. Each jpg file is now formatted by adding a frame, a description … to the slides which are saved as jpg files. The last step is the import of jpg files into Cooliris application used for NUK web exhibitions. In the paper the virtual exhibition design and creation, the technical point of view and criteria for the selection of exhibition content are explained following the example of the virtual exhibitions the Old Postcards of Ljubljana, Photo Ateliers in Slovenia, a collection of photographs Four Seasons by Fran Krašovec and photos of Post-Earthquake Ljubljana in 1895.
Leighton, David A.; Phillips, Steven P.
2003-01-01
Antelope Valley, California, is a topographically closed basin in the western part of the Mojave Desert, about 50 miles northeast of Los Angeles. The Antelope Valley ground-water basin is about 940 square miles and is separated from the northern part of Antelope Valley by faults and low-lying hills. Prior to 1972, ground water provided more than 90 percent of the total water supply in the valley; since 1972, it has provided between 50 and 90 percent. Most ground-water pumping in the valley occurs in the Antelope Valley ground-water basin, which includes the rapidly growing cities of Lancaster and Palmdale. Ground-water-level declines of more than 200 feet in some parts of the ground-water basin have resulted in an increase in pumping lifts, reduced well efficiency, and land subsidence of more than 6 feet in some areas. Future urban growth and limits on the supply of imported water may continue to increase reliance on ground water. To better understand the ground-water flow system and to develop a tool to aid in effectively managing the water resources, a numerical model of ground-water flow and land subsidence in the Antelope Valley ground-water basin was developed using old and new geohydrologic information. The ground-water flow system consists of three aquifers: the upper, middle, and lower aquifers. The aquifers, which were identified on the basis of the hydrologic properties, age, and depth of the unconsolidated deposits, consist of gravel, sand, silt, and clay alluvial deposits and clay and silty clay lacustrine deposits. Prior to ground-water development in the valley, recharge was primarily the infiltration of runoff from the surrounding mountains. Ground water flowed from the recharge areas to discharge areas around the playas where it discharged either from the aquifer system as evapotranspiration or from springs. Partial barriers to horizontal ground-water flow, such as faults, have been identified in the ground-water basin. Water-level declines owing to
30 CFR 77.803 - Fail safe ground check circuits on high-voltage resistance grounded systems.
2010-07-01
... circuits on high-voltage resistance grounded systems. On and after September 30, 1971, all high-voltage... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Fail safe ground check circuits on high-voltage resistance grounded systems. 77.803 Section 77.803 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION...
Directory of Open Access Journals (Sweden)
Mincheol Park
2018-05-01
Full Text Available The soft ground in coastal areas should be treated when it needs to be used for the sustainably developed of urban or industrial complex constructions. The ground heating method for soft ground improvement was applied in Eastern Europe in the 1960s, but it was not widely used due to economic and environmental problems. The author developed a device for improving soft ground using an electric heating pipe. This paper investigates the improvement effect and field application of deep soft ground by the ground heating method using the electric heating pipe. Ground heating increases the temperature of the deep soft ground and increases the tip resistance of the static electronic piezo-cone penetration test. Additionally, the pressure of the pore water decreases because the pore water is evaporated due to the ground heating. As a result of the experiment, it was verified that there was an improvement in the effect of deep soft ground by the ground heating method. With ground heating for 96 h, the tip resistance was increased by 61% at a point 0.35 m horizontally away from the electric heat pipe, 22% at 0.97 m, and 2% at 1.31 m. As a result of the field test, it was found that there were no problems in the power supply of the diesel generator and the control panel. It was easy to install the electric heating pipes in the deep soft ground. However, due to boring, the ground was disturbed and water vapor was discharged through this gap. To minimize the discharge of water vapor, it is necessary to drive the electric heating pipe.
Gunn, Jody M.
2006-01-01
The state-of-the-practice for engineering and development of Ground Systems has evolved significantly over the past half decade. Missions that challenge ground system developers with significantly reduced budgets in spite of requirements for greater and previously unimagined functionality are now the norm. Making the right trades early in the mission lifecycle is one of the key factors to minimizing ground system costs. The Mission Operations Strategic Leadership Team at the Jet Propulsion Laboratory has spent the last year collecting and working through successes and failures in ground systems for application to future missions.
Ground-water sample collection and analysis plan for the ground-water surveillance project
International Nuclear Information System (INIS)
Bryce, R.W.; Evans, J.C.; Olsen, K.B.
1991-12-01
The Pacific Northwest Laboratory performs ground-water sampling activities at the US Department of Energy's (DOE's) Hanford Site in support of DOE's environmental surveillance responsibilities. The purpose of this document is to translate DOE's General Environmental Protection Program (DOE Order 5400.1) into a comprehensive ground-water sample collection and analysis plan for the Hanford Site. This sample collection and analysis plan sets forth the environmental surveillance objectives applicable to ground water, identifies the strategy for selecting sample collection locations, and lists the analyses to be performed to meet those objectives
Lorah, Michelle M.; Clark, Jeffrey S.
1996-01-01
Chemical manufacturing, munitions filling, and other military-support activities have resulted in the contamination of ground water, surface water, and soil in the Canal Creek area of Aberdeen Proving Ground, Maryland. Chlorinated volatile organic compounds, including 1,1,2,2-tetrachloroethane and trichloroethylene, are widespread ground-water contaminants in two aquifers that are composed of unconsolidated sand and gravel. Distribution and fate of chlorinated organic compounds in the ground water has been affected by the movement and dissolution of solvents in their dense immiscible phase and by microbial degradation under anaerobic conditions. Detection of volatile organic contaminants in adjacent surface water indicates that shallow contaminated ground water discharges to surface water. Semivolatile organic compounds, especially polycyclic aromatic hydrocarbons, are the most prevalent organic contaminants in soils. Various trace elements, such as arsenic, cadmium, lead, and zinc, were found in elevated concentrations in ground water, surface water, and soil. Simulations with a ground-water-flow model and particle tracker postprocessor show that, without remedial pumpage, the contaminants will eventually migrate to Canal Creek and Gunpowder River. Simulations indicate that remedial pumpage of 2.0 million gallons per day from existing wells is needed to capture all particles originating in the contaminant plumes. Simulated pumpage from offsite wells screened in a lower confined aquifer does not affect the flow of contaminated ground water in the Canal Creek area.
Full Text Available ... Sexual Dysfunction? Attachment: consultation.jpg What Is the Relationship Between Depression and Parkinson's Disease? OHSU - Therapeutic Approaches for PD: Depression, Anxiety & Psychosis Parkinson’s Disease Psychosis: A Caregiver’s Story CareMAP: ...
Directory of Open Access Journals (Sweden)
Md. Hasan Ali
2017-10-01
Full Text Available This paper highlights the thermal performance of reclined (parallel to ground surface and standing (perpendicular to ground surface slinky horizontal ground heat exchangers (HGHEs with different water mass flow rates in the heating mode of continuous and intermittent operations. A copper tube with an outer surface protected with low-density polyethylene was selected as the tube material of the ground heat exchanger. Effects on ground temperature around the reclined slinky HGHE due to heat extraction and the effect of variation of ground temperatures on reclined HGHE performance are discussed. A higher heat exchange rate was experienced in standing HGHE than in reclined HGHE. The standing HGHE was affected by deeper ground temperature and also a greater amount of backfilled sand in standing HGHE (4.20 m3 than reclined HGHE (1.58 m3, which has higher thermal conductivity than site soil. For mass flow rate of 1 L/min with inlet water temperature 7 °C, the 4-day average heat extraction rates increased 45.3% and 127.3%, respectively, when the initial average ground temperatures at 1.5 m depth around reclined HGHE increased from 10.4 °C to 11.7 °C and 10.4 °C to 13.7 °C. In the case of intermittent operation, which boosted the thermal performance, a short time interval of intermittent operation is better than a long time interval of intermittent operation. Furthermore, from the viewpoint of power consumption by the circulating pump, the intermittent operation is more efficient than continuous operation.
Varietas Indiana: le cas de la Miscelánea Antártica de Miguel Cabello Valboa
Directory of Open Access Journals (Sweden)
2001-01-01
Full Text Available La notion de varietas est reprise par la culture de lHumanisme et érigée en principe générateur de formes de pensée et décriture. Compte tenu de ceci, il y a lieu de se demander quel fut son rôle dans lappréhension intellectuelle du Nouveau Monde et dans les divers discours sur celui-ci, aussi bien ceux qui furent élaborés depuis lEurope que ceux qui le furent depuis les Indes Occidentales. Il s'agit ici de réfléchir sur un cas particulier, celui de la fonction de la varietas dans la Miscelánea Antártica de Miguel Cabello Valboa, pour essayer de démontrer comment lauteur se sert doublement de ce principe pour insérer le lecteur, aussi bien local que peninsulaire, au sein de la matière américaine et, en même temps, assimiler celle-ci au fonds commun du savoir, rattachant lhistoire indigène à lHistoire universelle. VARIETAS INDIANA: EL CASO DE LA MISCELÁNEA ANTÁRTICA DE MIGUEL CABELLO VALBOA La noción de varietas se erige como principio generador de formas de pensamiento y de escritura y, en un sentido general, como eje de la cultura del Humanismo. Teniendo en cuenta lo anterior, cabe preguntarse sobre la función que ésta cumplió en la aprensión intelectual de los territorios ultamarinos dentro del imaginario europeo y en la formación de un imaginario local. En el presente artículo hemos examinado esta cuestión en un caso particular, el de la Miscelánea Antártica de Miguel Cabello Valboa, intentando mostrar cómo el autor se sirve doblemente del principio de la varietas para insertar al lector, tanto local como peninsular, en el ámbito de la materia americana y de la historia indígena, pero sobre todo para asimilarlas al fondo común del saber y engarzarlas, en un plano de igualdad, dentro de la historia universal. VARIETAS INDIANA: THE CASE OF MISCELÁNEA ANTÁRTICA DE MIGUEL CABELLO VALBOA The age of Humanism revived the notion of varietas and established it as a generating force of thought and
30 CFR 57.3360 - Ground support use.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Ground support use. 57.3360 Section 57.3360... and Support-Underground Only § 57.3360 Ground support use. Ground support shall be used where ground conditions, or mining experience in similar ground conditions in the mine, indicate that it is necessary...
DEFF Research Database (Denmark)
Simonsen, Bo Cerup; Pedersen, Preben Terndrup
1997-01-01
The paper deals with analysis of grounding of high-speed crafts. It is the purpose to present a comprehensive mathematical model for calculation of the overall dynamic ship response during grounding. This procedure is applied to derive the motions, the time varying sectional forces and the local...... loads during grounding on plane, sloping, sandy bottoms for six different designs of fast monohull ships made from steel, aluminium or GRP sandwich materials. The results show that the effect of the hull flexibility is to reduce the overall dynamic sectional loads on the hull girder. The considered...... numerical examples also indicate that, even with impact speeds of 40 knots against a 1:10 sloping bottom, the global strength of the hull girder is not exceeded by the grounding induced loads.For the local deformation of high-speed ship hulls at the point of contact with the ground, the paper presents...
National Oceanic and Atmospheric Administration, Department of Commerce — This dataset consists of video transect images (JPG files) from CRAMP surveys taken in 2004 at 6 sites, some of which had multiple depths. Digital images are...
46 CFR 111.05-13 - Grounding connection.
2010-10-01
... Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING ELECTRIC SYSTEMS-GENERAL REQUIREMENTS Equipment Ground, Ground Detection, and Grounded Systems § 111.05-13 Grounding... power sources operating in parallel in the system. ...
Dolan, Rebecca W; Aronson, Myla F J; Hipp, Andrew L
2017-08-09
Globally, urban plant populations are becoming increasingly important, as these plants play a vital role in ameliorating effects of ecosystem disturbance and climate change. Urban environments act as filters to bioregional flora, presenting survival challenges to spontaneous plants. Yet, because of the paucity of inventory data on plants in landscapes both before and after urbanization, few studies have directly investigated this effect of urbanization. We used historical, contemporary, and regional plant species inventories for Indianapolis, Indiana USA to evaluate how urbanization filters the bioregional flora based on species diversity, functional traits, and phylogenetic community structure. Approximately 60% of the current regional flora was represented in the Indianapolis flora, both historically and presently. Native species that survived over time were significantly different in growth form, life form, and dispersal and pollination modes than those that were extirpated. Phylogenetically, the historical flora represented a random sample of the regional flora, while the current urban flora represented a nonrandom sample. Both graminoid habit and abiotic pollination are significantly more phylogenetically conserved than expected. Our results likely reflect the shift from agricultural cover to built environment, coupled with the influence of human preference, in shaping the current urban flora of Indianapolis. Based on our analyses, the urban environment of Indianapolis does filter the bioregional species pool. To the extent that these filters are shared by other cities and operate similarly, we may see increasingly homogenized urban floras across regions, with concurrent loss of evolutionary information. © 2017 Dolan et al. Published by the Botanical Society of America. This work is licensed under a Creative Commons Attribution License (CC-BY-NC).
Energy resources of the west tailings pond, Airline-Sponsler Mine, Greene County, Indiana
Energy Technology Data Exchange (ETDEWEB)
Eggert, D.L.; Miller, L.V.; Irwin, P.N.
1980-12-01
The west tailings pond at the Airline-Sponsler Mine is a manmade prograding fan-delta system in which wastes from preparing coal are deposited in expected sequences. The tailings pond, originally a surface-mine final-cut and haulage road, is about 10,000 feet long, 200 to 300 feet wide, and 25 to 60 feet deep. The Indiana Geological Survey drilled eight auger holes at the pond. The first hole was 50 feet from the entry point, the second hole was 200 feet from the first, and the remaining six holes were 700 feet apart. At each hole samples were taken on 5-foot intervals, and a composite sample of each hole was also prepared. Coarse coal, dense rock fragments, and sulfide minerals settle first and are followed by medium to fine coal and clay and very fine coal. At the entry point ash is high (65.4 percent), sulfur is high (12 percent), calorific value is low (3220 Btu), and particle size is large. At the distal end ash is low near the surface but increases near the base (15.5 to 59.3 percent), sulfur is high near the surface but decreases near the base (2.6 to 1.0 percent), calorific value is high near the surface but decreases near the base (12,000 to 5250 Btu), and particle size is large near the surface but decreases near the base. Washability determinations indicate that some tailings located distally to the entry point might be reclaimed as a fuel with little further preparation and those located proximally could be upgraded by further preparation.
Bydlon, S. A.; Dunham, E. M.
2016-12-01
Recent increases in seismic activity in historically quiescent areas such as Oklahoma, Texas, and Arkansas, including large, potentially induced events such as the 2011 Mw 5.6 Prague, OK, earthquake, have spurred the need for investigation into expected ground motions associated with these seismic sources. The neoteric nature of this seismicity increase corresponds to a scarcity of ground motion recordings within 50 km of earthquakes Mw 3.0 and greater, with increasing scarcity at larger magnitudes. Gathering additional near-source ground motion data will help better constraints on regional ground motion prediction equations (GMPEs) and will happen over time, but this leaves open the possibility of damaging earthquakes occurring before potential ground shaking and seismic hazard in these areas are properly understood. To aid the effort of constraining near-source GMPEs associated with induced seismicity, we integrate synthetic ground motion data from simulated earthquakes into the process. Using the dynamic rupture and seismic wave propagation code waveqlab3d, we perform verification and validation exercises intended to establish confidence in simulated ground motions for use in constraining GMPEs. We verify the accuracy of our ground motion simulator by performing the PEER/SCEC layer-over-halfspace comparison problem LOH.1 Validation exercises to ensure that we are synthesizing realistic ground motion data include comparisons to recorded ground motions for specific earthquakes in target areas of Oklahoma between Mw 3.0 and 4.0. Using a 3D velocity structure that includes a 1D structure with additional small-scale heterogeneity, the properties of which are based on well-log data from Oklahoma, we perform ground motion simulations of small (Mw 3.0 - 4.0) earthquakes using point moment tensor sources. We use the resulting synthetic ground motion data to develop GMPEs for small earthquakes in Oklahoma. Preliminary results indicate that ground motions can be amplified
Modernization of the Cassini Ground System
Razo, Gus; Fujii, Tammy
2014-01-01
The Cassini Spacecraft and its ground system have been operational for over 16 years. Modernization presents several challenges due to the personnel, processes, and tools already invested and embedded into the current ground system structure. Every mission's ground system has its own unique complexities and challenges, involving various organizational units. As any mission from its inception to its execution, schedules are always tight. This forces GDS engineers to implement a working ground system that is not necessarily fully optimized. Ground system challenges increase as technology evolves and cyber threats become more sophisticated. Cassini's main challenges were due to its ground system existing before many security requirements were levied on the multi-mission tools and networks. This caused a domino effect on Cassini GDS tools that relied on outdated technological features. In the aerospace industry reliable and established technology is preferred over innovative yet less proven technology. Loss of data for a spacecraft mission can be catastrophic; therefore, there is a reluctance to make changes and updates to the ground system. Nevertheless, all missions and associated teams face the need to modernize their processes and tools. Systems development methods from well-known system analysis and design principles can be applied to many missions' ground systems. Modernization should always be considered, but should be done in such a way that it does not affect flexibility nor interfere with established practices. Cassini has accomplished a secure and efficient ground data system through periodic updates. The obstacles faced while performing the modernization of the Cassini ground system will be outlined, as well as the advantages and challenges that were encountered.
Energy Technology Data Exchange (ETDEWEB)
Loux, P C [Environmental Research Corporation, Alexandria, VA (United States)
1969-07-01
Nuclear generated ground motion is defined and then related to the physical parameters that cause it. Techniques employed for prediction of ground motion peak amplitude, frequency spectra and response spectra are explored, with initial emphasis on the analysis of data collected at the Nevada Test Site (NTS). NTS postshot measurements are compared with pre-shot predictions. Applicability of these techniques to new areas, for example, Plowshare sites, must be questioned. Fortunately, the Atomic Energy Commission is sponsoring complementary studies to improve prediction capabilities primarily in new locations outside the NTS region. Some of these are discussed in the light of anomalous seismic behavior, and comparisons are given showing theoretical versus experimental results. In conclusion, current ground motion prediction techniques are applied to events off the NTS. Predictions are compared with measurements for the event Faultless and for the Plowshare events, Gasbuggy, Cabriolet, and Buggy I. (author)
International Nuclear Information System (INIS)
Loux, P.C.
1969-01-01
Nuclear generated ground motion is defined and then related to the physical parameters that cause it. Techniques employed for prediction of ground motion peak amplitude, frequency spectra and response spectra are explored, with initial emphasis on the analysis of data collected at the Nevada Test Site (NTS). NTS postshot measurements are compared with pre-shot predictions. Applicability of these techniques to new areas, for example, Plowshare sites, must be questioned. Fortunately, the Atomic Energy Commission is sponsoring complementary studies to improve prediction capabilities primarily in new locations outside the NTS region. Some of these are discussed in the light of anomalous seismic behavior, and comparisons are given showing theoretical versus experimental results. In conclusion, current ground motion prediction techniques are applied to events off the NTS. Predictions are compared with measurements for the event Faultless and for the Plowshare events, Gasbuggy, Cabriolet, and Buggy I. (author)
The Development of Constructivist Grounded Theory
Jane Mills; Ann Bonner; Karen Francis
2006-01-01
Constructivist grounded theory is a popular method for research studies primarily in the disciplines of psychology, education, and nursing. In this article, the authors aim to locate the roots of constructivist grounded theory and then trace its development. They examine key grounded theory texts to discern their ontological and epistemological orientation. They find Strauss and Corbin's texts on grounded theory to possess a discernable thread of constructivism in their approach to inquiry. T...
National Oceanic and Atmospheric Administration, Department of Commerce — This dataset consists of digital still transect images (JPG files) from CRAMP surveys taken on Maui in 2006 at 8 sites, some of which had multiple depths. Surveys...
Full Text Available ... About Sexual Dysfunction? Attachment: consultation.jpg Help is just a click away. The PD Library is an ... parkinson.org Press Room Ask a Doctor Sign In Privacy & Terms Contact Us Connect With Us: Press ...
Full Text Available ... I Talk to My Physician or Spouse About Sexual Dysfunction? Attachment: consultation.jpg Betsaida Cruz, PT, Long ... 2 How Do PD and Its Treatment Affect Sexual Functioning? Help is just a click away. The ...
Full Text Available ... Participacion” How Do PD and Its Treatment Affect Sexual Functioning? What to Expect Emotionally What Medications Help ... I Talk to My Physician or Spouse About Sexual Dysfunction? Attachment: consultation.jpg Help is just a ...
Directory of Open Access Journals (Sweden)
Odis E. Simmons, PhD
2017-06-01
Full Text Available One of the things that drew me to grounded theory from the beginning was Glaser and Strauss’ assertion in The Discovery of Grounded Theory that it was useful as a “theoretical foothold” for practical applications (p. 268. From this, when I was a Ph.D student studying under Glaser and Strauss in the early 1970s, I devised a GT based approach to action I later came to call “grounded action.” In this short paper I’ll present a very brief sketch of an anger management program I developed in 1992, using grounded action. I began my research by attending a two-day anger management training workshop designed for training professionals in the most commonly used anger management model. Like other intervention programs I had seen, this model took a psychologizing and pathologizing approach to the issue. Following this, I sat through the full course of an anger management program that used this model, observing the reactions of the participants and the approach of the facilitator. Following each session I conducted open-ended interviews with most of the participants, either individually or in groups of two or three. I had also done previous research in counseling and social work contexts that turned out to be very relevant to an anger management program design.
Ground-Water Availability in the United States
Reilly, Thomas E.; Dennehy, Kevin F.; Alley, William M.; Cunningham, William L.
2008-01-01
Ground water is among the Nation's most important natural resources. It provides half our drinking water and is essential to the vitality of agriculture and industry, as well as to the health of rivers, wetlands, and estuaries throughout the country. Large-scale development of ground-water resources with accompanying declines in ground-water levels and other effects of pumping has led to concerns about the future availability of ground water to meet domestic, agricultural, industrial, and environmental needs. The challenges in determining ground-water availability are many. This report examines what is known about the Nation's ground-water availability and outlines a program of study by the U.S. Geological Survey Ground-Water Resources Program to improve our understanding of ground-water availability in major aquifers across the Nation. The approach is designed to provide useful regional information for State and local agencies who manage ground-water resources, while providing the building blocks for a national assessment. The report is written for a wide audience interested or involved in the management, protection, and sustainable use of the Nation's water resources.
Ground effect aerodynamics of racing cars
Zhang, Xin; Toet, Willem; Zerihan, Jonathan
2006-01-01
We review the progress made during the last thirty years on ground effect aerodynamics associated with race cars, in particular open wheel race cars. Ground effect aerodynamics of race cars is concerned with generating downforce, principally via low pressure on the surfaces nearest to the ground. The “ground effected” parts of an open wheeled car's aerodynamics are the most aerodynamically efficient and contribute less drag than that associated with, for example, an upper rear wing. Whilst dr...
Friedrich, Manuel; Stefanelli, Ulisse
2018-06-01
Graphene is locally two-dimensional but not flat. Nanoscale ripples appear in suspended samples and rolling up often occurs when boundaries are not fixed. We address this variety of graphene geometries by classifying all ground-state deformations of the hexagonal lattice with respect to configurational energies including two- and three-body terms. As a consequence, we prove that all ground-state deformations are either periodic in one direction, as in the case of ripples, or rolled up, as in the case of nanotubes.
DEFF Research Database (Denmark)
Bjerg, Poul Løgstrup
1996-01-01
Review af: Jack E. Barbash & Elizabeth A. Resek (1996). Pesticides in Ground Water. Distribution trends and governing factors. Ann Arbor Press, Inc. Chelsea, Michigan. pp 588.......Review af: Jack E. Barbash & Elizabeth A. Resek (1996). Pesticides in Ground Water. Distribution trends and governing factors. Ann Arbor Press, Inc. Chelsea, Michigan. pp 588....
Leicht-Young, S. A.; Pavlovic, N.B.; Grundel, R.; Frohnapple, K.J.
2009-01-01
In habitats where disturbance is frequent, seed banks are important for the regeneration of vegetation. Sand dune systems are dynamic habitats in which sand movement provides intermittent disturbance. As succession proceeds from bare sand to forest, the disturbance decreases. At Indiana Dunes National Lakeshore, we examined the seed banks of three habitat types across a successional gradient: foredunes, secondary dunes, and oak savanna. There were differences among the types of species that germinated from each of the habitats. The mean seed bank density increased across the successional gradient by habitat, from 376 to 433 to 968 seeds m-2, but with foredune and secondary dune seed bank densities being significantly lower than the savanna seed bank density. The number of seeds germinated was significantly correlated with soil organic carbon, demonstrating for this primary successional sequence that seed density increases with stage and age. The seed bank had much lower species richness than that of the aboveground vegetation across all habitats. Among sites within a habitat type, the similarity of species germinated from the seed banks was very low, illustrating the variability of the seed bank even in similar habitat types. These results suggest that restoration of these habitats cannot rely on seed banks alone. ?? 2008 Springer Science+Business Media B.V.
The Building Blocks of Life Move from Ground to Tree to Animal and Back to Ground
Davidson, E. A.
2015-12-01
I generally use combinations of big words to describe my science, such as biogeochemistry, ecosystem ecology, nutrient cycling, stoichiometry, tropical deforestation, land-use change, agricultural intensification, eutrophication, greenhouse gas emissions, and sustainable development. I didn't expect to use any of these words, but I was surprised that I couldn't use some others that seem simple enough to me, such as farm, plant, soil, and forest. I landed on "building blocks" as my metaphor for the forms of carbon, nitrogen, phosphorus, and other elements that I study as they cycle through and among ecosystems. I study what makes trees and other kinds of life grow. We all know that they need the sun and that they take up water from the ground, but what else do trees need from the ground? What do animals that eat leaves and wood get from the trees? Just as we need building blocks to grow our bodies, trees and animals also need building blocks for growing their bodies. Trees get part of their building blocks from the ground and animals get theirs from what they eat. When animals poop and when leaves fall, some of their building blocks return to the ground. When they die, their building blocks also go back to the ground. I also study what happens to the ground, the water, and the air when we cut down trees, kill or shoo away the animals, and make fields to grow our food. Can we grow enough food and still keep the ground, water, and air clean? I think the answer is yes, but it will take better understanding of how all of those building blocks fit together and move around, from ground to tree to animal and back to ground.
7 CFR 65.160 - Ground chicken.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Ground chicken. 65.160 Section 65.160 Agriculture... OF BEEF, PORK, LAMB, CHICKEN, GOAT MEAT, PERISHABLE AGRICULTURAL COMMODITIES, MACADAMIA NUTS, PECANS, PEANUTS, AND GINSENG General Provisions Definitions § 65.160 Ground chicken. Ground chicken means...
2010-07-01
... SAFETY BOATS AND ASSOCIATED EQUIPMENT Electrical Systems Manufacturer Requirements § 183.415 Grounding. If a boat has more than one gasoline engine, grounded cranking motor circuits must be connected to...
Full Text Available ... to Know? Why Is Comprehensive Care or Team Approach Important? 2013 PSA Featuring Katie Couric What Are ... About Sexual Dysfunction? Attachment: consultation.jpg OHSU - Therapeutic Approaches for PD: Depression, Anxiety & Psychosis CareMAP: Travel and ...
Full Text Available ... library Topic Type Living Alone: Home Safety and Management in PD Expert Briefings: Marijuana and PD: What ... consultation.jpg NPF Caregiver Summit 2016: Tools For Family Caregivers: Caremap and Caring & Coping CareMAP: Balancing Life ...
Full Text Available ... Nonmotor Symptoms of Parkinson's Disease Expert Briefings: Gait, Balance and Falls in Parkinson's Disease Expert Briefings: Coping ... About Sexual Dysfunction? Attachment: consultation.jpg CareMAP: Balancing Life and Caregiving What Medications Help with Cognitive Impairment? ...
Pittman, Joyce; Beeson, Terrie; Terry, Colin; Dillon, Jill; Hampton, Charity; Kerley, Denise; Mosier, Judith; Gumiela, Ellen; Tucker, Jessica
2016-01-01
Despite prevention strategies, hospital-acquired pressure ulcers (HAPUs) continue to occur in the acute care setting. The purpose of this study was to develop an operational definition of and an instrument for identifying avoidable/unavoidable HAPUs in the acute care setting. The Indiana University Health Pressure Ulcer Prevention Inventory (PUPI) was developed and psychometric testing was performed. A retrospective pilot study of 31 adult hospitalized patients with an HAPU was conducted using the PUPI. Overall content validity index of 0.99 and individual item content validity index scores (0.9-1.0) demonstrated excellent content validity. Acceptable PUPI criterion validity was demonstrated with no statistically significant differences between wound specialists' and other panel experts' scoring. Construct validity findings were acceptable with no statistically significant differences among avoidable or unavoidable HAPU patients and their Braden Scale total scores. Interrater reliability was acceptable with perfect agreement on the total PUPI score between raters (κ = 1.0; P = .025). Raters were in total agreement 93% (242/260) of the time on all 12 individual PUPI items. No risk factors were found to be significantly associated with unavoidable HAPUs. An operational definition of and an instrument for identifying avoidable/unavoidable HAPUs in the acute care setting were developed and tested. The instrument provides an objective and structured method for identifying avoidable/unavoidable HAPUs. The PUPI provides an additional method that could be used in root-cause analyses and when reporting adverse pressure ulcer events.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Ground lamb. 65.170 Section 65.170 Agriculture... OF BEEF, PORK, LAMB, CHICKEN, GOAT MEAT, PERISHABLE AGRICULTURAL COMMODITIES, MACADAMIA NUTS, PECANS, PEANUTS, AND GINSENG General Provisions Definitions § 65.170 Ground lamb. Ground lamb means comminuted...
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Ground goat. 65.165 Section 65.165 Agriculture... OF BEEF, PORK, LAMB, CHICKEN, GOAT MEAT, PERISHABLE AGRICULTURAL COMMODITIES, MACADAMIA NUTS, PECANS, PEANUTS, AND GINSENG General Provisions Definitions § 65.165 Ground goat. Ground goat means comminuted...
Grounded Theory in Medical Education Research.
Tavakol, Mohsen; Torabi, Sima; Akbar Zeinaloo, Ali
2006-12-01
The grounded theory method provides a systematic way to generate theoretical constructs or concepts that illuminate psychosocial processes common to individual who have a similar experience of the phenomenon under investigation. There has been an increase in the number of published research reports that use the grounded theory method. However, there has been less medical education research, which is based on the grounded theory tradition. The purpose of this paper is to introduce basic tenants of qualitative research paradigm with specific reference to ground theory. The paper aims to encourage readers to think how they might possibly use the grounded theory method in medical education research and to apply such a method to their own areas of interest. The important features of a grounded theory as well as its implications for medical education research are explored. Data collection and analysis are also discussed. It seems to be reasonable to incorporate knowledge of this kind in medical education research.
International Nuclear Information System (INIS)
Sharma, R.K.; Freeman, R.F. III.
1980-04-01
Region III of the US Fish and Wildlife Service contracted with the Division of Environmental Impact Studies, Argonne National Laboratory, to make the 316(b) determination for the Donald C. Cook Nuclear Power Plant of the Indiana and Michigan Power Company and to make recommendations for improvement in intake design to facilitate compliance. To conduct this assessment, appropriate literature on screening systems and reports furnished by the applicant on intake design and operation and on ecological studies at the site were reviewed. Modifications of the location and design of the existing intake and possibilities of retrofitting with fine-mesh screening to screen larval forms of fishes were examined. It was determined that currently there is no dictated need for fine-mesh screening of intake flow at the D.C. Cook Nuclear Power Plant
30 CFR 77.801 - Grounding resistors.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Grounding resistors. 77.801 Section 77.801 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR COAL MINE SAFETY AND HEALTH...-Voltage Distribution § 77.801 Grounding resistors. The grounding resistor, where required, shall be of the...
Ground states of a spin-boson model
International Nuclear Information System (INIS)
Amann, A.
1991-01-01
Phase transition with respect to ground states of a spin-boson Hamiltonian are investigated. The spin-boson model under discussion consists of one spin and infinitely many bosons with a dipole-type coupling. It is shown that the order parameter of the model vanishes with respect to arbitrary ground states if it vanishes with respect to ground states obtained as (biased) temperature to zero limits of thermic equilibrium states. The ground states of the latter special type have been investigated by H. Spohn. Spohn's respective phase diagrams are therefore valid for arbitrary ground states. Furthermore, disjointness of ground states in the broken symmetry regime is examined
Modelling man-made ground to link the above- and below- ground urban domains
Schokker, J.
2017-01-01
This report describes the results of STSM TU1206-36204. During a visit to GEUS (DK) between 23 and 27 January 2017, Jeroen Schokker (TNO-GSN, NL) has focussed on the modelling of man-made ground as a linking pin between the above- and below-ground urban domains. Key results include: • Man-made
Full Text Available ... Spouse About Sexual Dysfunction? Attachment: consultation.jpg OHSU - Therapeutic Approaches for PD: Depression, Anxiety & Psychosis What Is the Relationship Between Depression and Parkinson's Disease? CareMAP: Travel and Transportation: Part 2 Hallucinations and Delusions CareMAP: ...
Directory of Open Access Journals (Sweden)
F. LUCCHESE
2003-01-01
Full Text Available
jpg" alt="fanelli_g._et_al._512" width="512" height="357" />
National Oceanic and Atmospheric Administration, Department of Commerce — This dataset consists of digital still transect images (JPG files) from CRAMP surveys taken in 2007 from 9 sites on Maui, 3 sites on Molokai, and 1 site on Kauai....
Identification of resonant earthquake ground motion
Indian Academy of Sciences (India)
Resonant ground motion has been observed in earthquake records measured at several parts of the world. This class of ground motion is characterized by its energy being contained in a narrow frequency band. This paper develops measures to quantify the frequency content of the ground motion using the entropy ...
Ground Water and Climate Change
Taylor, Richard G.; Scanlon, Bridget; Doell, Petra; Rodell, Matt; van Beek, Rens; Wada, Yoshihide; Longuevergne, Laurent; Leblanc, Marc; Famiglietti, James S.; Edmunds, Mike;
2013-01-01
As the world's largest distributed store of fresh water, ground water plays a central part in sustaining ecosystems and enabling human adaptation to climate variability and change. The strategic importance of ground water for global water and food security will probably intensify under climate change as more frequent and intense climate extremes (droughts and floods) increase variability in precipitation, soil moisture and surface water. Here we critically review recent research assessing the impacts of climate on ground water through natural and human-induced processes as well as through groundwater-driven feedbacks on the climate system. Furthermore, we examine the possible opportunities and challenges of using and sustaining groundwater resources in climate adaptation strategies, and highlight the lack of groundwater observations, which, at present, limits our understanding of the dynamic relationship between ground water and climate.
Ground-water monitoring under RCRA
International Nuclear Information System (INIS)
Coalgate, J.
1993-11-01
In developing a regulatory strategy for the disposal of hazardous waste under the Resource Conservation and Recovery Act (RCRA), protection of ground-water resources was the primary goal of the Environmental Protection Agency (EPA). EPA's ground-water protection strategy seeks to minimize the potential for hazardous wastes and hazardous constituents in waste placed in land disposel units to migrate into the environment. This is achieved through liquids management (limiting the placement of liquid wastes in or on the land, requiring the use of liners beneath waste, installing leachate collection systems and run-on and run-off controls, and covering wastes at closure). Ground-water monitoring serves to detect any failure in EPA's liquids management strategy so that ground-water contamination can be detected and addressed as soon as possible
Using periodicity to mitigate ground vibration
DEFF Research Database (Denmark)
Andersen, Lars Vabbersgaard
2015-01-01
Introduction of trenches, barriers and wave impeding blocks on the transmission path between a source and receiver can be used for mitigation of ground vibration. However, to be effective a barrier must have a depth of about one wavelength of the waves to be mitigated. Hence, while great reductions......: A soil with periodic stiffening (ground improvement) and a ground with periodic changes in the surface elevation obtained by artificial landscaping. By means of a two-dimensional finite-element model, the stiffness and mass matrices are determined for a single cell of the ground with horizonal...
Citrus-orchard ground harbours a diverse, well-established and abundant ground-dwelling spider fauna
Energy Technology Data Exchange (ETDEWEB)
Monzo, C.; Molla, O.; Vanaclocha, P.; Monton, H.; Melic, A.; Castanera, P.; Urbaneja, A.
2011-07-01
Ground-dwelling spider assemblages comprise one of the most representative predatory groups to be found in many crops. There is some evidence of the role that ground-dwelling spiders play in controlling certain citrus pests; however, there are almost no studies about the abundance and composition of this predatory group in citrus orchards. A three-year survey conducted using pitfall traps in three citrus orchards in Eastern Spain yielded more than five-thousand ground-dwelling spiders belonging to more than 50 species and 20 families. Wandering families such as Lycosidae, Gnaphosidae and Zodariidae were the most numerous in terms of captures. The generalist predator Pardosa cribata Simon (Araneae: Lycosidae) was the most common species, representing a quarter of all captures, followed by Zodarion cesari Pekar. (Araneae: Zodariidae) and Trachyzelotes fuscipes (Koch) (Araneae: Gnaphosidae). Spiders were active throughout the year with a peak population in summer. The species abundance data for the three spider assemblages sampled fitted a log normal statistical model which is consistent with a well-established community. The presence of a cover crop provided higher abundance of alternative prey and consequently higher abundance and diversity of ground-dwelling spiders. This work demonstrates that the citrus-orchard ground harbours a diverse and abundant ground-dwelling spider fauna, which is also active throughout the year. A challenge for future studies will be to establish conservation management strategies for these predators, that will improve biological control of those citrus pests that inhabit or spend part of their life cycle on the orchard floor. (Author) 49 refs.
Dumouchelle, D.H.; Schalk, C.W.; Rowe, G.L.; De Roche, J.T.
1993-01-01
Ground water is the primary source of water in the Wright-Patterson Air Force Base area. The aquifer consists of glacial sands and gravels that fill a buried bedrock-valley system. Consolidated rocks in the area consist of poorly permeable Ordovician shale of the Richmondian stage, in the upland areas, the Brassfield Limestone of Silurian age. The valleys are filled with glacial sediments of Wisconsinan age consisting of clay-rich tills and coarse-grained outwash deposits. Estimates of hydraulic conductivity of the shales based on results of displacement/recovery tests range from 0.0016 to 12 feet per day; estimates for the glacial sediments range from less than 1 foot per day to more than 1,000 feet per day. Ground water flow from the uplands towards the valleys and the major rivers in the region, the Great Miami and the Mad Rivers. Hydraulic-head data indicate that ground water flows between the bedrock and unconsolidated deposits. Data from a gain/loss study of the Mad River System and hydrographs from nearby wells reveal that the reach of the river next to Wright-Patterson Air Force Base is a ground-water discharge area. A steady-state, three-dimensional ground-water-flow model was developed to simulate ground-water flow in the region. The model contains three layers and encompasses about 100 square miles centered on Wright-Patterson Air Force Base. Ground water enters the modeled area primarily by river leakage and underflow at the model boundary. Ground water exits the modeled area primarily by flow through the valleys at the model boundaries and through production wells. A model sensitivity analysis involving systematic changes in values of hydrologic parameters in the model indicates that the model is most sensitive to decreases in riverbed conductance and vertical conductance between the upper two layers. The analysis also indicates that the contribution of water to the buried-valley aquifer from the bedrock that forms the valley walls is about 2 to 4
Efektivitas Instagram Common Grounds
Wifalin, Michelle
2016-01-01
Efektivitas Instagram Common Grounds merupakan rumusan masalah yang diambil dalam penelitian ini. Efektivitas Instagram diukur menggunakan Customer Response Index (CRI), dimana responden diukur dalam berbagai tingkatan, mulai dari awareness, comprehend, interest, intentions dan action. Tingkatan respons inilah yang digunakan untuk mengukur efektivitas Instagram Common Grounds. Teori-teori yang digunakan untuk mendukung penelitian ini yaitu teori marketing Public Relations, teori iklan, efekti...
Frederick C. Hall
2000-01-01
Ground-based photo monitoring is repeat photography using ground-based cameras to document change in vegetation or soil. Assume those installing the photo location will not be the ones re-photographing it. This requires a protocol that includes: (1) a map to locate the monitoring area, (2) another map diagramming the photographic layout, (3) type and make of film such...
Management of ground water using isotope techniques
International Nuclear Information System (INIS)
Romani, Saleem
2004-01-01
Ground water play a major role in national economy and sustenance of life and environment. Prevalent water crisis in India includes falling water table, water quality deterioration, water logging and salinity. Keeping in view the increasing thrust on groundwater resources and the present scenario of availability vis-a vis demand there is a need to reorient our approach to ground water management. The various ground water management options require proper understanding of ground water flow system. Isotopes are increasingly being applied in hydrogeological investigations as a supplementary tool for assessment of aquifer flow and transport characteristics. Isotope techniques coupled with conventional hydrogeological and hydrochemical methods can bring in greater accuracy in the conceptualization of hydrogeological control mechanism. The use of isotope techniques in following areas can certainly be of immense help in implementing various ground water management options in an efficient manner. viz.Interaction between the surface water - groundwater systems to plan conjunctive use of surface and ground water. Establishing hydraulic interconnections between the aquifers in a multi aquifer system. Depth of circulation of water and dating of ground water. Demarcating ground water recharge and discharge areas. Plan ground water development in coastal aquifers to avoid sea water ingress. Development of flood plain aquifer. (author)
Navigating the grounded theory terrain. Part 1.
Hunter, Andrew; Murphy, Kathy; Grealish, Annmarie; Casey, Dympna; Keady, John
2011-01-01
The decision to use grounded theory is not an easy one and this article aims to illustrate and explore the methodological complexity and decision-making process. It explores the decision making of one researcher in the first two years of a grounded theory PhD study looking at the psychosocial training needs of nurses and healthcare assistants working with people with dementia in residential care. It aims to map out three different approaches to grounded theory: classic, Straussian and constructivist. In nursing research, grounded theory is often referred to but it is not always well understood. This confusion is due in part to the history of grounded theory methodology, which is one of development and divergent approaches. Common elements across grounded theory approaches are briefly outlined, along with the key differences of the divergent approaches. Methodological literature pertaining to the three chosen grounded theory approaches is considered and presented to illustrate the options and support the choice made. The process of deciding on classical grounded theory as the version best suited to this research is presented. The methodological and personal factors that directed the decision are outlined. The relative strengths of Straussian and constructivist grounded theories are reviewed. All three grounded theory approaches considered offer the researcher a structured, rigorous methodology, but researchers need to understand their choices and make those choices based on a range of methodological and personal factors. In the second article, the final methodological decision will be outlined and its research application described.
Superimposed deformation in seconds: breccias from the impact structure at Kentland, Indiana (USA)
Bjørnerud, M. G.
1998-05-01
Breccias from the central uplift at the Kentland, Indiana impact structure have outcrop and microscopic characteristics that give insight into events that may occur in a carbonate-dominated sedimentary sequence in the moments following hypervelocity impact. Three distinct types of brecciated rock bodies — fault breccias, breccia lenses, and breccia dikes — suggest multiple mechanisms of fragmentation. The fault breccias occur along steeply dipping faults that coincide with compositional discontinuities in the stratigraphic succession. The breccia lenses and dikes are less localized in occurrence and show no systematic spatial distribution or orientation. The fault breccias and breccia lenses show no consistent cross-cutting relationships, but both are transected by the breccia dikes. Textural analysis reveals significant differences in particle size distributions for the different breccias. The fault breccias are typically monomict, coarsest and least uniform in grain size, and yield the highest power-law exponent (fractal dimension) in plots of particle size vs. frequency. The polymict dike filling is finest and most uniform in grain size, has the lowest power-law exponent, and is locally laminated and size-sorted. SEM images of the dike-filling breccia show that fragmentation occurred to the scale of microns. Material within the breccia lenses has textural characteristics intermediate between the other two types, but the irregular morphology of these bodies suggests a mechanism of formation different from that of either of the other breccia categories. The breccia lenses and dikes both have sub-mm-scale spheroidal vugs that may have been formed by carbon dioxide bubbles released during sudden devolatilization of the carbonate country rock. Collectively, these observations shed light on the processes that occur during the excavation and modification phases of crater formation in carbonate strata — heterogeneous, polyphase, multiscale deformation accomplished
DEFF Research Database (Denmark)
Wang, Wen; Yan, Lingjie; Zeng, Xiangjun
2017-01-01
Neutral-to-ground overvoltage may occur in non-effectively grounded power systems because of the distributed parameters asymmetry and resonance between Petersen coil and distributed capacitances. Thus, the constraint of neutral-to-ground voltage is critical for the safety of distribution networks....... In this paper, an active grounding system based on single-phase inverter and its control parameter design method is proposed to achieve this objective. Relationship between its output current and neutral-to-ground voltage is derived to explain the principle of neutral-to-ground voltage compensation. Then...
Directory of Open Access Journals (Sweden)
Graham J.J. Kenealy, Ph.D.
2008-06-01
Full Text Available Grounded theory is a systematic methodology for the collection and analysis of data which was discovered by Glaser and Strauss in the 1960’s. The discovery of this method was first presented to the academic community in their book ‘The Discovery of Grounded Theory’ (1967 which still remains a primary point of reference for those undertaking qualitative research and grounded theory in particular. This powerful research method has become very popular in some research domains; whilst increasing in popularity it is still less prevalent in the field of organisational and management research particularly in its original form. This self reflexive paper sets out to explore the possibilities for this imbalance which takes the discussion onto the areas of methodological adaptation and training. It also enters the debate about access to research subjects and provides a succinct argument supporting the notion that grounded theory should simply be viewed as a method that develops empirically grounded conceptual theory.
Belcher, Wayne R.
2004-01-01
A numerical three-dimensional (3D) transient ground-water flow model of the Death Valley region was developed by the U.S. Geological Survey for the U.S. Department of Energy programs at the Nevada Test Site and at Yucca Mountain, Nevada. Decades of study of aspects of the ground-water flow system and previous less extensive ground-water flow models were incorporated and reevaluated together with new data to provide greater detail for the complex, digital model. A 3D digital hydrogeologic framework model (HFM) was developed from digital elevation models, geologic maps, borehole information, geologic and hydrogeologic cross sections, and other 3D models to represent the geometry of the hydrogeologic units (HGUs). Structural features, such as faults and fractures, that affect ground-water flow also were added. The HFM represents Precambrian and Paleozoic crystalline and sedimentary rocks, Mesozoic sedimentary rocks, Mesozoic to Cenozoic intrusive rocks, Cenozoic volcanic tuffs and lavas, and late Cenozoic sedimentary deposits of the Death Valley Regional Ground-Water Flow System (DVRFS) region in 27 HGUs. Information from a series of investigations was compiled to conceptualize and quantify hydrologic components of the ground-water flow system within the DVRFS model domain and to provide hydraulic-property and head-observation data used in the calibration of the transient-flow model. These studies reevaluated natural ground-water discharge occurring through evapotranspiration and spring flow; the history of ground-water pumping from 1913 through 1998; ground-water recharge simulated as net infiltration; model boundary inflows and outflows based on regional hydraulic gradients and water budgets of surrounding areas; hydraulic conductivity and its relation to depth; and water levels appropriate for regional simulation of prepumped and pumped conditions within the DVRFS model domain. Simulation results appropriate for the regional extent and scale of the model were
Figure-ground segmentation can occur without attention.
Kimchi, Ruth; Peterson, Mary A
2008-07-01
The question of whether or not figure-ground segmentation can occur without attention is unresolved. Early theorists assumed it can, but the evidence is scant and open to alternative interpretations. Recent research indicating that attention can influence figure-ground segmentation raises the question anew. We examined this issue by asking participants to perform a demanding change-detection task on a small matrix presented on a task-irrelevant scene of alternating regions organized into figures and grounds by convexity. Independently of any change in the matrix, the figure-ground organization of the scene changed or remained the same. Changes in scene organization produced congruency effects on target-change judgments, even though, when probed with surprise questions, participants could report neither the figure-ground status of the region on which the matrix appeared nor any change in that status. When attending to the scene, participants reported figure-ground status and changes to it highly accurately. These results clearly demonstrate that figure-ground segmentation can occur without focal attention.
Characteristics of near-field earthquake ground motion
International Nuclear Information System (INIS)
Kim, H. K.; Choi, I. G.; Jeon, Y. S.; Seo, J. M.
2002-01-01
The near-field ground motions exhibit special response characteristics that are different from those of ordinary ground motions in the velocity and displacement response. This study first examines the characteristics of near-field ground motion depending on fault directivity and fault normal and parallel component. And the response spectra of the near field ground motion are statistically processed, and are compared with the Regulatory Guide 1.60 spectrum that is present design spectrum of the nuclear power plant. The response spectrum of the near filed ground motions shows large spectral velocity and displacement in the low frequency range. The spectral accelerations of near field ground motion are greatly amplified in the high frequency range for the rock site motions, and in the low frequency range for the soil site motions. As a result, the near field ground motion effects should be considered in the seismic design and seismic safety evaluation of the nuclear power plant structures and equipment
Building Grounded Theory in Entrepreneurship Research
DEFF Research Database (Denmark)
Mäkelä, Markus; Turcan, Romeo V.
2007-01-01
In this chapter we describe the process of building of theory from data (Glaser and Strauss 1967; Strauss and Corbin 1998). We discuss current grounded theory in relation to research in entrepreneurship and point out directions and potential improvements for further research in this field....... The chapter has two goals. First, we wish to provide an explicit paradigmatic positioning of the grounded theory methodology, discussing the most relevant views of ontology and epistemology that can be used as alternative starting points for conducting grounded theory research. While the chapter introduces...... our approach to grounded theory, we acknowledge the existence of other approaches and try to locate our approach in relation to them. As an important part of this discussion, we take a stand on how to usefully define ‘grounded theory’ and ‘case study research’. Second, we seek to firmly link our...
Pollutant infiltration and ground water management
International Nuclear Information System (INIS)
1993-01-01
Following a short overview of hazard potentials for ground water in Germany, this book, which was compiled by the technical committee of DVWK on ground water use, discusses the natural scientific bases of pollutant movement to and in ground water. It points out whether and to what extent soil/ground water systems can be protected from harmful influences, and indicates relative strategies. Two zones are distinguished: the unsaturated zone, where local defence and remedial measures are frequently possible, and the saturated zone. From the protective function of geological systems, which is always pollutant-specific, criteria are derived for judging the systems generally, or at least regarding entire classes of pollutants. Finally, the impact of the infiltration of pollutants into ground water on its use as drinking water is pointed out and an estimate of the cost of remedial measures is given. (orig.) [de
Ground Motion Prediction Models for Caucasus Region
Jorjiashvili, Nato; Godoladze, Tea; Tvaradze, Nino; Tumanova, Nino
2016-04-01
Ground motion prediction models (GMPMs) relate ground motion intensity measures to variables describing earthquake source, path, and site effects. Estimation of expected ground motion is a fundamental earthquake hazard assessment. The most commonly used parameter for attenuation relation is peak ground acceleration or spectral acceleration because this parameter gives useful information for Seismic Hazard Assessment. Since 2003 development of Georgian Digital Seismic Network has started. In this study new GMP models are obtained based on new data from Georgian seismic network and also from neighboring countries. Estimation of models is obtained by classical, statistical way, regression analysis. In this study site ground conditions are additionally considered because the same earthquake recorded at the same distance may cause different damage according to ground conditions. Empirical ground-motion prediction models (GMPMs) require adjustment to make them appropriate for site-specific scenarios. However, the process of making such adjustments remains a challenge. This work presents a holistic framework for the development of a peak ground acceleration (PGA) or spectral acceleration (SA) GMPE that is easily adjustable to different seismological conditions and does not suffer from the practical problems associated with adjustments in the response spectral domain.
Knutson, Randy L.; Kwilosz, John R.; Grundel, Ralph
1999-01-01
We conducted a three-year mark-release-recapture study of the endangered Karner blue butterfly (Lycaeides melissa samuelis Nabokov) at Indiana Dunes National Lakeshore to describe the butterfly's movement patterns and to assess seasonal changes in the Karner blue's population structure. Estimated mean Karner blue adult life span was less than 3.5 days. Populations exhibited protandry and about a 2:1 male:female sex ratio at population peak within a brood. Ranges, or maximum distances moved by individual butterflies, were typically less than 100 m. Maximum ranges were less than 1 km. These distances are similar to those reported for other lycaenid butterflies and from other studies of the Karner blue in the midwestern United States. At two sites, fewer than 2% of adults had ranges greater than 300 m, while at a third site 4.3% of adults had ranges greater than 300 m. Given typical subpopulation sizes these movement percentages suggest that few adults per generation will move between subpopulations separated by more than 300 m. Movement of individuals between subpopulation sites is important for maintaining genetic diversity within a metapopulation and for recolonizing areas following local extinctions. Therefore, prudent conservation planning should aim for a landscape with habitat patches suitable for Karner blue butterfly occupancy separated by less than 300 m.
Ground water pollution through air pollutants
International Nuclear Information System (INIS)
Cichorowski, G.; Michel, B.; Versteegen, D.; Wettmann, R.
1989-01-01
The aim of the investigation is to determine the significance of air pollutants for ground water quality and ground water use. The report summarizes present knowledge and assesses statements with a view to potential ground water pollution from the air. In this context pollution paths, the spreading behaviour of pollutants, and 'cross points' with burden potentials from other pollutant sources are presented. (orig.) [de
American Association for the Advancement of Science
... Lecture: Richard Harris on Challenges of Replication in Science Elect a Strong Leadership for AAAS: Deadline Ends Soon! Elect a Strong ... 20140730_leadership-seminar_teaser.jpg 13 Nov 2017 Leadership Seminar in Science & Technology Policy... REGISTER event-featured-twothird_Default_200x200. ...
Lifescience Database Archive (English)
Full Text Available 1V3H 大豆 Soybean Glycine max (L.) Merrill Beta-Amylase Name=Bmy1; Glycine Max Molecule: Beta-Amylase; Chai... 495 AA, Molecular weight: 56011 Da ATSDSNMLLNYVPVYVMLPLGVVNVDNVFEDPDGLKEQLLQLRAAGVDGVMVDVWWGIIELKGPKQYDWRAYRSLFQLVQECGLTLQAI...MSFHQCGGNVGDIVNIPIPQWVLDIGESNHDIFYTNRSGTRNKEYLTVGVDNEPIFHGRTAIEIYSDYMKSFRENMSDFLESGLIIDIEVG...FLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKVSGIHWWYKVENHAAELTAGYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDAKSGPQELVQQVLSG...GWREDIRVAGENALPRYDATAYNQIILNAKPQGVNNNGPPKLSMFGVTYLRLSDDLLQKSNFNIFKKFVLKMHADQDYCANPQKYNHAITPLKPSAPKIPIEVLLEATKPTLPFPWLPETDMKVDG soybean_1V3H.jpg ...
Hanford site ground water protection management plan
International Nuclear Information System (INIS)
1994-10-01
Ground water protection at the Hanford Site consists of preventative and remedial measures that are implemented in compliance with a variety of environmental regulations at local, state, and federal levels. These measures seek to ensure that the resource can sustain a broad range of beneficial uses. To effectively coordinate and ensure compliance with applicable regulations, the U.S. Department of Energy has issued DOE Order 5400.1 (DOE 1988a). This order requires all U.S. Department of Energy facilities to prepare separate ground water protection program descriptions and plans. This document describes the Ground Water Protection Management Plan (GPMP) for the Hanford Site located in the state of Washington. DOE Order 5400.1 specifies that the GPMP covers the following general topical areas: (1) documentation of the ground water regime; (2) design and implementation of a ground water monitoring program to support resource management and comply with applicable laws and regulations; (3) a management program for ground water protection and remediation; (4) a summary and identification of areas that may be contaminated with hazardous waste; (5) strategies for controlling hazardous waste sources; (6) a remedial action program; and (7) decontamination, decommissioning, and related remedial action requirements. Many of the above elements are currently covered by existing programs at the Hanford Site; thus, one of the primary purposes of this document is to provide a framework for coordination of existing ground water protection activities. The GPMP provides the ground water protection policy and strategies for ground water protection/management at the Hanford Site, as well as an implementation plan to improve coordination of site ground water activities
Juckem, Paul F.
2009-01-01
A regional, two-dimensional, areal ground-water-flow model was developed to simulate the ground-water-flow system and ground-water/surface-water interaction in the Rock River Basin. The model was developed by the U.S. Geological Survey (USGS), in cooperation with the Rock River Coalition. The objectives of the regional model were to improve understanding of the ground-water-flow system and to develop a tool suitable for evaluating the effects of potential regional water-management programs. The computer code GFLOW was used because of the ease with which the model can simulate ground-water/surface-water interactions, provide a framework for simulating regional ground-water-flow systems, and be refined in a stepwise fashion to incorporate new data and simulate ground-water-flow patterns at multiple scales. The ground-water-flow model described in this report simulates the major hydrogeologic features of the modeled area, including bedrock and surficial aquifers, ground-water/surface-water interactions, and ground-water withdrawals from high-capacity wells. The steady-state model treats the ground-water-flow system as a single layer with hydraulic conductivity and base elevation zones that reflect the distribution of lithologic groups above the Precambrian bedrock and a regionally significant confining unit, the Maquoketa Formation. In the eastern part of the Basin where the shale-rich Maquoketa Formation is present, deep ground-water flow in the sandstone aquifer below the Maquoketa Formation was not simulated directly, but flow into this aquifer was incorporated into the GFLOW model from previous work in southeastern Wisconsin. Recharge was constrained primarily by stream base-flow estimates and was applied uniformly within zones guided by regional infiltration estimates for soils. The model includes average ground-water withdrawals from 1997 to 2006 for municipal wells and from 1997 to 2005 for high-capacity irrigation, industrial, and commercial wells. In addition
Jimenez-Berni, Jose A; Deery, David M; Rozas-Larraondo, Pablo; Condon, Anthony Tony G; Rebetzke, Greg J; James, Richard A; Bovill, William D; Furbank, Robert T; Sirault, Xavier R R
2018-01-01
Crop improvement efforts are targeting increased above-ground biomass and radiation-use efficiency as drivers for greater yield. Early ground cover and canopy height contribute to biomass production, but manual measurements of these traits, and in particular above-ground biomass, are slow and labor-intensive, more so when made at multiple developmental stages. These constraints limit the ability to capture these data in a temporal fashion, hampering insights that could be gained from multi-dimensional data. Here we demonstrate the capacity of Light Detection and Ranging (LiDAR), mounted on a lightweight, mobile, ground-based platform, for rapid multi-temporal and non-destructive estimation of canopy height, ground cover and above-ground biomass. Field validation of LiDAR measurements is presented. For canopy height, strong relationships with LiDAR ( r 2 of 0.99 and root mean square error of 0.017 m) were obtained. Ground cover was estimated from LiDAR using two methodologies: red reflectance image and canopy height. In contrast to NDVI, LiDAR was not affected by saturation at high ground cover, and the comparison of both LiDAR methodologies showed strong association ( r 2 = 0.92 and slope = 1.02) at ground cover above 0.8. For above-ground biomass, a dedicated field experiment was performed with destructive biomass sampled eight times across different developmental stages. Two methodologies are presented for the estimation of biomass from LiDAR: 3D voxel index (3DVI) and 3D profile index (3DPI). The parameters involved in the calculation of 3DVI and 3DPI were optimized for each sample event from tillering to maturity, as well as generalized for any developmental stage. Individual sample point predictions were strong while predictions across all eight sample events, provided the strongest association with biomass ( r 2 = 0.93 and r 2 = 0.92) for 3DPI and 3DVI, respectively. Given these results, we believe that application of this system will provide new
Hanford Site ground-water surveillance for 1989
International Nuclear Information System (INIS)
Evans, J.C.; Bryce, R.W.; Bates, D.J.; Kemner, M.L.
1990-06-01
This annual report of ground-water surveillance activities provides discussions and listings of results for ground-water monitoring at the Hanford Site during 1989. The Pacific Northwest Laboratory (PNL) assesses the impacts of Hanford operations on the environment for the US Department of Energy (DOE). The impact Hanford operations has on ground water is evaluated through the Hanford Site Ground-Water Surveillance program. Five hundred and sixty-seven wells were sampled during 1989 for Hanford ground-water monitoring activities. This report contains a listing of analytical results for calendar year (CY) 1989 for species of importance as potential contaminants. 30 refs., 29 figs,. 4 tabs
International Nuclear Information System (INIS)
Yang Shan; Liu Li; Huang Xiaojing
2014-01-01
In the domestic and abroad standards, the grounding capacitive current limitation in the non-grounding electric auxiliary system is less than 10 A. Limiting capacitive current in the standard aims to speed up the arc extinguishing to reduce the duration of arc over-voltage, but not to prevent the arc producing, The arc over-voltage harm is related to the multiple, frequency and duration of the over-voltage. When the insulation vulnerabilities appear in the equipment, the arc over-voltage may result in insulation vulnerabilities of the electrical equipment breakdown, which leads to multiple, short-circuit accidents. The cable connector, accessory and electromotor winding are all insulation vulnerabilities. Setting the arc suppression coil which can counteract the grounding capacitive current makes the arc vanish quickly. Using the casting bus which remarkably reduces the ground capacitance of the electric transmission line makes the equipment safer. (authors)
Duris, J.W.; Haack, S.K.; Fogarty, L.R.
2009-01-01
The relation of bacterial pathogen occurrence to fecal indicator bacteria (FIB) concentrations used for recreational water quality criteria (RWQC) is poorly understood. This study determined the occurrence of Shiga-toxin producing Escherichia coli (STEC) markers and their relation to FIB concentrations in Michigan and Indiana river water. Using 67 fecal coliform (FC) bacteria cultures from 41 river sites in multiple watersheds, we evaluated the occurrence of five STEC markers: the Escherichia coli (EC) O157 antigen and gene, and the STEC virulence genes eaeA, stx1, and stx2. Simple isolations from selected FC cultures yielded viable EC O157. By both antigen and gene assays, EC O157 was detected in a greater proportion of samples exceeding rather than meeting FC RWQC (P public health decision-making. Copyright ?? 2009 by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America. All rights reserved.
Directory of Open Access Journals (Sweden)
Thomas Simon
2015-01-01
Full Text Available The National Wildlife Refuge system is a vital resource for the protection and conservation of biodiversity and biological integrity in the United States. Surveys were conducted to determine the spatial and temporal patterns of fish, macroinvertebrate, and crayfish populations in two watersheds that encompass three refuges in southern Indiana. The Patoka River National Wildlife Refuge had the highest number of aquatic species with 355 macroinvertebrate taxa, six crayfish species, and 82 fish species, while the Big Oaks National Wildlife Refuge had 163 macroinvertebrate taxa, seven crayfish species, and 37 fish species. The Muscatatuck National Wildlife Refuge had the lowest diversity of macroinvertebrates with 96 taxa and six crayfish species, while possessing the second highest fish species richness with 51 species. Habitat quality was highest in the Muscatatuck River drainage with increased amounts of forested habitats compared to the Patoka River drainage. Biological integrity of the three refuges ranked the Patoka NWR as the lowest biological integrity (mean IBI reach scores = 35 IBI points, while Big Oaks had the highest biological integrity (mean IBI reach score = 41 IBI points. The Muscatatuck NWR had a mean IBI reach score of 31 during June, which seasonally increased to a mean of 40 IBI points during summer. Watershed IBI scores and habitat condition were highest in the Big Oaks NWR.
Morris, Charles C.; Robb, Joseph R.; McCoy, William
2015-01-01
Abstract The National Wildlife Refuge system is a vital resource for the protection and conservation of biodiversity and biological integrity in the United States. Surveys were conducted to determine the spatial and temporal patterns of fish, macroinvertebrate, and crayfish populations in two watersheds that encompass three refuges in southern Indiana. The Patoka River National Wildlife Refuge had the highest number of aquatic species with 355 macroinvertebrate taxa, six crayfish species, and 82 fish species, while the Big Oaks National Wildlife Refuge had 163 macroinvertebrate taxa, seven crayfish species, and 37 fish species. The Muscatatuck National Wildlife Refuge had the lowest diversity of macroinvertebrates with 96 taxa and six crayfish species, while possessing the second highest fish species richness with 51 species. Habitat quality was highest in the Muscatatuck River drainage with increased amounts of forested habitats compared to the Patoka River drainage. Biological integrity of the three refuges ranked the Patoka NWR as the lowest biological integrity (mean IBI reach scores = 35 IBI points), while Big Oaks had the highest biological integrity (mean IBI reach score = 41 IBI points). The Muscatatuck NWR had a mean IBI reach score of 31 during June, which seasonally increased to a mean of 40 IBI points during summer. Watershed IBI scores and habitat condition were highest in the Big Oaks NWR. PMID:25632261
Grounding Damage to Conventional Vessels
DEFF Research Database (Denmark)
Lützen, Marie; Simonsen, Bo Cerup
2003-01-01
The present paper is concerned with rational design of conventional vessels with regard to bottom damage generated in grounding accidents. The aim of the work described here is to improve the design basis, primarily through analysis of new statistical data for grounding damage. The current regula...
Procedures for ground-water investigations
International Nuclear Information System (INIS)
1992-12-01
This manual was developed by the Pacific Northwest Laboratory (PNL) to document the procedures used to carry out and control the technical aspects of ground-water investigations at the PNL. Ground-water monitoring procedures are developed and used in accordance with the PNL Quality Assurance Program