Effects of heavy metals on biomarkers for oxidative stress in Griffon vulture (Gyps fulvus)
International Nuclear Information System (INIS)
Espín, Silvia; Martínez-López, Emma; Jiménez, Pedro; María-Mojica, Pedro; García-Fernández, Antonio J.
2014-01-01
Metals are involved in the formation of reactive oxygen species (ROS) which may result in metal-related oxidative stress that can lead to oxidative damage to lipids, DNA and proteins. It is necessary to understand the mechanisms of metal toxicity in wild birds, and the concentrations that cause effects on oxidative stress biomarkers. The aim of this study is to assess the concentrations of lead (Pb), cadmium (Cd), mercury (Hg), copper (Cu) and zinc (Zn) with regards to oxidative stress in blood samples of 66 Griffon vultures (Gyps fulvus) from two areas of the Autonomous Community of Valencia (East of Spain). The two study areas (Alcoy n=36 and Cinctorres n=30) were selected as random locations of interest that had not yet been studied, and are feeding stations where supplementary food, mainly of pork origin, is provided for vultures. Given that the two study areas are not considered polluted sites, we expected to find low metal concentrations. However, there are no known threshold concentrations at which metals can affect antioxidant systems, and low metal levels may have an effect on antioxidant biomolecules. In this study, since sampling was done at the beginning of the hunting season, the low Pb levels found in most Griffon vultures from Alcoy and Cinctorres (median=12.37 and 16.26 μg/dl, respectively) are suggestive of background levels usually found in vultures that feed on pork carcasses all year round. The ingestion of game meat with bullet fragments in carcasses or with Pb shots embedded in the flesh could be the cause of the high blood Pb concentrations found in three vultures from Cinctorres (83, 290 and 362 μg/dl). Griffon vultures feeding in Cinctorres had enhanced CAT and GST activities and tGSH concentrations, which may be interpreted as protective response against the higher TBARS levels. This study provides threshold concentrations at which metals affect antioxidant system derived from 66 samples of Griffon vulture. Blood Cd concentrations
Effects of heavy metals on biomarkers for oxidative stress in Griffon vulture (Gyps fulvus)
Energy Technology Data Exchange (ETDEWEB)
Espín, Silvia, E-mail: silvia.espin@um.es [Department of Toxicology, Faculty of Veterinary Medicine, University of Murcia, Campus de Espinardo, 30100 Murcia (Spain); Martínez-López, Emma, E-mail: emmaml@um.es [Department of Toxicology, Faculty of Veterinary Medicine, University of Murcia, Campus de Espinardo, 30100 Murcia (Spain); Jiménez, Pedro, E-mail: pjjm@um.es [Department of Toxicology, Faculty of Veterinary Medicine, University of Murcia, Campus de Espinardo, 30100 Murcia (Spain); María-Mojica, Pedro, E-mail: pmmojica@um.es [Department of Toxicology, Faculty of Veterinary Medicine, University of Murcia, Campus de Espinardo, 30100 Murcia (Spain); “Santa Faz” Wildlife Recovery Centre, Comunidad Valenciana, Alicante (Spain); García-Fernández, Antonio J., E-mail: ajgf@um.es [Department of Toxicology, Faculty of Veterinary Medicine, University of Murcia, Campus de Espinardo, 30100 Murcia (Spain)
2014-02-01
Metals are involved in the formation of reactive oxygen species (ROS) which may result in metal-related oxidative stress that can lead to oxidative damage to lipids, DNA and proteins. It is necessary to understand the mechanisms of metal toxicity in wild birds, and the concentrations that cause effects on oxidative stress biomarkers. The aim of this study is to assess the concentrations of lead (Pb), cadmium (Cd), mercury (Hg), copper (Cu) and zinc (Zn) with regards to oxidative stress in blood samples of 66 Griffon vultures (Gyps fulvus) from two areas of the Autonomous Community of Valencia (East of Spain). The two study areas (Alcoy n=36 and Cinctorres n=30) were selected as random locations of interest that had not yet been studied, and are feeding stations where supplementary food, mainly of pork origin, is provided for vultures. Given that the two study areas are not considered polluted sites, we expected to find low metal concentrations. However, there are no known threshold concentrations at which metals can affect antioxidant systems, and low metal levels may have an effect on antioxidant biomolecules. In this study, since sampling was done at the beginning of the hunting season, the low Pb levels found in most Griffon vultures from Alcoy and Cinctorres (median=12.37 and 16.26 μg/dl, respectively) are suggestive of background levels usually found in vultures that feed on pork carcasses all year round. The ingestion of game meat with bullet fragments in carcasses or with Pb shots embedded in the flesh could be the cause of the high blood Pb concentrations found in three vultures from Cinctorres (83, 290 and 362 μg/dl). Griffon vultures feeding in Cinctorres had enhanced CAT and GST activities and tGSH concentrations, which may be interpreted as protective response against the higher TBARS levels. This study provides threshold concentrations at which metals affect antioxidant system derived from 66 samples of Griffon vulture. Blood Cd concentrations
Levels of blood lead in Griffon vultures from a Wildlife Rehabilitation Center in Spain.
González, Fernando; López, Irene; Suarez, Laura; Moraleda, Virginia; Rodríguez, Casilda
2017-09-01
Lead is considered a highly toxic contaminant with important impacts to bird wildlife. Griffon vultures (Gyps fulvus) are a sensitive indicator of the level of environmental contamination due to their position at the top of the food chain and their dependence on human activities. The aim of this study was to assess susceptibility to lead intoxication in Griffon vultures admitted to Wildlife Rehabilitation Centers (WRC), measuring blood lead levels and determining if blood lead concentrations are related to clinical signs, hematological, biochemical or radiographic findings. Also, the influence of age, gender, body condition, season and primary cause of admission were evaluated. This study was realized in all Griffon vultures admitted during a period of one year in the Rehabilitation Center GREFA. Blood lead levels are measured by using anodic stripping voltammetry. In Griffon vultures, we observed that 26% of the analyzed birds presented lead levels above 20µg/dL with 74% below 20µg/dL ([Pb] lead according to sex, season of admission to the center and body condition. A negative correlation was found between levels of metal and hematocrit. No association was found between clinical signs and blood lead levels in Griffon vultures, except for digestive signs as stasis and weight loss. On numerous occasions, the intoxication in this specie is related to ingestion of lead ammunition; however, we have not detected radiographic lead in our vultures. Compared with other studies, we generally found low levels of lead in blood of Griffon vultures but the blood of all birds admitted to WRC presented detectable lead concentrations. This species apparently presents a higher sensibility to the toxic effects of this metal than that described by other authors. It have been observed that there is some evidence that suggests that subclinical levels of lead could be related with a predisposition to injury or diseases, even though these birds might be admitted for other causes. The
Lucas, Manuela de; Ferrer, Miguel; Bechard, Mark J.; Muñoz, Antonio R.
2012-01-01
Wind is increasingly being used as a renewable energy source around the world. Avian mortality is one of the negative impacts of wind energy and a new technique that reduces avian collision rates is necessary. Using the most frequently-killed species, the griffon vulture (Gyps fulvus), we studied its mortality at 13 wind farms in Tarifa, Cadiz, Spain, before (2006-2007) and after (2008-2009) when selective turbine stopping programs were implemented as a mitigation measure. Ten wind farms (tot...
Roles of survival and dispersal in reintroduction success of Griffon vulture (Gyps fulvus).
Le Gouar, Pascaline; Robert, Alexandre; Choisy, Jean-Pierre; Henriquet, Sylvain; Lecuyer, Philippe; Tessier, Christian; Sarrazin, François
2008-06-01
The success of reintroduction programs greatly depends on the amount of mortality and dispersal of the released individuals. Although local environmental pressures are likely to play an important role in these processes, they have rarely been investigated because of the lack of spatial replicates of reintroduction. In the present study, we analyzed a 25-year data set encompassing 272 individuals released in five reintroduction programs of Griffon Vultures (Gyps fulvus) in France to examine the respective roles of survival and dispersal in program successes and failures. We use recent developments in multi-strata capture-recapture models to take into account tag loss in survival estimates and to consider and estimate dispersal among release areas. We also examined the effects of sex, age, time, area, and release status on survival, and we tested whether dispersal patterns among release areas were consistent with habitat selection theories. Results indicated that the survival of released adults was reduced during the first year after release, with no difference between sexes. Taking into account local observations only, we found that early survival rates varied across sites. However when we distinguished dispersal from mortality, early survival rates became equal across release sites. It thus appears that among reintroduction programs difference in failure and success was due to differential dispersal among release sites. We revealed asymmetrical patterns of dispersal due to conspecific attraction: dispersers selected the closest and the largest population. We showed that mortality can be homogeneous from one program to another while, on the contrary, dispersal is highly dependent on the matrix of established populations. Dispersal behavior is thus of major interest for metapopulation restoration and should be taken into account in planning reintroduction designs.
How do colonial Eurasian Griffon Vultures prevent extra-pair mating?
Directory of Open Access Journals (Sweden)
Joan Bertran
2016-02-01
Full Text Available In colonial breeding species, preventive measures to reduce the risks of extra-pair copulations (EPCs should reflect the actual risk perceived by males (e.g., proximity of neighbors, intrusions into the nest mainly during the fertile period. In colonial vultures, specific studies examining the preventive measures that minimize the risks of EPCs occurring within the competitive context of colonial breeding have not been conducted. Here we tested at Eurasian Griffon Vulture (Gyps fulvus nesting sites the intensity of paternity assurance behavior, shown as frequency and duration of within-pair copulations (WPCs, potential mate vigilance or nest attendance, and levels of aggressivity. This was measured according to the frequency of territorial intrusions and comparison of the fertile vs. the non-fertile period. Our findings suggest that the frequency of WPCs and their duration increased significantly during the presumed fertile period, regarded as the period when Griffon pairs spent significantly more time together at their nests. In addition, low levels of territorial intrusions were observed, an aggressive response of pairs towards intruders, and a relatively high presence of pairs at the nests during the fertile period. Thus, although nesting sites are subject to low exposure to EPC attempts, the increased frequency and duration of copulations during the fertile period suggests that, under pressure from the colonial breeding system, a higher rate of copulations is the most effective preventive mechanism against relative uncertainty of paternity.
African Journals Online (AJOL)
Education Environnementale et de. Protection des Oiseaux au Maroc) has produced a poster on the Griffon Vulture. Gyps fulvus, in collaboration with the. HCEFLCD (Haut Commissariat au. Eaux et Forêts et à la Lutte Contre la. Désertification) and ...
African Journals Online (AJOL)
First record of Himalayan Griffon vulture Gyps himalyensis in Chhep, Preah Vihear, northern Cambodia · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Martin Gilbert, Song Chansocheat, Nadia Sureda, 4-5 ...
Using wind tunnels to predict bird mortality in wind farms: the case of griffon vultures.
de Lucas, Manuela; Ferrer, Miguel; Janss, Guyonne F E
2012-01-01
Wind farms have shown a spectacular growth during the last 15 years. Avian mortality through collision with moving rotor blades is well-known as one of the main adverse impacts of wind farms. In Spain, the griffon vulture incurs the highest mortality rates in wind farms. As far as we know, this study is the first attempt to predict flight trajectories of birds in order to foresee potentially dangerous areas for wind farm development. We analyse topography and wind flows in relation to flight paths of griffon vultures, using a scaled model of the wind farm area in an aerodynamic wind tunnel, and test the difference between the observed flight paths of griffon vultures and the predominant wind flows. Different wind currents for each wind direction in the aerodynamic model were observed. Simulations of wind flows in a wind tunnel were compared with observed flight paths of griffon vultures. No statistical differences were detected between the observed flight trajectories of griffon vultures and the wind passages observed in our wind tunnel model. A significant correlation was found between dead vultures predicted proportion of vultures crossing those cells according to the aerodynamic model. Griffon vulture flight routes matched the predominant wind flows in the area (i.e. they followed the routes where less flight effort was needed). We suggest using these kinds of simulations to predict flight paths over complex terrains can inform the location of wind turbines and thereby reduce soaring bird mortality.
Using wind tunnels to predict bird mortality in wind farms: the case of griffon vultures.
Directory of Open Access Journals (Sweden)
Manuela de Lucas
Full Text Available BACKGROUND: Wind farms have shown a spectacular growth during the last 15 years. Avian mortality through collision with moving rotor blades is well-known as one of the main adverse impacts of wind farms. In Spain, the griffon vulture incurs the highest mortality rates in wind farms. METHODOLOGY/PRINCIPAL FINDINGS: As far as we know, this study is the first attempt to predict flight trajectories of birds in order to foresee potentially dangerous areas for wind farm development. We analyse topography and wind flows in relation to flight paths of griffon vultures, using a scaled model of the wind farm area in an aerodynamic wind tunnel, and test the difference between the observed flight paths of griffon vultures and the predominant wind flows. Different wind currents for each wind direction in the aerodynamic model were observed. Simulations of wind flows in a wind tunnel were compared with observed flight paths of griffon vultures. No statistical differences were detected between the observed flight trajectories of griffon vultures and the wind passages observed in our wind tunnel model. A significant correlation was found between dead vultures predicted proportion of vultures crossing those cells according to the aerodynamic model. CONCLUSIONS: Griffon vulture flight routes matched the predominant wind flows in the area (i.e. they followed the routes where less flight effort was needed. We suggest using these kinds of simulations to predict flight paths over complex terrains can inform the location of wind turbines and thereby reduce soaring bird mortality.
Record of Rüppell's Griffon Gyps rueppellii in southern KwaZulu ...
African Journals Online (AJOL)
ZeldaH
Modderfontein, 1645, South. Africa. ² P.O. Box 26776, Plains, 4243, South Africa. Rüppell's Griffon Gyps rueppellii is considered to be a rare vagrant to southern Africa (Hockey et al. 2005) and the first record for this species for the region is from Wabai ...
Directory of Open Access Journals (Sweden)
Ravikanth Manchiryala
2016-04-01
Full Text Available Out of nine species of vultures, the population of three Gyps species, White-backed Vulture (Gyps bengalensis, Slender-billed Vulture (Gyps tenuirostris and Long-billed Vulture (Gyps indicus has declined drastically by 99% over the past decade (Prakash, 1999. The Gyps vultures' population declined in India by 97% and by 92% in Pakistan (Virani, 2006, Prakash et al., 2012. Possibly the widespread usage of Diclofenac drug in the animal led to the rapid population decline for these Vultures (Green et al., 2004. The Long-billed Vulture G. indicus is a bald headed vulture with very broad wings and short tail feathers, having no sexual dimorphism. In Malabar hills region of India the breeding season of Long-billed Vultures was noted to be November to May where it breed mainly on cliffs (Edward, 1915. Presently, it is in the most critical category of endangerment, listed in Schedule-I of the Indian Wildlife Protection Act-1972 followed by IUCN, 2015 (http://www.iucnredlist.org/details/22729731/0. The Andhra Pradesh State Biodiversity Board, Hyderabad announced that vultures are already 'Extinct' in the state (Medicheti, 2013.
White-backed Vulture Gyps africanus parental care and chick growth ...
African Journals Online (AJOL)
Persistent vulture declines across Africa are a cause for concern as the number of species threatened with extinction increases. The White-backed Vulture Gyps africanus was, until recently, considered abundant but has been declining rapidly in recent years due to various threats including decreasing food availability.
Ghorpade, Prabhakar B; Gupta, Praveen K; Prakash, Vibhu; Cuthbert, Richard J; Kulkarni, Mandar; Prakash, Nikita; Das, Asit; Sharma, Anil K; Saini, Mohini
2012-12-01
During the last two decades populations of three resident species of Gyps vulture have declined dramatically and are now threatened with extinction in South Asia. Sex identification of vultures is of key importance for the purpose of conservation breeding as it is desirable to have an equal sex ratio in these monogamous species which are housed together in large colony aviaries. Because vultures are monomorphic, with no differences in external morphology or plumage colour between the sexes, other methods are required for sex identification. Molecular methods for sex identification in birds rely on allelic length or nucleotide sequence discrimination of the chromohelicase-DNA binding (CHD) gene located on male and female chromosomes ZZ and ZW, respectively. We characterized the partial sequences of CHD alleles from Gyps indicus, Gyps bengalensis, Gyps himalayensis and Aegypius monachus and analysed the applicability of five molecular methods of sex identification of 46 individual vultures including 26 known-sex G. bengalensis and G. indicus. The results revealed that W-specific PCR in combination with ZW-common PCR is a quick, accurate and simple method, and is ideal for sex identification of vultures. The method is also suitable to augment ecological studies for identifying sex of these endangered birds during necropsy examinations especially when gonads are not apparent, possibly due to regression during non-breeding seasons.
Directory of Open Access Journals (Sweden)
Vibhu Prakash
Full Text Available Populations of oriental white-backed vulture (Gyps bengalensis, long-billed vulture (Gyps indicus and slender-billed vulture (Gyps tenuirostris crashed during the mid-1990s throughout the Indian subcontinent. Surveys in India, initially conducted in 1991-1993 and repeated in 2000, 2002, 2003 and 2007, revealed that the population of Gyps bengalensis had fallen by 2007 to 0.1% of its numbers in the early 1990s, with the population of Gyps indicus and G. tenuirostris combined having fallen to 3.2% of its earlier level. A survey of G. bengalensis in western Nepal indicated that the size of the population in 2009 was 25% of that in 2002. In this paper, repeat surveys conducted in 2011 were analysed to estimate recent population trends. Populations of all three species of vulture remained at a low level, but the decline had slowed and may even have reversed for G. bengalensis, both in India and Nepal. However, estimates of the most recent population trends are imprecise, so it is possible that declines may be continuing, though at a significantly slower rate. The degree to which the decline of G. bengalensis in India has slowed is consistent with the expected effects on population trend of a measured change in the level of contamination of ungulate carcasses with the drug diclofenac, which is toxic to vultures, following a ban on its veterinary use in 2006. The most recent available information indicates that the elimination of diclofenac from the vultures' food supply is incomplete, so further efforts are required to fully implement the ban.
Diclofenac disposition in Indian cow and goat with reference to Gyps vulture population declines
Energy Technology Data Exchange (ETDEWEB)
Taggart, M.A. [Royal Society for the Protection of Birds, The Lodge, Sandy, Bedfordshire, SG19 2DL (United Kingdom); School of Biological Sciences, Department of Plant and Soil Science, University of Aberdeen, AB24 3UU (United Kingdom); Cuthbert, R. [Royal Society for the Protection of Birds, The Lodge, Sandy, Bedfordshire, SG19 2DL (United Kingdom)]. E-mail: richard.cuthbert@rspb.org.uk; Das, D. [Bombay Natural History Society, Hornbill House, Mumbai, 400023 (India); Sashikumar, C. [Bombay Natural History Society, Hornbill House, Mumbai, 400023 (India); Pain, D.J. [Royal Society for the Protection of Birds, The Lodge, Sandy, Bedfordshire, SG19 2DL (United Kingdom); Green, R.E. [Royal Society for the Protection of Birds, The Lodge, Sandy, Bedfordshire, SG19 2DL (United Kingdom); Conservation Biology Group, Department of Zoology, University of Cambridge, Downing Street, Cambridge, CB2 3EJ (United Kingdom); Feltrer, Y. [Institute of Zoology, Zoological Society of London, Regent' s Park, London, NW1 4RY (United Kingdom); Shultz, S. [Royal Society for the Protection of Birds, The Lodge, Sandy, Bedfordshire, SG19 2DL (United Kingdom); Institute of Zoology, Zoological Society of London, Regent' s Park, London, NW1 4RY (United Kingdom); Cunningham, A.A. [Institute of Zoology, Zoological Society of London, Regent' s Park, London, NW1 4RY (United Kingdom); Meharg, A.A. [School of Biological Sciences, Department of Plant and Soil Science, University of Aberdeen, AB24 3UU (United Kingdom)
2007-05-15
Gyps vultures across India are declining rapidly and the NSAID diclofenac has been shown to be the major cause. Vultures scavenge livestock carcasses that have been treated with diclofenac within the days preceding death. We present data on diclofenac disposition in Indian cow and goat, and field data on the prevalence of diclofenac in carcases in the environment. In the disposition experiment, animals were treated with a single intramuscular injection of diclofenac at 1000 {mu}g kg{sup -1} bw. In cow, diclofenac was detectable in liver, kidney and intestine up to 71 h post-treatment; in plasma, half-life was 12.2 h. In goat, tissue residues were undetectable after 26 h. Prevalence of diclofenac in liver from 36 dead livestock collected in the field was 13.9%. Data suggest that diclofenac residues in Indian cow and goat are short-lived, but diclofenac prevalence in carcasses available to vultures may still be very high. - Residual diclofenac in livestock carcasses in India poses a continuing risk to Gyps vultures.
Diclofenac disposition in Indian cow and goat with reference to Gyps vulture population declines
International Nuclear Information System (INIS)
Taggart, M.A.; Cuthbert, R.; Das, D.; Sashikumar, C.; Pain, D.J.; Green, R.E.; Feltrer, Y.; Shultz, S.; Cunningham, A.A.; Meharg, A.A.
2007-01-01
Gyps vultures across India are declining rapidly and the NSAID diclofenac has been shown to be the major cause. Vultures scavenge livestock carcasses that have been treated with diclofenac within the days preceding death. We present data on diclofenac disposition in Indian cow and goat, and field data on the prevalence of diclofenac in carcases in the environment. In the disposition experiment, animals were treated with a single intramuscular injection of diclofenac at 1000 μg kg -1 bw. In cow, diclofenac was detectable in liver, kidney and intestine up to 71 h post-treatment; in plasma, half-life was 12.2 h. In goat, tissue residues were undetectable after 26 h. Prevalence of diclofenac in liver from 36 dead livestock collected in the field was 13.9%. Data suggest that diclofenac residues in Indian cow and goat are short-lived, but diclofenac prevalence in carcasses available to vultures may still be very high. - Residual diclofenac in livestock carcasses in India poses a continuing risk to Gyps vultures
Ghorpade, Prabhakar B; Gupta, Praveen K; Prakash, Vibhu; Cuthbert, Richard J; Kulkarni, Mandar; Prakash, Nikita; Das, Asit; Sharma, Anil K; Saini, Mohini
2012-01-01
During the last two decades populations of three resident species of Gyps vulture have declined dramatically and are now threatened with extinction in South Asia. Sex identification of vultures is of key importance for the purpose of conservation breeding as it is desirable to have an equal sex ratio in these monogamous species which are housed together in large colony aviaries. Because vultures are monomorphic, with no differences in external morphology or plumage colour between the sexes, o...
Directory of Open Access Journals (Sweden)
Swetha Stotrabhashyam
2015-01-01
Full Text Available The Long-billed Vulture Gyps indicus is, Critically Endangered with few known breeding sites in peninsular India. We present a previously undocumented Long-billed Vulture breeding site in Bejjur Reserve Forest, Adilabad District, northern Telangana.
Energy Technology Data Exchange (ETDEWEB)
Camina, Alvaro
2011-07-01
Full text: Spain is one of the leading countries on wind energy, accounting for 20,155 MW installed by 2010. The study has been made in a large area, 300 km long and 50 km width, extending over eight provinces accounting for 170 wind farms and 4605 turbines. 89 wind farms were sampled between 2001 and 2009 for bird fatalities. Collisions involved 2191 griffon vultures Gyps fulvus, the most affected species with 75% of them being adult birds. Other species colliding were the cinereous vulture Aegypius monachus (2 individuals) and the Egyptian vulture Neophron percnopterus (4 individuals). Around 5-10% of turbines caused up to 60% of fatalities and mortality was temporally clumped and related with the species biology. It was lower in January- February while griffons are incubating, increasing in March when hatching. Then, it was reduced until September with a new increase at November-December. In order to explain causes in detail and reduce mortality a pilot study was carried out in a portion of this area (10 wind farms and 267 turbines) from 2005 to the present. Due to high mortality rates on griffons, 33 turbines were shut down by authorities in June 2008. Relationships between flight altitude at turbines area with both weather conditions and landscape features were analysed by means of statistical parametric GLM models. Results included air temperature; turbine features such as its slope and time of the year as significant variables. On the other side, the European policy against the Bovine Spongiform Encephalopathy (BSE) also contributed to increase both mortality and vulture.s crossings through the turbines. Closure of vulture restaurants and carcass removal in the area caused food lacking for these birds. Then, they were forced to feed from a rubbish dump close to the turbines. Correction measures such as opening vulture restaurants since June 2009 and ceasing droppings at the rubbish dump significantly reduced flying rates of griffons to previous levels. In
Cuthbert, Richard; Taggart, Mark A.; Prakash, Vibhu; Saini, Mohini; Swarup, Devendra; Upreti, Suchitra; Mateo, Rafael; Chakraborty, Soumya Sunder; Deori, Parag; Green, Rhys E.
2011-01-01
Contamination of their carrion food supply with the non-steroidal anti-inflammatory drug diclofenac has caused rapid population declines across the Indian subcontinent of three species of Gyps vultures endemic to South Asia. The governments of India, Pakistan and Nepal took action in 2006 to prevent the veterinary use of diclofenac on domesticated livestock, the route by which contamination occurs. We analyse data from three surveys of the prevalence and concentration of diclofenac residues in carcasses of domesticated ungulates in India, carried out before and after the implementation of a ban on veterinary use. There was little change in the prevalence and concentration of diclofenac between a survey before the ban and one conducted soon after its implementation, with the percentage of carcasses containing diclofenac in these surveys estimated at 10.8 and 10.7%, respectively. However, both the prevalence and concentration of diclofenac had fallen markedly 7–31 months after the implementation of the ban, with the true prevalence in this third survey estimated at 6.5%. Modelling of the impact of this reduction in diclofenac on the expected rate of decline of the oriental white-backed vulture (Gyps bengalensis) in India indicates that the decline rate has decreased to 40% of the rate before the ban, but is still likely to be rapid (about 18% year−1). Hence, further efforts to remove diclofenac from vulture food are still needed if the future recovery or successful reintroduction of vultures is to be feasible. PMID:21589920
Scavenging efficiency and red fox abundance in Mediterranean mountains with and without vultures
Morales-Reyes, Zebensui; Sánchez-Zapata, José A.; Sebastián-González, Esther; Botella, Francisco; Carrete, Martina; Moleón, Marcos
2017-02-01
Vertebrate scavenging assemblages include two major functional groups: obligate scavengers (i.e., vultures), which depend totally on carrion and are undergoing severe declines around the globe, and facultative scavengers, which exploit carrion opportunistically and are generally ubiquitous. Our goal was to investigate the hypothesis that vultures can indirectly regulate the abundance of mesopredators (i.e., facultative scavengers) through modulating their access to carrion resources. We studied scavenging efficiency and red fox (Vulpes vulpes) abundance in two neighbouring areas of South-eastern Spain where vultures (mainly griffon vultures Gyps fulvus) are present (Cazorla) and absent (Espuña). To do so, we monitored ungulate carcasses consumption during winter and summer, and counted red fox scats along walking transects as a proxy of fox density. Our results confirmed that scavenging efficiency was higher in Cazorla and in carcasses visited by vultures. This resulted in increasing scavenging opportunities for facultative scavengers where vultures were absent. Accordingly, mean red fox abundance was higher in Espuña. These results suggest the existence of a vulture-mediated mesopredator release (i.e., an increase of mesopredator numbers following vulture loss), which could trigger important indirect ecological effects. Also, our study demonstrates that facultative scavengers are hardly able to functionally replace vultures, mainly because the former exploit carrion on a slower time scale.
Using Wind Tunnels to Predict Bird Mortality in Wind Farms: The Case of Griffon Vultures
de Lucas, Manuela; Ferrer, Miguel; Janss, Guyonne F. E.
2012-01-01
Background: Wind farms have shown a spectacular growth during the last 15 years. Avian mortality through collision with moving rotor blades is well-known as one of the main adverse impacts of wind farms. In Spain, the griffon vulture incurs the highest mortality rates in wind farms. Methodology/Principal Findings: As far as we know, this study is the first attempt to predict flight trajectories of birds in order to foresee potentially dangerous areas for wind farm development. We analyse topo...
African Journals Online (AJOL)
Chansocheat, Song. Vol 55 (2006) - Articles Olfaction in Accipitrid vultures. Abstract PDF · Vol 55 (2006) - Articles First record of Himalayan Griffon vulture Gyps himalyensis in Chhep, Preah Vihear, northern Cambodia Abstract PDF. ISSN: 1606-7479. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for ...
The Humansdorp Cape Griffon Site
African Journals Online (AJOL)
ZeldaH
Figure 1. The cliff north-west of the town of Humansdorp, Eastern Cape, South Africa, where a small group of Cape Griffons Gyps coprotheres roosted, and reportedly bred, until the end of the. 19 th century. The trees seen in the picture are all alien, invasive, black wattles Acacia mearnsii. (Photo: A Boshoff).
Removing the threat of diclofenac to critically endangered Asian vultures.
Directory of Open Access Journals (Sweden)
Gerry Swan
2006-03-01
Full Text Available Veterinary use of the nonsteroidal anti-inflammatory (NSAID drug diclofenac in South Asia has resulted in the collapse of populations of three vulture species of the genus Gyps to the most severe category of global extinction risk. Vultures are exposed to diclofenac when scavenging on livestock treated with the drug shortly before death. Diclofenac causes kidney damage, increased serum uric acid concentrations, visceral gout, and death. Concern about this issue led the Indian Government to announce its intention to ban the veterinary use of diclofenac by September 2005. Implementation of a ban is still in progress late in 2005, and to facilitate this we sought potential alternative NSAIDs by obtaining information from captive bird collections worldwide. We found that the NSAID meloxicam had been administered to 35 captive Gyps vultures with no apparent ill effects. We then undertook a phased programme of safety testing of meloxicam on the African white-backed vulture Gyps africanus, which we had previously established to be as susceptible to diclofenac poisoning as the endangered Asian Gyps vultures. We estimated the likely maximum level of exposure (MLE of wild vultures and dosed birds by gavage (oral administration with increasing quantities of the drug until the likely MLE was exceeded in a sample of 40 G. africanus. Subsequently, six G. africanus were fed tissues from cattle which had been treated with a higher than standard veterinary course of meloxicam prior to death. In the final phase, ten Asian vultures of two of the endangered species (Gyps bengalensis, Gyps indicus were dosed with meloxicam by gavage; five of them at more than the likely MLE dosage. All meloxicam-treated birds survived all treatments, and none suffered any obvious clinical effects. Serum uric acid concentrations remained within the normal limits throughout, and were significantly lower than those from birds treated with diclofenac in other studies. We conclude that
Phipps, W Louis; Wolter, Kerri; Michael, Michael D; MacTavish, Lynne M; Yarnell, Richard W
2013-01-01
Cape vulture Gyps coprotheres populations have declined across their range due to multiple anthropogenic threats. Their susceptibility to fatal collisions with the expanding power line network and the prevalence of carcasses contaminated with illegal poisons and other threats outside protected areas are thought to be the primary drivers of declines in southern Africa. We used GPS-GSM units to track the movements and delineate the home ranges of five adult (mean ±SD minimum convex polygon area = 121,655±90,845 km(2)) and four immature (mean ±SD minimum convex polygon area = 492,300±259,427 km(2)) Cape vultures to investigate the influence of power lines and their use of protected areas. The vultures travelled more than 1,000 km from the capture site and collectively entered five different countries in southern Africa. Their movement patterns and core foraging ranges were closely associated with the spatial distribution of transmission power lines and we present evidence that the construction of power lines has allowed the species to extend its range to areas previously devoid of suitable perches. The distribution of locations of known Cape vulture mortalities caused by interactions with power lines corresponded to the core ranges of the tracked vultures. Although some of the vultures regularly roosted at breeding colonies located inside protected areas the majority of foraging activity took place on unprotected farmland. Their ability to travel vast distances very quickly and the high proportion of time they spend in the vicinity of power lines and outside protected areas make Cape vultures especially vulnerable to negative interactions with the expanding power line network and the full range of threats across the region. Co-ordinated cross-border conservation strategies beyond the protected area network will therefore be necessary to ensure the future survival of threatened vultures in Africa.
How cheap is soaring flight in raptors? A preliminary investigation in freely-flying vultures.
Duriez, Olivier; Kato, Akiko; Tromp, Clara; Dell'Omo, Giacomo; Vyssotski, Alexei L; Sarrazin, François; Ropert-Coudert, Yan
2014-01-01
Measuring the costs of soaring, gliding and flapping flight in raptors is challenging, but essential for understanding their ecology. Among raptors, vultures are scavengers that have evolved highly efficient soaring-gliding flight techniques to minimize energy costs to find unpredictable food resources. Using electrocardiogram, GPS and accelerometer bio-loggers, we report the heart rate (HR) of captive griffon vultures (Gyps fulvus and G. himalayensis) trained for freely-flying. HR increased three-fold at take-off (characterized by prolonged flapping flight) and landing (>300 beats-per-minute, (bpm)) compared to baseline levels (80-100 bpm). However, within 10 minutes after the initial flapping phase, HR in soaring/gliding flight dropped to values similar to baseline levels, i.e. slightly lower than theoretically expected. However, the extremely rapid decrease in HR was unexpected, when compared with other marine gliders, such as albatrosses. Weather conditions influenced flight performance and HR was noticeably higher during cloudy compared to sunny conditions when prolonged soaring flight is made easier by thermal ascending air currents. Soaring as a cheap locomotory mode is a crucial adaptation for vultures who spend so long on the wing for wide-ranging movements to find food.
Meteyer, C.U.; Rideout, B.A.; Gilbert, M.; Shivaprasad, H.L.; Oaks, J.L.
2005-01-01
Oriental white-backed vultures (Gyps bengalensis; OWBVs) died of renal failure when they ingested diclofenac, a nonsteroidal anti-inflammatory drug (NSAID), in tissues of domestic livestock. Acute necrosis of proximal convoluted tubules in these vultures was severe. Glomeruli, distal convoluted tubules, and collecting tubules were relatively spared in the vultures that had early lesions. In most vultures, however, lesions became extensive with large urate aggregates obscuring renal architecture. Inflammation was minimal. Extensive urate precipitation on the surface and within organ parenchyma (visceral gout) was consistently found in vultures with renal failure. Very little is known about the physiologic effect of NSAIDs in birds. Research in mammals has shown that diclofenac inhibits formation of prostaglandins. We propose that the mechanism by which diclofenac induces renal failure in the OWBV is through the inhibition of the modulating effect of prostaglandin on angiotensin II-mediated adrenergic stimulation. Renal portal valves open in response to adrenergic stimulation, redirecting portal blood to the caudal vena cava and bypassing the kidney. If diclofenac removes a modulating effect of prostaglandins on the renal portal valves, indiscriminant activation of these valves would redirect the primary nutrient blood supply away from the renal cortex. Resulting ischemic necrosis of the cortical proximal convoluted tubules would be consistent with our histologic findings in these OWBVs.
Hooded Vulture Necrosyrtes monachus and African White-backed ...
African Journals Online (AJOL)
Basic ecological information is still lacking for many species of African vultures. The Hooded Vulture Necrosyrtes monachus is known as a rare breeding resident in north-eastern South Africa. This study set out to monitor the nests of Hooded Vultures and, secondarily, White-backed Vultures Gyps africanus in the Olifants ...
Directory of Open Access Journals (Sweden)
Morgan B. Pfeiffer
2015-05-01
Full Text Available Despite the extent of subsistence farmland in Africa, little is known about endangered species that persist within them. The Cape Vulture (Gyps coprotheres is regionally endangered in southern Africa and at least 20% of the population breeds in the subsistence farmland area previously known as the Transkei in the Eastern Cape province of South Africa. To understand their movement ecology, adult Cape Vultures (n = 9 were captured and fitted with global positioning system/global system for mobile transmitters. Minimum convex polygons (MCPs,and 99% and 50% kernel density estimates (KDEs were calculated for the breeding and non breeding seasons of the Cape Vulture. Land use maps were constructed for each 99% KDE and vulture locations were overlaid. During the non-breeding season, ranges were slightly larger(mean [± SE] MCP = 16 887 km2 ± 366 km2 than the breeding season (MCP = 14 707 km2 ± 2155 km2. Breeding and non-breeding season MCPs overlapped by a total of 92%. Kernel density estimates showed seasonal variability. During the breeding season, Cape Vultures used subsistence farmland, natural woodland and protected areas more than expected. In the non-breeding season, vultures used natural woodland and subsistence farmland more than expected, and protected areas less than expected. In both seasons, human-altered landscapes were used less, except for subsistence farmland. Conservation implications: These results highlight the importance of subsistence farm land to the survival of the Cape Vulture. Efforts should be made to minimise potential threats to vultures in the core areas outlined, through outreach programmes and mitigation measures.The conservation buffer of 40 km around Cape Vulture breeding colonies should be increased to 50 km.
Naidoo, V; Swan, G E
2009-04-01
Diclofenac (DF), a non-steroidal anti-inflammatory drug (NSAID), is largely regarded as one of the most devastating environmental toxicant in recent times, after accidental exposure via their food-chain lead to massive mortalities in three vulture species on the Asian subcontinent. Although the use of diclofenac was recently banned on the Indian subcontinent, following the favourable safety profile of meloxicam, its mechanism of toxicity remains unknown. In an attempt to establish this mechanism, we test three hypotheses using models established from either the domestic chicken (Gallus domesticus) or the African White-backed vulture (Gyps africanus). We demonstrate that both DF and meloxicam are toxic to renal tubular epithelial (RTE) cells following 12 h of exposure, due to an increase in production of reactive oxygen species (ROS), which could be temporarily ameliorated by pre-incubation with uric acid (UA). When cultures were incubated with either drug for only 2 h, meloxicam showed no toxicity in contrast to diclofenac. In both cases no increase in ROS production was evident. In addition, diclofenac decreased the transport of uric acid, by interfering with the p-amino-hippuric acid (PAH) channel. We conclude that vulture susceptibility to diclofenac results from a combination of an increased ROS, interference with UA transport and the duration of exposure.
Himalayan Vultures in Khodpe, far-west Nepal: is there any threat?
Directory of Open Access Journals (Sweden)
Manoj Kumar Joshi
2015-11-01
Full Text Available There is evidence that Himalayan Vulture Gyps himalayensis is susceptible to the veterinary drug diclofenac, which is responsible for the decline of other Gyps species across South Asia. Unlike other Gyps species, there is little quantitative data to assess Himalayan Vultures population. Based on observation, we analyzed the flock size and breeding success of the Himalayan Vultures on two cliffs of Khodpe in Baitadi District, far-west Nepal. The mean flock size of Himalayan Vulture was 25.83±6.33. Overall breeding success was 90.9% based on active nests. We also conducted a questionnaire survey to assess the perceived threats in the view of local people to vultures and these threats include loss of food, veterinary drug, lack of proper nest sites, and lack of public awareness. Additionally, 76% of the respondents felt that vultures were decreasing in the area, 94.7% were not aware of the toxicity of diclofenac to vultures, and very few (2% knew about the availability of meloxicam as a safe alternative drug. The colony we studied is one of the few remaining known breeding populations, which provide baseline information from far-west Nepal, thus we recommend for conservation and continuous monitoring of this species to understand their population change and breeding biology.
Selected mineral and heavy metal concentrations in blood and ...
African Journals Online (AJOL)
Concentrations of eight essential elements (Ca, Co, Cr, Cu, Fe, Mn, Ni and Zn) and three toxic metals (Al, Pb and Sr) were measured in various tissue samples from African whitebacked (Pseudogyps africanus), Cape griffon (Gyps coprotheres) and Lappetfaced (Torgos tracheliotos) vultures in different regions of South ...
Lappet-faced Vulture (Torgos tracheliotos) breeding in Ithala Game ...
African Journals Online (AJOL)
Predator simulation, re-colonization, KwaZulu-Natal. African White-backed Vulture Gyps africanus, Lappet-faced. Vulture Torgos tracheliotos. Authors' addresses: Ian Rushworth & James Wakelin, Ezemvelo KwaZulu-Natal. Wildlife, P.O. Box 13053, Cascades 3202, KwaZulu-Natal,. South Africa; Gary Bawden, Ithala Game ...
Tree-nesting Rüppells Griffon vultures | Rondeau | Vulture News
African Journals Online (AJOL)
Guy Rondeau, Phlippe Pilard, Bernard Ahon, Moussa Coundé. Abstract. No Abstract. Vulture News Vol. 55, 2006: 14-22. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians ...
Directory of Open Access Journals (Sweden)
Tamsyn Fourie
Full Text Available The following study evaluates the overt toxic potential of carprofen (CRP, flunixin (FXN and phenylbutazone (PBZ in Old world vultures in relation to historic toxicity data for diclofenac and ketoprofen, with the Cape vulture (Gyps coprotheres being the indicator species. The toxic potential of a single oral dose of CRP (11.5 mg/kg, FXN (1 mg/kg,PBZ (1.7 mg/kg or water was evaluated by means of a four-way parallel study (n = 2, as means of ascertaining if these drugs were as toxic as diclofenac in the vulture. No unscheduled deaths or pathological lesions were noted following exposure. Clinical signs of lethargy and depression were, however, noted in one CRP, two FXN and one PBZ treated birds. Mild reversible inhibition of UA excretion was evident in all three groups, although UA remained within the population reference interval in contrast to the effects previously described for diclofenac and ketoprofen. All treatment groups had a drug concentration responsive increase in alanine transferase activity. CRP, FXN and PBZ were characterised by a maximum plasma concentration (Cmax of 1051.8 ± 620.7 ng/ml, 335.9 ± 36.3 ng/ml and 11150 ± 2474.9 ng/ml at 4 ± 4.3, 0.45 ± 0.02 and 5.3 ± 5.2 hours (Tmax respectively and a half-life of elimination of 13.3 ±5, 1.8±1 and 18.7 ±11.4 hours respectively. While we could not demonstrate a lethal effect of the tested substances, the presence of toxic clinical signs, clinical pathological changes and/or long half-lives of elimination suggests that all three drugs have a potential for toxicity in a larger population or on repeat administration. In conclusion while the studied substances were not as overtly toxic as diclofenac, they are of safety concern.
Fourie, Tamsyn; Cromarty, Duncan; Duncan, Neil; Wolter, Kerri; Naidoo, Vinny
2015-01-01
The following study evaluates the overt toxic potential of carprofen (CRP), flunixin (FXN) and phenylbutazone (PBZ) in Old world vultures in relation to historic toxicity data for diclofenac and ketoprofen, with the Cape vulture (Gyps coprotheres) being the indicator species. The toxic potential of a single oral dose of CRP (11.5 mg/kg), FXN (1 mg/kg),PBZ (1.7 mg/kg) or water was evaluated by means of a four-way parallel study (n = 2), as means of ascertaining if these drugs were as toxic as diclofenac in the vulture. No unscheduled deaths or pathological lesions were noted following exposure. Clinical signs of lethargy and depression were, however, noted in one CRP, two FXN and one PBZ treated birds. Mild reversible inhibition of UA excretion was evident in all three groups, although UA remained within the population reference interval in contrast to the effects previously described for diclofenac and ketoprofen. All treatment groups had a drug concentration responsive increase in alanine transferase activity. CRP, FXN and PBZ were characterised by a maximum plasma concentration (Cmax) of 1051.8 ± 620.7 ng/ml, 335.9 ± 36.3 ng/ml and 11150 ± 2474.9 ng/ml at 4 ± 4.3, 0.45 ± 0.02 and 5.3 ± 5.2 hours (Tmax) respectively and a half-life of elimination of 13.3 ±5, 1.8±1 and 18.7 ±11.4 hours respectively. While we could not demonstrate a lethal effect of the tested substances, the presence of toxic clinical signs, clinical pathological changes and/or long half-lives of elimination suggests that all three drugs have a potential for toxicity in a larger population or on repeat administration. In conclusion while the studied substances were not as overtly toxic as diclofenac, they are of safety concern.
Blood lead levels in White-Backed Vultures (Gyps africanus) from ...
African Journals Online (AJOL)
Campbell Murn
Currently vulture populations in sub-. Saharan Africa are dramatically declining due to direct and indirect poisoning with pesticides (Ogada. 2014, Virani 2011). During a tagging and radio telemetry study from 2012 thru 2015 involving several species of vultures in. Botswana, the Denver Zoological. Foundation in ...
Observation of a population of Egyptian Vultures Neophron ...
African Journals Online (AJOL)
Campbell Murn
Observational study of behavior: sampling methods. Behaviour 49:227- 267. Baral, N., R. Gautam & B. Tamang .2005. Population status and breeding ecology of White-rumped Vulture Gyps bengalensis in Rampur Valley,. Nepal. Forktail 21: 87-91. Brandl, R., Utschick, H & Schmidtke, K. 1985. Raptors and land-use systems.
Directory of Open Access Journals (Sweden)
P. C.B. Turnbull
2008-08-01
Full Text Available TURNBULLP, P.C.B. DIEKMANNM,M., KILIAN, J.W., VERSFELDW, W.,DE VOS, V., ARNTZENL, L.,WOLTER, K., BARTELS, P. & KOTZE, A. 2008.N aturally acquired antibodies to Bacillusa nthracisp rotective antigeni n vultureso f southern Africa. Onderstepoort Journal of Veterinary Research, T5:95-102 Sera from 19 wild caught vultures in northern Namibia and 15 (12 wild caught and three captive bred but with minimal histories in North West Province, South Africa, were examined by an enzyme-linked immunosorbenats say( ELISAf or antibodiesto the Bacillus anthracis toxin protective antigen (PA. As assessed from the baseline established with a control group of ten captive reared vultures with well-documented histories, elevated titres were found in 12 of the 19 (63% wild caught Namibian birds as compared with none of the 15 South African ones. There was a highly significant difference between the Namibian group as a hole and the other groups (P 0.05. Numbers in the Namibian group were too small to determine any significances in species-, sex- or age-related differences within the raw data showing elevated titres in four out of six Cape Vultures, Gyps coprotheress, six out of ten Whitebacked Vultures, Gyps africanus, and one out of three Lappet-faced Vultures, Aegypiust racheliotus, or in five of six males versus three of seven females, and ten of 15 adults versus one of four juveniles. The results are in line with the available data on the incidence of anthrax in northern Namibia and South Africa and the likely contact of the vultures tested with anthrax carcasses. lt is not known whether elevated titre indicates infection per se in vultures or absorption of incompletely digested epitopes of the toxin or both. The results are discussed in relation to distances travelled by vultures as determined by new tracking techniques, how serology can reveal anthrax activity in an area and the issue of the role of vultures in transmission of anthrax.
Cape Vulture Gyps coprotheres caught in gin trap
African Journals Online (AJOL)
campbell
its right foot fly into its nest situated on a cliff face and containing a large chick. The chain used to tether the trap to the ground could be clearly seen dangling below the flying bird. We have no way of knowing whether the deployment of this trap was accidental or intentional relative to its having caught a Cape Vulture.
Assessing species habitat using Google Street View: a case study of cliff-nesting vultures.
Olea, Pedro P; Mateo-Tomás, Patricia
2013-01-01
The assessment of a species' habitat is a crucial issue in ecology and conservation. While the collection of habitat data has been boosted by the availability of remote sensing technologies, certain habitat types have yet to be collected through costly, on-ground surveys, limiting study over large areas. Cliffs are ecosystems that provide habitat for a rich biodiversity, especially raptors. Because of their principally vertical structure, however, cliffs are not easy to study by remote sensing technologies, posing a challenge for many researches and managers working with cliff-related biodiversity. We explore the feasibility of Google Street View, a freely available on-line tool, to remotely identify and assess the nesting habitat of two cliff-nesting vultures (the griffon vulture and the globally endangered Egyptian vulture) in northwestern Spain. Two main usefulness of Google Street View to ecologists and conservation biologists were evaluated: i) remotely identifying a species' potential habitat and ii) extracting fine-scale habitat information. Google Street View imagery covered 49% (1,907 km) of the roads of our study area (7,000 km²). The potential visibility covered by on-ground surveys was significantly greater (mean: 97.4%) than that of Google Street View (48.1%). However, incorporating Google Street View to the vulture's habitat survey would save, on average, 36% in time and 49.5% in funds with respect to the on-ground survey only. The ability of Google Street View to identify cliffs (overall accuracy = 100%) outperformed the classification maps derived from digital elevation models (DEMs) (62-95%). Nonetheless, high-performance DEM maps may be useful to compensate Google Street View coverage limitations. Through Google Street View we could examine 66% of the vultures' nesting-cliffs existing in the study area (n = 148): 64% from griffon vultures and 65% from Egyptian vultures. It also allowed us the extraction of fine-scale features of cliffs
A survey of White-rumped Vultures Gyps bengalensis in Gujarat ...
African Journals Online (AJOL)
2007-09-02
Sep 2, 2007 ... During the field survey, 73.1% of the vultures were found soaring, 13.7% were perching on trees and/or the ground, while 13.2% were observed feeding on ..... A Pictorial Guide to the Birds of the Indian subcontinent. Bombay ...
Dropping dead: causes and consequences of vulture population declines worldwide.
Ogada, Darcy L; Keesing, Felicia; Virani, Munir Z
2012-02-01
Vultures are nature's most successful scavengers, and they provide an array of ecological, economic, and cultural services. As the only known obligate scavengers, vultures are uniquely adapted to a scavenging lifestyle. Vultures' unique adaptations include soaring flight, keen eyesight, and extremely low pH levels in their stomachs. Presently, 14 of 23 (61%) vulture species worldwide are threatened with extinction, and the most rapid declines have occurred in the vulture-rich regions of Asia and Africa. The reasons for the population declines are varied, but poisoning or human persecution, or both, feature in the list of nearly every declining species. Deliberate poisoning of carnivores is likely the most widespread cause of vulture poisoning. In Asia, Gyps vultures have declined by >95% due to poisoning by the veterinary drug diclofenac, which was banned by regional governments in 2006. Human persecution of vultures has occurred for centuries, and shooting and deliberate poisoning are the most widely practiced activities. Ecological consequences of vulture declines include changes in community composition of scavengers at carcasses and an increased potential for disease transmission between mammalian scavengers at carcasses. There have been cultural and economic costs of vulture declines as well, particularly in Asia. In the wake of catastrophic vulture declines in Asia, regional governments, the international scientific and donor communities, and the media have given the crisis substantial attention. Even though the Asian vulture crisis focused attention on the plight of vultures worldwide, the situation for African vultures has received relatively little attention especially given the similar levels of population decline. While the Asian crisis has been largely linked to poisoning by diclofenac, vulture population declines in Africa have numerous causes, which have made conserving existing populations more difficult. And in Africa there has been little
Assessing species habitat using Google Street View: a case study of cliff-nesting vultures.
Directory of Open Access Journals (Sweden)
Pedro P Olea
Full Text Available The assessment of a species' habitat is a crucial issue in ecology and conservation. While the collection of habitat data has been boosted by the availability of remote sensing technologies, certain habitat types have yet to be collected through costly, on-ground surveys, limiting study over large areas. Cliffs are ecosystems that provide habitat for a rich biodiversity, especially raptors. Because of their principally vertical structure, however, cliffs are not easy to study by remote sensing technologies, posing a challenge for many researches and managers working with cliff-related biodiversity. We explore the feasibility of Google Street View, a freely available on-line tool, to remotely identify and assess the nesting habitat of two cliff-nesting vultures (the griffon vulture and the globally endangered Egyptian vulture in northwestern Spain. Two main usefulness of Google Street View to ecologists and conservation biologists were evaluated: i remotely identifying a species' potential habitat and ii extracting fine-scale habitat information. Google Street View imagery covered 49% (1,907 km of the roads of our study area (7,000 km². The potential visibility covered by on-ground surveys was significantly greater (mean: 97.4% than that of Google Street View (48.1%. However, incorporating Google Street View to the vulture's habitat survey would save, on average, 36% in time and 49.5% in funds with respect to the on-ground survey only. The ability of Google Street View to identify cliffs (overall accuracy = 100% outperformed the classification maps derived from digital elevation models (DEMs (62-95%. Nonetheless, high-performance DEM maps may be useful to compensate Google Street View coverage limitations. Through Google Street View we could examine 66% of the vultures' nesting-cliffs existing in the study area (n = 148: 64% from griffon vultures and 65% from Egyptian vultures. It also allowed us the extraction of fine-scale features of
Antibiotics threaten wildlife: circulating quinolone residues and disease in Avian scavengers.
Directory of Open Access Journals (Sweden)
Jesús A Lemus
Full Text Available Antibiotic residues that may be present in carcasses of medicated livestock could pass to and greatly reduce scavenger wildlife populations. We surveyed residues of the quinolones enrofloxacin and its metabolite ciprofloxacin and other antibiotics (amoxicillin and oxytetracycline in nestling griffon Gyps fulvus, cinereous Aegypius monachus and Egyptian Neophron percnopterus vultures in central Spain. We found high concentrations of antibiotics in the plasma of many nestling cinereous (57% and Egyptian (40% vultures. Enrofloxacin and ciprofloxacin were also found in liver samples of all dead cinereous vultures. This is the first report of antibiotic residues in wildlife. We also provide evidence of a direct association between antibiotic residues, primarily quinolones, and severe disease due to bacterial and fungal pathogens. Our results indicate that, by damaging the liver and kidney and through the acquisition and proliferation of pathogens associated with the depletion of lymphoid organs, continuous exposure to antibiotics could increase mortality rates, at least in cinereous vultures. If antibiotics ingested with livestock carrion are clearly implicated in the decline of the vultures in central Spain then it should be considered a primary concern for conservation of their populations.
Vulture rescue and rehabilitation in South Africa: An urban perspective
Directory of Open Access Journals (Sweden)
V. Naidoo
2011-04-01
Full Text Available SouthAfrica is home to 9 vulture species, of which 7 are endangered. While the cause of the population declines remains largely speculative, a vast amount of effort has been dedicated towards the protection of populations by ensuring sustainable and safe food sources for the various colonies. Limited focus was placed in the past on efforts related to the rescue and/or rehabilitation (R&R of injured birds and the release of these birds back into the wild. This paper provides an overview of the causes, the impact and success of 3 organisations involved in R&R efforts of vultures in the Magaliesberg mountain range and surrounding areas over a period of 10 years. Study material included 162 Cape griffon (CGV and 38 African white-backed (AWBV vultures. Datasets include the number, sex and age of birds received, the reason the vultures were brought in for R&R, surgical interventions performed and outcomes of rescue efforts. The CGV dominated the rehabilitation attempts. Results further show that a large number of apparently healthy birds were presented for veterinary treatment. The R&R data clearly indicate that the major cause of injuries was birds colliding with overhead pylons, as a high number of soft tissue and skeletal injuries were observed. The study also shows that successful releases of rescued birds are possible. It is concluded that urbanisation has had a major negative impact on vultures around the Magaliesberg mountain range.
Not in wilderness: African vulture strongholds remain in areas with high human density
Granadeiro, José Pedro; Monteiro, Hamilton; Nuno, Ana; Lecoq, Miguel; Cardoso, Paulo; Regalla, Aissa; Catry, Paulo
2018-01-01
Vultures constitute an important functional group in many ecosystems, providing crucial ecosystem services both in natural and humanized environments. These scavengers are facing massive declines worldwide, but in several African countries virtually nothing is known on populations’ status and threats, hampering the development of adequate conservation strategies. In Guinea-Bissau, globally important populations of Hooded Necrosyrtes monachus and African white-backed vultures Gyps africanus were recently reported. Using the country as a study area, we aim to characterize human-vulture interactions in West Africa applying a multidisciplinary approach. We assessed the status and distribution of vulture populations using data from 1711 km of roadside transects, examined predictors of their distribution, and produced a nationwide population estimate for the Hooded Vulture, using an innovative method based on the relationship between the size of human population in settlements and vulture numbers. We conducted 47 stakeholder interviews to assess perceived roles played by vultures, and to investigate potential anthropogenic threats. Hooded vultures were strongly associated with high human population densities, whereas no relation was found between African white-backed and Rüppell’s vultures and any of the tested predictors, which included cattle density, precipitation and Normalized Difference Vegetation Index, among others. We estimate a national population of 43347 Hooded vultures, the largest population reported in the species range. Respondents were generally aware of the services provided by vultures, especially waste and carcass removal, including in urban areas. Hunting for witchcraft and traditional medicine was the most frequently recognised threat, while poisoning was ranked as having the highest impact. We hypothesise that poisoning-related mortality may be affecting African white-backed and Rüppell’s vultures’ distribution and explain their scarcity
Metabolism of aceclofenac in cattle to vulture-killing diclofenac.
Galligan, T H; Taggart, M A; Cuthbert, R J; Svobodova, D; Chipangura, J; Alderson, D; Prakash, V M; Naidoo, V
2016-10-01
The nonsteroidal anti-inflammatory drug (NSAID) diclofenac is highly toxic to Gyps vultures, and its recent widespread use in South Asia caused catastrophic declines in at least 3 scavenging raptors. The manufacture of veterinary formulations of diclofenac has since been banned across the region with mixed success. However, at least 12 other NSAIDs are available for veterinary use in South Asia. Aceclofenac is one of these compounds, and it is known to metabolize into diclofenac in some mammal species. The metabolic pathway of aceclofenac in cattle, the primary food of vultures in South Asia, is unknown. We gave 6 cattle the recommended dose of aceclofenac (2 mg/kg), collected blood thereafter at intervals for up to 12 h, and used liquid chromatography with mass spectrometry in a pharmacokinetic analysis of aceclofenac and diclofenac in the plasma. Nearly all the aceclofenac administered to the cattle was very rapidly metabolized into diclofenac. At 2 h, half the aceclofenac had been converted into diclofenac, and at 12 h four-fifths of the aceclofenac had been converted into diclofenac. Therefore, administering aceclofenac to livestock poses the same risk to vultures as administering diclofenac to livestock. This, coupled with the risk that aceclofenac may replace diclofenac in the veterinary market, points to the need for an immediate ban on all aceclofenac formulations that can be used to treat livestock. Without such a ban, the recovery of vultures across South Asia will not be successful. © 2016 Society for Conservation Biology.
High altitude and hemoglobin function in the vultures Gyps rueppelli and Aegypius monachus
DEFF Research Database (Denmark)
Weber, Roy E.; Hiebl, Inge; Braunitzer, Gerhard
1988-01-01
Functional characteristics of the stripped composite hemoglobins (Hbs) of lhevultures Gyps rueppellii and Aegypills monachus that can fly at extremely high altitudes, and of component Hbs of G. rueppellii are reported, in relation to influences of pH, temperalure and inositol hexaphosphate. G...... structures of the constituent polypeptide chains to trace molecular adaptations to high-altitude respiration, and to physiological factors (pulmonary hypoxia and hypocapnia, body temperature shifts, and lung and nasal gas and heat exchange) to discern their possible survival value at altitudes of 11300 m....
A preliminary assessment of the potential risks from electrical ...
African Journals Online (AJOL)
... Grey-crowned Crane Balearica regulorum, Lesser Flamingo Phoeniconaias minor, White-backed Vulture Gyps africanus, Rüppell's Vulture Gyps rueppellii, Martial Eagle Polemaetus bellicosus, White Stork Ciconia ciconia, Secretarybird Sagittarius serpentarius, and various sit-and-wait raptors. These preliminary findings ...
Directory of Open Access Journals (Sweden)
Sophie Monsarrat
Full Text Available Feeding stations are commonly used to sustain conservation programs of scavengers but their impact on behaviour is still debated. They increase the temporal and spatial predictability of food resources while scavengers have supposedly evolved to search for unpredictable resources. In the Grands Causses (France, a reintroduced population of Griffon vultures Gyps fulvus can find carcasses at three types of sites: 1. "light feeding stations", where farmers can drop carcasses at their farm (spatially predictable, 2. "heavy feeding stations", where carcasses from nearby farms are concentrated (spatially and temporally predictable and 3. open grasslands, where resources are randomly distributed (unpredictable. The impact of feeding stations on vulture's foraging behaviour was investigated using 28 GPS-tracked vultures. The average home range size was maximal in spring (1272 ± 752 km(2 and minimal in winter (473 ± 237 km(2 and was highly variable among individuals. Analyses of home range characteristics and feeding habitat selection via compositional analysis showed that feeding stations were always preferred compared to the rest of the habitat where vultures can find unpredictable resources. Feeding stations were particularly used when resources were scarce (summer or when flight conditions were poor (winter, limiting long-ranging movements. However, when flight conditions were optimal, home ranges also encompassed large areas of grassland where vultures could find unpredictable resources, suggesting that vultures did not lose their natural ability to forage on unpredictable resources, even when feeding stations were available. However during seasons when food abundance and flight conditions were not limited, vultures seemed to favour light over heavy feeding stations, probably because of the reduced intraspecific competition and a pattern closer to the natural dispersion of resources in the landscape. Light feeding stations are interesting tools
Monsarrat, Sophie; Benhamou, Simon; Sarrazin, François; Bessa-Gomes, Carmen; Bouten, Willem; Duriez, Olivier
2013-01-01
Feeding stations are commonly used to sustain conservation programs of scavengers but their impact on behaviour is still debated. They increase the temporal and spatial predictability of food resources while scavengers have supposedly evolved to search for unpredictable resources. In the Grands Causses (France), a reintroduced population of Griffon vultures Gyps fulvus can find carcasses at three types of sites: 1. "light feeding stations", where farmers can drop carcasses at their farm (spatially predictable), 2. "heavy feeding stations", where carcasses from nearby farms are concentrated (spatially and temporally predictable) and 3. open grasslands, where resources are randomly distributed (unpredictable). The impact of feeding stations on vulture's foraging behaviour was investigated using 28 GPS-tracked vultures. The average home range size was maximal in spring (1272 ± 752 km(2)) and minimal in winter (473 ± 237 km(2)) and was highly variable among individuals. Analyses of home range characteristics and feeding habitat selection via compositional analysis showed that feeding stations were always preferred compared to the rest of the habitat where vultures can find unpredictable resources. Feeding stations were particularly used when resources were scarce (summer) or when flight conditions were poor (winter), limiting long-ranging movements. However, when flight conditions were optimal, home ranges also encompassed large areas of grassland where vultures could find unpredictable resources, suggesting that vultures did not lose their natural ability to forage on unpredictable resources, even when feeding stations were available. However during seasons when food abundance and flight conditions were not limited, vultures seemed to favour light over heavy feeding stations, probably because of the reduced intraspecific competition and a pattern closer to the natural dispersion of resources in the landscape. Light feeding stations are interesting tools for managing
African Journals Online (AJOL)
Campbell Murn
genus name of Gyps for Gyps vulgaris [= G.fulvus], which he ... Appendix to this note my translation of Perrault's article; curiously he ... My translation of Mr. Perrault's article. ANATOMICAL DESCRIPTION OF. TWO GRIFONS. The description that previous. Authors made of the Grifon does not fit any known animal: besides the.
Directory of Open Access Journals (Sweden)
Ricardo Carrasco-Garcia
2018-03-01
Full Text Available Understanding the role that facultative scavenger species may play in spreading infectious pathogens, and even becoming reservoirs for humans, domestic and wild ungulates or, on the contrary, preventing the spread of disease, requires a prior understanding of the pattern of carrion scavenging in specific scenarios. The objectives of this paper are (i to describe the guild of vertebrate scavengers and (ii to study the species-specific, habitat, and management-related factors involved in the usage of gut piles in South Central Spain (SCS, a tuberculosis (TB endemic area. We used camera trapping at 18 hunting piles on seven hunting estates. A total of eight bird and five mammal taxa were detected at the remains of hunting piles. The most frequently detected species in terms of number of gut piles visited (78% and scavenged (61% was the red fox Vulpes vulpes, followed by the griffon vulture Gyps fulvus (56% as regards both presence and scavenging and the raven Corvus corax (61 and 39% as regards presence and scavenging, respectively. We evidenced that griffon vultures accounted for most of the scavenging activity in open habitats, while facultative mammal scavengers, red fox, and wild boar Sus scrofa made the highest contribution to scavenging in vegetation-covered habitats. In the case of wild boar, the gut piles deposited during the evening and night favored higher rates of scavenging, while the opposite pattern was observed for griffons. Overall, our findings suggest that when disposing of hunting remains in areas of risk as regards disease transmission it is particularly important to consider the access that facultative mammals, and especially wild boar, have to material, while the presence of the resource needs to be safeguarded to protect specialist scavengers of conservation value. These results are of particular relevance in the case of wild boar in the current context of re-emerging TB and emerging African swine fever (ASF in Europe.
Griffon: what's new and what's coming
CERN. Geneva
2014-01-01
The Griffon framework has reinvented itself in order to reach new heights! Version 2.0 brings along a better modular design, dependency injection, JDK8 Lambdas support, and much more. The reduced memory footprint of the Griffon runtime allows applications to be installed on platforms where resources are scarcer, such as Raspberry Pi and other embedded platforms. Turning to the build time, applications can participate effortlessly on multi-project builds, no matter if those builds are driven by Gradle or Maven. There are of course other features that will popup in the near future. Come learn what's new and what's next for Griffon; one thing is for sure, it's future looks very bright. About the speaker Andres Almiray is a Java/Groovy developer and Java Champion, with more than 14 years of experience in software design and development. He has been involved in web and desktop application developments since the early days of Java. His current interests include Groovy, Swing and JavaFX...
Cape Vulture usurps Bearded Vulture nest | Crowson | Vulture News
African Journals Online (AJOL)
Cape Vulture usurps Bearded Vulture nest. John Crowson, Sonja Krüger. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More ...
African Journals Online (AJOL)
, ... Vol 53 (2005), Poisoning of seventeen Eurasian Griffons by ... may help save critically endangered Asian vultures, Abstract PDF ... Vol 61 (2011), Trade in Andean Condor Vulture gryphus feathers and body parts in the ...
Vulture updates - October 2016 - Around the World of Vultures ...
African Journals Online (AJOL)
Campbell Murn
2016-10-17
Oct 17, 2016 ... The CMS Africa-Eurasian Vulture. Multi-species Action Plan ... a novel success there. African roundup: The 2nd. Pan-. African Vulture Summit was integrated with Africa's regional contribution to the CMS Vulture. MsAP and was held as part of .... The movements of those birds have generated considerable ...
Fatal embryo chondral damage associated with fluoroquinolones in eggs of threatened avian scavengers
International Nuclear Information System (INIS)
Lemus, J.A.; Blanco, G.; Arroyo, B.; Martinez, F.; Grande, J.
2009-01-01
Stabled livestock reared in housed conditions are often subjected to intensive treatments with veterinary drug, which residues may be present in livestock meat ingested by scavengers, but nothing is known about their presence in eggs of wild birds and their potential detrimental effects on breeding success. We searched for residues of veterinary drugs and other toxicants in infertile and embryonated unhatched eggs of griffon vultures (Gyps fulvus) and red kites (Milvus milvus), two threatened avian scavengers. Quinolones (ciprofloxacin and enrofloxacin) were found in most unhatched eggs of both scavenger species clearly associated with severe alterations in the development of embryo cartilage and bones that could preclude embryo movements and subsequently normal development, pre-hatch position and successful hatching. The detrimental effects on developing eggs of veterinary drugs from livestock operations may help to explain reduced breeding success of avian scavengers. - Fluoroquinolones used in livestock farming and found in eggs of avian scavenger caused severe alterations in embryo cartilage and bone development.
Fatal embryo chondral damage associated with fluoroquinolones in eggs of threatened avian scavengers
Energy Technology Data Exchange (ETDEWEB)
Lemus, J.A. [Departamento de Ecologia Evolutiva, Museo Nacional de Ciencias Naturales (CSIC), J. Gutierrez Abascal 2, 28006 Madrid (Spain); Blanco, G., E-mail: gublanco2@yahoo.e [Departamento de Ecologia Evolutiva, Museo Nacional de Ciencias Naturales (CSIC), J. Gutierrez Abascal 2, 28006 Madrid (Spain); Arroyo, B.; Martinez, F.; Grande, J. [Departamento de Ecologia Evolutiva, Museo Nacional de Ciencias Naturales (CSIC), J. Gutierrez Abascal 2, 28006 Madrid (Spain)
2009-08-15
Stabled livestock reared in housed conditions are often subjected to intensive treatments with veterinary drug, which residues may be present in livestock meat ingested by scavengers, but nothing is known about their presence in eggs of wild birds and their potential detrimental effects on breeding success. We searched for residues of veterinary drugs and other toxicants in infertile and embryonated unhatched eggs of griffon vultures (Gyps fulvus) and red kites (Milvus milvus), two threatened avian scavengers. Quinolones (ciprofloxacin and enrofloxacin) were found in most unhatched eggs of both scavenger species clearly associated with severe alterations in the development of embryo cartilage and bones that could preclude embryo movements and subsequently normal development, pre-hatch position and successful hatching. The detrimental effects on developing eggs of veterinary drugs from livestock operations may help to explain reduced breeding success of avian scavengers. - Fluoroquinolones used in livestock farming and found in eggs of avian scavenger caused severe alterations in embryo cartilage and bone development.
Donázar, José Antonio; Ceballos, Olga; Cortés-Avizanda, Ainara
2018-07-15
The expansion of road networks and the increase in traffic have emerged in recent years as key threats to the conservation of biodiversity. This is particularly concerning in many protected areas because the increase of recreational activities requiring the use of vehicles. Effects of roads and traffic within guild scenarios and ecological processes remain however poorly known. Here we examined how road proximity and traffic intensity influence patterns of resource use in an Old-World avian scavenger guild living in a protected natural park in northern Spain. We experimentally placed 130 carcasses at different distances from a scenic road in the centre of the park. Vehicles were recorded by means of traffic counters which revealed that maximum numbers were reached during weekends and holidays and during the middle hours of the day. Avian scavenger attendance at carcasses was recorded by means of camera-traps. Obligated scavengers, Eurasian griffon (Gyps fulvus) and Egyptian vultures (Neophron percnopterus) were frequently observed (59.4% and 37.7% of the consumed carcasses) together with five other facultative scavenger species. We found that the richness (number of species) and the probability of consumption of the resource were reduced the smaller the distance to the road and in days with higher traffic intensity. The same factors affected the probability of presence of all the scavenger species. Moreover, some of them, notably griffon vultures, showed hourly patterns of carcass attendance suggesting avoidance of maximum traffic levels. Our results highlight that roads and traffic would trigger consequences on the structure and functioning of scavenger food webs, which may be particularly concerning in protected areas with remarkable levels of biodiversity. Future regulations at protected areas should couple both traffic and tourist affluence with wildlife conservation. In this way important ecological processes would be preserved while maintaining a good
Energy Technology Data Exchange (ETDEWEB)
Gallego, Antonio-Roman Munoz; Lucas, Manuela De; Casado, Eva; Ferrer, Miguel
2011-07-01
Full text: To assess and monitor the impact of wind farms on fauna is crucial if we want to achieve ecologically sustainable development of this renewable energy resource. Today there are clear evidences that the probability of raptor collision depends critically on species behaviour and weather conditions, and the topographic factors related to each windmill. In our study area EIA were not able to predict this differential risk and in these circumstances mitigating the causes of bird mortality becomes a task of major importance, especially to those wind farms located in the Strait of Gibraltar, a water crossing of 14 km at its shortest distance acting as a major migration bottleneck for Paleo-African soaring migrants. We collected all available information on raptor collision from 1992, when the first wind farm was installed, and from 2005 until present a total of 262 turbines, grouped into 20 wind farms, were surveyed in a daily basis through a surveillance program with the main goal of register the actual mortality of birds. A total of 1291 raptors of 19 species were found of which 78.5% correspond to two species, the griffon vulture (Gyps fulvus) and the kestrel (Falco tinnunculus). In order to mitigate the impact on raptors, and particularly on the griffon vulture, in 2007 a program based on selective stopping of turbines was imposed, in collaboration with the environmental competent authority, on new approved projects. During 2008 there was a reduction in mortality by 48%, which remained in 2009 with a remarkably lower economic cost. An analysis of the temporal collision patterns will be presented and discussed, with special attention to those species suffering higher mortality rate, and to those who have some degree of threat. (Author)
Status of birds of prey in Guinea-Bissau: first assessment based on ...
African Journals Online (AJOL)
... cover (based on the normalised difference vegetation index). Apart from Hooded Vultures and White-backed Vultures Gyps africanus, all other raptors in the IUCN Red List were found to be scarce, including other vultures and several medium-to-large eagles. Keywords: birds, Guinea-Bissau, raptors, transects, West Africa ...
Turkey vulture surveys in Cuba
Wotzkow, C.; Wiley, J.W.
1988-01-01
Turkey Vultures (Cathartes aura), were surveyed monthly in Cuba from March 1982-January 1983. A total of 25371 vultures were tallied in 7186 km (3.5 vultures/transect km) of roadside counting along main highways leading from the city of La Habana (northwestern Cuba) to the city of Las Tunas (southeast). Numbers of vultures counted declined substantially beyond 200 m from the transect road. Density of vultures observed within 200 m of the road along the transect route was 0.06/ha. Highest counts were obtained in March, April and June. Turkey Vulture flying activity was greatest during the periods 0900-1200 H and 1400-1700 H.
African Journals Online (AJOL)
campbell
Abstract. A study on communal roosts of African White-backed Gyps africanus and. Hooded Vultures Necrosyrtes monachus in Wondo Genet College of Forestry and Natural Resources, southern Ethiopia was conducted from January to. March 2012 to investigate population dynamics of vultures. The population fluctuation ...
African Journals Online (AJOL)
2006-09-02
Sep 2, 2006 ... Does the King Vulture Sarcoramphus papa use a sense of smell to locate food? Ibis 126: 67-69. Houston, D.C. 1986. Scavenging efficacy of Turkey Vultures in Tropical Forest. Condor 88: 318-323. Stager, K.E. 1964. The role of olfaction in food location by the Turkey Vulture. Contrib. Sci. (Los Ang.) 8: 1.
High occurrence of extra-pair partnerships and homosexuality in a ...
African Journals Online (AJOL)
The Cape Vulture Gyps coprotheres is an Endangered colonial cliff-nesting species that is typically cited as monogamous. Observations of wild Cape Vulture colonies note extra-pair breeding activities but homosexual activity has never been confirmed. Observations of breeding behaviours within a captive colony were ...
African Journals Online (AJOL)
2011-09-01
Sep 1, 2011 ... that an exchange of information can occur at a colony, ... events, low adult survival rates and high emigration rates, and these sinks are therefore prone to ..... Eurasian griffons Gyps fulvus in the island of Crete, Greece. Wildlife ...
The microbiome of New World vultures
DEFF Research Database (Denmark)
Roggenbuck, Michael; Schnell, Ida Baerholm; Blom, Nikolaj
2014-01-01
Vultures are scavengers that fill a key ecosystem niche, in which they have evolved a remarkable tolerance to bacterial toxins in decaying meat. Here we report the first deep metagenomic analysis of the vulture microbiome. Through face and gut comparisons of 50 vultures representing two species, we...... demonstrate a remarkably conserved low diversity of gut microbial flora. The gut samples contained an average of 76 operational taxonomic units (OTUs) per specimen, compared with 528 OTUs on the facial skin. Clostridia and Fusobacteria, widely pathogenic to other vertebrates, dominate the vulture's gut...... microbiota. We reveal a likely faecal-oral-gut route for their origin. DNA of prey species detectable on facial swabs was completely degraded in the gut samples from most vultures, suggesting that the gastrointestinal tracts of vultures are extremely selective. Our findings show a strong adaption of vultures...
In South Asia, it's cattle vs vultures | Ganguli | Vulture News
African Journals Online (AJOL)
In South Asia, it's cattle vs vultures. Ishani Ganguli. Abstract. No Abstract. Vulture News Vol. 55, 2006: 50-51. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors ...
The microbiome of New World vultures.
Roggenbuck, Michael; Bærholm Schnell, Ida; Blom, Nikolaj; Bælum, Jacob; Bertelsen, Mads Frost; Sicheritz-Pontén, Thomas; Pontén, Thomas Sicheritz; Sørensen, Søren Johannes; Gilbert, M Thomas P; Graves, Gary R; Hansen, Lars H
2014-11-25
Vultures are scavengers that fill a key ecosystem niche, in which they have evolved a remarkable tolerance to bacterial toxins in decaying meat. Here we report the first deep metagenomic analysis of the vulture microbiome. Through face and gut comparisons of 50 vultures representing two species, we demonstrate a remarkably conserved low diversity of gut microbial flora. The gut samples contained an average of 76 operational taxonomic units (OTUs) per specimen, compared with 528 OTUs on the facial skin. Clostridia and Fusobacteria, widely pathogenic to other vertebrates, dominate the vulture's gut microbiota. We reveal a likely faecal-oral-gut route for their origin. DNA of prey species detectable on facial swabs was completely degraded in the gut samples from most vultures, suggesting that the gastrointestinal tracts of vultures are extremely selective. Our findings show a strong adaption of vultures and their bacteria to their food source, exemplifying a specialized host-microbial alliance.
Culture- and molecular-based detection of swine-adapted Salmonella shed by avian scavengers.
Blanco, Guillermo; Díaz de Tuesta, Juan A
2018-04-13
Salmonella can play an important role as a disease agent in wildlife, which can then act as carriers and reservoirs of sanitary importance at the livestock-human interface. Transmission from livestock to avian scavengers can occur when these species consume contaminated carcasses and meat remains in supplementary feeding stations and rubbish dumps. We compared the performance of PCR-based detection with conventional culture-based methods to detect Salmonella in the faeces of red kites (Milvus milvus) and griffon vultures (Gyps fulvus) in central Spain. The occurrence of culturable Salmonella was intermediate in red kites (1.9%, n=52) and high in griffon vultures (26.3%, n=99). These proportions were clearly higher with PCR-based detection (13.5% and 40.4%, respectively). Confirmation cultures failed to grow Salmonella in all faecal samples positive by the molecular assay but negative by the initial conventional culture in both scavenger species, indicating the occurrence of false (non-culturable) positives by PCR-based detection. This suggests that the molecular assay is highly sensitive to detecting viable Salmonella in cultures, but also partial genomes and dead or unviable bacteria from past infections or contamination. Thus, the actual occurrence of Salmonella in a particular sampling time period can be underestimated when using only culture detection. The serovars found in the scavenger faeces were among the most frequently isolated in pigs from Spain and other EU countries, especially those generally recognized as swine-adapted monophasic variants of S. Typhimurium. Because the studied species obtain much of their food from pig carcasses, this livestock may be the primary source of Salmonella via direct ingestion of infected carcasses and indirectly via contamination due to the unsanitary conditions found in supplementary feeding stations established for scavenger conservation. Combining culture- and molecular-based detection is encouraged to understand the
Directory of Open Access Journals (Sweden)
Amanda E Holland
Full Text Available Knowledge of black vulture (Coragyps atratus and turkey vulture (Cathartes aura spatial ecology is surprisingly limited despite their vital ecological roles. Fine-scale assessments of space use patterns and resource selection are particularly lacking, although development of tracking technologies has allowed data collection at finer temporal and spatial resolution. Objectives of this study were to conduct the first assessment of monthly home range and core area sizes of resident black and turkey vultures with consideration to sex, as well as elucidate differences in monthly, seasonal, and annual activity patterns based on fine-scale movement data analyses. We collected 2.8-million locations for 9 black and 9 turkey vultures from June 2013 -August 2015 using solar-powered GSM/GPS transmitters. We quantified home ranges and core areas using the dynamic Brownian bridge movement model and evaluated differences as a function of species, sex, and month. Mean monthly home ranges for turkey vultures were ~50% larger than those of black vultures, although mean core area sizes did not differ between species. Turkey vulture home ranges varied little across months, with exception to a notable reduction in space-use in May, which corresponds with timing of chick-rearing activities. Black vulture home ranges and core areas as well as turkey vulture core areas were larger in breeding season months (January-April. Comparison of space use between male and female vultures was only possible for black vultures, and space use was only slightly larger for females during breeding months (February-May. Analysis of activity patterns revealed turkey vultures spend more time in flight and switch motion states (between flight and stationary more frequently than black vultures across temporal scales. This study reveals substantive variability in space use and activity rates between sympatric black and turkey vultures, providing insights into potential behavioral mechanisms
African Journals Online (AJOL)
The Hooded Vulture Neophron monachus occurs naturally in most of Zambia's rural areas, especially around large cattle farms and human habitations. Being next to a large game farm, The Meintjes have a number of Hooded Vultures on their farm, Kamfinsa Dairy Farm. About seven years ago they slaughtered a sheep.
Case Report Associated with Aspergillosis and Hepatitis E Virus Coinfection in Himalayan Griffons
Directory of Open Access Journals (Sweden)
Heng Li
2015-01-01
Full Text Available This study involved a death which occurred in four Himalayan griffons housed in Beijing zoo, China. Based on pathogen identification and the pathological changes observed, we did characterize the fungi and Hepatitis E virus (HEV in four dead Himalayan griffons. Pathological changes were severe. Membranous-like material was observed on the surface of the internal organs. Spleen was necrotic. Focal lymphocyte infiltration in the liver and many sunflower-like fungi nodules were evident in the tissues, especially in the kidney. PCR was used to identify the pathogen. Based on the 18SrRNA genomic sequence of known fungi, the results confirmed that all four dead Himalayan griffons were infected with Aspergillus. At the same time the detection of HEV also showed positive results. To the best of our knowledge, this work appears to be the first report of concurrent presence of Aspergillosis and Hepatitis E virus in rare avian species.
The microbiome of New World vultures
Roggenbuck, Michael; Schnell, Ida Baerholm; Blom, Nikolaj; Bælum, Jacob; Bertelsen, Mads Frost; Sicheritz-Pontén, Thomas; Sørensen, Søren Johannes; Gilbert, M. Thomas P.; Graves, Gary R.; Hansen, Lars Henrik
2014-01-01
Vultures are scavengers that fill a key ecosystem niche, in which they have evolved a remarkable tolerance to bacterial toxins in decaying meat. Here we report the first deep metagenomic analysis of the vulture microbiome. Through face and gut comparisons of 50 vultures representing two species, we demonstrate a remarkably conserved low diversity of gut microbial flora. The gut samples contained an average of 76 operational taxonomic units (OTUs) per specimen, compared with 528 OTUs on the fa...
Ecology and behaviour of Palm-nut Vultures Gypohierax angolensis ...
African Journals Online (AJOL)
Populations of many vulture species have undergone substantial declines. In Africa, 82% are threatened and although research on vultures has increased, the biology and ecology of several species is still poorly known. The Palm-nut Vulture Gypohierax angolensis has peculiar ecological characteristics, feeding on palm ...
The impact of urbanization and agricultural development on vultures ...
African Journals Online (AJOL)
The methodology uses point count surveys of vulture species density along an urban to forest gradient (dense downtown areas, suburbs, rural villages and farms, mixed uninhabited savanna, open and closed forests). The very common Black Vulture and the slightly less common Turkey Vulture were most often recorded in ...
Effects of vulture exclusion on carrion consumption by facultative scavengers.
Hill, Jacob E; DeVault, Travis L; Beasley, James C; Rhodes, Olin E; Belant, Jerrold L
2018-03-01
Vultures provide an essential ecosystem service through removal of carrion, but globally, many populations are collapsing and several species are threatened with extinction. Widespread declines in vulture populations could increase the availability of carrion to other organisms, but the ways facultative scavengers might respond to this increase have not been thoroughly explored. We aimed to determine whether facultative scavengers increase carrion consumption in the absence of vulture competition and whether they are capable of functionally replacing vultures in the removal of carrion biomass from the landscape. We experimentally excluded 65 rabbit carcasses from vultures during daylight hours and placed an additional 65 carcasses that were accessible to vultures in forested habitat in South Carolina, USA during summer (June-August). We used motion-activated cameras to compare carrion use by facultative scavenging species between the experimental and control carcasses. Scavenging by facultative scavengers did not increase in the absence of competition with vultures. We found no difference in scavenger presence between control carcasses and those from which vultures were excluded. Eighty percent of carcasses from which vultures were excluded were not scavenged by vertebrates, compared to 5% of carcasses that were accessible to vultures. At the end of the 7-day trials, there was a 10.1-fold increase in the number of experimental carcasses that were not fully scavenged compared to controls. Facultative scavengers did not functionally replace vultures during summer in our study. This finding may have been influenced by the time of the year in which the study took place, the duration of the trials, and the spacing of carcass sites. Our results suggest that under the warm and humid conditions of our study, facultative scavengers would not compensate for loss of vultures. Carcasses would persist longer in the environment and consumption of carrion would likely shift from
Dallas Zoo hunts for escaped vulture
African Journals Online (AJOL)
shows eating off the antelopes that lions kill and everything,” Mr Brown said. The African White-backed vultures have been at the zoo since August. They're expected to be part of an exhibit that is undergoing renovations. Mr Brown said vultures are hardy, resourceful animals. When the missing bird becomes hungry,.
Sympatric occurrence of four Cathartid vultures in the dry forests of ...
African Journals Online (AJOL)
dry forests of north-western Peru. Robert S R Williams. Frankfurt Zoological Society and Asociación TuTierra. rob@szfperu.org. This photograph, taken with a cameratrap, shows four species of Cathartid vultures: Andean Condor Vultur gryphus, King. Vulture Sarcoramphus papa, Turkey. Vulture Cathartes aura and Black ...
Vulture worries stalk activists on Uttarayan
African Journals Online (AJOL)
2007-03-01
Mar 1, 2007 ... Vulture worries stalk activists on Uttarayan. Anon. Ahmedabad – When kites take to the skies on Uttarayan, animal activists will be biting their nails in apprehension. Their main concern is the White-rumped. Vulture, a highly endangered species, of which only 137 birds are left in the city, according to figures ...
López-Rull, Isabel; Hornero-Méndez, Dámaso; Frías, Óscar; Blanco, Guillermo
2015-01-01
Variation in immunity is influenced by allocation trade-offs that are expected to change between age-classes as a result of the different environmental and physiological conditions that individuals encounter over their lifetime. One such trade-off occurs with carotenoids, which must be acquired with food and are involved in a variety of physiological functions. Nonetheless, relationships between immunity and carotenoids in species where these micronutrients are scarce due to diet are poorly studied. Among birds, vultures show the lowest concentrations of plasma carotenoids due to a diet based on carrion. Here, we investigated variations in the relationships between innate immunity (hemagglutination by natural antibodies and hemolysis by complement proteins), pathogen infection and plasma carotenoids in nestling and adult griffon vultures (Gyps fulvus) in the wild. Nestlings showed lower hemolysis, higher total carotenoid concentration and higher pathogen infection than adults. Hemolysis was negatively related to carotenoid concentration only in nestlings. A differential carotenoid allocation to immunity due to the incomplete development of the immune system of nestlings compared with adults is suggested linked to, or regardless of, potential differences in parasite infection, which requires experimental testing. We also found that individuals with more severe pathogen infections showed lower hemagglutination than those with a lower intensity infection irrespective of their age and carotenoid level. These results are consistent with the idea that intraspecific relationships between innate immunity and carotenoids may change across ontogeny, even in species lacking carotenoid-based coloration. Thus, even low concentrations of plasma carotenoids due to a scavenger diet can be essential to the development and activation of the immune system in growing birds.
African Journals Online (AJOL)
Poisoning of seventeen Eurasian Griffons by carbofuran on the Island of Rab, Croatia, in December 2004 · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Gordana Pavokovic, Goran Susic, 24-25. http://dx.doi.org/10.4314/vulnew.v53i1.37632 ...
Vulture populations in Pakistan and the Gyps Vulture Restoration ...
African Journals Online (AJOL)
near 50%, suggesting that extinction, at least across most of the range for these. March 2008 ... (approximately 90 km north-west of. Multan), were extinct by the 2003/2004 breeding season. .... Worldwide: Proceedings of the VI World Conference on Birds of Prey and Owls,. Budapest, Hungary, 18-23 May 2003. Chancellor ...
DEFF Research Database (Denmark)
Rudling, E. H.; Schlamowitz, Sarah; Pipper, Christian Bressen
2016-01-01
INTRODUCTION: To investigate the prevalence and amplitudes of the electrocardiographic J wave in the Petit Basset Griffon Vendéen compared to 10 other dog breeds. ANIMALS: Electrocardiograms from 206 healthy dogs representing 11 dog breeds were included in the study. Besides Petit Basset Griffon...
Assessing the impact on birds of prey of nine established wind farms in Thrace, NE Greece
Energy Technology Data Exchange (ETDEWEB)
Kret, Elzbieta; Carcamo, Beatriz; Zografou, Christina; Vasilakis, Dimitris
2011-07-01
Full text: In this study, we evaluate the impact on birds of prey of nine already established wind farms in Thrace, where a large scale wind farm development project of at least 930 MW is under development. Moreover, the area is acknowledged as of high ornithological interest, used for nesting, wintering and passage by rare territorial birds of prey, including the Near Threatened black vultures that use it for foraging. Finally, ca 50% of the wind farm development project area is covered by Natura 2000 sites. During the monitoring (2008-2010), carcass surveys were carried out in order to estimate mortality. In addition, avian space use surveys were carried out, in order to calculate indexes and to establish comparisons with a previous monitoring study run in 2004-05. In total, 14 birds of prey were found dead (one black vulture, four griffon vultures, one booted eagle, two short-toed eagles, one western marsh harrier, one Eurasian sparrow hawk, three common buzzards, one hawk species). The estimated mortality rate was 0.152 birds of prey (including vultures/turbine/year). Griffon vultures, black vultures and common buzzards comprised more than 50% of observations in the study area. Crossing densities between wind turbines were positively correlated with east exposition and the inclination of the slope, and the length of the wind turbines. gaps, while it was negatively correlated with north exposition. The use of the area was more intensive four years after the initial monitoring, but numbers of common buzzard observations drastically decreased. We suggest that during the planning phase of wind farms it is important to avoid steep slopes, east expositions and to take into account the distance between consecutive wind turbines. Our findings indicate that running a post-construction monitoring during only one year may not be enough to properly assess the impact of wind farms on birds of prey. (Author)
Confirmed organophosphorus and carbamate pesticide poisonings in South African wildlife (2009–2014
Directory of Open Access Journals (Sweden)
Christo J. Botha
2015-12-01
Full Text Available During a six-year period (from January 2009 to December 2014, specimens collected from 344 cases of suspected organophosphorus and carbamate pesticide poisonings in wildlife, including birds, were submitted to the Toxicology Laboratory (ARC-OVI for analysis. A positive diagnosis was made in 135 (39% of these cases. The majority of cases were from birds, which included Cape vultures (Gyps coprotheres and African white-backed vultures (Gyps africanus and bateleur eagles (Terathopius ecaudatus. In one incident 49 vultures were killed when a farmer intentionally laced carcasses with carbofuran in an attempt to control jackal predation. There were 22 incidents of poisoning in helmeted guineafowl (Numida meleagris. On nine different occasions blue cranes (Anthropoides paradiseus were poisoned, in one incident 14 birds were reported to have been killed. Over the period of investigation, there were 20 cases of poisoning involving mammalian species, the majority being vervet monkeys (Chlorocebus pygerythrus. The carbamate pesticides were responsible for 57 incidents of poisoning. Aldicarb, carbofuran and methomyl were detected in 26, 18 and 12 cases respectively. The majority of organophosphorus pesticide poisonings were caused by diazinon (n = 19, monocrotophos (n = 13 and methamidophos (n = 10.
Removal (and attempted removal) of material from a Hooded Vulture ...
African Journals Online (AJOL)
Relatively little is documented about nest material theft in vultures. We used camera traps to monitor Hooded Vulture Necrosyrtes monachus nests for a year. We report camera trap photographs of a starling Lamprotornis sp. removing what appeared to be dung from an inactive Hooded Vulture nest on Cleveland Game ...
Collision vulnerability of vultures at established windfarms
African Journals Online (AJOL)
Campbell Murn
Acquisition (SCADA) systems. (Davenport et al. 2011) as well as the strategic positioning of vulture restaurants to draw vultures away from these areas (Martin et al. 2012). Acknowledgements. An unknown reviewer is thanked for comments on a previous draft of this note. References. Baidya Roy, S., Pacala, S.W. & Walko, ...
VULTURE SNIPPETS FROM AROUND THE WORLD
African Journals Online (AJOL)
2007-03-01
Mar 1, 2007 ... bird-watchers, we made a list of all the bird species seen .... on the vehicle contains a very good image of a Cape Griffon, ..... gets into an engine, it will destroy it, the motor will stop ... benches and a shelf for binoculars, books.
Significant population of Egyptian Vulture Neophron percnopterus ...
African Journals Online (AJOL)
The Egyptian Vulture Neophron percnopterus population in Morocco has undergone a marked decline since the 1980s to the point of nearing local extinction in the twenty-first century. A field study of some possible sites for Egyptian Vultures was carried out over six days during June 2014 in the Middle Atlas Mountains, ...
Quantitative analysis of Chiari-like malformation and syringomyelia in the Griffon Bruxellois dog.
Directory of Open Access Journals (Sweden)
Susan P Knowler
Full Text Available This study aimed to develop a system of quantitative analysis of canine Chiari-like malformation and syringomyelia on variable quality MRI. We made a series of measurements from magnetic resonance DICOM images from Griffon Bruxellois dogs with and without Chiari-like malformation and syringomyelia and identified several significant variables. We found that in the Griffon Bruxellois dog, Chiari-like malformation is characterized by an apparent shortening of the entire cranial base and possibly by increased proximity of the atlas to the occiput. As a compensatory change, there appears to be an increased height of the rostral cranial cavity with lengthening of the dorsal cranial vault and considerable reorganization of the brain parenchyma including ventral deviation of the olfactory bulbs and rostral invagination of the cerebellum under the occipital lobes.
Observations on the population and breeding status of the African ...
African Journals Online (AJOL)
The breeding success of the nests of 60 African White-backed Vultures Gyps africanus, nine Black-chested Snake Eagles Circaetus pectoralis and 12 Secretarybirds Sagittarius serpentarius was monitored for three years, during a seven-year population dynamics study on raptors in the Kgalagadi Transfrontier Park (KTP).
Chung, Oksung; Jin, Seondeok; Cho, Yun Sung; Lim, Jeongheui; Kim, Hyunho; Jho, Sungwoong; Kim, Hak-Min; Jun, JeHoon; Lee, HyeJin; Chon, Alvin; Ko, Junsu; Edwards, Jeremy; Weber, Jessica A; Han, Kyudong; O'Brien, Stephen J; Manica, Andrea; Bhak, Jong; Paek, Woon Kee
2015-10-21
The cinereous vulture, Aegypius monachus, is the largest bird of prey and plays a key role in the ecosystem by removing carcasses, thus preventing the spread of diseases. Its feeding habits force it to cope with constant exposure to pathogens, making this species an interesting target for discovering functionally selected genetic variants. Furthermore, the presence of two independently evolved vulture groups, Old World and New World vultures, provides a natural experiment in which to investigate convergent evolution due to obligate scavenging. We sequenced the genome of a cinereous vulture, and mapped it to the bald eagle reference genome, a close relative with a divergence time of 18 million years. By comparing the cinereous vulture to other avian genomes, we find positively selected genetic variations in this species associated with respiration, likely linked to their ability of immune defense responses and gastric acid secretion, consistent with their ability to digest carcasses. Comparisons between the Old World and New World vulture groups suggest convergent gene evolution. We assemble the cinereous vulture blood transcriptome from a second individual, and annotate genes. Finally, we infer the demographic history of the cinereous vulture which shows marked fluctuations in effective population size during the late Pleistocene. We present the first genome and transcriptome analyses of the cinereous vulture compared to other avian genomes and transcriptomes, revealing genetic signatures of dietary and environmental adaptations accompanied by possible convergent evolution between the Old World and New World vultures.
Vulture worries stalk activists on Uttarayan | Anon | Vulture News
African Journals Online (AJOL)
Vulture News. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 56 (2007) >. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Download this PDF file. The PDF file you selected should load here if your Web ...
Vulture worries stalk activists on Uttarayan | Anon | Vulture News
African Journals Online (AJOL)
No Abstract. Vulture News Vol. 56 () 2007: pp.103-103. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms ...
Mighty vulture back from near extinction | Nickerson | Vulture News
African Journals Online (AJOL)
No Abstract. Vulture News Vol. 56 () 2007: pp.104-105. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms ...
Vulture significance in Ogoni Culture | Saale | AFRREV LALIGENS ...
African Journals Online (AJOL)
This study explained the spiritual and social significance of vulture in Ogoni culture. It also explained how the use of vulture to refer to human beings and its characteristics became sources of social relations and conflicts in Ogoni culture. It adopted both the anthropological and sociological approaches. Findings from the ...
Some statistics from the 2012 Lappet-faced Vulture chick ringing in ...
African Journals Online (AJOL)
Campbell Murn
The long and the short of it: Some statistics from the 2012. Lappet-faced Vulture chick ringing in the Namib. Holger Kolberg1 and Peter Bridgeford2. Vultures Namibia, P.O. Box 3699, Walvis Bay, Namibia. 1 email: holgerk@mweb.com.na, 2 email: pmbridge@iway.na. Vultures Namibia once again ringed. Lappet-faced.
Visitors to nests of Hooded Vultures Necrosyrtes monachus in ...
African Journals Online (AJOL)
We recommend expanding the Hooded Vulture nest monitoring programme to include more pairs. Keywords: Alopochen aegyptiaca, Chacma Baboon, Egyptian Goose, Hooded Vulture, Kruger-to-Canyons Biosphere Region, Martial Eagle, Necrosyrtes monachus, nest visitors, Papio ursinus, Polemaetus bellicosus ...
Comoé National Park – a refuge for critically endangered vulture ...
African Journals Online (AJOL)
Campbell Murn
vulture nests to assess the status of the different species in the south- west of the park;. 2. To capture two White- headed Vultures or White-backed. Vultures to equip them with satellite tags;. 3. To introduce the project to the park-authorities of the Office. Ivorien des Parcs et Reserves. (OIPR), to the Deutsche Gesellschaft.
Fluhr, Julie; Horvitz, Nir; Sarrazin, François; Hatzofe, Ohad
2016-01-01
Natural selection theory suggests that mobile animals trade off time, energy and risk costs with food, safety and other pay-offs obtained by movement. We examined how birds make movement decisions by integrating aspects of flight biomechanics, movement ecology and behaviour in a hierarchical framework investigating flight track variation across several spatio-temporal scales. Using extensive global positioning system and accelerometer data from Eurasian griffon vultures (Gyps fulvus) in Israel and France, we examined soaring–gliding decision-making by comparing inbound versus outbound flights (to or from a central roost, respectively), and these (and other) home-range foraging movements (up to 300 km) versus long-range movements (longer than 300 km). We found that long-range movements and inbound flights have similar features compared with their counterparts: individuals reduced journey time by performing more efficient soaring–gliding flight, reduced energy expenditure by flapping less and were more risk-prone by gliding more steeply between thermals. Age, breeding status, wind conditions and flight altitude (but not sex) affected time and energy prioritization during flights. We therefore suggest that individuals facing time, energy and risk trade-offs during movements make similar decisions across a broad range of ecological contexts and spatial scales, presumably owing to similarity in the uncertainty about movement outcomes. This article is part of the themed issue ‘Moving in a moving medium: new perspectives on flight’. PMID:27528787
Rare birds of prey observations in Kresna Gorge in Bulgaria
African Journals Online (AJOL)
Campbell Murn
the feeding site and roost in the area in 2013. Passage of birds from Serbia,. Croatia, FYR of Macedonia and. Greece were recorded, as well as a bird tagged in Israel, but most were probably of Balkan origin. There are two peaks of increased presence of exogenous Griffon Vultures in. Kresna Gorge and these are in May-.
Population and breeding success of Red-headed Vulture Sarcogyps ...
African Journals Online (AJOL)
Campbell Murn
the population trends of Red-headed and Egyptian Vultures in Nepal, where this study was undertaken. Large-scale surveys of domestic ungulate carcasses (the principal food source of vultures in South Asia) across India indicate that 10-11% of carcasses are contaminated with diclofenac (Cuthbert et al. 2011b).
Directory of Open Access Journals (Sweden)
Francis Gbogbo
2016-01-01
Full Text Available Despite major declines in the population of vultures around the world, noticeable increases were reported in the populations of Hooded Vultures Necrosyrtes monachus over the past decade in Accra—an important vulture habitat in Ghana. In recent times, however, there is a growing concern that the vulture numbers are decreasing even though scientific data to support this is nonexisting. As a vital zoogeographical and conservation tool, it is important to keep an up-to-date knowledge about urban bird populations amidst rapid urbanization and associated changes. Using a combination of field data, literature review, and stakeholder consultations, it was indicative that severe decline might have indeed occurred in the populations of Hooded Vultures in Accra. Evidence suggests the killing of vultures for consumption, traditional medicine, and black magic in an undercover trade with possible transboundary connections as important underlying factor. Additional factors suspected to underlie the declines include changes in management of urban facilities and destruction of roosting and nesting trees. The implications of interspecific competition with Pied Crows Corvus albus on Hooded Vultures however remain unclear. There is an urgent need for conservation campaign and education to save the Hooded Vulture in Ghana.
African Journals Online (AJOL)
van Stuyvenberg, Karen. Vol 66 (2014) - Articles Monitoring White-backed Vultures Gyps africanus in the North West Province (Stellaland), South Africa Abstract PDF. ISSN: 1606-7479. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's ...
Vultures have flown under radar Population boom inspires scientists ...
African Journals Online (AJOL)
2007-03-02
Mar 2, 2007 ... Page 1 ... age structure is.” USDA researchers are fitting 16 vultures with satellite transmitters this month to document movements and behavioural patterns of vultures near the Marine Corps Air. Station in Beaufort, S.C. The project will ... emergency landing at Merritt Island. Airport. “You're always constantly ...
African Journals Online (AJOL)
ZeldaH
in the Ganab area of the Namib-Naukluft. Park, Namibia, we came across an unusual occurrence: When we reached the chick in the nest, we found honeybees Apis mellifera, crowded over and covering the eyes of the young vulture. The Namib-Naukluft Park (NNP),. 49,785 km², is the largest conservation area in Namibia ...
Observations of White-backed Vultures eating plant material in ...
African Journals Online (AJOL)
campbell
small quantities of the green leaves and eagerly feed on dried leaves after the first winter frost without obvious negative effects (H. Stehn, pers. obs.). On being informed of the incident, NT was intrigued, as he had never heard of vultures eating plant material and as White-backed. Vultures eat primarily soft body parts and do ...
Movement ecology of migration in turkey vultures.
Mandel, J T; Bildstein, K L; Bohrer, G; Winkler, D W
2008-12-09
We develop individual-based movement ecology models (MEM) to explore turkey vulture (Cathartes aura) migration decisions at both hourly and daily scales. Vulture movements in 10 migration events were recorded with satellite-reporting GPS sensors, and flight behavior was observed visually, aided by on-the-ground VHF radio-tracking. We used the North American Regional Reanalysis dataset to obtain values for wind speed, turbulent kinetic energy (TKE), and cloud height and used a digital elevation model for a measure of terrain ruggedness. A turkey vulture fitted with a heart-rate logger during 124 h of flight during 38 contiguous days showed only a small increase in mean heart rate as distance traveled per day increased, which suggests that, unlike flapping, soaring flight does not lead to greatly increased metabolic costs. Data from 10 migrations for 724 hourly segments and 152 daily segments showed that vultures depended heavily upon high levels of TKE in the atmospheric boundary layer to increase flight distances and maintain preferred bearings at both hourly and daily scales. We suggest how the MEM can be extended to other spatial and temporal scales of avian migration. Our success in relating model-derived atmospheric variables to migration indicates the potential of using regional reanalysis data, as here, and potentially other regional, higher-resolution, atmospheric models in predicting changing movement patterns of soaring birds under various scenarios of climate and land use change.
The impact of traditional use on vultures in South Africa
African Journals Online (AJOL)
Campbell Murn
are betting and gambling, for improved business success, and intelligence in school children. Vulture is ... some 59,000 consumption events of vulture pieces. The total ... spirits (Berglund 1976). For this ... plants and animals to earn a living .... relationship with traders / Traditional. Healers at ..... through enhanced policy and.
African Journals Online (AJOL)
The impact of urbanization and agricultural development on vultures in El Salvador · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Michael O'Neal Campbell, 16-28 ...
Directory of Open Access Journals (Sweden)
Corinne J Kendall
Full Text Available The ongoing global decline in vulture populations raises major conservation concerns, but little is known about the factors that mediate scavenger habitat use, in particular the importance of abundance of live prey versus prey mortality. We test this using data from the Serengeti-Mara ecosystem in East Africa. The two hypotheses that prey abundance or prey mortality are the main drivers of vulture habitat use provide alternative predictions. If vultures select areas based only on prey abundance, we expect tracked vultures to remain close to herds of migratory wildebeest regardless of season. However, if vultures select areas where mortality rates are greatest then we expect vultures to select the driest regions, where animals are more likely to die of starvation, and to be attracted to migratory wildebeest only during the dry season when wildebeest mortality is greatest. We used data from GSM-GPS transmitters to assess the relationship between three vulture species and migratory wildebeest in the Mara-Serengeti ecosystem. Results indicate that vultures preferentially cluster around migratory herds only during the dry season, when herds experience their highest mortality. Additionally during the wet season, Ruppell's and Lappet-faced vultures select relatively dry areas, based on Normalized Difference Vegetation Index, whereas White-backed vultures preferred wetter areas during the wet season. Differences in habitat use among species may mediate coexistence in this scavenger guild. In general, our results suggest that prey abundance is not the primary driver of avian scavenger habitat use. The apparent reliance of vultures on non-migratory ungulates during the wet season has important conservation implications for vultures in light of on-going declines in non-migratory ungulate species and use of poisons in unprotected areas.
Coprophagy of African Wild Dog faeces by Hooded Vultures in ...
African Journals Online (AJOL)
Campbell Murn
Coprophagy by vertebrates is rare, especially among birds and species that consume the faeces of other species (Soave & Brand 1991,. Hirakawa 2001, Shimada 2012). While New World Vultures practice coprophagy (Del Hoyo et al. 1994,. Buckley 1999, Blanco et al. 2013), the only Old World vulture we could find that ...
Natural mortality factors for African White-backed Vultures in Namibia?
African Journals Online (AJOL)
2007-09-02
Sep 2, 2007 ... September 2007. Vulture News 57. 63. Figure 2. Lightning damage to the bark of the above camel thorn tree (photographer: Ann Scott). Figure 1. Carcass of an African White-backed Vulture below a nest in a camel thorn tree in the Kalahari Desert, Namibia (photographer: Ann Scott).
Natural mortality factors for African White-backed Vultures in Namibia?
African Journals Online (AJOL)
Natural mortality factors for African White-backed Vultures in Namibia? A Scott, M Scott, P Bridgeford, M Bridgeford. Abstract. No Abstract. Vulture News Vol. 57 2007: pp. 62-64. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online.
African Journals Online (AJOL)
Radio-satelllite telemetry of a territorial bearded vulture Gypaetus barbatus in the Caucasus · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A Gavashelishvili, MJ McGrady, 4-13 ...
Vulture News 71 November 2016 61 The Editor The Hindu Daily ...
African Journals Online (AJOL)
Campbell Murn
2016-11-17
Nov 17, 2016 ... governments, Non-Governmental Organizations and researchers to rescue vulture populations from the brink of extinction. Vultures play a very important role in ecosystems and biodiversity conservation by scavenging on dead animals thereby protecting humans from potentially lethal zoonotic diseases.
Cinereous Vulture Nesting Ecology in Ikh Nartyn Chuluu Nature Reserve, Mongolia
Directory of Open Access Journals (Sweden)
Richard P. Reading
2005-06-01
Full Text Available Cinereous vultures ( Aegypius monachus are the largest raptors in Eurasia. Little is known about the species, especially in Mongolia. We studied the nesting ecology of cinereous vultures in Ikh Nartyn Chuluu Nature Reserve, Dornogobi Aimag. To assess reproductive success, we located active nests and periodically checked to determine if they remained active. We measured nest sizes and, periodically, nestling sizes and weights. We located 42 active cinereous vulture nests (27 on rocks and 15 on trees in 2003 and 19 nests (14 on rocks and 5 on trees in 2004. Mean volume of active nests was 3.92 ± 0.39 m 3 ( n = 36. Most nests failed prior to egg hatching, but after hatching nesting success rates increased dramatically. Following hatching, cinereous vulture chicks grew linearly until leveling off just prior to fledging. We generated growth curves for chicks that allowed us to determine the average size of chicks on specific dates. Improving the prospects for successful cinereous vulture conservation likely requires a better understanding of nesting ecology. As such, we plan to improve the quality of our data by monitoring nests more intensively to determine incubation and fledging lengths, as well as causes of nest failures.
The treatment implementation advisor: a component of the GypsES project
Michael C. Saunders; Michael A. Foster
1991-01-01
The treatment implementation advisor is one of the knowledge based advisory modules of GypsES, a knowledge system environment for decision support in gypsy moth management. Its function is to provide detailed advice on intervention tactics for gypsy moth: e.g. aerial and ground application of insecticides and microbials, inundative or augmentative releases of...
African Journals Online (AJOL)
2006-09-02
Sep 2, 2006 ... this predatory behaviour had a profound impact on chick mortality rates. Even after the chicks fledged and began flying around the pan, the vultures persisted with predation. In earlyMay many of the juvenile birds had already joined the adult population in the remaining waters in the northern section of Sua ...
African Journals Online (AJOL)
2006-09-02
Sep 2, 2006 ... trapping expedition* to Chhep district,. Preah Vihear province ... Our trap had been baited the previous evening with a young cow, and within two hours of sunrise had attracted a mixed flock of 54 vultures. The birds strung themselves out in the trees above the bait ... patterns and to locate nest locations. As.
African Journals Online (AJOL)
Scavenging and predation by Black Vultures Coragyps atratus at a South American sea lion breeding colony · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. HJ Pavés, RP Schlatter, CI Espinoza, 4-15 ...
Lisney, Thomas J; Stecyk, Karyn; Kolominsky, Jeffrey; Graves, Gary R; Wylie, Douglas R; Iwaniuk, Andrew N
2013-12-01
Vultures are highly reliant on their sensory systems for the rapid detection and localization of carrion before other scavengers can exploit the resource. In this study, we compared eye morphology and retinal topography in two species of New World vultures (Cathartidae), turkey vultures (Cathartes aura), with a highly developed olfactory sense, and black vultures (Coragyps atratus), with a less developed sense of olfaction. We found that eye size relative to body mass was the same in both species, but that black vultures have larger corneas relative to eye size than turkey vultures. However, the overall retinal topography, the total number of cells in the retinal ganglion cell layer, peak and average cell densities, cell soma area frequency distributions, and the theoretical peak anatomical spatial resolving power were the same in both species. This suggests that the visual systems of these two species are similar and that vision plays an equally important role in the biology of both species, despite the apparently greater reliance on olfaction for finding carrion in turkey vultures. Copyright © 2013 Wiley Periodicals, Inc.
DEFF Research Database (Denmark)
Lisney, Thomas J.; Stecyk, Karyn; Kolominsky, Jeffrey
2013-01-01
Vultures are highly reliant on their sensory systems for the rapid detection and localization of carrion before other scavengers can exploit the resource. In this study, we compared eye morphology and retinal topography in two species of New World vultures (Cathartidae), turkey vultures (Cathartes...... aura), with a highly developed olfactory sense, and black vultures (Coragyps atratus), with a less developed sense of olfaction. We found that eye size relative to body mass was the same in both species, but that black vultures have larger corneas relative to eye size than turkey vultures. However......, the overall retinal topography, the total number of cells in the retinal ganglion cell layer, peak and average cell densities, cell soma area frequency distributions, and the theoretical peak anatomical spatial resolving power were the same in both species. This suggests that the visual systems of these two...
African Journals Online (AJOL)
second count of vultures at carcasses in Uganda, and a revised proposal for a standardised method · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. D Pomeroy, A Byaruhangab, G Kaphu, M Opige, M Masiko, B Lutuk, 15-21 ...
SOVEREIGN DEBT RESTRUCTURING AND “VULTURE FUNDS”
Directory of Open Access Journals (Sweden)
Emilia Cornelia STOICA
2016-06-01
Full Text Available Defining sovereign debt - debt issued or guaranteed by a public entity: central and / or regional public authorities, central banks, public institutions or enterprises - must include the risks that its management may generate, mainly the risk of default. If an medium period of time - 3-5 years – the macroeconomic growth of a state, and as the result the increase of the public revenues constantly lies below the growth of sovereign debt, these will cause an insolvability risk to cover it, and that state should proceed to restructure its debt. Financial stability of public authorities and sovereign debt occurred since the beginning of the creation of democratic states, and instruments for debt restructuring have been continuously adapted to economic and social conjuncture. Initially, states faced a necessity of funding were borrowed from foreign governments and / or large consortia bank, and when their debts had to be restructured it has been created the international institutional framework to negotiate between debtor countries and public creditors - Paris Club - and to coordinate negotiations between public authorities and major debtor consortia - London Club. In the last decade 'vulture funds' occurred, which are hedge funds acquiring from the secondary financial market debt the securities, including public debt, to a much lower share nominal value. Subsequently, vulture funds claim states issuing debt repayment at values close or equal to the face value - in this way can make a profit of more than 100% of the financial investment they made it on the secondary market. If these countries do not comply, generally being unable to honor their public debt, vultures funds act the countries in international courts, which usually prevails because vultures funds’ action is legal under current conditions.
Directory of Open Access Journals (Sweden)
Oscar Cabezón
Full Text Available Toxoplasma gondii is a zoonotic intracellular protozoan parasite of worldwide distribution that infects many species of warm-blooded animals, including birds. To date, there is scant information about the seropositivity of T. gondii and the risk factors associated with T. gondii infection in wild bird populations. In the present study, T. gondii infection was evaluated on sera obtained from 1079 wild birds belonging to 56 species (including Falconiformes (n=610, Strigiformes (n=260, Ciconiiformes (n=156, Gruiformes (n=21, and other orders (n=32, from different areas of Spain. Antibodies to T. gondii (modified agglutination test, MAT titer ≥1:25 were found in 282 (26.1%, IC(95%:23.5-28.7 of the 1079 birds. This study constitute the first extensive survey in wild birds species in Spain and reports for the first time T. gondii antibodies in the griffon vulture (Gyps fulvus, short-toed snake-eagle (Circaetus gallicus, Bonelli's eagle (Aquila fasciata, golden eagle (Aquila chrysaetos, bearded vulture (Gypaetus barbatus, osprey (Pandion haliaetus, Montagu's harrier (Circus pygargus, Western marsh-harrier (Circus aeruginosus, peregrine falcon (Falco peregrinus, long-eared owl (Asio otus, common scops owl (Otus scops, Eurasian spoonbill (Platalea leucorodia, white stork (Ciconia ciconia, grey heron (Ardea cinerea, common moorhen (Gallinula chloropus; in the International Union for Conservation of Nature (IUCN "vulnerable" Spanish imperial eagle (Aquila adalberti, lesser kestrel (Falco naumanni and great bustard (Otis tarda; and in the IUCN "near threatened" red kite (Milvus milvus. The highest seropositivity by species was observed in the Eurasian eagle owl (Bubo bubo (68.1%, 98 of 144. The main risk factors associated with T. gondii seropositivity in wild birds were age and diet, with the highest exposure in older animals and in carnivorous wild birds. The results showed that T. gondii infection is widespread and can be at a high level in many wild
The impact of traditional use on vultures in South Africa | McKean ...
African Journals Online (AJOL)
The main drivers of demand for these uses are betting and gambling, for improved business success, and intelligence in school children. Vulture is also prescribed by traditional healers for various ailments, including headaches. It is estimated that 160 vultures are sold per annum in eastern South Africa, with some 59,000 ...
Effects of habitat and time of day on flock size of Turkey Vultures in Cuba (Cathartes aura
Directory of Open Access Journals (Sweden)
Piotr Tryjanowski
2018-01-01
Full Text Available In agricultural landscapes, the Turkey Vulture Cathartes aura feeds mainly on carcases of domestic animals. In spring 2017, data on 214 flocks of Turkey vultures were collected in a road survey in Cuba (in total 2384 km. Turkey Vultures were found to be common accross Cuba, but flock size varied between habitats, reaching a maximum of 43 in valleys and 31 in agricultural landscapes with domestic animal farms. Vultures were active throughout the day, but the time of day did not significantly affect flock size. This study corroborates previous studies which suggested that carrion resources located in agricultural habitats and river valleys is crucial for the continued survival of this still abundant species. Changes in Cuba’s socio-political system in the near future will likely impact agricultural practices, and this in turn will likely affect Turkey Vultures. Our study may serve as a baseline against which future population changes and flocking behaviour of Turkey Vultures can be compared.
Lead and arsenic in bones of birds of prey from Spain
Energy Technology Data Exchange (ETDEWEB)
Mateo, R.; Taggart, M.; Meharg, A.A
2003-11-01
Raptors feeding on species targeted by hunters in upland habitats suffer from lead poisoning. - The bones (humerus and/or femur) of 229 birds of prey from 11 species were analyzed for Pb and As to evaluate their exposure to Pb shot. The species with the highest mean Pb levels were red kite (Milvus milvus) and Eurasian griffon (Gyps fulvus), and the species with the lowest levels were Eurasian buzzard (Buteo buteo) and booted eagle (Hieraaetus pennatus). Red kite also had the highest mean As level, an element present in small amounts in Pb shot. Elevated bone Pb concentrations (>10 {mu}g/g dry weight) were found in 10 birds from six species. Clinical signs compatible with lethal Pb poisoning and/or excessive bone Pb concentrations (>20 {mu}g/g) were observed in one Eurasian eagle-owl (Bubo bubo), one red kite, and one Eurasian griffon. Pb poisoning has been diagnosed in eight upland raptor species in Spain to date.
Lead and arsenic in bones of birds of prey from Spain
International Nuclear Information System (INIS)
Mateo, R.; Taggart, M.; Meharg, A.A.
2003-01-01
Raptors feeding on species targeted by hunters in upland habitats suffer from lead poisoning. - The bones (humerus and/or femur) of 229 birds of prey from 11 species were analyzed for Pb and As to evaluate their exposure to Pb shot. The species with the highest mean Pb levels were red kite (Milvus milvus) and Eurasian griffon (Gyps fulvus), and the species with the lowest levels were Eurasian buzzard (Buteo buteo) and booted eagle (Hieraaetus pennatus). Red kite also had the highest mean As level, an element present in small amounts in Pb shot. Elevated bone Pb concentrations (>10 μg/g dry weight) were found in 10 birds from six species. Clinical signs compatible with lethal Pb poisoning and/or excessive bone Pb concentrations (>20 μg/g) were observed in one Eurasian eagle-owl (Bubo bubo), one red kite, and one Eurasian griffon. Pb poisoning has been diagnosed in eight upland raptor species in Spain to date
Vulture numbers are cut to the bone Extinction fears for a scavenger ...
African Journals Online (AJOL)
2007-03-01
Mar 1, 2007 ... gives them the gift to see the future. – are eating vulture meat to acquire the power of clairvoyance. ... Asia over the past five years, the use of the painkiller diclofenac in cattle has wiped out three species ... need for vulture flesh to satisfy markets for traditional medicines, their links with clairvoyance, hunting ...
Nandankanan zoo to house vultures
African Journals Online (AJOL)
of epidemics by eating the carcasses before they rot and are known to feed on rotting flesh without any adverse effect on them. The Indian White-backed. Vulture in 1992 number was more than 100 times than the 2003 number. Although they hang out in smelly places and eat carcasses, research shows that if given a choice ...
Chick success for Asian vultures
African Journals Online (AJOL)
2007-03-02
Mar 2, 2007 ... of international zoo programmes, said the society had been heavily involved in the centre since the late 1990s. “It was established with a UK government ... about the extinction of the vultures,” he warned. “The communities that use this drug can be remote; cattle are literally found in their millions and people ...
Lead toxicosis of captive vultures: case description and responses to chelation therapy
2013-01-01
Background Lead, a serious threat for raptors, can hamper the success of their conservation. This study reports on experience with accidental lead intoxication and responses to chelation therapy in captive Cinereous (Aegypius monachus) and Egyptian (Neophron percnopterus) Vultures. Results Soil contamination by lead-based paint sanded off the steel aviary resulted in poisoning of eight Cinereous and two Egyptian Vultures. A male Egyptian Vulture developed signs of apathy, polydipsia, polyuria, regurgitation, and stupor, and died on the next day. Liver, kidney and blood lead concentrations were 12.2, 8.16 and 2.66 μg/g, respectively. Laboratory analyses confirmed severe liver and kidney damage and anaemia. Blood Pb levels of Pb-exposed Cinereous Vultures were 1.571 ± 0.510 μg/g shortly after intoxication, decreased to 0.530 ± 0.165 μg/g without any therapy in a month and to 0.254 ± 0.097 μg/g one month after CaNa2EDTA administration. Eight months later, blood lead levels decreased to close to the background of the control group. Blood parameters of healthy Pb-non-exposed Cinereous Vultures were compared with those of the exposed group prior to and after chelation therapy. Iron levels in the lead-exposed pre-treatment birds significantly decreased after chelation. Haematocrit levels in Pb-exposed birds were significantly lower than those of the controls and improved one month after chelation. Creatine kinase was higher in pre-treatment birds than in the controls but normalised after therapy. Alkaline phosphatase increased after chelation. A marked increase in the level of lipid peroxidation measured as thiobarbituric acid reactive species was demonstrated in birds both prior to and after chelation. The ferric reducing antioxidant power was significantly lower in pre-treatment vultures and returned to normal following chelation therapy. Blood metallothionein levels in lead-exposed birds were higher than in controls. Reduced glutathione dropped after
Lead toxicosis of captive vultures: case description and responses to chelation therapy.
Pikula, Jiri; Hajkova, Pavlina; Bandouchova, Hana; Bednarova, Ivana; Adam, Vojtech; Beklova, Miroslava; Kral, Jiri; Ondracek, Karel; Osickova, Jitka; Pohanka, Miroslav; Sedlackova, Jana; Skochova, Hana; Sobotka, Jakub; Treml, Frantisek; Kizek, Rene
2013-01-16
Lead, a serious threat for raptors, can hamper the success of their conservation. This study reports on experience with accidental lead intoxication and responses to chelation therapy in captive Cinereous (Aegypius monachus) and Egyptian (Neophron percnopterus) Vultures. Soil contamination by lead-based paint sanded off the steel aviary resulted in poisoning of eight Cinereous and two Egyptian Vultures. A male Egyptian Vulture developed signs of apathy, polydipsia, polyuria, regurgitation, and stupor, and died on the next day. Liver, kidney and blood lead concentrations were 12.2, 8.16 and 2.66 μg/g, respectively. Laboratory analyses confirmed severe liver and kidney damage and anaemia. Blood Pb levels of Pb-exposed Cinereous Vultures were 1.571 ± 0.510 μg/g shortly after intoxication, decreased to 0.530 ± 0.165 μg/g without any therapy in a month and to 0.254 ± 0.097 μg/g one month after CaNa(2)EDTA administration. Eight months later, blood lead levels decreased to close to the background of the control group. Blood parameters of healthy Pb-non-exposed Cinereous Vultures were compared with those of the exposed group prior to and after chelation therapy. Iron levels in the lead-exposed pre-treatment birds significantly decreased after chelation. Haematocrit levels in Pb-exposed birds were significantly lower than those of the controls and improved one month after chelation. Creatine kinase was higher in pre-treatment birds than in the controls but normalised after therapy. Alkaline phosphatase increased after chelation. A marked increase in the level of lipid peroxidation measured as thiobarbituric acid reactive species was demonstrated in birds both prior to and after chelation. The ferric reducing antioxidant power was significantly lower in pre-treatment vultures and returned to normal following chelation therapy. Blood metallothionein levels in lead-exposed birds were higher than in controls. Reduced glutathione dropped after CaNa(2)EDTA therapy, while
DeVault, Travis L.; Blackwell, Bradley F.; Seamans, Thomas W.; Lima, Steven L.; Fernández-Juricic, Esteban
2014-01-01
The avoidance of motorized vehicles is a common challenge for birds in the modern world. Birds appear to rely on antipredator behaviors to avoid vehicles, but modern vehicles (automobiles and aircraft) are faster than natural predators. Thus, birds may be relatively ill-equipped, in terms of sensory capabilities and behaviors, to avoid vehicles. We examined the idea that birds may be unable to accurately assess particularly high speeds of approaching vehicles, which could contribute to miscalculations in avoidance behaviors and ultimately cause collisions. We baited turkey vultures (Cathartes aura) to roads with animal carcasses and measured flight initiation distance and effective time-to-collision in response to a truck driving directly towards vultures from a starting distance of 1.13 km and at one of three speeds: 30, 60, or 90 kph (no vultures were struck). Flight initiation distance of vultures increased by a factor of 1.85 as speed increased from 30 to 90 kph. However, for 90-kph approaches there was no clear trend in flight initiation distance across replicates: birds appeared equally likely to initiate escape behavior at 40 m as at 220 m. Time-to-collision decreased by a factor of 0.62 with approach speeds from 30 to 90 kph. Also, at 90 kph, four vehicle approaches (17%) resulted in near collisions with vultures (time-to-collision ≤1.7 s), compared to none during 60 kph approaches and one during 30 kph approaches (4%). Our findings suggest that antipredator behaviors in turkey vultures, particularly stimulus processing and response, might not be well tuned to vehicles approaching at speeds ≥90 kph. The possible inability of turkey vultures to react appropriately to high-speed vehicles could be common among birds, and might represent an important determinant of bird-vehicle collisions. PMID:24503622
A mass poisoning of White-Backed and Lappet-Faced Vultures in Gonarezhou National Park
Groom, R.J.; Gandiwa, E.; Gandiwa, P.; Westhuizen, H.F.
2013-01-01
In this article we report a mass poisoning of vultures in the Gonarezhou National Park in Zimbabwe. This was one of the largest mass killings of vultures ever recorded and the largest recorded in Zimbabwe. On many of the carcasses the upper beaks were removed, suggesting the involvement of
Homesick vulture moves into retirement village
African Journals Online (AJOL)
2007-03-01
Mar 1, 2007 ... contact him on (031) 785-2981. Raptor. Rescue is based at the newly opened. African Bird of Prey Centre on the Lion. Park road where other vultures and many species of hawks, owls and eagles are on display. This is also where Hoffman's wife, Shannon, and her team, present daily flying demonstrations.
Congregations of wintering Egyptian Vultures Neophron ...
African Journals Online (AJOL)
Nearly half of the birds were adults and the majority roosted on bird-safe types of electric pylons. Most of the Egyptian Vultures were found below 500 m above sea level, in bare areas, open savannas or grasslands, and their abundance was negatively related to the amount of cover of bush vegetation. The distribution of ...
Avian Pox in Turkey Vulture (Cathartes aura)
African Journals Online (AJOL)
Campbell Murn
Vulture Cathartes aura meridionalis was captured for wing-tagging on San. Francisco, Zulia state, Venezuela. (10°32'15"N, -71°38'10"W). Nodular cutaneous lesions were observed on the head (Figure 1A). Sections of the skin were removed and fixed in 10% buffer formalin and submitted to. Laboratorio de. Diagnostico.
Gregory Elmes; Thomas Millette; Charles B. Yuill
1991-01-01
GypsES, a decision-support and expert system for the management of Gypsy Moth addresses five related research problems in a modular, computer-based project. The modules are hazard rating, monitoring, prediction, treatment decision and treatment implementation. One common component is a geographic information system designed to function intelligently. We refer to this...
Observation of a population of Egyptian Vultures Neophron ...
African Journals Online (AJOL)
Campbell Murn
Forest between 2013 and 2014 in Karnataka, southern India. ... could affect other animals and humans (Ogada ... Nepal (Cuthbert et al. .... most people are Hindu and therefore .... Bathing behavior and waterhole importance of white-rumped vulture ... strategies in a flock-living bird: movement and social cohesion of hooded.
Blanco, Guillermo; Junza, Alexandra; Barrón, Dolores
2017-01-01
Pharmaceuticals from veterinary treatments may enter terrestrial food webs when medicated livestock are available to wildlife in supplementary feeding stations aimed at the conservation of endangered scavengers. Here, we hypothesized that the exposure risk to livestock fluoroquinolones, as indicators of pharmaceutical burden in food, is related to the variable reliance of scavengers on domestic versus wild animal carcasses. Since the misuse of broad-spectrum antibiotics is a major predisposing factor for opportunistic mycoses, we evaluated disease signs potentially associated with diet-dependent drug exposure in nestlings of two threatened vultures. A greater occurrence (100%, n=14) and concentration of fluoroquinolones (mean±SD=73.0±27.5µgL -1 , range=33.2-132.7), mostly enrofloxacin, were found in Cinereous vultures, Aegypius monachus, due to their greater dependence on livestock carcasses than Egyptian vultures, Neophron percnopterus (fluoroquinolones occurrence: 44%, n=16, concentration: 37.9±16.6µgL -1 , range=11.5-55.9), which rely much more on carcasses of wild animals (42% of remains vs. 23% in the cinereous vulture). The chaotic, chronic and pulsed ingestion of these drugs throughout nestling development is proposed as one of the most plausible explanations for the high occurrence and intensity of oral Candida-like lesions in nestling vultures. The high occurrence of fluoroquinolone residues and disease hindered the probing of a cause-effect relationship between both factors in individual vultures. This relationship could be evaluated through a population-based approach by sampling vultures not exposed to these drugs. The high dependence of vultures on domestic animals today compared to past decades and the growing intensification of livestock farming, imply an expected increase in the impact of pharmaceuticals on scavenger populations. This requires further evaluation due to potential consequences in biodiversity conservation and environmental health
The vultures at the crossroads of biodiversity, politics, tourism, the ...
African Journals Online (AJOL)
ZeldaH
... (Orabi 2011), or by consuming carcasses of cattle treated ... in the functioning of communities (Choisy. 2003). ... eaten by vultures at small feeding sites operated by ... water supplies can be polluted. The ..... The integrated biogeographic and.
Directory of Open Access Journals (Sweden)
Marcella M. Tagliarini
2011-01-01
Full Text Available Similarities between New World and Old World vultures have been interpreted to reflect a close relationship and to suggest the inclusion of both in Accipitridae (Falconiformes. However, deeper analyses indicated that the placement of the New World vultures (cathartids in this Order is uncertain. Chromosome analysis has shown that cathartids retained a karyotype similar to the putative avian ancestor. In order to verify the occurrence of intrachromosomal rearrangements in cathartids, we hybridized whole chromosome probes of two species (Gallus gallus and Leucopternis albicollis onto metaphases of Cathartes aura. The results showed that not only were the syntenic groups conserved between Gallus and C. aura, but probably also the general gene order, suggesting that New World vultures share chromosomal symplesiomorphies with most bird lineages.
Cape Vulture Gyps coprotheres breeding status in southern Africa ...
African Journals Online (AJOL)
While our data suggests multiple colonies are stable or increasing, the extinction of peripheral colonies and contraction of the species' range is alarming and gives evidence for unsustainable population declines. Monitoring efforts chronicled the extinction of the previously large core colony at Roberts' Farm, which was ...
The impact of urbanization and agricultural development on vultures ...
African Journals Online (AJOL)
Campbell Murn
along an urban to forest gradient (dense downtown areas, suburbs, rural villages and farms ... negatively on many species, including .... landuse, this having more animals ..... behavior of black and turkey vultures: implications for reducing bird– .... Brazil: species richness and abundance and the influence of the survey.
Report on Kwando (Botswana) Vulture poisoning investigation 16 ...
African Journals Online (AJOL)
Campbell Murn
2013-11-16
Nov 16, 2013 ... and only two white-back vulture remains were found. Although no tusks were present, we saw no evidence of chopping of the maxilla on this elephant skull. It is possible that all three carcasses were poisoned, but the majority of the dead birds were found at Carcass 1 and 2. Both carcasses were further ...
HD-GYP domain proteins regulate biofilm formation and virulence in Pseudomonas aeruginosa
DEFF Research Database (Denmark)
Ryan, Robert P.; Lucey, Jean; O'Donovan, Karen
2009-01-01
residues (YN-GYP). Here we have investigated the role of these proteins in biofilm formation, virulence factor synthesis and virulence of P. aeruginosa. Mutation of PA4108 and PA4781 led to an increase in the level of cyclic-di-GMP in P. aeruginosa, consistent with the predicted activity of the encoded......2572 had a negative influence on swarming that was cryptic and was revealed only after removal of an uncharacterized C-terminal domain. Mutation of PA4108, PA4781 and PA2572 had distinct effects on biofilm formation and architecture of P. aeruginosa. All three proteins contributed to virulence of P...
The decline of an urban Hooded Vulture Necrosyrtes monachus ...
African Journals Online (AJOL)
Likely causes are (1) exponential urbanisation resulting in loss of feeding sites and reduced food availability, (2) increased poisoning of feral dogs with strychnine sulphate due to an upsurge of rabies and (3) increased disappearance of suitable trees for nesting and roosting. Keywords: cutting of trees, Hooded Vulture, ...
Non-steroidal Anti-inflammatory Drugs in Raptors
Oaks, J. Lindsay; Meteyer, Carol U.; Miller, R. Eric; Fowler, Murray E.
2012-01-01
The use of analgesia has become standard, and appropriate, practice in avian medicine. As in mammals, pain control in avian patients is usually accomplished with opioids and nonsteroidal anti-inflammatory drugs (NSAIDs) used singly or in combination for a multimodal approach. Despite their usefulness, widespread use, and relative safety in clinical use, few controlled studies in birds have been conducted on efficacy, safety, and dosing. The guidelines for the use of NSAIDs in raptors and other birds have mainly been empirical. More recently, NSAIDs in free-living raptors have emerged as a major conservation issue with the discovery that diclofenac sodium was responsible for the population crash of three species of Gyps vultures in southern Asia. In this context, residues of veterinary NSAIDs in domestic animals are now considered environmental contaminants that can be significantly toxic to vultures and possibly other avian scavengers. Ironically, the disaster with Asian vultures has led to a considerable body of research on NSAIDs in raptors to the benefit of clinicians who now have scientific information available to help assess dosing, safety, toxicity, and pharmacokinetics of NSAIDs in their raptor patients.
Directory of Open Access Journals (Sweden)
Guillermo Blanco
Full Text Available Among birds, vultures show low concentrations of plasma carotenoids due to the combination of their large size, general dull colouration and a diet based on carrion. We recorded the concentration of each carotenoid type present in plasma of the Andean condor (Vultur gryphus according to age and sex, that determine colour signalling and dominance hierarchies in the carcasses. We compared the carotenoid profile in wild condors with that of captive condors fed with a controlled diet of flesh to test the hypothesis that wild individuals could acquire extra carotenoids from vegetal matter contained in carcass viscera and fresh vegetation. Wild American black vultures (Coragyps atratus were also sampled to evaluate the potential influence of colouration in the integument on absorption and accumulation patterns of plasma carotenoids. A remarkably higher concentration of lutein than β-carotene was found in wild condors, while the contrary pattern was recorded in American black vultures and captive condors. We found a consistent decrease in all plasma carotenoids with age, and a lower concentration of most xanthophylls in male compared to female wild condors. Positive correlations of all carotenoids indicated general common absorption and accumulation strategies or a single dietary source containing all pigments found in plasma. The comparatively low total concentration of carotenoids, and especially of lutein rather than β-carotene, found in captive condors fed with a diet restricted to flesh supports the hypothesis that Andean condors can efficiently acquire carotenoids from vegetal matter in the wild. Andean condors seem to be physiologically more competent in the uptake or accumulation of xanthophylls than American black vultures, which agrees with the use of colour-signalling strategies in sexual and competitive contexts in the Andean condor. This study suggests that vultures may use dietary vegetal supplements that provide pigments and
Blanco, Guillermo; Hornero-Méndez, Dámaso; Lambertucci, Sergio A.; Bautista, Luis M.; Wiemeyer, Guillermo; Sanchez-Zapata, José A.; Garrido-Fernández, Juan; Hiraldo, Fernando; Donázar, José A.
2013-01-01
Among birds, vultures show low concentrations of plasma carotenoids due to the combination of their large size, general dull colouration and a diet based on carrion. We recorded the concentration of each carotenoid type present in plasma of the Andean condor (Vultur gryphus) according to age and sex, that determine colour signalling and dominance hierarchies in the carcasses. We compared the carotenoid profile in wild condors with that of captive condors fed with a controlled diet of flesh to test the hypothesis that wild individuals could acquire extra carotenoids from vegetal matter contained in carcass viscera and fresh vegetation. Wild American black vultures (Coragyps atratus) were also sampled to evaluate the potential influence of colouration in the integument on absorption and accumulation patterns of plasma carotenoids. A remarkably higher concentration of lutein than β-carotene was found in wild condors, while the contrary pattern was recorded in American black vultures and captive condors. We found a consistent decrease in all plasma carotenoids with age, and a lower concentration of most xanthophylls in male compared to female wild condors. Positive correlations of all carotenoids indicated general common absorption and accumulation strategies or a single dietary source containing all pigments found in plasma. The comparatively low total concentration of carotenoids, and especially of lutein rather than β-carotene, found in captive condors fed with a diet restricted to flesh supports the hypothesis that Andean condors can efficiently acquire carotenoids from vegetal matter in the wild. Andean condors seem to be physiologically more competent in the uptake or accumulation of xanthophylls than American black vultures, which agrees with the use of colour-signalling strategies in sexual and competitive contexts in the Andean condor. This study suggests that vultures may use dietary vegetal supplements that provide pigments and micronutrients that are
Margalida, Antoni; Villalba, Daniel
2017-08-14
Vultures are central-place foragers and need to optimize their foraging behaviour to offset travel costs by increasing their energy gain. This process is more obvious in certain vulture species that do not feed their young by regurgitation and so must carry food items back to the nest. The Bearded Vulture Gypaetus barbatus is the only species with a bone-diet based. We analysed the chemical composition of bones and the age-related changes in their nutritive value to assess the differences in energy content between bones of differing age, body part and species. We found differences between specific anatomical parts, species and the age of the bones. Fresh bones contain 108% as much energy as fresh meat and, interestingly, dry bones retain 90% of the protein found in fresh bones. Dry femurs weighing 140 g retain enough protein to be comparable to 111 g of fresh meat, in energy terms. Compared to meat-eating species, the specialized osteophagous diet of the Bearded Vulture seems to have certain advantages. A better understanding of nutrient levels in food remains could help to improve theoretical foraging models, assist in conservation management, and even improve our understanding of the use of bones by early hominids.
Traditional medicine trade in vulture parts in northern Nigeria | Saidu ...
African Journals Online (AJOL)
We report findings on the vulture trade in northern Nigeria, where it is commonly practised especially to supply the traditional medicine industry. We administered an open-ended questionnaire to 113 traditional, predominantly Hausa medicinal traders in 39 markets within eight states in northern Nigeria. Of the interviewed ...
Dodge, Somayeh; Bohrer, Gil; Bildstein, Keith; Davidson, Sarah C; Weinzierl, Rolf; Bechard, Marc J; Barber, David; Kays, Roland; Brandes, David; Han, Jiawei; Wikelski, Martin
2014-01-01
Variation is key to the adaptability of species and their ability to survive changes to the Earth's climate and habitats. Plasticity in movement strategies allows a species to better track spatial dynamics of habitat quality. We describe the mechanisms that shape the movement of a long-distance migrant bird (turkey vulture, Cathartes aura) across two continents using satellite tracking coupled with remote-sensing science. Using nearly 10 years of data from 24 satellite-tracked vultures in four distinct populations, we describe an enormous amount of variation in their movement patterns. We related vulture movement to environmental conditions and found important correlations explaining how far they need to move to find food (indexed by the Normalized Difference Vegetation Index) and how fast they can move based on the prevalence of thermals and temperature. We conclude that the extensive variability in the movement ecology of turkey vultures, facilitated by their energetically efficient thermal soaring, suggests that this species is likely to do well across periods of modest climate change. The large scale and sample sizes needed for such analysis in a widespread migrant emphasizes the need for integrated and collaborative efforts to obtain tracking data and for policies, tools and open datasets to encourage such collaborations and data sharing.
Observations on the breeding of Indian long-billed vultures Gyps ...
African Journals Online (AJOL)
Campbell Murn
observed to be abandoned by the birds after 29 days of incubation during December. We also observed mating attempts (n=5) in adult birds during nestling period. Out of 16 chicks, one died at the hatching stage and one died during the fledgling stage, thus only 14 chicks fledged successfully with a success rate of. 82.35%.
Monitoring White-backed Vultures Gyps africanus in the North West ...
African Journals Online (AJOL)
Campbell Murn
Stellaland), South Africa. Dirk, Karen and Stefan van Stuyvenberg. Stellaland Raptor Project. e-mail: stuyvies@telkomsa.net. Introduction. We became involved with the ringing of birds in 2002 and started to ring raptors actively since 2003.
Devil's Claw – a natural substitute for diclofenac? | Mundy | Vulture ...
African Journals Online (AJOL)
Vulture News. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 67, No 2 (2014) >. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Download this PDF file. The PDF file you selected should load here if your ...
Directory of Open Access Journals (Sweden)
Helmut Tributsch
2016-01-01
Full Text Available Since primordial times, vultures have been competing with man for animal carcasses. One of these vultures, the once widespread bearded vulture ( Gypaetus barbatus , has the habit of bathing its polluted feathers and skin in red iron oxide - ochre - tainted water puddles. Why? Primitive man may have tried to find out and may have discovered its advantages. Red ochre, which has accompanied human rituals and everyday life for more than 100,000 years, is not just a simple red paint for decoration or a symbol for blood. As modern experiments demonstrate, it is active in sunlight producing aggressive chemical species. They can kill viruses and bacteria and convert smelly organic substances into volatile neutral carbon dioxide gas. In this way, ochre can in sunlight sterilize and clean the skin to provide health and comfort and make it scentless, a definitive advantage for nomadic meat hunters. This research thus also demonstrates a sanitary reason for the vulture’s habit of bathing in red ochre mud. Prehistoric people have therefore included ochre use into their rituals, especially into those in relation to birth and death. Significant ritual impulses during evolution of man may thus have developed bio-mimetically, inspired from the habits of a vulture. It is discussed how this health strategy could be developed to a modern standard helping to fight antibiotics-resistant bacteria in hospitals.
Bird-strike of a Cinereous Vulture Aegypius monachus in the ...
African Journals Online (AJOL)
Campbell Murn
Bird-strike of a Cinereous Vulture Aegypius monachus in the Balearic Islands, Spain. Alvaro Camiña1* and Joan ... http://dx.doi.org/10.4314/vulnew.v71i1.3. On 15 September 2016 a Lufthansa flight en route from Munich ... nautical miles from runway 24L. Considering the altitude of the area of around 100 meters, the bird ...
An analysis of bones and other materials collected by Cape Vultures ...
African Journals Online (AJOL)
We compared bones and non-faunal items collected by Cape Vultures at the Blouberg and Kransberg colonies. Bones from the base of the nesting cliffs were on average longer than those from the crops and stomachs of birds. Bones from the Blouberg cliff base were on average shorter than those from the Kransberg.
Centre for Cellular and Molecular Biology to breed vultures for Parsis
African Journals Online (AJOL)
Hyderabad – Parsis worried about the growing pile of bodies in their 'Towers of Silence' can take heart. The Centre for Cellular and Molecular Biology. (CCMB) has decided to take up, on an express basis, the job of breeding vultures, which can later be transported to various parts of the country. Though the problem of ...
Berny, Philippe; Vilagines, Lydia; Cugnasse, Jean-Marc; Mastain, Olivier; Chollet, Jean-Yves; Joncour, Guy; Razin, Martine
2015-08-01
A specific surveillance program has been set up to monitor avian scavenger populations in the French Pyrenean Mountains, hosting a high proportion of the French populations. The two main purposes of the study were to identify all causes of death and to investigate poisoning cases. All 170 birds found dead during the 7-year program were submitted to full necropsy, X-Ray, parasitological investigations and consistent analytical toxicology screenings (Cholinesterase inhibitors, anticoagulant rodenticides, organochlorine insecticides, Pb, Cd). Over the study period, 8 Bearded Vultures, 120 Griffon Vultures, 8 Egyptian Vultures and 34 Red kites were eventually collected. Mortality events were often multifactorial, but poisoning was by far the most common cause of death (24.1%), followed by trauma/fall (12%), bacterial diseases and starvation (8%) and electrocution (6%). Illicit use of banned pesticides was identified as a common cause of poisoning (53% of all poisoning cases) and lead poisoning was also identified as a significant toxicant issue (17% of all poisoning cases). Lead isotopic signature could be associated primarily with ammunition. Last, a positive association between trauma and lead contamination was detected, indicating that lead could be a significant contributor to different causes of death. These results urge for severe restrictions on the use of lead ammunition to prevent scavengers from detrimental exposure. Copyright © 2015 Elsevier Inc. All rights reserved.
The normal electrocardiogram of four species of conscious raptors.
Talavera, J; Guzmán, M J; del Palacio, M J Fernández; Albert, A P; Bayón, A
2008-02-01
The aim of this study was to describe normal ECG patterns and values in four species of conscious raptors (Eurasian kestrel, Griffon vulture, Little owl, and Eurasian Eagle owl). Electrocardiograms were carried out in 75 conscious birds belonging to four species of raptors. Lead II waveforms were analysed to determine amplitudes and durations of waves and intervals. Morphologic patterns of P-QRS-T deflections were analysed in the six limb leads. Rhythm, heart rate, mean electrical axis, presence of Ta wave, ST slurring, and P-on-T phenomenon were also studied. The influence of species, body weight and heart rate in electrocardiographic variables were statistically analysed (P raptors that can be used to establish comparisons for clinical purposes.
New Data About Breeding of the Cinereous Vulture in the Republic of Altai, Russia
Directory of Open Access Journals (Sweden)
Elena P. Snayder
2016-02-01
Full Text Available A new step in our knowledge on Cinereous Vulture spreading in Altai was done at the end of July of 2015 when a new breeding colony was found in the canyon of river Kyziilshin that belongs to the basin of Chagan-Uzun River. In total, we found four nest – two of them were empty, but the other two possessed the signs of being used by the vultures in the present year. Checking of the one of those nests yielded us a nice views on a full-fledged nestling. The four newly-found nests located in a row along the river. The distance between the neighboring nests were 0.26 km, 0.16 km and 0.43 km respectively. The spacing between the occupied nests was 0.43 km. The distance between the newly found colony in the canyon of Kyziilshin and the old one in the canyon of Chagan-Uzun is 4.62 km average.
Sulfates removal by the GYP-CIX process following lime treatment
International Nuclear Information System (INIS)
Robertson, A.M.; Everett, D.J.; Plessis, N.J. Du
1994-01-01
The treatment of acid mine drainage by limiting results in the discharge of water saturated in gypsum and containing residual metal concentrations. These waters may exceed drinking and irrigation water standards for TDS, sulfates and some metals. The scaling nature of the saturated gypsum solution makes it unsuitable for industrial use and makes further processing difficult and costly. This paper discusses a novel ion exchange process that is suitable to desalinate large volumes of mine and industrial waters with a TDS of up to 6,500 mg/l which is also high in calcium and sulfates, to meet effluent discharge specifications. The GYP-CIX process is a continuous fluidized bed ion-exchange process that effectively removes calcium sulfate from gypsum saturated waters. It uses low cost chemicals such as lime and sulfuric acid for resin regeneration. The only waste product is gypsum and the treated water produced meets standards for reuse or discharge. This process consists of a two stage operation. The first is the removal of cations in a multistage continuous loading train, using cation exchange resin. The second operation is the removal of anions, again in a multistage continuous loading train using anion exchange resin
DEFF Research Database (Denmark)
Graves, Gary R.
2016-01-01
The naked heads of Cathartes vultures are widely believed to be adaptations for temperature regulation and to reduce plumage fouling during carrion feeding. Bright head color and the elaborate pattern of caruncles on the head and neck skin have a likely function in intra- and interspecific...... signaling. These integumentary characters have been difficult to study because of extensive postmortem color fading and shrinkage in museum specimens. Here I provide the first detailed description of head color and caruncles of the Greater Yellow-headed Vulture (C. melambrotus) from freshly collected...
Whitfield, D. Philip; Kati, Vassiliki
2017-01-01
Wind farm development can combat climate change but may also threaten bird populations’ persistence through collision with wind turbine blades if such development is improperly planned strategically and cumulatively. Such improper planning may often occur. Numerous wind farms are planned in a region hosting the only cinereous vulture population in south-eastern Europe. We combined range use modelling and a Collision Risk Model (CRM) to predict the cumulative collision mortality for cinereous vulture under all operating and proposed wind farms. Four different vulture avoidance rates were considered in the CRM. Cumulative collision mortality was expected to be eight to ten times greater in the future (proposed and operating wind farms) than currently (operating wind farms), equivalent to 44% of the current population (103 individuals) if all proposals are authorized (2744 MW). Even under the most optimistic scenario whereby authorized proposals will not collectively exceed the national target for wind harnessing in the study area (960 MW), cumulative collision mortality would still be high (17% of current population) and likely lead to population extinction. Under any wind farm proposal scenario, over 92% of expected deaths would occur in the core area of the population, further implying inadequate spatial planning and implementation of relevant European legislation with scant regard for governmental obligations to protect key species. On the basis of a sensitivity map we derive a spatially explicit solution that could meet the national target of wind harnessing with a minimum conservation cost of less than 1% population loss providing that the population mortality (5.2%) caused by the operating wind farms in the core area would be totally mitigated. Under other scenarios, the vulture population would probably be at serious risk of extinction. Our ‘win-win’ approach is appropriate to other potential conflicts where wind farms may cumulatively threaten wildlife
Directory of Open Access Journals (Sweden)
Dimitris P Vasilakis
Full Text Available Wind farm development can combat climate change but may also threaten bird populations' persistence through collision with wind turbine blades if such development is improperly planned strategically and cumulatively. Such improper planning may often occur. Numerous wind farms are planned in a region hosting the only cinereous vulture population in south-eastern Europe. We combined range use modelling and a Collision Risk Model (CRM to predict the cumulative collision mortality for cinereous vulture under all operating and proposed wind farms. Four different vulture avoidance rates were considered in the CRM. Cumulative collision mortality was expected to be eight to ten times greater in the future (proposed and operating wind farms than currently (operating wind farms, equivalent to 44% of the current population (103 individuals if all proposals are authorized (2744 MW. Even under the most optimistic scenario whereby authorized proposals will not collectively exceed the national target for wind harnessing in the study area (960 MW, cumulative collision mortality would still be high (17% of current population and likely lead to population extinction. Under any wind farm proposal scenario, over 92% of expected deaths would occur in the core area of the population, further implying inadequate spatial planning and implementation of relevant European legislation with scant regard for governmental obligations to protect key species. On the basis of a sensitivity map we derive a spatially explicit solution that could meet the national target of wind harnessing with a minimum conservation cost of less than 1% population loss providing that the population mortality (5.2% caused by the operating wind farms in the core area would be totally mitigated. Under other scenarios, the vulture population would probably be at serious risk of extinction. Our 'win-win' approach is appropriate to other potential conflicts where wind farms may cumulatively threaten
Directory of Open Access Journals (Sweden)
Daniel Oro
Full Text Available BACKGROUND: Human-predator conflicts are directly or indirectly threatening many species with extinction. Thus, biologists are urged to find simple solutions to complex situations while avoiding unforeseen conservation outcomes. The provision of supplementary food at artificial feeding sites (AFS is frequently used in the conservation of scavenger bird populations currently suffering from indirect poisoning, although no scientific studies on its effectiveness have been conducted. METHODOLOGY/PRINCIPAL FINDINGS: We used a long-term data set of 95 individually marked birds from the largest European core of the endangered bearded vulture (Gypaetus barbatus to test the long-term effects of specific AFS for bearded vultures on their survival rates (by CMR models and population dynamics (by Monte Carlo simulations in an area where fatalities derived from illegal poisoning and the use of other toxics like veterinary drugs have increased over the last several years. Our data support the positive relationship between the use of AFS and survival. However, contrary to theoretical predictions (e.g. high and more stable adult survival among long-lived species, the use of AFS increased only survival of pre-adults. Moreover, AFS buffered the effects of illegal poisoning on this age-class, while adult survival decreased over years. Our simulations predicted a maximum value of extinction probability over a time horizon of 50 years. Population projections run with survival rates expected in scenarios without poisoning predicted the situation of least conservation concern, while including only AFS can maintain a large floater surplus that may delay population decline but fails to reduce poisoning risk among adults. CONCLUSIONS/SIGNIFICANCE: Although AFS are not effective to save bearded vultures from an expected population decline, they delay population extinction and can be a useful tool for prolonging population viability while combating illegal and indirect
VULTURES: EXEGESIS OF A SYMBOL
Directory of Open Access Journals (Sweden)
Maura Andreoni
2016-12-01
Full Text Available Depending on the different cultures and historical periods, vultures have been considered both impure or sacred. But, since they usually do not prey upon living animals, their symbolic dimension, associated to the idea of purification, is present in many myths, religions, burial praxis of ancient populations and remains in some religions today.In the ancient Mediterranean civilizations, they have been carved in some of the most ancient bas-reliefs of the history by stone age people; were sacred to Egyptians, who even took them as symbol of gods; in the classical times they were supposed to be all feminine and breed by parthenogenesis, and therefore appreciated by some early Christian authors, who came to comparing them even to the Virgin Mary; they have been studied and described by ancient scientists, naturalists, philosophers, playwrights; involved in many of the most enduring Greek and Roman myths and legends; many parts of their body were considered as a medicine or even a talisman for happiness; and they were so proverbial for Romans to become even one of the symbols of the founding of Rome itself.But they were also so fragile that perfumes, myrrh and pomegranates were supposed to be lethal for them ….
Directory of Open Access Journals (Sweden)
Laura Gangoso
Full Text Available BACKGROUND: A generalized decline in populations of Old World avian scavengers is occurring on a global scale. The main cause of the observed crisis in continental populations of these birds should be looked for in the interaction between two factors -- changes in livestock management, including the increased use of pharmaceutical products, and disease. Insular vertebrates seem to be especially susceptible to diseases induced by the arrival of exotic pathogens, a process often favored by human activities, and sedentary and highly dense insular scavengers populations may be thus especially exposed to infection by such pathogens. Here, we compare pathogen prevalence and immune response in insular and continental populations of the globally endangered Egyptian vulture under similar livestock management scenarios, but with different ecological and evolutionary perspectives. METHODS/PRINCIPAL FINDINGS: Adult, immature, and fledgling vultures from the Canary Islands and the Iberian Peninsula were sampled to determine a the prevalence of seven pathogen taxa and b their immunocompetence, as measured by monitoring techniques (white blood cells counts and immunoglobulins. In the Canarian population, pathogen prevalence was higher and, in addition, an association among pathogens was apparent, contrary to the situation detected in continental populations. Despite that, insular fledglings showed lower leukocyte profiles than continental birds and Canarian fledglings infected by Chlamydophila psittaci showed poorer cellular immune response. CONCLUSIONS/SIGNIFICANCE: A combination of environmental and ecological factors may contribute to explain the high susceptibility to infection found in insular vultures. The scenario described here may be similar in other insular systems where populations of carrion-eaters are in strong decline and are seriously threatened. Higher susceptibility to infection may be a further factor contributing decisively to the extinction
Margalida, Antoni; Pérez-García, Juan Manuel; Afonso, Ivan; Moreno-Opo, Rubén
2016-10-25
Understanding the movement of threatened species is important if we are to optimize management and conservation actions. Here, we describe the age and sex specific spatial and temporal ranging patterns of 19 bearded vultures Gypaetus barbatus tracked with GPS technology. Our findings suggest that spatial asymmetries are a consequence of breeding status and age-classes. Territorial individuals exploited home ranges of about 50 km 2 , while non-territorial birds used areas of around 10 000 km 2 (with no seasonal differences). Mean daily movements differed between territorial (23.8 km) and non-territorial birds (46.1 km), and differences were also found between sexes in non-territorial birds. Daily maximum distances travelled per day also differed between territorial (8.2 km) and non-territorial individuals (26.5 km). Territorial females moved greater distances (12 km) than males (6.6 km). Taking into account high-use core areas (K20), Supplementary Feeding Sites (SFS) do not seem to play an important role in the use of space by bearded vultures. For non-territorial and territorial individuals, 54% and 46% of their home ranges (K90), respectively, were outside protected areas. Our findings will help develop guidelines for establishing priority areas based on spatial use, and also optimize management and conservation actions for this threatened species.
Chinsamy, Anusuya; Tumarkin-Deratzian, Allison
2009-09-01
We report on similar pathological bone microstructure in an extant turkey vulture (Cathartes aura) and a nonavian dinosaur from Transylvania. Both these individuals exhibit distinctive periosteal reactive bone deposition accompanied by endosteal bone deposits in the medullary cavity. Our findings have direct implications on the two novel bone tissues recently described among nonavian dinosaurs, radial fibrolamellar bone tissue and medullary bone tissue. On the basis of the observed morphology of the periosteal reactive bone in the turkey vulture and the Transylvanian dinosaur, we propose that the radial fibrolamellar bone tissues observed in mature dinosaurs may have had a pathological origin. Our analysis also shows that on the basis of origin, location, and morphology, pathologically derived endosteal bone tissue can be similar to medullary bone tissues described in nonavian dinosaurs. As such, we caution the interpretation of all endosteally derived bone tissue as homologous to avian medullary bone. (c) 2009 Wiley-Liss, Inc.
Murn, Campbell; Mundy, Peter; Virani, Munir Z; Borello, Wendy D; Holloway, Graham J; Thiollay, Jean-Marc
2016-02-01
The White-headed Vulture Trigonoceps occipitalis (WhV) is uncommon and largely restricted to protected areas across its range in sub-Saharan Africa. We used the World Database on Protected Areas to identify protected areas (PAs) likely to contain White-headed Vultures. Vulture occurrence on road transects in Southern, East, and West Africa was adjusted to nests per km(2) using data from areas with known numbers of nests and corresponding road transect data. Nest density was used to calculate the number of WhV nests within identified PAs and from there extrapolated to estimate the global population. Across a fragmented range, 400 PAs are estimated to contain 1893 WhV nests. Eastern Africa is estimated to contain 721 nests, Central Africa 548 nests, Southern Africa 468 nests, and West Africa 156 nests. Including immature and nonbreeding birds, and accounting for data deficient PAs, the estimated global population is 5475 - 5493 birds. The identified distribution highlights are alarming: over 78% (n = 313) of identified PAs contain fewer than five nests. A further 17% (n = 68) of PAs contain 5 - 20 nests and 4% (n = 14) of identified PAs are estimated to contain >20 nests. Just 1% (n = 5) of PAs are estimated to contain >40 nests; none is located in West Africa. Whilst ranging behavior of WhVs is currently unknown, 35% of PAs large enough to hold >20 nests are isolated by more than 100 km from other PAs. Spatially discrete and unpredictable mortality events such as poisoning pose major threats to small localized vulture populations and will accelerate ongoing local extinctions. Apart from reducing the threat of poisoning events, conservation actions promoting linkages between protected areas should be pursued. Identifying potential areas for assisted re-establishment via translocation offers the potential to expand the range of this species and alleviate risk.
First detection of an NSAID, flunixin, in sheep's wool using GC-MS
Energy Technology Data Exchange (ETDEWEB)
Richards, Ngaio, E-mail: ngaio.richards@anglia.ac.uk [Life Sciences, Anglia Ruskin University, East Road, Cambridge, CB1 1PT (United Kingdom); Hall, Sarah [Life Sciences, Anglia Ruskin University, East Road, Cambridge, CB1 1PT (United Kingdom); Scott, Karen [Forensic Medicine and Science, University of Glasgow, Glasgow G12 8QQ (United Kingdom); Harrison, Nancy [Life Sciences, Anglia Ruskin University, East Road, Cambridge, CB1 1PT (United Kingdom)
2011-05-15
Exposure to the nonsteroidal anti-inflammatory drug (NSAID) diclofenac resulted in the near extinction of three species of Gyps vultures on the Indian subcontinent. Other NSAIDs present in the environment, including flunixin, may pose a similar risk. In the course of a study to determine the feasibility of detecting NSAIDs in keratinous matrices (i.e., hair, nails and feathers) using GC-MS, wool opportunistically collected from a sheep treated with flunixin was analysed for residues. Flunixin was detected qualitatively in external wool wash and extract samples. While residues of veterinary agents and pesticides have previously been found in sheep's wool, our preliminary investigation provides the first instance of an NSAID being detected in this matrix. Here we provide the sample preparation methods and GC-MS parameters used to enable further refinement as part of ongoing conservation and consumer quality control measures. - Highlights: > In this study we qualitatively detected the NSAID flunixin in sheep's wool using GC-MS. > Potential applications of this technique to the conservation of avian scavengers are outlined. > The quantitative and confirmatory steps required to fully validate the method are also provided. - This is the first time that an NSAID has been investigated or detected in sheep's wool. As such, it details a novel exposure pathway for scavenging species in the environment and offers a potential tool for future monitoring effort in vulture conservation.
International Nuclear Information System (INIS)
Saini, Mohini; Taggart, Mark A.; Knopp, Dietmar; Upreti, Suchitra; Swarup, Devendra; Das, Asit; Gupta, Praveen K.; Niessner, Reinhard; Prakash, Vibhu; Mateo, Rafael; Cuthbert, Richard J.
2012-01-01
Diclofenac, a non-steroidal anti-inflammatory drug (NSAID), has caused catastrophic vulture declines across the Indian sub-continent. Here, an indirect ELISA is used to detect and quantify diclofenac in 1251 liver samples from livestock carcasses collected across India between August 2007 and June 2008, one to two years after a ban on diclofenac manufacture and distribution for veterinary use was implemented. The ELISAs applicability was authenticated with independent data obtained using LC–ESI/MS. Of 1251 samples, 1150 (91.9%) were negative for diclofenac using both methods, and 60 (4.8%) were positive at 10–4348 and 10–4441 μg kg −1 when analysed by ELISA and LC–ESI/MS, respectively. The residue level relationship in the 60 positive samples was highly significant (p 2 = 0.644). Data suggest that this immunological assay could be used not only for cost effective sample screening, but also for residue level semi-quantification. - Highlights: ► An ELISA is validated for use in diclofenac monitoring. ► We compare ELISA and LC–ESI/MS data for 1251 samples. ► Results indicate the ELISA can be reliably used for screening and semi-quantification. ► In 2007–2008, in India, around 1 in 20 ungulate carcasses contained detectable diclofenac. - The prevalence of diclofenac in carcasses available to vultures in India has declined from around 1:10 to 1:20 since restrictions on veterinary use were first put in place in 2006.
Lead and cadmium in wild birds in southeastern Spain
Energy Technology Data Exchange (ETDEWEB)
Garcia-Fernandez, A.J.; Sanchez-Garcia, J.A.; Luna, A. [Univ. of Murcia (Spain); Jimenez-Montalban, P. [Regional Environmental Agency, Murcia (Spain). Centro de Recuperacion de Fauna Silvestre El Valle
1995-12-01
The main purpose of this study was to monitor exposure to lead and cadmium in wild birds in Murcia, a southeastern region of Spain on the Mediterranean coast. This region lies on one of the African-European flyways. Samples of liver, kidney, brain, bone, and whole blood from several species of wild birds were obtained during 1993. The authors found a clear relationship between cadmium and lead concentrations in birds and their feedings habits. Vultures (Gyps fulvus) had the highest concentrations of lead (mean 40 {micro}g/dl in blood), and seagulls (Larus argentatus and Larus ridibundus) the highest concentrations of cadmium (mean 4.43 {micro}g/g in kidney). Insectivores had high concentrations of both metals, and diurnal and nocturnal raptors showed the lowest tissue concentrations. The findings that tissue and blood concentrations were generally not elevated suggests environmental (rather than acute) exposure. Birds from more industrialized areas of the region studied here had higher concentrations of both lead and cadmium.
Directory of Open Access Journals (Sweden)
Antoni Margalida
Full Text Available After the quasi-extinction of much of the European vertebrate megafauna during the last few centuries, many reintroduction projects seek to restore decimated populations. However, the future of numerous species depends on the management scenarios of metapopulations where the flow of individuals can be critical to ensure their viability. This is the case of the bearded vulture Gypaetus barbatus, an Old World, large body-sized and long-lived scavenger living in mountain ranges. Although persecution in Western Europe restrained it to the Pyrenees, the species is nowadays present in other mountains thanks to reintroduction projects. We examined the movement patterns of pre-adult non-breeding individuals born in the wild population of the Pyrenees (n = 9 and in the reintroduced populations of the Alps (n = 24 and Andalusia (n = 13. Most birds were equipped with GPS-GSM radio transmitters, which allowed accurate determination of individual dispersal patterns. Two estimators were considered: i step length (i.e., the distance travelled per day by each individual, calculated considering only successive days; and ii total dispersal distance (i.e., the distance travelled between each mean daily location and the point of release. Both dispersal estimators showed a positive relationship with age but were also highly dependent on the source population, birds in Andalusia and Alps moving farther than in Pyrenees. Future research should confirm if differences in dispersal distances are the rule, in which case the dynamics of future populations would be strongly influenced. In summary, our findings highlight that inter-population differences can affect the flow of individuals among patches (a key aspect to ensure the viability of the European metapopulation of the endangered bearded vulture, and thus should be taken into account when planning reintroduction programs. This result also raises questions about whether similar scenarios may occur in other
Directory of Open Access Journals (Sweden)
Rubén Moreno-Opo
Full Text Available The application of scientific-based conservation measures requires that sampling methodologies in studies modelling similar ecological aspects produce comparable results making easier their interpretation. We aimed to show how the choice of different methodological and ecological approaches can affect conclusions in nest-site selection studies along different Palearctic meta-populations of an indicator species. First, a multivariate analysis of the variables affecting nest-site selection in a breeding colony of cinereous vulture (Aegypius monachus in central Spain was performed. Then, a meta-analysis was applied to establish how methodological and habitat-type factors determine differences and similarities in the results obtained by previous studies that have modelled the forest breeding habitat of the species. Our results revealed patterns in nesting-habitat modelling by the cinereous vulture throughout its whole range: steep and south-facing slopes, great cover of large trees and distance to human activities were generally selected. The ratio and situation of the studied plots (nests/random, the use of plots vs. polygons as sampling units and the number of years of data set determined the variability explained by the model. Moreover, a greater size of the breeding colony implied that ecological and geomorphological variables at landscape level were more influential. Additionally, human activities affected in greater proportion to colonies situated in Mediterranean forests. For the first time, a meta-analysis regarding the factors determining nest-site selection heterogeneity for a single species at broad scale was achieved. It is essential to homogenize and coordinate experimental design in modelling the selection of species' ecological requirements in order to avoid that differences in results among studies would be due to methodological heterogeneity. This would optimize best conservation and management practices for habitats and species in
Directory of Open Access Journals (Sweden)
Philippe Lemay
Full Text Available Chiari-like malformation (CM is a developmental abnormality of the craniocervical junction that is common in the Griffon Bruxellois (GB breed with an estimated prevalence of 65%. This disease is characterized by overcrowding of the neural parenchyma at the craniocervical junction and disturbance of cerebrospinal fluid (CSF flow. The most common clinical sign is pain either as a direct consequence of CM or neuropathic pain as a consequence of secondary syringomyelia. The etiology of CM remains unknown but genetic factors play an important role. To investigate the genetic complexity of the disease, a quantitative trait locus (QTL approach was adopted. A total of 14 quantitative skull and atlas measurements were taken and were tested for association to CM. Six traits were found to be associated to CM and were subjected to a whole-genome association study using the Illumina canine high density bead chip in 74 GB dogs (50 affected and 24 controls. Linear and mixed regression analyses identified associated single nucleotide polymorphisms (SNPs on 5 Canis Familiaris Autosomes (CFAs: CFA2, CFA9, CFA12, CFA14 and CFA24. A reconstructed haplotype of 0.53 Mb on CFA2 strongly associated to the height of the cranial fossa (diameter F and an haplotype of 2.5 Mb on CFA14 associated to both the height of the rostral part of the caudal cranial fossa (AE and the height of the brain (FG were significantly associated to CM after 10 000 permutations strengthening their candidacy for this disease (P = 0.0421, P = 0.0094 respectively. The CFA2 QTL harbours the Sall-1 gene which is an excellent candidate since its orthologue in humans is mutated in Townes-Brocks syndrome which has previously been associated to Chiari malformation I. Our study demonstrates the implication of multiple traits in the etiology of CM and has successfully identified two new QTL associated to CM and a potential candidate gene.
The shikimic acid: an important metabolite for the Aglianico del Vulture wines
Directory of Open Access Journals (Sweden)
Pasquale Tamborra
2014-12-01
Full Text Available Shikimic acid is a precursor for the biosynthesis of aromatic amino acids and flavonoids (anthocyanins, tannins and flavonols. In the pharmaceutical industry, it is obtained by extraction of star anise from China, and at a yield of 3-7% it is used for the production of antiviral drug, e.g. oseltamivir. Unlike flavonoids which are only present in the grape skins, shikimic acid is present in the juice together with hydroxycinnamil tartaric acids (caffeic, ferulic and p-coumaric acid. Therefore, their content in white wines may not be negligible and their presence may explain the epidemiological studies that showed a reduced incidence of cardiovascular diseases also in people with moderate white wine consumption. The content of shikimic acid has been used to characterize wines. In southern Italy it has been used to distinguish Aglianico grape, which holds medium-high content, from Negroamaro, Primitivo and Uva di Troia grapes who have rather lower levels. It could be useful also to distinguish Fiano di Avellino (high value from Fiano Minutolo (low value. However, results of a recent work showed that the shikimic acid content decreases significantly during the ripening of the grapes and therefore its content in wine is strongly influenced by the harvest period. Finally, in a recent paper it was highlighted the increase in shikimic acid content at the end of fermentation in an Aglianico del Vulture wine, produced in the area of Rapolla (PZ, Italy municipality during the 2013 harvest. These last experimental results explain why the values of shikimic acid were lower in grapes and surprisingly higher in wines produced in the 2011 and 2012 harvest.
Differential range use between age classes of southern African Bearded Vultures Gypaetus barbatus.
Directory of Open Access Journals (Sweden)
Sonja Krüger
Full Text Available Bearded Vulture Gypaetus barbatus movements were investigated in southern Africa to determine whether an individual's age, sex or breeding status influenced its ranging behaviour and to provide the information required to guide conservation activities. Data from satellite transmitters fitted to 18 individuals of four age classes were used to determine range size and use. Because of the nature of the movements of marked individuals, these data could be used to determine the overall foraging range of the entire population, which was estimated to be 51 767 km(2. Although juvenile, immature and sub-adult birds used different parts of the overall range, their combined foraging range was 65% (33 636 km(2 of the overall range. Average adult home ranges (286 km(2 were only around 1% the size of the average foraging ranges of non-adults (10 540 -25 985 km(2, with those of breeding adults being even smaller (95 km(2. Home ranges of breeding adults did not vary in size between seasons but adults utilized their home range more intensively whilst breeding, moving greater distances during the incubation and chick hatching period. Range size and use increased as non-adults aged. Immatures and sub-adults had larger range sizes during winter, but range use of non-adults did not vary seasonally. Range size and use did not differ between the sexes in any of the age classes. Information on home range size and use enables specific areas within the species' range to be targeted for management planning, education and conservation action.
First Report of Cucumber mosaic virus Isolated from Sambungai (Gynura procumbens
Directory of Open Access Journals (Sweden)
June Kwon
2017-12-01
Full Text Available In March 2016, an isolate of Cucumber mosaic virus (named Gyp-CMV was isolated from the Sambungai (Gynura procumbens showing the symptoms of mosaic and chlorosis. The isolate Gyp-CMV was characterized by disease reactions in several indicator plants, reverse transcription-polymerase chain reaction (RT-PCR, PCR-restriction fragment length polymorphism, and sequence analysis of movement protein (3a and coat protein (CP genes. Tobacco, tomato, pepper, ground cherry, and lambsquarters (Chenopodium quinoa and C. amaranticolor appeared typical CMV symptoms, but zucchini and cucumber were not infected. Phylogenetic analysis of the 3a and CP gene indicated that Gyp-CMV belongs to the CMV subgroup II. Sequence identities of the Gyp-CMV 3a and CP genes showed 99.3% and 100% to that of Hnt-CMV at amino acid level. To our knowledge, this is the first report of CMV infection in Gynura procumbens.
Naveda-Rodríguez, Adrián; Vargas, Félix Hernán; Kohn, Sebastián; Zapata-Ríos, Galo
2016-01-01
The Andean Condor (Vultur gryphus) in Ecuador is classified as Critically Endangered. Before 2015, standardized and systematic estimates of geographic distribution, population size and structure were not available for this species, hampering the assessment of its current status and hindering the design and implementation of effective conservation actions. In this study, we performed the first quantitative assessment of geographic distribution, population size and population viability of Andean Condor in Ecuador. We used a methodological approach that included an ecological niche model to study geographic distribution, a simultaneous survey of 70 roosting sites to estimate population size and a population viability analysis (PVA) for the next 100 years. Geographic distribution in the form of extent of occurrence was 49 725 km2. During a two-day census, 93 Andean Condors were recorded and a population of 94 to 102 individuals was estimated. In this population, adult-to-immature ratio was 1:0.5. In the modeled PVA scenarios, the probability of extinction, mean time to extinction and minimum population size varied from zero to 100%, 63 years and 193 individuals, respectively. Habitat loss is the greatest threat to the conservation of Andean Condor populations in Ecuador. Population size reduction in scenarios that included habitat loss began within the first 15 years of this threat. Population reinforcement had no effects on the recovery of Andean Condor populations given the current status of the species in Ecuador. The population size estimate presented in this study is the lower than those reported previously in other countries where the species occur. The inferences derived from the population viability analysis have implications for Condor management in Ecuador. This study highlights the need to redirect efforts from captive breeding and population reinforcement to habitat conservation.
Directory of Open Access Journals (Sweden)
David Grémillet
Full Text Available Animals are primarily limited by their capacity to acquire food, yet digestive performance also conditions energy acquisition, and ultimately fitness. Optimal foraging theory predicts that organisms feeding on patchy resources should maximize their food loads within each patch, and should digest these loads quickly to minimize travelling costs between food patches. We tested the prediction of high digestive performance in wandering albatrosses, which can ingest prey of up to 3 kg, and feed on highly dispersed food resources across the southern ocean. GPS-tracking of 40 wandering albatrosses from the Crozet archipelago during the incubation phase confirmed foraging movements of between 475-4705 km, which give birds access to a variety of prey, including fishery wastes. Moreover, using miniaturized, autonomous data recorders placed in the stomach of three birds, we performed the first-ever measurements of gastric pH and temperature in procellariformes. These revealed surprisingly low pH levels (average 1.50±0.13, markedly lower than in other seabirds, and comparable to those of vultures feeding on carrion. Such low stomach pH gives wandering albatrosses a strategic advantage since it allows them a rapid chemical breakdown of ingested food and therefore a rapid digestion. This is useful for feeding on patchy, natural prey, but also on fishery wastes, which might be an important additional food resource for wandering albatrosses.
Directory of Open Access Journals (Sweden)
David Kenny
2015-09-01
Full Text Available Since 2009, we have been determining blood lead levels (BLLs for Eurasian black vulture (EbVs, Aegypius monachus in Mongolia. Since EbVs migrated from Mongolia to the Republic (R. of Korea in 2012, we started comparing BLLs from Mongolia to Korean birds [Mongolia; mean=2.72±0.09 μg/dL standard error (SE, n=181, R. of Korea; mean=6.68±0.58 μg/dL SE, n=124]. In Korea we also analyzed birds by comparing BLLs for free-ranging birds (mean=7.54±0.50 μg/dL SE, n=44 to rehabilitation center birds (mean=6.21±0.86 μg/dL SE, n=80, and for birds fed rescued water deer (Hydropotes inermis (mean=11.26±1.66 μg/dL SE, n=7 to birds fed livestock (mean=1.97±0.27 μg/dL, n=4. Finally, we analyzed BLLs from Mongolia and the R. of Korea according to the following categories: background=<10.0 μg/dL (Mongolia 100%, n=181; R. of Korea 83.1%, exposure=≥10.0 μg/dL to <45.0 μg/dL (Mongolia 0%; R. of Korea 16.1%, n=20, and diagnostic=≥45.0 μg/dL (Mongolia 0%; R. of Korea 0.8%, n=1. Our research indicates that EbVs are acquiring lead while migrating to the R. of Korea.
African Journals Online (AJOL)
campbell
On the morning of 13 May 2013, driving on the S28, a gravel road in southern. Kruger National Park, between Crocodile Bridge camp and Lower Sabie camp, a sub-adult Egyptian Vulture was spotted. It was in open knob-thorn - marula woodland and sitting near a white-backed vulture. The Egyptian Vulture was preening, ...
Gray, D.; Estes, M. G., Jr.; Griffin, R.; Estes, S. M.
2017-12-01
As the global urban population rapidly increases, many wild species lose habitat to human development. The Western Cape of South Africa contains one of Earth's 35 biodiversity hotspots, with remarkably high levels of species richness and endemism. Understanding the relationship between anthropogenic changes and key species in this region is crucial for conservation of its threatened ecosystems. The objective of this research was to investigate the effect that climate change and urbanization each have on habitat suitability of the Cape Vulture. This research utilized NASA satellite data and crowdsourced species sightings to model past, current, and future habitat suitability for this key species in the Western Cape. Data used from NASA Earth Observations included: Landsat 8- derived Land Cover, Modis Land Surface Temperature, Digital Elevation Models from the Shuttle Radar Topography Mission, and precipitation data which integrated in-situ stations with Infrared data. Species observations were sourced from the Global Biodiversity Information Facility online database. A geospatial modelling framework was used to generate maps of present, past and future suitable habitats for analysis and comparison. Changes in precipitation and temperature may be a factor in the extreme loss of habitat since 1995, and predict even more drastic loss in the future. This research provides insights on anthropogenic effects on a species' range which may be used to inform discussions of conservation as an element of environmentally sustainable development.
Stoppa, Francesco; Principe, Claudia
1998-01-01
The Monticchio Lakes Formation (MLF) is a newly identified carbonatite-melilitite tuff sequence which is exposed in the southwestern sector of the Vulture volcano. It is the youngest example (ca. 0.13 m.y.) of this type of volcanism in Italy, although other carbonatites of smaller volume, but with similar characteristics, have been discovered recently. This volcanic event occurred in isolation after a 0.35 m.y. period of inactivity at Vulture. The eruption produced two maar-type vents and formed tuff aprons mainly composed of dune beds of lapilli. Depositional features suggest that a dry surge mechanism, possibly triggered by CO 2 expansion, was dominant during tuff emplacement. The MLF event involved a mixture of carbonatite and melilitite liquids which were physically separated before the eruption. Abundant mantle xenoliths are direct evidence of the deep-seated origin of the parental magma and its high velocity of propagation towards the surface. Often, these nodules form the core of lapilli composed of concentric shells of melilitite and/or porphyritic carbonatite. Coarse-ash beds alternate with lapilli beds and consist of abundant lumps and spherulae of very fine-grained calcite immersed in a welded, highly compacted carbonatite matrix. Porphyritic carbonatite shells of the lapilli and fine-grained spherulae of calcite in the tuff matrix suggest incipient crystallisation of a carbonatite liquid in subvolcanic conditions and eruption of carbonatite-spray droplets. Dark coloured juvenile fragments mainly consist of melilite, phlogopite, calcite, apatite, perovskite, and häuyne crystals in a carbonatite or melilitite matrix. The rocks have an extremely primitive, ultramafic composition with very high Mg# (> 85) and Cr and Ni content (1500 ppm). The calcite contains high SrO, BaO and REE of up to 1.5 wt.%. Similar compositions are typical of primary, magmatic carbonates which are found in both intrusive and extrusive carbonatites. The high modal Sr
Schlierf, Roland; Hight, Ron; Payne, Stephen J.; Shaffer, John P.; Missimer, Brad; Willis, Christopher
2007-01-01
While birds might seem harmless, there's a good reason for the concern. During the July 2005 launch of Discovery on mission STS-1 14, a vulture soaring around the launch pad impacted the shuttle's external tank just after liftoff. With a vulture's average weight ranging from 3 to 5 pounds. a strike at a critical point on the Shuttle -- like the nose or wing leading thermal protection panels -- could cause catastrophic damage to the vehicle. The foam chunk that fatefully struck Columbia's wing in 2003 weighed only 1.7 pounds. (Cheryl L. Mansfield "Bye Bye Birdies" 2006) To address this issue, NASA formed an "Avian Abatement Team". The team goal is to have safer Shuttle missions by reducing the vulture population at KSC near the pad area thereby reducing the probability of another vulture strike during a Shuttle launch.
ORF Alignment: cds [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 92 ---YSSRYIGSLVGDVHRTLIYGGVFGYPGDKKNPNGKLRLLYECAPMAYLMEQAGGIAT 348 ... ... YS+RYIGSLVGD HRTL+YGG++GYP D+K+ NGKLRLLYECAPM++++EQAGG ... + Sbjct: 240 GKPYSARYIGSLVGDFHRTLLYGGIYGYPRDQKSKNGKLRLLYECAPMSFIVEQAGGKGS 299 ...
African Journals Online (AJOL)
Items 101 - 150 of 154 ... ... Coragyps atratus at a South American sea lion breeding colony ... Notes and reports - New record of African White-backed Vulture ... Vol 61 (2011), Sympatric occurrence of four Cathartid vultures in the dry forests of ...
SHORT COMMUNICATIONS, NOTES AND REPORTS
African Journals Online (AJOL)
campbell
Possible sighting of the Indian subspecies of the Egyptian. Vulture Neophron percnopterus ginginianus in Africa. Ivaylo Angelov. 1*. , Bruktawit Abdu. 2. , Nikolay Terziev. 3. , Samson Zelleke. 4. 1 “Balgarka” 29-A-18, Sliven 8800, Bulgaria. 2 Ethiopian Wildlife and Natural History Society. ... Tunisia, which Egyptian Vultures.
African Journals Online (AJOL)
Campbell Murn
Portuguese Nature Conservation. Agency) and the Arribes del Duero. Natural Park, revealed that there are. 135 pairs of Egyptian Vultures along the International Douro and its tributaries. Also, the survey of. Egyptian Vulture in France in 2016 was published by Erick Kobierzycki, who is responsible for the Pyrenees.
Y.A. Kapetanakos; I.J. Lovette; T.E. Katzner
2014-01-01
Southeast Asian vultures have been greatly reduced in range and population numbers, but it is challenging to use traditional tagging and monitoring techniques to track changes in their populations. Genotypes derived from non-invasively collected feather samples provide an alternative and effective means to 'capture' individual vultures for mark-recapture...
Short CommuniCationS, noteS and reportS
African Journals Online (AJOL)
Lappet-faced Vultures with white feathers hein van Grouw. Curator, Bird Group, Dept. of Zoology, The Natural History Museum, Akeman Street,. Tring, Herts, HP23 6AP, UK. e-mail: h.van-grouw@nhm.ac.uk. Two different Lappet-faced Vultures Torgos tracheliotos with remarkable white feathers over their bodies are seen.
African Journals Online (AJOL)
Tidmus, Scott. Vol 71 (2016) - Articles Vulture updates - October 2016 - Around the World of Vultures & VSG activities. Abstract PDF. ISSN: 1606-7479. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions of Use ...
African Journals Online (AJOL)
Williams, RSR. Vol 61 (2011) - Articles Trade in Andean Condor Vulture gryphus feathers and body parts in the city of Cusco and the Sacred Valley, Cusco region, Peru Abstract PDF · Vol 61 (2011) - Articles Sympatric occurrence of four Cathartid vultures in the dry forests of north-western Peru Abstract PDF. ISSN: 1606- ...
2013-06-21
..., 2012. Inc., Union City Plant, Griffon Corporation, Adecco. 82,747 Textile Piece Dyeing Lincolnton, NC May 15, 2012. Co., Inc., A Subsidiary of Dartmouth Textiles. The following certifications have been.... Technologies, Inc., Dissolution Division, Volt. Negative Determinations for Worker Adjustment Assistance In the...
African Journals Online (AJOL)
... underutilized samples for detecting organophosphorus and carbamate pesticide poisoning in raptors · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Ngaio Richards, Irene Zorrilla, Joseph Lalah, Peter Otieno, Isabel Fernandez, Monica Calvino, Joaquin Garcia ...
Hu, Biao-lin; Li, Xia; Wan, Yong; Qiu, Zai-hui; Nie, Yuan-yuan; Xie, Jian-kun
2015-08-01
To identify the low nitrogen tolerance of Dongxiang wild rice (DXWR) and its progenies, ten phenotypic traits including plant height (PH), heading day (HD), panicle length (PL), number of effective tillers per plant (NETP), number of filled grains per panicle (NFGP), number of grains per panicle (NGP), grain density (GD), spikelet fertility (SF), 1000-grain mass (TGM) and grain yield per plant (GYP) were studied under normal and low nitrogen treatments, using backcross inbred lines (BILs) of Xieqingzao B//DXWR/Xieqingzao B in BC1 F12. Comprehensive evaluation on the low nitrogen tolerance of the BILs population was conducted using principal component analysis and the subordinate function. The evaluation results indicated that the low nitrogen tolerance of the line 116, 143 and 157 was the strongest, which could be served as the intermediate materials for genetic studies on the low nitrogen tolerance of DXWR and breeding for the low nitrogen tolerance in rice. The optimal regression equation of the low nitrogen tolerance in rice was established using stepwise regression analysis. The relative values of five traits including PH, NGP, SF, TGM and GYP were screened out and could be used as comprehensive evaluation indices for the low nitrogen tolerance in the whole growth stage. Therefore, more attention should be paid to the relative values of these five traits, especially for NGP and GYP, in the genetic improvement of the low nitrogen tolerance in rice.
Egyptian Vultures and the principle of subspecies in vultures
African Journals Online (AJOL)
Campbell Murn
“abnormal pigmentation” (Porter &. Suleiman 2012). (ii) an adult was photographed in northern Ethiopia (410E) in December. 2010, and was noted as “considerably ... Cramp & Simmons 1980) has provided some real data on percnopterus skins from museums, to compare against the average of ginginianus from literature.
Mighty vulture back from near extinction | Nickerson | Vulture News
African Journals Online (AJOL)
Journal Home > Vol 56 (2007) >. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Download this PDF file. The PDF file you selected should load here if your Web browser has a PDF reader plug-in installed (for example, a recent version of Adobe Acrobat Reader).
Assessment of Mercury in Soils, Crops, Earthworms, and Water when Soil is Treated with Gypsum
Flue gas desulfurization (FGD) gypsum from fossil fuel combustion has many potential uses in agriculture, but there is concern about the potential environmental effects of its elevated mercury (Hg) concentration. The wet limestone scrubbing process that removes sulfur from flue gas (and produces gyp...
Phenology prediction component of GypsES
Jesse A. Logan; Lukas P. Schaub; F. William Ravlin
1991-01-01
Prediction of phenology is an important component of most pest management programs, and considerable research effort has been expended toward development of predictive tools for gypsy moth phenology. Although phenological prediction is potentially valuable for timing of spray applications (e.g. Bt, or Gypcheck) and other management activities (e.g. placement and...
Conservation genetics of Iberian raptors
Directory of Open Access Journals (Sweden)
Martinez–Cruz, B.
2011-12-01
Full Text Available In this paper I provide an overview of conservation genetics and describe the management actions in the wild that can benefit from conservation genetic studies. I describe the genetic factors of risk for the survival of wild species, the consequences of loss of genetic diversity, inbreeding and outbreeding depression, and the use of genetic tools to delimitate units of conservation. Then I introduce the most common applications of conservation genetics in the management of wild populations. In a second part of the paper I review the conservation genetic studies carried on the Iberian raptors. I introduce several studies on the Spanish imperial eagle, the bearded vulture, the black vulture and the red kite that were carried out using autosomal microsatellite markers and mitochondrial DNA (mtDNA sequencing. I describe studies on the lesser kestrel and Egyptian vulture that additionally applied major histocompatibility complex (MHC markers, with the purpose of incorporating the study of non–neutral variation. For every species I explain how these studies can be and/or are applied in the strategy of conservation in the wild.
African Journals Online (AJOL)
On first mention in all articles, the generally accepted English common name of a species should be followed by the scientific binomial. Thereafter the English name should be used. Scientific names and all non-English words, with the exception of those adopted into the English language, should be in italics. Journal names ...
International Nuclear Information System (INIS)
Mahoney, John J.; Frey, Ryan A.
2014-01-01
Objectives: • Develop predictive model to estimate concentrations in the Sink Vulture Treated Effluent Management System (SVTEMS) for AREVA Resources Canada McClean Lake Mill: • Sink Reservoir, Vulture and McClean Lakes; • PHREEQC based calculations for geochemistry; • Employ PHREEPLOT for data fittings. • Model designed to predict concentrations in response to changing conditions, including: • Different ores; • Different processes; • Different waters sources; • Changing treatment conditions; • This is a batch mixing model: • Think well mixed beakers; • Each model represents one year; • No year-to-year carry over in models
First report of Lasiodiplodia theobromae (Pat.) Griffon & Maubl ...
African Journals Online (AJOL)
SARAH
2014-07-31
Jul 31, 2014 ... *1School of Crop and Seed Production and Management (EGPVS), ... 2International Institute of Tropical Agriculture, 08 BP 0932, Cotonou, Rep. ... Objective: Jatropha curcas L. is an important biofuel crop grown worldwide.
Syringomyelia and Craniocervical Junction Abnormalities in Chihuahuas
Kiviranta, A.‐M.; Rusbridge, C.; Laitinen‐Vapaavuori, O.; Hielm‐Björkman, A.; Lappalainen, A.K.; Knowler, S.P.; Jokinen, T.S.
2017-01-01
Background: Chiari-like malformation (CM) and syringomyelia (SM) are widely reported in Cavalier King Charles Spaniels and Griffon Bruxellois dogs. Increasing evidence indicates that CM and SM also occur in other small and toy breed dogs, such as Chihuahuas. Objectives: To describe the presence of SM and craniocervical junction (CCJ) abnormalities in Chihuahuas and to evaluate the possible association of CCJ abnormalities with SM. To describe CM/SM-related clinical signs and neuro...
African Journals Online (AJOL)
introduced veterinary pharmaceuticals. Diclofenac is a non steroidal anti- inflammatory (NSAID) drug administered to livestock on the Indian subcontinent. Diclofenac is administered for many of the same reasons that a human might take aspirin or ibuprofen, it masks nominal pain and discomfort and gets us back on our feet ...
African Journals Online (AJOL)
2006-01-30
Jan 30, 2006 ... extensive visceral gout (a buildup of uric acid crystals in the internal organs associated with renal failure). The birds often appeared sick and lethargic, some showed prolonged severe neck drooping, before collapsing—sometimes from their perches. Intensive testing failed to implicate infectious disease ...
African Journals Online (AJOL)
2006-09-02
Sep 2, 2006 ... area in eastern Mali (Rondeau et al. in prep), along with the Gandamia colony of Gourma, Mali – once the largest in West Africa (Elósegui 1975) that is now virtually abandoned (Rondeau &. Thiollay 2004, Thiollay 2006), there is no overpopulation, nor lack of suitable cliffs, to explain the tree-nesting ...
Tagged vulture causes concerns
African Journals Online (AJOL)
2008-09-15
Sep 15, 2008 ... Italy, Croatia, Bulgaria, Greece, Serbia,. Macedonia, Turkey, Jordan, Sinai and even from Saudi Arabia. Together with. Orr Spiegel we fit 40 GPS-loggers (these are not transmitters) as part of a feeding and demography study, in addition to a smaller number of GPS/PTT transmitters received from Argos.
African Journals Online (AJOL)
Search tips: Search terms are case-insensitive; Common words are ignored; By default only articles containing all terms in the query are returned (i.e., AND is implied); Combine multiple words with OR to find articles containing either term; e.g., education OR research; Use parentheses to create more complex queries; e.g., ...
African Journals Online (AJOL)
2006-06-18
Jun 18, 2006 ... near San Lucas, but the marksmen didn't use non-lead ammunition. Condors eat only carrion – dead carcasses – and are highly susceptible to lead poisoning if they ingest lead bullet ... came in and started eating everything,”. Petersen said. News of the ... And yet the state refuses to act.” Earlier this.
African Journals Online (AJOL)
2006-09-02
Sep 2, 2006 ... to scan the hills with binoculars. To my shock, just 20 feet away, I found myself looking into the ruby eyes of a condor. It was perched on the brink of a cliff, just beyond a guard rail, overlooking. Sea Lion Cove and the Pacific Ocean. The condor stared straight at me as if wondering when I might be ready for.
2017-06-01
solutions in civil and military engineering, geospatial sciences, water resources, and environmental sciences for the Army, the Department of Defense...was unexpectedly upgraded soon after the demonstration coatings were applied, apparently due to a scheduling change or miscommunication re- lated...oils and grease, so no cleaning solution was needed. Sherwin Williams ProMar 200 acrylic primer was used to prime all gyp- sum surfaces that were
Ostrich: Journal of African Ornithology - Vol 77, No 1 (2006)
African Journals Online (AJOL)
Adaptive benefits of differential post-fledging development patterns in the Lesser Flamingo ... Breeding records and nest site preference of Hooded Vultures in the greater Kruger ... The Bird-watcher's Companion to North American Birdlife
African Journals Online (AJOL)
Many animal species benefit from resources provided by other species. ... 98), we observed behavioral interactions at the Punta Lobería Southern Sea-lion ... by Black Vulture Coragyps atratus, Kelp Gull Larus dominicanus and Domestic Dogs.
African Journals Online (AJOL)
African Journals Online (AJOL)
2013). International Journal of Engineering, Science and Technology. Vol 5, No 3 (2013). International Journal of Engineering, Science and Technology. Vol 30, No 1 (2018). South African Journal of Sports Medicine. Vol 66 (2014). Vulture News.
African Journals Online (AJOL)
User
Ilorin Journal of Religious Studies, (IJOURELS). Vol.7 No.2, 2017, ..... Bee, iah meaning Vulture , Zimri meaning a mountain Sheep ,. Jonah meaning Dove , ..... American Journal of Semitic Languages and Literatures Vol. 24, No. 1. (1907) ...
African Zoology - Vol 25, No 3 (1990)
African Journals Online (AJOL)
Food choice and diet of the bearded vulture Gypaetus barbatus in southern Africa · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. C.J. Brown, I Plug, 169-177 ...
African Journals Online (AJOL)
2007-03-01
Mar 1, 2007 ... most colonies of Cape Vultures have gone extinct; a southern colony is the only one showing ... have disappeared first around Lesotho causing both species' range to retract into ... plants and animals have shifted their.
Selected mineral and heavy metal concentrations in blood and ...
African Journals Online (AJOL)
Unknown
Pb in the dead vultures were generally above values characteristic of heavy metal poisoning. ... of the food chain), may accumulate and concentrate heavy metals in their ..... µg/g wet weight) (Honda et al., 1990), which validates the order of ...
78 FR 23286 - Endangered Species; Marine Mammals; Receipt of Applications for Permit
2013-04-18
...-horned oryx (Oryx dammah), from the captive herd maintained at their facility, for the purpose of...) African wild dog (Lycaon pictus) Rothschild's starling (Leucopsar rothschildi) Radiated tortoise...) Koala (Phascolarctos cinereus) African wild dog (Lycaon pictus) Andean condor (Vultur gryphus) Harpy...
Book Reviews | Mundy | Vulture News
African Journals Online (AJOL)
(2015) Ministry of Environment and Tourism, and Namibia Nature Foundation, Windhoek. 320pp. ISBN 978-9-9945-0082-6. Book Review 3. Book Title: The 2015 Eskom Red Data Book of birds of South Africa, Lesotho and Swaziland. Book Authors: M.R. Taylor, F Peacock & R.M. Wanless (Eds.) (2015) BirdLife South Africa, ...
African Journals Online (AJOL)
... but underutilized samples for detecting organophosphorus and carbamate pesticide poisoning in raptors · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Ngaio Richards, Irene Zorrilla, Joseph Lalah, Peter Otieno, Isabel Fernandez, Monica Calvino, Joaquin Garcia ...
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
... Faculty of Veterinary, University of Zaragoza, Zaragoza, Spain; Foundation for the Conservation of the Bearded Vulture (FCQ), Zaragoza, Spain; Biodiversity Service, Agriculture and Environmental Department, Aragón Government, Aragón, Spain; Wildlife Conservation Centre La Alfranca, Zaragoza, Spain; Surgery Unit, ...
Vidal-Mateo, Javier; Mellone, Ugo; López-López, Pascual; La Puente, Javier De; García-Ripollés, Clara; Bermejo, Ana; Urios, Vicente
2016-01-01
Abstract Wind is among the most important environmental factors shaping birds’ migration patterns. Birds must deal with the displacement caused by crosswinds and their behavior can vary according to different factors such as flight mode, migratory season, experience, and distance to goal areas. Here we analyze the relationship between wind and migratory movements of three raptor species which migrate by soaring–gliding flight: Egyptian vulture Neophron percnopterus, booted eagle Aquila pennata, and short-toed snake eagle Circaetus gallicus. We analyzed daily migratory segments (i.e., the path joining consecutive roosting locations) using data recorded by GPS satellite telemetry. Daily movements of Egyptian vultures and booted eagles were significantly affected by tailwinds during both autumn and spring migrations. In contrast, daily movements of short-toed eagles were only significantly affected by tailwinds during autumn migration. The effect of crosswinds was significant in all cases. Interestingly, Egyptian vultures and booted eagles showed latitudinal differences in their behavior: both species compensated more frequently at the onset of autumn migration and, at the end of the season when reaching their wintering areas, the proportion of drift segments was higher. In contrast, there was a higher drift at the onset of spring migration and a higher compensation at the end. Our results highlight the effect of wind patterns on the migratory routes of soaring raptors, with different outcomes in relation to species, season, and latitude, ultimately shaping the loop migration patterns that current tracking techniques are showing to be widespread in many long distance migrants. PMID:29491895
African Journals Online (AJOL)
Campbell Murn
Traders identified the following traits ascribed to vulture remains: treatment of epilepsy, insanity, stroke, ease of delivery in women, spiritual protection against witches and witchcraft, evil spirits, good luck (during gambling, money doubling, competition, contest), to stimulate walking in infants, and to gain supernatural powers.
Czech Academy of Sciences Publication Activity Database
Heneberg, P.; Dolinay, Matej; Matušík, H.; Pfeiffer, T.; Nachtigall, W.; Bizos, J.; Šimčíková, D.; Literák, I.
2016-01-01
Roč. 11, č. 7 (2016), č. článku 159202. E-ISSN 1932-6203 Institutional support: RVO:68081766 Keywords : Old-World vultures * mitochondrial DNA * harriers circus * bird * gene * sterility * Eagles * hybridization * phylogeny Subject RIV: EG - Zoology Impact factor: 2.806, year: 2016
SHORT COMMUNICATIONS, NOTES AND REPORTS Record of ...
African Journals Online (AJOL)
Campbell Murn
50. SHORT COMMUNICATIONS, NOTES AND. REPORTS. Record of Cinereous Vulture Aegypius monachus from Mukundara Hills Tiger Reserve, Rajasthan,. India. Sailaja Nayak1*, Sunny Shah2 and Jimmy Borah2 .... Prey status and abundance in Mukundara Hills Tiger. Reserve. Technical Report, WWF-India. Rao, J.P. ...
African Journals Online (AJOL)
ZeldaH
better method than a bird carrying us up to the heavens. ... on the Gulf of Khambhat at 250 km north of Mumbai .... connected to the war-god Ares, and thus affiliated to .... The role of vultures in the disposal of human corpses in India and. Tibet.
African Journals Online (AJOL)
Migrants tended to fly higher in more stable air than local birds, which often fly low over the forest canopy .... Flapping rate of Turkey Vultures as a function of cloud cover in Costa Rica, autumn 2003. Data are ... layer in order to search for food.
Judging the urgency of non-verbal auditory alarms: a case study.
Arrabito, G Robert; Mondor, Todd; Kent, Kimberley
2004-06-22
When designed correctly, non-verbal auditory alarms can convey different levels of urgency to the aircrew, and thereby permit the operator to establish the appropriate level of priority to address the alarmed condition. The conveyed level of urgency of five non-verbal auditory alarms presently used in the Canadian Forces CH-146 Griffon helicopter was investigated. Pilots of the CH-146 Griffon helicopter and non-pilots rated the perceived urgency of the signals using a rating scale. The pilots also ranked the urgency of the alarms in a post-experiment questionnaire to reflect their assessment of the actual situation that triggers the alarms. The results of this investigation revealed that participants' ratings of perceived urgency appear to be based on the acoustic properties of the alarms which are known to affect the listener's perceived level of urgency. Although for 28% of the pilots the mapping of perceived urgency to the urgency of their perception of the triggering situation was statistically significant for three of the five alarms, the overall data suggest that the triggering situations are not adequately conveyed by the acoustic parameters inherent in the alarms. The pilots' judgement of the triggering situation was intended as a means of evaluating the reliability of the alerting system. These data will subsequently be discussed with respect to proposed enhancements in alerting systems as it relates to addressing the problem of phase of flight. These results call for more serious consideration of incorporating situational awareness in the design and assignment of auditory alarms in aircraft.
Serologic evidence of exposure of raptors to influenza A virus.
Redig, Patrick T; Goyal, Sagar M
2012-06-01
Serum or plasma samples from raptors that prey or scavenge upon aquatic birds were tested by a commercially available blocking enzyme-linked immunosorbent assay for the evidence of antibodies to influenza A virus. Samples were taken from birds (n = 616) admitted to two rehabilitation centers in the United States. In addition, samples from 472 migrating peregrine falcons (Falco peregrinus) trapped on autumnal and vernal migrations for banding purposes were also tested. Only bald eagles were notably seropositive (22/406). One each of peregrine falcon, great horned owl (Bubo virginianus), and Cooper's hawk (Accipiter cooperi) from a total of 472, 81, and 100, respectively, were also positive. None of the turkey vultures (n = 21) or black vultures (n = 8) was positive. No clinical signs referable to avian influenza were seen in any bird at the time of capture. These data indicate that, among raptors, bald eagles do have exposure to influenza A viruses.
Items of interest from recent ornithological literature
African Journals Online (AJOL)
Molecular Phylogenetics and Evolution 37: 327-346. ii) Helbig, A.J., Kocum, A., Seibold, I. & Braun, M.J. 2005. A multi-gene phylogeny of aquiline eagles ... Genera: Gypohierax, Neophron and Gypaetus (Palm-nut and. Egyptian Vultures and Lammergeier) iv. Perninae: Kites that specialise on insects, bees or wasp larvae.
Validation of the EU Environmental Risk Assessment for Veterinary Medicines
Montforts, M.H.M.M.
2005-01-01
An alarming decline of vulture populations (up to 95%) in Pakistan in the late 1990’s has recently been attributed to the use of the anti-inflammatory drug diclofenac in cattle. Several species are now threatened with extinction, a tragedy that demonstrates that an environmental risk assessment of
African Journals Online (AJOL)
Wildlife and Environmental Society of Malawi, Blantyre. Lipiya, A. 2011. Status of Birds of Prey, with Special Emphasis on Vultures, in Kasungu. National Park. Unpublished report. Department of National Parks and Wildlife,. Lilongwe. 5pp. MacDonald, L. 2011. Recent Sightings. Vocifer. A Bulletin of Ornithological News in.
African Journals Online (AJOL)
Items 1 - 50 of 154 ... Vol 68, No 1 (2015), A preliminary assessment of the palate and tongue for detecting organophosphorus and carbamate pesticide exposure in the degraded carcasses of vultures and other animals, Abstract PDF PDF. Ngaio L Richards, Irene Zorilla, Isabel Fernandez, Monica Calvino, Joaquin Garcia, ...
The 20TH Annual Intelligent Ground Vehicle Competition: Building a Generation of Robotists
2012-11-26
advisors as an excellent multidisciplinary design experience for student teams, and a number of engineering schools give credit in senior design courses...Indian Institute of Technology, Bombay IIT Bombay 1044.00 7 U.S. Naval Academy Robo -Goat 1041.67 8 Lawrence Technological University vuLTUre 2 1033.67
California condors spotted nesting in Big Spur | San Hose Mercury ...
African Journals Online (AJOL)
California condors spotted nesting in Big Spur. Associated Press San Hose Mercury News. Abstract. No Abstract. Vulture News Vol. 55, 2006: 59. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL.
Impact of Kite String Injuries and Temporal Variation in Type of ...
African Journals Online (AJOL)
campbell
patterns. Results and Discussion. Injuries caused by Kite Strings. (KSI), dehydration and visceral gout have been the major causes of rescues/mortalities in Ahmadabad and the White-rumped Vulture. (WRV) colonies in the surrounding areas (Muralidharan et al. 2010;. Roy 2011). A total of 108 live/dead WRVs have been.
African Journals Online (AJOL)
Thomson, Ian. Vol 70 (2016) - Articles King Vulture (Sarcoramphus papa) scavenging at green turtle (Chelonia mydas) carcasses in Tortuguero National Park, Costa Rica Abstract PDF. ISSN: 1606-7479. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about ...
African Journals Online (AJOL)
Cutler, Kat. Vol 70 (2016) - Articles King Vulture (Sarcoramphus papa) scavenging at green turtle (Chelonia mydas) carcasses in Tortuguero National Park, Costa Rica Abstract PDF. ISSN: 1606-7479. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL ...
自然発症高血圧ラットにおける釣藤散の抗高血圧作用 : 釣藤鈎及び石膏の役割について
趙, ??; 渡辺, 裕司; 村上, 孝寿; 東田, 道久; 松本, 欣三; Zhao, QI; Hiroshi, WATANABE; Yukihisa, MURAKAMI; Michihisa, TOHDA; Kinzo, MATSUMOTO; 富山医科薬科大学 和漢薬研究所 生物試験部門; 富山医科薬科大学 和漢薬研究所 生物試験部門; 富山医科薬科大学 和漢薬研究所 生物試験部門; 富山医科薬科大学 和漢薬研究所 生物試験部門; 富山医科薬科大学 和漢薬研究所 生物試験部門
2002-01-01
To clarify a role of Chotoko (Uncaria sp.) and gypsum in the anti-hypertensive effect of a Kampo prescription Choto-san (Diao-Teng-San), we investigated effects of Choto-san except Chotoko or gypsum, Chotoko alone and gyp-sum alone on the blood pressure and the heart rate in spontaneously hypertensive rats (SHR). Choto-san (0.5, 1.0 and 2.0 g/kg, p.o.) produced a dose-dependent hypotensive effect, but did not affect the heart rate in SHR. It affected neither blood pressure nor heart rate in n...
Updated vegetation information in high resolution WRF simulations
DEFF Research Database (Denmark)
Nielsen, Joakim Refslund; Dellwik, Ebba; Hahmann, Andrea N.
2013-01-01
modify the energy distribution at the land surface. In weather and climate models it is important to represent the vegetation variability accurately to obtain reliable results. The weather research and forecasting (WRF) model uses green vegetation fraction (GVF) time series to represent vegetation...... seasonality. The GVF of each grid cell is additionally used to scale other parameters such as LAI, roughness, emissivity and albedo within predefined intervals. However, the default GYP used by WRF does not reflect recent climatic changes or change in management practices since it was derived more than 20...
African Journals Online (AJOL)
Reid, Tim. Vol 64 (2013) - Articles New project examining Bearded Vulture movements in southern Africa to inform wind turbine placement. Abstract PDF. ISSN: 1606-7479. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms ...
Raptor population decline in West Africa | Thiollay | Ostrich: Journal ...
African Journals Online (AJOL)
The roadside counts conducted in 1969–1973 through Burkina Faso, Mali, Niger and northern Cameroon (9 712km) were repeated in 2000–2004 by the same observer, using the same methods, during the same season. Overall, 28 837 Falconiforms from 51 species were recorded. The four large vultures decreased ...
Variability in morphology of Microsphaera alphitoides Griffon et Maubl. in Poland
Directory of Open Access Journals (Sweden)
Krzysztof Ufnalski
2011-01-01
Full Text Available The aim of this study was to verify descriptions of the morphology of the fungus responsible for powdery mildew on oak leaves of nursery seedlings and of young trees in forest stands. Infected, fully developed leaves from apical parts of stems of Quercus robur or Q. petraea were collected in two national parks and in six forest districts in Poland. The taxonomic characteres of all specimens were generally consistent with those given in keys for Microsphaera alphitoides. However, the limoniform shape of conidia, characteristic of two sites (nurseries, has not been found in available synopses. Limoniform conidia were significantly longer and wider than others. Agreat variety of forms of mycelium on leaves were observed. The mycelium appeared in three forms: (1 floccose or felted oval patches (always with yellow or brown discoloration, (2 faveolate oval patches (often with yellow or brown discoloration, and (3 felted or mealy mycelium along veins (rarely with discoloration. Mycelium without limoniform conidia appeared in all forms, while mycelium with limoniform conidia appeared only in the form of patches, always causing leaf discoloration.
VULTURE SNIPPETS FROM AROUND THE WORLD
African Journals Online (AJOL)
2007-09-02
Sep 2, 2007 ... roof of this structure the bottom of their nest. As the palm sheds its .... It is fairly flat area, 900-1100 m ... Drinie van Rensburg; e-mail address: driniev@wrc.org.za. Buzzards foil .... be about three feet tall, weigh up to 30 pounds ...
VULTURE SNIPPETS FROM AROUND THE WORLD
African Journals Online (AJOL)
2007-03-01
Mar 1, 2007 ... We spent a week in the Kruger National ... minutes, they started taking off without ... Kundian near Mianwali in three months, ... Some more links to articles about lead poisoning and California .... which also kill the condors.
African Journals Online (AJOL)
Campbell, Michael O'Neal. Vol 66 (2014) - Articles The impact of urbanization and agricultural development on vultures in El Salvador Abstract PDF. ISSN: 1606-7479. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and ...
« Nouveaux servages » et société en Europe (XIIIe-XXe siècle
Directory of Open Access Journals (Sweden)
Nicolas Carrier
2008-07-01
Full Text Available Ces trois journées de colloque ont rassemblé près d’une centaine de personnes, universitaires, étudiants et membres des sociétés savantes, dans la tradition des colloques de l’AHSR, association qui vise à rassembler les publics les plus variés autour de thématiques d’histoire rurale, tout en restant au plus haut niveau scientifique. Ce sont tantôt les superbes locaux du Fort Griffon de Besançon, mis à disposition par l’IUFM de Franche-Comté, qui ont accueilli les participants, tantôt le musée...
Zone-tailed Hawk (Buteo albonotatus)
Scott H. Stoleson; Giancarlo Sadoti
2010-01-01
The Zone-tailed Hawk (Buteo albonotatus) might well be dubbed "the Great Pretender" because it so closely resembles the ubiquitous Turkey Vulture (Cathartes aura) in appearance and behavior as to be frequently mistaken for it. In the border regions where it lives, it may be confused as well with another "Mexican" raptor, the Common Black-Hawk (...
Malaria Epidemics in Dembia, Northwest Ethiopia 1952 – 1953
African Journals Online (AJOL)
unhcc
result, dead bodies were reportedly devoured by dogs and wild animals. That was particularly the case when domestic servants died. They were left in the open field to be eaten by vultures, dogs, and hyenas. Some of the lucky ones were .... had fever and enormous swelling of the spleen and nearly all of them had serious ...
African Journals Online (AJOL)
2006-03-02
Mar 2, 2006 ... perch sites utilized by the adult Turkey. Vultures before landing on the entrance ledge at the BMW Nest could not be seen by the nestlings. Therefore, at the BMW nest the only contact between the adult on perch sites and young in the pit was auditory. On day 25 post hatch the nestlings appeared to respond.
SHORT COMMUNICATIONS, NOTES AND REPORTS
African Journals Online (AJOL)
Campbell Murn
1976). Among raptors there are those species where only the female incubates, those where the male may also incubate for short to longer periods, and those in which females and males equally share the incubation (Newton 1979). It is well known that both sexes incubate the clutch in vultures, both in the wild (Mundy et al.
Book Review – Wildlife Forensic Investigation
African Journals Online (AJOL)
Campbell Murn
Wildlife crime is an increasingly serious issue for populations of both threatened and common species in many parts of the world. In particular, the use of poisons and other toxic chemicals are one of the greatest threats to vultures in many parts of the world, especially in. Africa. Often, one of the key difficulties in prosecuting ...
Organ procurement: let's presume consent
Moustarah, F
1998-01-01
IN WINNING FIRST PRIZE in the Logie Medical Ethics Essay Contest in 1997, Dr. Fady Moustarah made a strong and compelling argument in favour of presumed consent in the procurement of donor organs. He stressed that a major education campaign will be needed when such a policy is adopted lest some people begin to regard physicians as "organ vultures."
Arbulu Ruiz, Sara
2016-01-01
El trabajo desarrollado en esta tesis doctoral ha empleado técnicas de microbiología y bioquímica clásicas, así como técnicas recientes de ingeniería genética, genómica y proteómica y describe en capítulos diferenciados, los siguientes objetivos: En el capítulo III, se describe la identificación y caracterización de bacterias lácticas (BAL) aísladas de heces de buitres leonados (Gyps fulvus subesp. fulvus) por su actividad antimicrobiana, genes que codifican bacteriocinas, factores potenciale...
Environmental Assessment of Demolition Activities at Dover Air Force Base, Delaware
2003-11-01
Setophaga ruticilla), broad- winged hawk (Buteo platypterus), cliff swallow (Petrochelidon pyrrhonota), bank swallow ( Riparia riparia ), black vulture...Explosive safety-quantity distance (QD) zones are designated areas designed to safeguard the base population and civilian community from potential...explosions. These clear zones include the area within a safety arc surrounding an explosive storage facility. The QD zones at Dover AFB encompass
African Journals Online (AJOL)
2007-09-02
Sep 2, 2007 ... Summary. I collected data over six field seasons (34 ½ wks) between 1994-2000 at Hato Las. Nieves in northwestern Bolívar state, Venezuela. A mean of 6.4 King Vultures. (Sarcoramphus papa) ± 4.9 SD (range = 2-15) searched in flight for jaguar (Panthera onca) or remains of kills and were present at or ...
Prevalence of encysted apicomplexans in muscles of raptors.
Lindsay, D S; Blagburn, B L
1999-01-28
An acid-pepsin digestion technique was used to examine portions of breast muscle and heart from raptors for encysted protozoans. Apicomplexan zoites were present in 52 (45.6%) of the 114 samples examined: 11 of 12 (91.7%) red-shouldered hawks (Buteo lineatus), 20 of 34 (58.8%) red-tailed hawks (Buteo jamaicensis), two of seven (28.6%) Cooper's hawks (Accipiter cooperi), three of four (75%) sharp-shinned hawks (Accipiter striatus), one (100%) Mississippi kites (Ictinia misisippiensis), one of two (50%) American kestrels (Falco sparverius), one bald eagle (Haliaeetus leucocephalus), one of two (50%) golden eagles (Aquila chrysaetos), one of three (33%) turkey vultures (Cathartes aura), two of three (66.7%) black vultures (Coragyps atratus), three of six (50%) great-horned owls (Bubo virginianus), five of 15 (33.3%) barred owls (Strix varia), and one of 12 (8.3%) screech owls (Asio otus). Encysted protozoans were not observed in digests of tissues from three broad-winged hawks (Buteo platypterus), four ospreys (Pandion haliaetus), and five barn owls (Tyto alba). Apicomplexan cysts resembling Sarcocystis species were observed in tissue sections of muscles from 28 (37.8%) of 74 raptors.
Directory of Open Access Journals (Sweden)
Poirazidis, K.
2007-12-01
Full Text Available In this study the nest-site selection patterns of four tree-nesting sympatric raptor species in Dadia National Park (Greece were compared in order to provide a sound conservation tool for their long-term management in the area. The species studied were the Black vulture (Aegypius monachus, the Lesser-spotted eagle (Aquila pomarina, the Booted eagle (Hieraaetus pennatus and the Goshawk (Accipiter gentilis. Twenty-six variables illustrating the landscape context and vegetation structure of nesting sites were analysed. Multivariate-ANOVA and Discriminant Function Analysis were used to test for significant differentiations in nest-site characteristics among the species. The species studied were initially differentiated by geomorphology and distance to foraging areas. Once these were determined their nesting areas were established according to forest structure. Our results indicate that forest management should integrate the preservation of mature forest stands with sparse canopy and forest heterogeneity in order to conserve suitable nesting habitats for the raptors. Specific conservation measures such as restriction of road construction should be implemented in order to protect the active nests and provisions should be made for adequate nesting sites for the Black vulture, which is sensitive to human disturbance.
Improving conservation outcomes with insights from local experts and bureaucracies.
Haenn, Nora; Schmook, Birgit; Reyes, Yol; Calmé, Sophie
2014-08-01
We describe conservation built on local expertise such that it constitutes a hybrid form of traditional and bureaucratic knowledge. Researchers regularly ask how local knowledge might be applied to programs linked to protected areas. By examining the production of conservation knowledge in southern Mexico, we assert local expertise is already central to conservation. However, bureaucratic norms and social identity differences between lay experts and conservation practitioners prevent the public valuing of traditional knowledge. We make this point by contrasting 2 examples. The first is a master's thesis survey of local experts regarding the biology of the King Vulture (Sarcoramphus papa) in which data collection took place in communities adjacent to the Calakmul Biosphere Reserve. The second is a workshop sponsored by the same reserve that instructed farmers on how to monitor endangered species, including the King Vulture. In both examples, conservation knowledge would not have existed without traditional knowledge. In both examples, this traditional knowledge is absent from scientific reporting. On the basis of these findings, we suggest conservation outcomes may be improved by recognizing the knowledge contributions local experts already make to conservation programming. © 2014 Society for Conservation Biology.
Screening of new British thraustochytrids isolates for docosahexaenoic acid (DHA) production.
Marchan, Loris Fossier; Lee Chang, Kim J; Nichols, Peter D; Polglase, Jane L; Mitchell, Wilfrid J; Gutierrez, Tony
2017-01-01
Thraustochytrids isolated from hot tropical and sub-tropical waters have been well studied for DHA and biodiesel production in the last decades. However, little research has been performed on the oils of cold water thraustochytrids, in particular from the North Sea region. In this study, thraustochytrid strains from British waters showed high relative levels of omega-3 long-chain (≥C 20 ) polyunsaturated fatty acids (LC-PUFA), including docosahexaenoic acid (DHA, 22:6ω3). The relative levels of DHA (as % of total fatty acids, TFA) in the different British strains are hitherto amongst the highest recorded from any thraustochytrid screening study, with strain TL18 reaching up to 67% DHA in modified Glucose-Yeast Extract-Peptone (GYP) medium. At this screening stage, low final biomass and fatty acid yield were observed in modified GYP and MarChiquita-Brain Heart Broth (MCBHB), while PUFA profiles (as % of PUFA) remained unaltered regardless of the culture medium used. Hence, optimizing the medium and culture conditions to improve growth and lipid content, without impacting the relative percentage of DHA, has the potential to increase the final DHA concentration. With this in mind, three strains were identified as promising organisms for the production of DHA. In the context of possible future industrial exploitation involving a winterization step, we investigated the recycling of the residual oil for biodiesel use. To do this, a mathematical model was used to assess the intrinsic properties of the by-product oil. The results showed the feasibility of producing primary DHA-rich oil, assuming optimized conditions, while using the by-product oil for biodiesel use.
Assessing allowable take of migratory birds
Runge, M.C.; Sauer, J.R.; Avery, M.L.; Blackwell, B.F.; Koneff, M.D.
2009-01-01
Legal removal of migratory birds from the wild occurs for several reasons, including subsistence, sport harvest, damage control, and the pet trade. We argue that harvest theory provides the basis for assessing the impact of authorized take, advance a simplified rendering of harvest theory known as potential biological removal as a useful starting point for assessing take, and demonstrate this approach with a case study of depredation control of black vultures (Coragyps atratus) in Virginia, USA. Based on data from the North American Breeding Bird Survey and other sources, we estimated that the black vulture population in Virginia was 91,190 (95% credible interval = 44,520?212,100) in 2006. Using a simple population model and available estimates of life-history parameters, we estimated the intrinsic rate of growth (rmax) to be in the range 7?14%, with 10.6% a plausible point estimate. For a take program to seek an equilibrium population size on the conservative side of the yield curve, the rate of take needs to be less than that which achieves a maximum sustained yield (0.5 x rmax). Based on the point estimate for rmax and using the lower 60% credible interval for population size to account for uncertainty, these conditions would be met if the take of black vultures in Virginia in 2006 was < 3,533 birds. Based on regular monitoring data, allowable harvest should be adjusted annually to reflect changes in population size. To initiate discussion about how this assessment framework could be related to the laws and regulations that govern authorization of such take, we suggest that the Migratory Bird Treaty Act requires only that take of native migratory birds be sustainable in the long-term, that is, sustained harvest rate should be < rmax. Further, the ratio of desired harvest rate to 0.5 x rmax may be a useful metric for ascertaining the applicability of specific requirements of the National Environmental Protection Act.
do Amaral, Fabio S Raposo; Miller, Matthew J; Silveira, Luís Fábio; Bermingham, Eldredge; Wajntal, Anita
2006-01-01
Abstract Background The family Accipitridae (hawks, eagles and Old World vultures) represents a large radiation of predatory birds with an almost global distribution, although most species of this family occur in the Neotropics. Despite great morphological and ecological diversity, the evolutionary relationships in the family have been poorly explored at all taxonomic levels. Using sequences from four mitochondrial genes (12S, ATP8, ATP6, and ND6), we reconstructed the phylogeny of the Neotro...
Margalida, Antoni; Colomer, M? ?ngels; Oro, Daniel; Arlettaz, Rapha?l; Don?zar, Jos? A.
2015-01-01
The removal of eggs or chicks from wild populations to create captive populations, reinforce free-ranging populations or reintroduce species into the wild is a restoration tool that requires an assessment of potential detrimental effects upon the donor population. This is an absolute prerequisite when wild donor populations are scarce and small. Here, we forecast the population trend of the largest European population of the bearded vulture (Gypaetus barbatus) over the next 30 years under dif...
U. S. Pacific Fleet. Central Pacific Force. Operation Plan Number Cen 1-43
1943-10-25
Wareagle Snowflake Stork Beagle v Jocko Bagdad Frolic Locust Tycoon Vulture Dodger Husky Trojan Harpoon Designation or Commander A-II-2 COMM. A...Tiptop Killnrney Saskatoon Dodger Boar lake Titvdllow Beagle Huniboldt Moonglow Raiiisgate COIJ2!. A-II GOMI. A-II OPERATIONfPI^M No. Cen 1-43 ANNEX A...Daytona Decatur Delaware Denmark Del Rio Democrat DeSoto Dingbct Dodger Dogwood Dolores Ship or Unit TG 54.1 CTG 54.6 CTF 51 LST 78 Hq
Seasonal and circadian biases in bird tracking with solar GPS-tags
Silva, Rafa; Afán, Isabel; Gil, Juan A.; Bustamante, Javier
2017-01-01
Global Positioning System (GPS) tags are nowadays widely used in wildlife tracking. This geolocation technique can suffer from fix loss biases due to poor satellite GPS geometry, that result in tracking data gaps leading to wrong research conclusions. In addition, new solar-powered GPS tags deployed on birds can suffer from a new "battery drain bias" currently ignored in movement ecology analyses. We use a GPS tracking dataset of bearded vultures (Gypaetus barbatus), tracked for several years...
Wind farms threaten southern Africa's cliff-nesting vultures ...
African Journals Online (AJOL)
active selection for ridge tops and upper slopes), and that both species generally fly at heights within the rotor-sweep of a typical, modern wind turbine. We constructed a population viability model using actual population data from the area presently ...
New project examining Bearded Vulture movements in southern ...
African Journals Online (AJOL)
campbell
southern Africa to inform wind turbine placement. Tim Reid. 1. , Sonja Krüger. 1,2 and Arjun Amar. 1. 1. Percy FitzPatrick Institute of African Ornithology, DST/NRF Centre of. Excellence, Dept. of Biological Sciences, University of Cape Town,. Rondebosch 7701, South Africa. 2. Ezemvelo KwaZulu-Natal Wildlife, P.O. Box ...
Unearthing poison use and consequent anecdotal vulture mortalities ...
African Journals Online (AJOL)
Aldicarb or carbofuran were the most commonly used poisons, but strychnine is still used by about one farmer out of 10. Poison is typically used by means of distributing poisoned baits in the landscape. Furthermore, willingness to use poison in the future was highest for farmers who own large properties with high livestock ...
Prevalence of encysted Toxoplasma gondii in raptors from Alabama.
Lindsay, D S; Smith, P C; Hoerr, F J; Blagburn, B L
1993-12-01
Little is known about the prevalence of encysted Toxoplasma gondii in wild birds. We examined the hearts and breast muscles from 101 raptors for encysted T. gondii. All of the raptors had been submitted for necropsy to the State Veterinary Diagnostic Laboratory, Auburn, Alabama. Tissues were digested in acid-pepsin solution and inoculated into groups of 3-5 laboratory mice. Toxoplasma gondii was isolated from 27 of 101 (26.7%) raptors: 8 of 12 (66.7%) red-shouldered hawks (Buteo lineatus), 13 of 27 (41.1%) red-tailed hawks (Buteo jamaicensis), 1 of 4 (25%) Cooper's hawks (Accipiter cooperi), 1 of 5 (20%) great horned owls (Bubo virginianus), 4 of 15 (26.7%) barred owls (Strix varia), and 1 of 3 (33.3%) kestrels (Falco sparverius). Toxoplasma gondii was not isolated from 3 broad-winged hawks (Buteo platypterus), 3 sharp-shinned hawks (Accipiter striatus), 6 barn owls (Tyto alba), 9 screech owls (Asio otus), a Mississippi kite (Ictinia misisippiensis), 2 golden eagles (Aquila chrysaetos), a bald eagle (Haliaeetus leucocephalus), 4 ospreys (Pandion haliaetus), 4 turkey vultures (Cathartes aura), or 2 black vultures (Coragyps atratus). No significant difference (P > 0.05) in prevalence was detected based on sex using chi-square analysis. Chi-square analysis of the data demonstrated that adult raptors had encysted stages of T. gondii significantly (P < 0.05) more often than did immature raptors.
Straub, Mary H.; Kelly, Terra R.; Rideout, Bruce A.; Eng, Curtis; Wynne, Janna; Braun, Josephine; Johnson, Christine K.
2015-01-01
Throughout the world, populations of scavenger birds are declining rapidly with some populations already on the brink of extinction. Much of the current research into the factors contributing to these declines has focused on exposure to drug residues, lead, and other toxins. Despite increased monitoring of these declining populations, little is known about infectious diseases affecting scavenger bird species. To assess potential infectious disease risks to both obligate and facultative scavenger bird species, we performed a serosurvey for eleven potential pathogens in three species of scavenging birds in California: the California condor (Gymnogyps californianus), turkey vulture (Cathartes aura) and golden eagle (Aquila chrysaetos). California condors were seropositive for avian adenovirus, infectious bronchitis virus, Mycoplasma gallisepticum, avian paramyxovirus-2, West Nile virus (WNV) and Toxoplasma gondii. Golden eagles were seropositive for avian adenovirus, Chlamydophila psittaci and Toxoplasma gondii, and turkey vultures were seropositive for avian adenovirus, Chlamydophila psittaci, avian paramyxovirus-1, Toxoplasma gondii and WNV. Risk factor analyses indicated that rearing site and original release location were significantly associated with a positive serologic titer to WNV among free-flying condors. This study provides preliminary baseline data on infectious disease exposure in these populations for aiding in early disease detection and provides potentially critical information for conservation of the endangered California condor as it continues to expand its range and encounter new infectious disease threats. PMID:26606755
Martínez, Omar; Maillard Z., Oswaldo; Vedia-Kennedy, Javier; Herrera, Mauricio; Mesili, Thibeault; Rojas, Abraham
2011-01-01
Se relevó la avifauna de 11 localidades en el Parque Nacional y Área Natural de Manejo Integrado Serranía del Aguaragüe, provincia Gran Chaco, departamento de Tarija, Bolivia. Fueron registradas en total 272 especies de aves, 5 de ellas amenazadas (Buteogallus coronatus, Ara militaris, Amazona tucumana, Vultur gryphus y Buteogallus solitarius). Se incluye el registro de 11 especies nuevas para el departamento de Tarija y de 14 que eran conocidas por pocos registros. Se registraron 29 especies...
SU-F-T-447: The Impact of Treatment Planning Methods On RapidPlan Modeling for Rectum Cancer
Energy Technology Data Exchange (ETDEWEB)
Lu, S; Peng, J; Li, K; Wang, J; Hu, W [Fudan University Shanghai Cancer Center, Shanghai, Shanghai (China)
2016-06-15
Purpose: To investigate the dose volume histogram (DVH) prediction varieties based on intensity modulate radiotherapy (IMRT) plan or volume arc modulate radiotherapy (VMAT) plan models on the RapidPlan. Methods: Two DVH prediction models were generated in this study, including an IMRT model trained from 83 IMRT rectum plans and a VMAT model trained from 60 VMAT rectum plans. In the internal validation, 20 plans from each training database were selected to verify the clinical feasibility of the model. Then, 10 IMRT plans (PIMRT-by-IMRT-model) generated from IMRT model and 10 IMRT plans generated from VMAT model (PIMRT-by-VMAT-model) were compared on the dose to organs at risk (OAR), which included bladder, left and right femoral heads. The similar comparison was also performed on the VMAT plans generated from IMRT model (PVMAT-by-IMRT-model) and VMAT plans generated from VMAT (PVMAT-by-VMAT-model) model. Results: For the internal validation, all plans from IMRT or VMAT model shows significantly improvement on OAR sparing compared with the corresponded clinical ones. Compared to the PIMRT-by-VMAT-model, the PIMRT-by-IMRT-model has a reduction of 6.90±3.87%(p<0.001) on V40 6.63±3.62%(p<0.001) on V45 and 4.74±2.26%(p<0.001) on V50 in bladder; and a mean dose reduction of 2.12±1.75Gy(p=0.004) and 2.84±1.53Gy(p<0.001) in right and left femoral head, respectively. There was no significant difference on OAR sparing between PVMAT-by-IMRT-model and PVMAT-by-VMAT-model. Conclusion: The IMRT model for the rectal cancer in the RapidPlan can be applied to for VMAT planning. However, the VMAT model is not suggested to use in the IMRT planning. Cautions should be taken that the planning model based on some technique may not feasible to other planning techniques.
Lactic acid production by irradiated Bacillus NF17 and poly-L-lactate biopolymer formation
International Nuclear Information System (INIS)
Tongpim, Saowanit; Poonsawat, Choosak; Khansawai, Paveena; Piadaeng, Nattaya
2006-09-01
This study was conducted to manipulate the thermo tolerant, lactic acid-producing bacteria, Bacillus coagulans strain NF 1 7, in the production of L-lactic acid and a bio polymer: poly-L-lactate. The bacterial isolate NF 1 7 kept in the culture collection of Khon Kaen University and could tolerate high temperature and produce lactic acid, was employed in this research work. Cell suspension of isolate NF 1 7 was exposed to gamma irradiation at various doses (1-5 KGy). The irradiated survivors were screened on the basis of forming larger colonies and clear zones than the parent strain NF 1 7 when grown on Glucose-Yeast extract-Peptone (GYP) containing CaCO 3 . We obtained 55 effective isolates which the isolate L5I2-14(5), designated as K 1 4, was chosen together with the parent strain NF 1 7 for fermentation experiments. Each bacterial strain was inoculated into GYP broth and incubated statically at 50 o C with daily pH neutralization. After 5 days of incubation, the isolate K 1 4 and NF 1 7 produced 9.71 g/l and 7.42 g/l of L-lactic acid, respectively with a small amount of D-lactic acid. Lactic acid production from sugar cane molasses by batch fermentation of Bacillus Sp. K 1 4 was carried out in a 7 l jar fermentor containing 5 l of fermentation medium. It was found that 20% molasses with the agitation speed of 100 rpm gave the highest yield of lactic acid. Poly-L-lactic acid was chemically polymerized by bulk polymerization process at 140 o C under 40 mmHg conditions. We could obtain the off-white polymer in a small amount of powder form. Improvement the yield of poly-L-lactic acid would be achieved by using polyisoprene-g-polyvinyl monomer to separate lactic acid from the fermenting liquid prior to polymerization processes
The power of poison: pesticide poisoning of Africa's wildlife.
Ogada, Darcy L
2014-08-01
Poisons have long been used to kill wildlife throughout the world. An evolution has occurred from the use of plant- and animal-based toxins to synthetic pesticides to kill wildlife, a method that is silent, cheap, easy, and effective. The use of pesticides to poison wildlife began in southern Africa, and predator populations were widely targeted and eliminated. A steep increase has recently been observed in the intensity of wildlife poisonings, with corresponding population declines. However, the majority of poisonings go unreported. Under national laws, it is illegal to hunt wildlife using poisons in 83% of African countries. Pesticide regulations are inadequate, and enforcement of existing legislation is poor. Few countries have forensic field protocols, and most lack storage and testing facilities. Methods used to poison wildlife include baiting carcasses, soaking grains in pesticide solution, mixing pesticides to form salt licks, and tainting waterholes. Carbofuran is the most widely abused pesticide in Africa. Common reasons for poisoning are control of damage-causing animals, harvesting fish and bushmeat, harvesting animals for traditional medicine, poaching for wildlife products, and killing wildlife sentinels (e.g., vultures because their aerial circling alerts authorities to poachers' activities). Populations of scavengers, particularly vultures, have been decimated by poisoning. Recommendations include banning pesticides, improving pesticide regulations and controlling distribution, better enforcement and stiffer penalties for offenders, increasing international support and awareness, and developing regional pesticide centers. © 2014 New York Academy of Sciences.
A lightweight portable, walk-in trap for catching vultures
African Journals Online (AJOL)
Two holes are drilled through the tubing and the piece of wood is attached to the tubing using 8.7 cm screws (Figure. 3). The location of the latch on the ... lightweight, walk-in trap, with door (shaded area) open, small black square shows location of gate latch. Figure 3. Close-up of gate latch. (photograph: David R. Barber).
Mighty vulture back from near extinction Austrian project breeds ...
African Journals Online (AJOL)
2007-03-02
Mar 2, 2007 ... Alpine roosts. Today, however, the bone crusher is soaring toward a comeback as the continent's most ambitious – and priciest – wildlife reintroduction project achieves small but biologically significant success. The species was hunted nearly to extinction in the Alps by the start of the 20th century, mainly by ...
Poison blamed for decline of Spain's majestic Black Vultures
African Journals Online (AJOL)
2007-03-01
catastrophic” decline in numbers because of illegal poisoning by hunters. The use of poisoned bait to kill foxes, badgers, wild dogs, feral cats and smaller birds of prey has reduced the population by almost a half in the past decade,.
Directory of Open Access Journals (Sweden)
Lydston Rodrigues de Carvalho
2003-07-01
Full Text Available Strict and facultative culturable anaerobic bacteria from the digestive tract of six American black vultures (Coragyps atratus Bechstein 1793 were isolated and identified. After capture, the birds received a non-contaminated diet for one week to eliminate possible allochthonous microorganisms. Then, specimens collected from tongue, stomach and intestines were weighed, submitted to decimal dilution in an anaerobic chamber, inoculated into culture media and incubated aerobically and anaerobically at 37ºC for enumeration, isolation and identification. Isolated bacteria were submitted to tests to detect possible antagonisms between them. The total bacterial population along the digestive tract ranged from 3.46 ± 0.39 log CFU/g in the stomach to 10.75 ± 0.37 log CFU/g in the distal intestine. Some bacteria were isolated for the first time from the digestive tract of C. atratus: Actinomyces bovis, Lactobacillus cellobiosus, Micrococcus luteus, Neisseria sicca, Clostridium bifermentans, Enterobacter agglomerans, Peptostreptococcus sp., Sarcina sp., Serratia odorifera, and Shigella flexneri. Associations between microorganisms were observed during isolation on two occasions, one involving A. bovis and N. sicca, and the other involving A. bovis and a Gram-negative rod. Hetero-, iso- and autoantagonisms were observed, suggesting the ecological role of these indigenous microorganisms in terms of population auto-control and environmental barrier in the digestive tract of carrion-feeding birds.As bactérias anaeróbias estritas e facultativas cultiváveis do trato digestivo de seis urubus (Coragyps atratus Bechstein 1793 foram isoladas e identificadas. Após a captura, as aves receberam uma alimentação de baixa contaminação durante uma semana para eliminar possíveis microorganismos alóctonos. A seguir, amostras colhidas na língua, estomago e intestinos foram pesadas, submetidas a diluições decimais numa câmara anaeróbia, inoculadas em meios de
The saga behind a slight change of name – now it is Gyps rueppelli
African Journals Online (AJOL)
Campbell Murn
Hawks and owls of the world: a distributional and taxonomic list. Proceedings Western Foundation Vertebrate Zoology. 3: 295-357. Brehm, A. 1852. Beiträge zur Ornithologie Nord-Ost-Afrika's. Naumannia 2. (3): 38-51. Brehm, A.E. 1882. Historia Natural. Tomo III. Montaner y Simon,. Barcelona. Brown, L. & Amadon, D. 1968.
Directory of Open Access Journals (Sweden)
Maryse Bresson
2011-04-01
Full Text Available Le présent article propose de prolonger le débat sur « La précarité » commencé dans la livraison de SociologieS mise en ligne le 27 septembre 2010. Il met en perspective les analyses d’Henri Eckert et Mircea Vultur, et propose une grille d’analyse de la précarité ou plus exactement, ici, des emplois dits « atypiques ». L’auteure invite à distinguer d’une part, les représentations sociales et les ressentis « subjectifs » des individus ; d’autre part, les processus économiques et sociaux associés aux transformations du marché du travail, afin de mieux articuler ensuite ces deux dimensions, en insistant sur l’enjeu de la norme d’emploi, et sur l’idée « d’entre-deux » proposée comme clé de lecture de la précarité.Precariousness: a pertinent analysis of the standard of employment issues and of "in-between" social situationsThis paper proposes to extend the debate on "Precariousness" started in SociologieS online on September 27, 2010. It puts into perspective analyses of Henry Eckert and Mircea Vultur, and offers an analysis of precariousness, or more precisely, here, jobs as "atypical". The author invites to distinguish, on the one hand, social representations and how individualsfeel subjectively the precariousness; on the other hand, economic and social processes associated to changes in the labour market, in order to better articulate these two dimensions, with particular emphasis on the issue of the standard of employment, and on the idea of "in-between" proposed as a key to reading the precariousness.¿Es la precariedad un concepto pertinente en lo que concierne la problemática del empleo y des situaciones sociales ambiguas?Este artículo es la continuación del debate sobe la precariedad publicado en la red en Sociologies el 27 septiembre de 2010. Pone en perspectiva los análisis de Henri Eckert y de Mircea Vultur y presenta un panel de análisis de la precariedad en particular de los
Blood-borne parasites in the Black Vulture Coragyps atratus in ...
African Journals Online (AJOL)
campbell
varying greatly by species (Kloss et al. 2003, Nogami et al. 2000). Because sampling occurred at an .... of 12 with multiple protozoan genera present. Finding only hemoprotozoans of the genus. Plasmodium is thus concordant with previously established patterns. Also in agreement with previous research is the lack of.
Scavenging and predation by Black Vultures Coragyps atratus at a ...
African Journals Online (AJOL)
Entre un 12% y 17% de los cachorros sufrieron ataques por jotes durante ambas temporadas. Los perros vagos compiten en forma ventajosa con jotes por carroña. Se postula que la redirección de una conducta carroñera mutualista a depredadora, en el jote de cabeza negra, estaría influenciada por estrés alimentario, ...
Directory of Open Access Journals (Sweden)
Fernando Ballejo
2012-11-01
Full Text Available Existen diversos estudios actualísticos en tafonomía sobre restos de presas de diferentes especies de aves raptoras. Sin embargo, este tipo de trabajos en aves carroñeras ha sido escasamente considerado hasta el momento en Argentina, a pesar que ellas cumplen un papel fundamental en la alteración y transporte de cadáveres. Coragyps atratus (jote de cabeza negra tiene la particularidad de formar posaderos comunales cercanos a áreas de actividades humanas y de alimentarse de animales de todos los tamaños, por lo que pueden interferir en la formación de sitios arqueológicos. El objetivo de este trabajo es realizar un análisis tafonómico sobre los restos óseos recuperados de egagrópilas de C. atratus en el Noroeste patagónico, con el fin de generar herramientas que permitan identificar a estas aves como posibles agentes acumuladores. Se recolectaron 469 egagrópilas distribuidas en tres posaderos del Noroeste patagónico. Se identificaron los elementos recuperados y se evaluaron los grados de alteraciones por ácidos gástricos. Lepus europaeus y Ovis aries dominaron las muestras. Los elementos más representativos pertenecen al autopodio, principalmente falanges. Todos ellos muestran signos de digestión, que van desde porosidades superficiales, perforaciones y fracturas, con la desaparición de la médula en el caso de varias falanges; denotando diferencias en relación al tamaño de la presa consumida. Abstract There are several actualistic taphonomic studies regarding different species of birds of prey. However, the studies focus on scavenger birds have been scarcely considered in Argentina, despite the fact that they play a fundamental role in the alteration and transportation of carcasses. A peculiar characteristic of Coragyps atratus (black vulture is that it builds communal roosts near places where human activities are developed and it feeds on animals of varying size, which may interfere with the formation of archaeological
Directory of Open Access Journals (Sweden)
V. H. Sunitha.
2012-09-01
Full Text Available Amylases are among the most important enzymes used in modern biotechnology particularly in the process involving starch hydrolysis. Fungal amylase has large applications in food and pharmaceutical industries. Considering these facts, endophytic fungi isolated from the plant Alpinia calcarata (Haw. Roscoe were screened for amylolytic activity on glucose yeast extract peptone agar (GYP medium. Among thirty isolates of endophytic fungi, isolate number seven identified as Cylindrocephalum sp. (Ac-7 showed highest amylolytic activity and was taken for further study. Influence of various physical and chemical factors such as pH, temperature, carbon and nitrogen sources on amylase production in liquid media were studied. The maximal amylase production was found to be at 30ºC and at pH 7.0 of the growth medium. Among the various carbon and nitrogen sources tested, maltose at 1.5% and Sodium nitrate at 0.3% respectively gave optimum amylase production.
Exploring bird aerodynamics using radio-controlled models
International Nuclear Information System (INIS)
Hoey, Robert G
2010-01-01
A series of radio-controlled glider models was constructed by duplicating the aerodynamic shape of soaring birds (raven, turkey vulture, seagull and pelican). Controlled tests were conducted to determine the level of longitudinal and lateral-directional static stability, and to identify the characteristics that allowed flight without a vertical tail. The use of tail-tilt for controlling small bank-angle changes, as observed in soaring birds, was verified. Subsequent tests, using wing-tip ailerons, inferred that birds use a three-dimensional flow pattern around the wing tip (wing tip vortices) to control adverse yaw and to create a small amount of forward thrust in gliding flight.
Directory of Open Access Journals (Sweden)
Carlos Alberto Perez
2008-12-01
Full Text Available Foram avaliadas 7 espécies da mastofauna e 36 da avifauna quanto à prevalência e intensidade de infestação por carrapatos na ESALQ/USP, no Município de Piracicaba, SP. Analisaram-se 52 indivíduos da mastofauna e 158 da avifauna, parasitados por 12418 carrapatos. Os exemplares adultos (N= 7343 foram encontrados em parasitismo nas capivaras enquanto que os imaturos foram, na maioria, coletados de pequenos mamíferos e aves. Os principais hospedeiros para as formas imaturas, em ordem decrescente, foram gambás (69,1%, capivaras (24,4% e urubus (3,7%. Entre a avifauna, o urubu apresentou o maior número de carrapatos com 69,9%, seguido por indivíduos das famílias Thamnophilidae e Turdidae. Os carrapatos adultos encontrados em capivaras foram A. cajennense (80,8% e A. dubitatum (19,2%. Ambas as espécies foram também coletadas em gambás, correspondendo a 72,4% e 27,6%, respectivamente. Pela facilidade de captura e atratividade de Amblyomma spp. o gambá pode ser usado como bioindicador de infestação em locais endêmicos para febre maculosa. Considerando os índices de parasitismo e prevalência bem como de abundância de carrapatos, susceptibilidade dos hospedeiros, proliferação e susceptibilidade para infecção por R. rickettsi, capivaras e gambás são potenciais hospedeiros amplificadores desse microrganismo no Campus da ESALQ, enquanto eqüídeos, urubus e gatos atuam como hospedeiros secundários.Seven species of mammals and 36 of birds were investigated to determine the tick prevalence and intensity of infestation. The study was conducted at the Esalq/USP in Piracicaba municipality, State of São Paulo. It was collected 52 mammals and 158 birds parasitized by 12,418 ticks. Adult ticks (N= 7,343 were found on capybaras, while the immature were mainly collected on small mammals and birds. The main hosts for immatures in descending order were opossums (69.1%, capybara (24.4% and black vultures (3.7%. Among the avifauna, the black
Screening and mutagenesis of lactobacillus brevis for biosynthesis of γ-aminobutyric acid
International Nuclear Information System (INIS)
Xia Jiang; Mei Lehe; Huang Jun
2006-01-01
γ-aminobutyric acid (GABA) is a major inhibitory neurotransmitter in the central nervous system. In this study, a GABA-producing strain, hjxj-01, was isolated from the milk samples and identified as Lactobacillus brevis. In this GYP medium containing sodium glutamate, the highest GABA concentration accumulated by Lactobacillus brevis hjxj-01 is 7 g/L. The strain was treated with UV and 60 Co γ-rays. Based on high positive mutation rate, the final mutagenesis conditions were UV light 30 W, irradiation distance 45 cm, irradiation time 50 s, and 60 Co γ-rays irradiation of 500 Gy. The mutant strain, hjxj-08119, was bred by GABA resistance selection. Cultured for 12 generations continually, the GABA-producing capacity of hjxj-08119 maintained stably. The fermentation results indicate that compared with the origin strain hjxj-01, the average yield of GABA by hjij-08119 is 17 g/L, which is 142.9% of the origin strain. (authors)
Murn, Campbell; Holloway, Graham J
2016-10-01
Species occurring at low density can be difficult to detect and if not properly accounted for, imperfect detection will lead to inaccurate estimates of occupancy. Understanding sources of variation in detection probability and how they can be managed is a key part of monitoring. We used sightings data of a low-density and elusive raptor (white-headed vulture Trigonoceps occipitalis ) in areas of known occupancy (breeding territories) in a likelihood-based modelling approach to calculate detection probability and the factors affecting it. Because occupancy was known a priori to be 100%, we fixed the model occupancy parameter to 1.0 and focused on identifying sources of variation in detection probability. Using detection histories from 359 territory visits, we assessed nine covariates in 29 candidate models. The model with the highest support indicated that observer speed during a survey, combined with temporal covariates such as time of year and length of time within a territory, had the highest influence on the detection probability. Averaged detection probability was 0.207 (s.e. 0.033) and based on this the mean number of visits required to determine within 95% confidence that white-headed vultures are absent from a breeding area is 13 (95% CI: 9-20). Topographical and habitat covariates contributed little to the best models and had little effect on detection probability. We highlight that low detection probabilities of some species means that emphasizing habitat covariates could lead to spurious results in occupancy models that do not also incorporate temporal components. While variation in detection probability is complex and influenced by effects at both temporal and spatial scales, temporal covariates can and should be controlled as part of robust survey methods. Our results emphasize the importance of accounting for detection probability in occupancy studies, particularly during presence/absence studies for species such as raptors that are widespread and
Trade in Andean Condor Vulture gryphus feathers and body parts in ...
African Journals Online (AJOL)
body parts in the city of Cusco and the Sacred Valley,. Cusco region, Peru. Robert S. R. ... The sale of Andean Condor feathers and body parts is undertaken openly in the tourist markets of Cusco and the Sacred .... and shops. Prices in local currency – Nuevo Sol and US Dollar equivalent given in parentheses). Feather.
Trade in Andean Condor Vulture gryphus feathers and body parts in ...
African Journals Online (AJOL)
commitments under international conventions and act immediately to stop this illegal trade, which is further threatening a species that is already in a precarious situation. Resumen. La venta de ... level (IUCN 2011) and Endangered in Peru.
Food choice and diet of the bearded vulture Gypaetus barbatus in ...
African Journals Online (AJOL)
1990-04-17
Apr 17, 1990 ... samples, forming at least 67% of the bones collected at ossuaries (Table 8) and .... for breaking, and these were mostly larger animals (e.g. horses and cattle). ..... NEWMAN, K.B. 1969. Some notes on the feeding habits of.
The creation of the SAVE consortium – Saving Asia's Vultures from ...
African Journals Online (AJOL)
This article describes the background to this problem, caused mainly by the veterinary drug diclofenac, and the establishment and structure of the SAVE consortium created to help coordinate the necessary conservation response. The lessons learnt in Asia and the working model of such a consortium are presented, which ...
Solid Particle Erosion Behaviors of Carbon-Fiber Epoxy Composite and Pure Titanium
Cai, Feng; Gao, Feng; Pant, Shashank; Huang, Xiao; Yang, Qi
2016-01-01
Rotor blades of Bell CH-146 Griffon helicopter experience excessive solid particle erosion at low altitudes in desert environment. The rotor blade is made of an advanced light-weight composite which, however, has a low resistance to solid particle erosion. Coatings have been developed and applied to protect the composite blade. However, due to the influence of coating process on composite material, the compatibility between coating and composite base, and the challenges of repairing damaged coatings as well as the inconsistency between the old and new coatings, replaceable thin metal shielding is an alternative approach; and titanium, due to its high-specific strength and better formability, is an ideal candidate. This work investigates solid particle erosion behaviors of carbon-fiber epoxy composite and titanium in order to assess the feasibility of titanium as a viable candidate for erosion shielding. Experiment results showed that carbon-fiber epoxy composite showed a brittle erosion behavior, whereas titanium showed a ductile erosion mode. The erosion rate on composite was 1.5 times of that on titanium at impingement angle 15° and increased to 5 times at impact angle 90°.
Scavengers on the move: behavioural changes in foraging search patterns during the annual cycle.
Directory of Open Access Journals (Sweden)
Pascual López-López
Full Text Available BACKGROUND: Optimal foraging theory predicts that animals will tend to maximize foraging success by optimizing search strategies. However, how organisms detect sparsely distributed food resources remains an open question. When targets are sparse and unpredictably distributed, a Lévy strategy should maximize foraging success. By contrast, when resources are abundant and regularly distributed, simple brownian random movement should be sufficient. Although very different groups of organisms exhibit Lévy motion, the shift from a Lévy to a brownian search strategy has been suggested to depend on internal and external factors such as sex, prey density, or environmental context. However, animal response at the individual level has received little attention. METHODOLOGY/PRINCIPAL FINDINGS: We used GPS satellite-telemetry data of Egyptian vultures Neophron percnopterus to examine movement patterns at the individual level during consecutive years, with particular interest in the variations in foraging search patterns during the different periods of the annual cycle (i.e. breeding vs. non-breeding. Our results show that vultures followed a brownian search strategy in their wintering sojourn in Africa, whereas they exhibited a more complex foraging search pattern at breeding grounds in Europe, including Lévy motion. Interestingly, our results showed that individuals shifted between search strategies within the same period of the annual cycle in successive years. CONCLUSIONS/SIGNIFICANCE: Results could be primarily explained by the different environmental conditions in which foraging activities occur. However, the high degree of behavioural flexibility exhibited during the breeding period in contrast to the non-breeding period is challenging, suggesting that not only environmental conditions explain individuals' behaviour but also individuals' cognitive abilities (e.g., memory effects could play an important role. Our results support the growing
Seasonal and circadian biases in bird tracking with solar GPS-tags.
Directory of Open Access Journals (Sweden)
Rafa Silva
Full Text Available Global Positioning System (GPS tags are nowadays widely used in wildlife tracking. This geolocation technique can suffer from fix loss biases due to poor satellite GPS geometry, that result in tracking data gaps leading to wrong research conclusions. In addition, new solar-powered GPS tags deployed on birds can suffer from a new "battery drain bias" currently ignored in movement ecology analyses. We use a GPS tracking dataset of bearded vultures (Gypaetus barbatus, tracked for several years with solar GPS tags, to evaluate the causes and triggers of fix and data retrieval loss biases. We compare two models of solar GPS tags using different data retrieval systems (Argos vs GSM-GPRS, and programmed with different duty cycles. Neither of the models was able to accomplish the duty cycle programed initially. Fix and data retrieval loss rates were always greater than expected, and showed non-random gaps in GPS locations. Number of fixes per month of tracking was a bad criterion to identify tags with smaller biases. Fix-loss rates were four times higher due to battery drain than due to poor GPS satellite geometry. Both tag models were biased due to the uneven solar energy available for the recharge of the tag throughout the annual cycle, resulting in greater fix-loss rates in winter compared to summer. In addition, we suggest that the bias found along the diurnal cycle is linked to a complex three-factor interaction of bird flight behavior, topography and fix interval. More fixes were lost when vultures were perching compared to flying, in rugged versus flat topography. But long fix-intervals caused greater loss of fixes in dynamic (flying versus static situations (perching. To conclude, we emphasize the importance of evaluating fix-loss bias in current tracking projects, and deploying GPS tags that allow remote duty cycle updates so that the most appropriate fix and data retrieval intervals can be selected.
Saha, A; Mandal, P; Dasgupta, S; Saha, D
2008-05-01
Lasiodiplodia theobromae, a common tea (Camellia sinensis) pathogen, usually does not sporulate or sporulates poorly in common media, which makes spore production difficult. In this study the effects of culture media, carbon source, nitrogen source, temperature, pH and light on mycelial growth and sporulation were evaluated. Among several carbon sources tested, glucose and sucrose were found superior for growth. Potassium nitrate supplemented media showed maximum growth amongst the tested inorganic nitrogen sources while peptone produced maximum growth among the tested organic nitrogen sources. Tea root extract supplemented potato dextrose agar medium was found to be the most suitable for mycelial growth and sporulation of L. theobromae. The fungus grow at temperatures ranging from 40 to 36 degrees C, with optimum growth at 28 degrees C and no growth was noted at 40 degrees C. There was no significant effect of different light period on growth of L. theobromae, but light enhanced sporulation. The fungus grow at pH 3.0-8.0 and optimum growth was observed at pH 6.0. Tea root extract supplemented potato dextrose agar medium with pH 6.0 was the most suitable for production of conidia of L. theobromae at 28 degrees C. Hence this media may be recommended for inoculum production for further studies.
VULtURe snIPPets FRoM ARoUnD tHe WoRLD
African Journals Online (AJOL)
2007-05-03
May 3, 2007 ... species. The government has now modified the mad cow rules, adopting a decree allowing farmers ..... Endangered California Condors Gymnogyps californianus in ... Tree Condor Conservation Act and again putting our state ...
VULtURe snIPPets FRoM ARoUnD tHe WoRLD
African Journals Online (AJOL)
2007-05-03
May 3, 2007 ... protect this incredible bird,” said Nava. AB. 821, the Ridley-Tree Condor Preservation. Act, will remove the number one threat to the survival of the endangered California. Condor, lead ammunition, by having hunters switch to a widely available, non- lead ammunition alternative when they hunt big game ...
In vitro mutagenesis of red ginger (Alpinia purpurata)
International Nuclear Information System (INIS)
Lamseejan, S.; Ubonprasert, B.; Kareeros, P.; Pungkan, V.
1996-01-01
Gamma rays and in vitro culture techniques were used for mutation induction experiment in red ginger. Shoot clusters of red ginger were treated with gamma rays at 0, 30, 50, 70 and 90 Gy. Treated shoots were then isolated and transferred individually to fresh medium. L D 50 was calculated based on a number of surviving plants in each treatment at 30 days after irradiation. L D 50 for in vitro vulture of red ginger was approximately 20 Gy. In an attempt to isolate mutants by sub culturing 3 times at 1 month interval, two mutants were isolated. One mutant has a normal growth with numerous white streaks on green leaves. The other mutant has darkly wrinkled leaves with abnormal plant type. These mutants were both isolated from in vitro culture of red ginger treated with 10 Gy of gamma rays
Effect of 60Co gamma irradiation on cochlea function and structure in guinea pigs
International Nuclear Information System (INIS)
Wang Zhonghe; Cai Yilin; Hu Haisen
1994-01-01
In the experiment inner ears of guinea pigs were irradiated with 60 Co gamma rays using the method of simulated clinical routine irradiation in order to find the effects of ionizing radiation on the cochlea function and structure and to explore the mechanism and protective measure that lead to hearing impairment following radiotherapy to the head and neck of cancer patients. Ten weeks after irradiation it was found that ABR threshold increased with increasing dose of radiation. The mean values of ABR thresholds in 70 Gy and 90 Gy groups were 10 dB and 28 dB respectively. The number of inner and outer hair cell and pillar cell loss was counted under microscope. The number of lost cells increased with increasing dose of radiation. The severity of damage in morphology of inner, outer hair cells and pillar cells reduced progressively. The groups of 70 Gy and 90 Gy lost significantly more than groups of control and 50 Gy(P<0.05). It is concluded that the damage of hair cells of cochlea is the direct result of gamma ray irradiation of the inner ear and is the main cause of hearing impairment following irradiation
Directory of Open Access Journals (Sweden)
Caroline da Cruz Vasconcelos
2017-03-01
Full Text Available O uso de extratos vegetais tem sido amplamente estudado como controle biológico alternativo de doenças de plantas, especialmente aquelas causadas por fungos patogênicos. Nesse sentido, o objetivo do presente estudo foi avaliar a atividade antifúngica in vitro do extrato bruto etanólico obtido de folhas de algodão (Gossypium arboreum L., Malvaceae em diferentes concentrações sob o desenvolvimento micelial do fungo fitopatogênico Lasiodiplodia theobromae. O ensaio foi conduzido nos Laboratórios de Microbiologia/Fitopatologia/Genética e de Cultivo/Isolamento da Universidade do Estado do Amapá/UEAP, em Macapá, Amapá. Em um Delineamento Inteiramente Casualizado (DIC, seis tratamentos e seis repetições foram organizados: T1 (controle negativo – BDA (Batata-Dextrose-Ágar + 0 mg.mL-1 (extrato foliar; T2 - BDA + 5 mg.mL-1 (extrato foliar; T3 - BDA + 10 mg.mL-1 (extrato foliar; T4 - BDA + 20 mg.mL-1 (extrato foliar; T5 - BDA + 2,5 mL de etanol e T6 (controle positivo - BDA + 2,5 mL de fungicida comercial (Derosal®. As variáveis inibição do crescimento micelial (ICM, índice de velocidade de crescimento micelial (IVCM e área abaixo da curva de cobertura de crescimento micelial (AACCM foram calculadas ao final do experimento. Os resultados mostraram que o extrato bruto etanólico das folhas de G. arboreum não apresentou atividade antifúngica in vitro frente ao fungo L. theobromae nas concentrações testadas. O extrato induziu o crescimento micelial do fungo, especialmente na concentração 10 mg.mL-1, a qual apresentou condição ideal para o desenvolvimento das estruturas do fungo. Palavras-chave: Malvaceae, extrato vegetal, controle biológico, fitopatógeno.
Micro- and macroscopic study on the porosity of marble as a function of temperature and impregnation
Malaga-Starzec, K.; Akesson, U.; Lindqvist, J. E.; Schouenborg, B.
2003-04-01
The thermal weathering of marble is demonstrated by the progressive granular decohesion that leads to an increased porosity and subsequently to loss of strength. In order to determine how temperature cycling initiates changes in the porosity of fresh and impregnated stones: two chemically and petrographically very different marble types were tested for water absorption and ultrasonic velocity propagation and analysed by fluorescence microscopy and nitrogen adsorption. The influence of the impregnation materials: GypStop P17 and P22, both silica sols with different particle size, on changes of the porosity was also evaluated. A separate long-term study of thermal expansion was additionally performed on fresh unimpregnated samples. The results indicated that inter-granular decohesion was more pronounced for the calictic marble than the dolomitic marble. The impregnation materials had a mitigating effect on the granular decohesion. Use of fluorescence microscopy, among the other methods, appears to give inexpensive and reliable information about internal structure of the marbles. A better understanding of the effect that temperature has on the porosity of marble could be used as a guide for election of suitable stone material for exterior use as well as an indication for appropriate conditioning of the samples before physical properties testing.
Precariedade do trabalho e da vida de catadores de recicláveis em Fortaleza, CE
Directory of Open Access Journals (Sweden)
Regina Heloisa Maciel
2011-01-01
Full Text Available The article discusses life and work conditions of young, middle-aged and elderly street pickers, focusing on experiences of childhood, adolescence and actual job. Eight workers, between 20 and 85 years of age, men and women, were interviewed. The data indicates that: all had a childhood and adolescence marked by lack of resources and emotional support, early insertion in precarious work and low education; the current work maintains the previous experiences of precarious living and working conditions and lack of prospects of inclusion in the formal work market; young workers express feelings of hopelessness and failure; middle-aged and older workers managed to build a safety net through associations of recyclable collectors; all participants reported they have to deal with bigotry revealed in the eyes "of others" for whom a collector is "garbage", "beggar, vulture", a possible "thief". Finally, all believe the work is critical to their and their families’ survival and is a "right" job.
Table scraps: inter-trophic food provisioning by pumas.
Elbroch, L Mark; Wittmer, Heiko U
2012-10-23
Large carnivores perform keystone ecological functions through direct predation, or indirectly, through food subsidies to scavengers or trophic cascades driven by their influence on the distributions of their prey. Pumas (Puma concolor) are an elusive, cryptic species difficult to study and little is known about their inter-trophic-level interactions in natural communities. Using new GPS technology, we discovered that pumas in Patagonia provided 232 ± 31 kg of edible meat/month/100 km(2) to near-threatened Andean condors (Vultur gryphus) and other members of a diverse scavenger community. This is up to 3.1 times the contributions by wolves (Canis lupus) to communities in Yellowstone National Park, USA, and highlights the keystone role large, solitary felids play in natural systems. These findings are more pertinent than ever, for managers increasingly advocate controlling pumas and other large felids to bolster prey populations and mitigate concerns over human and livestock safety, without a full understanding of the potential ecological consequences of their actions.
Precariedade do trabalho e da vida de catadores de recicláveis em Fortaleza, CE
Directory of Open Access Journals (Sweden)
Regina Heloisa Maciel
2011-10-01
Full Text Available The article discusses life and work conditions of young, middle-aged and elderly street pickers, focusing on experiences of childhood, adolescence and actual job. Eight workers, between 20 and 85 years of age, men and women, were interviewed. The data indicates that: all had a childhood and adolescence marked by lack of resources and emotional support, early insertion in precarious work and low education; the current work maintains the previous experiences of precarious living and working conditions and lack of prospects of inclusion in the formal work market; young workers express feelings of hopelessness and failure; middle-aged and older workers managed to build a safety net through associations of recyclable collectors; all participants reported they have to deal with bigotry revealed in the eyes "of others" for whom a collector is "garbage", "beggar, vulture", a possible "thief". Finally, all believe the work is critical to their and their families' survival and is a "right" job.
Net Effects of Ecotourism on Threatened Species Survival.
Directory of Open Access Journals (Sweden)
Ralf C Buckley
Full Text Available Many threatened species rely on ecotourism for conservation funding, but simultaneously suffer direct ecological impacts from ecotourism. For a range of IUCN-Redlisted terrestrial and marine bird and mammal species worldwide, we use population viability analyses to calculate the net effects of ecotourism on expected time to extinction, in the presence of other anthropogenic threats such as poaching, primary industries and habitat loss. Species for which these calculations are currently possible, for one or more subpopulations, include: orangutan, hoolock gibbon, golden lion tamarin, cheetah, African wild dog, New Zealand sealion, great green macaw, Egyptian vulture, and African penguin. For some but not all of these species, tourism can extend expected survival time, i.e., benefits outweigh impacts. Precise outcomes depend strongly on population parameters and starting sizes, predation, and ecotourism scale and mechanisms. Tourism does not currently overcome other major conservation threats associated with natural resource extractive industries. Similar calculations for other threatened species are currently limited by lack of basic population data.
An immunohistochemical study of the endocrine pancreas in raptors.
Palmieri, C; Shivaprasad, H L
2014-12-01
The cytoarchitecture of the endocrine pancreas of 10 raptors (golden eagles, peregrine falcons, Saker falcon, turkey vultures, red-tailed hawk and unspecified falcon) was examined by immunohistochemistry. Three islet types were identified: type A mixed islets composed mainly by glucagon (A)-secreting cells, type B mixed islets with predominantly insulin (B)-secreting cell component and type M mixed islets (type M) consisting of variable number of glucagon-, insulin- and somatostatin (D)-secreting cells. The latter were further characterized into Type I, II or III according to the cell distribution of the three cell types. A and D cells were also randomly scattered within the exocrine pancreas. The results of this study suggest that the classical concept in birds of a segregation of A and B cells in well-defined and distinct islets is not applicable in raptors, reflecting an evolutionary adaptation to different dietary habits and variation in developmental mechanisms. Copyright © 2014 Elsevier Ltd. All rights reserved.
Investigation of Aerodynamic Capabilities of Flying Fish in Gliding Flight
Park, H.; Choi, H.
In the present study, we experimentally investigate the aerodynamic capabilities of flying fish. We consider four different flying fish models, which are darkedged-wing flying fishes stuffed in actual gliding posture. Some morphological parameters of flying fish such as lateral dihedral angle of pectoral fins, incidence angles of pectoral and pelvic fins are considered to examine their effect on the aerodynamic performance. We directly measure the aerodynamic properties (lift, drag, and pitching moment) for different morphological parameters of flying fish models. For the present flying fish models, the maximum lift coefficient and lift-to-drag ratio are similar to those of medium-sized birds such as the vulture, nighthawk and petrel. The pectoral fins are found to enhance the lift-to-drag ratio and the longitudinal static stability of gliding flight. On the other hand, the lift coefficient and lift-to-drag ratio decrease with increasing lateral dihedral angle of pectoral fins.
Net Effects of Ecotourism on Threatened Species Survival.
Buckley, Ralf C; Morrison, Clare; Castley, J Guy
2016-01-01
Many threatened species rely on ecotourism for conservation funding, but simultaneously suffer direct ecological impacts from ecotourism. For a range of IUCN-Redlisted terrestrial and marine bird and mammal species worldwide, we use population viability analyses to calculate the net effects of ecotourism on expected time to extinction, in the presence of other anthropogenic threats such as poaching, primary industries and habitat loss. Species for which these calculations are currently possible, for one or more subpopulations, include: orangutan, hoolock gibbon, golden lion tamarin, cheetah, African wild dog, New Zealand sealion, great green macaw, Egyptian vulture, and African penguin. For some but not all of these species, tourism can extend expected survival time, i.e., benefits outweigh impacts. Precise outcomes depend strongly on population parameters and starting sizes, predation, and ecotourism scale and mechanisms. Tourism does not currently overcome other major conservation threats associated with natural resource extractive industries. Similar calculations for other threatened species are currently limited by lack of basic population data.
La précarité au Québec : un concept parmi d’autres pour parler des jeunes
Directory of Open Access Journals (Sweden)
Madeleine Gauthier
2011-04-01
Full Text Available Ce texte met en contexte l’usage du concept de précarité au Québec. Celui-ci a surtout été utilisé parmi beaucoup d’autres pour décrire la situation des jeunes au moment de la crise de l’emploi des décennies 1970 et 1980. Il a parfois contribué, par son attribution à l’ensemble des jeunes, à laisser les plus vulnérables dans l’ombre et à amplifier l’effet du travail atypique sur l’avenir de toute une génération. Un usage plus modéré du concept s’est imposé progressivement en présence de faits plus justement vérifiés. Sa force de persuasion a pu susciter des stratégies tant individuelles que collectives en faveur des jeunes. Ce retour dans le temps a permis de montrer que les jeunes sont sensibles à la conjoncture mais n’en restent pas pour autant les victimes. Est-ce à cause du type d’État (de Gøsta Esping-Anderson, évoqué par Mircea Vultur que le concept n’a eu qu’une importance relative au Québec ? La question se pose-t-elle dans une approche pragmatique du changement ?"Precariousness" in Québec: one of several concepts applied to young peopleThis paper examines the concept of "precariousness" in a Québec context. This concept was one of several used to describe the situation of young people during the employment crisis of the 1970s and 1980s. It was applied to young people as a whole and thus sometimes favoured a tendency to gloss over the highly vulnerable situations and to amplify the effect of non-standard employment on the future of an entire generation. More moderate use of the concept gradually prevailed with more accurate data. It was a persuasive concept that did bring about individual and collective strategies to help young people. This look backward in time shows that young people are sensitive to the economy and its performance. They are nonetheless not permanently victims of economic downturn. Is the type of welfare state (Esping-Anderson as argued by Vultur the reason why
2014-10-01
characterized by the sudden onset of high acceleration forces, impact , extreme neck angles or a combination thereof. Numerous investigations on helmet and...Regular IFR 2-Full Check FE Take-off to Hover Regular Transit Contour 2-Full Check NFP Pilot Post-Take off Checks Transit NOE SAR Check Taxi to Hold...Area Transit with Slung Load Plan ISR Land at Hold Area Race Track or Circular Conduct ISR Profile Obtain IFR Clearance Loiter Figure 8 Plan
Frequency of DEA 1 antigen in 1037 mongrel and PUREBREED dogs in ITALY.
Carli, E; Carminato, A; Ravagnan, S; Capello, K; Antognoni, M T; Miglio, A; Furlanello, T; Proverbio, D; Spada, E; Stefani, A; Mutinelli, F; Vascellari, M
2017-11-29
The prevalence of dog erythrocyte antigen (DEA 1) in canine population is approximately 40-60%. Often data are limited to a small number of breeds and/or dogs. The aims of this study were to evaluate frequency of DEA 1 in a large population of purebred and mongrel dogs including Italian native breeds and to recognize a possible association between DEA 1 and breed, sex, and genetic and phenotypical/functional classifications of breeds. Frequencies of DEA 1 blood group collected from screened/enrolled blood donors and from healthy and sick dogs were retrospectively evaluated. The breed and the sex were recorded when available. DEA 1 blood typing was assessed by immunocromatographic test on K3EDTA blood samples. The prevalence of DEA 1 antigen was statistically related to breed, gender, Fédération Cynologique Internationale (FCI) and genotypic grouping. Sixty-two per cent dogs resulted DEA 1+ and 38% DEA 1-. DEA 1- was statistically associated with Dogo Argentino, Dobermann, German Shepherd, Boxer, Corso dogs, the molossian dogs, the FCI group 1, 2 and 3 and the genetic groups "working dogs" and "mastiff". DEA 1+ was statistically associated with Rottweiler, Briquet Griffon Vendéen, Bernese mountain dog, Golden Retriever, the hunting breeds, the FCI group 4, 6, 7 and 8 and the genetic groups "scent hounds" and "retrievers". No gender association was observed. Data obtained by this work may be clinically useful to drive blood donor enrollment and selection among different breeds.
Hall, J. K.; Kristoffersen, Y.
2013-12-01
We have tested the feasibility of hovercraft travel through predominantly first year ice of the Transpolar Drift between 81°N - 85°N north of Svalbard. With 2-9 ridges per kilometer, our hovercraft (Griffon TD2000 Mark II), with an effective hover height of about 0.5 m, had to travel a distance 1.3 times the great circle distance between the point of origin and the final destination. Instantaneous speeds were mostly 5-7 knots. Two weeks later icebreaker Oden completed the same transit under conditions with no significant pressure in the ice at a speed mostly 1 knot higher than the hovercraft and travelled 1.2 times the great circle distance. The hovercraft spent 25 days monitoring micro-earthquake activity of the Arctic Mid-Ocean Ridge at a section of the spreading center where no seismicity has been recorded by the global seismograph network. More than ten small earthquake events per day were recorded. Visibility appears to be the most critical factor to hovercraft travel in polar pack ice. Improved control of hovercraft motion would substantially increase the potential usefulness of hovercraft in the sea ice environment. University of Bergen graduate student Gaute Hope emplacing one of the hydrophones in the triangular array used to locate small earthquakes over the Gakkel Ridge rift valley around 85N during FRAM-2012. The research hovercraft R/H SABVABAA is in the background.
Rendel, Pedro M.; Gavrieli, Ittai; Wolff-Boenisch, Domenik; Ganor, Jiwchar
2018-03-01
The main obstacle in the formulation of a quantitative rate-model for mineral precipitation is the absence of a rigorous method for coupling nucleation and growth processes. In order to link both processes, we conducted a series of batch experiments in which gypsum nucleation was followed by crystal growth. Experiments were carried out using various stirring methods in several batch vessels made of different materials. In the experiments, the initial degree of supersaturation of the solution with respect to gypsum (Ωgyp) was set between 1.58 and 1.82. Under these conditions, heterogeneous nucleation is the dominant nucleation mode. Based on changes in SO42- concentration with time, the induction time of gypsum nucleation and the following rate of crystal growth were calculated for each experiment. The induction time (6-104 h) was found to be a function of the vessel material, while the rates of crystal growth, which varied over three orders of magnitude, were strongly affected by the stirring speed and its mode (i.e. rocking, shaking, magnetic stirrer, and magnetic impeller). The SO42- concentration data were then used to formulate a forward model that couples the simple rate laws for nucleation and crystal growth of gypsum into a single kinetic model. Accordingly, the obtained rate law is based on classical nucleation theory and heterogeneous crystal growth.
Richards, Jean; Lickey, Adrienne; Sleeman, Jonathan M
2005-09-01
A retrospective study was conducted to identify the epidemiologic factors associated with gunshot injuries in raptors presented to the Wildlife Center of Virginia from 1993 to 2002. Of the 3,156 raptors admitted, 118 raptors (3.7%), representing 15 species, were admitted with gunshot trauma as the primary cause of morbidity and mortality. The majority of cases consisted of four species: red-tailed hawk (Buteo jamaicensis; 47%), red-shouldered hawk (Buteo lineatus; 14%), turkey vulture (Cathartes aura; 10%), and bald eagle (Haliaeetus leucocephalus; 8%). For species with greater than 40 admissions during the study period, the proportion of gunshot trauma of all causes of morbidity and mortality ranged from raptors with gunshot trauma were admitted during the fall and winter months (75%) compared with the spring and summer (25%). A significant decrease in the absolute number of gunshot cases per year was observed over the time period studied. The population-level effect of gunshot trauma is unknown for these species; however, it appears to be minor compared with other causes of morbidity and mortality.
Directory of Open Access Journals (Sweden)
Caroline Demo
2013-10-01
Full Text Available The activity of vertebrates that feed on corpses can modify the chronology of the decomposition process and interfere with postmortem interval estimates. Further, by destroying the soft parts of the cadaver, scattering, burying or causing the disappearance of bones, it can entirely change the crime scene. In this study, we simulated a clandestine cemetery in an area of Cerrado located inside a farm in Brasília, Distrito Federal. Three domestic pigs of the size of a human of about 60 kg were placed on the ground in different periods of 2010 and 2011. We recorded four species of birds and one of mammal eating the carcasses: 1 Cathartidae: Coragyps atratus (Bechstein, 1973, Cathartes aura (Linnaeus, 1758, Sarcoramphus papa (Linnaeus, 1758; 2 Falconidae: Caracara plancus (Miller, 1777; and 3 Felidae: Leopardus pardalis (Lund, 1840. The behavior of these animals interfered in the decomposition process and resulted in the dispersion and loss of bony parts.
Knowler, Susan P; Kiviranta, Anna-Mariam; McFadyen, Angus K; Jokinen, Tarja S; La Ragione, Roberto M; Rusbridge, Clare
2017-01-01
To characterize and compare the phenotypic variables of the hindbrain and craniocervical junction associated with syringomyelia (SM) in the Chihuahua, Affenpinscher and Cavalier King Charles Spaniel (CKCS). Analysis of 273 T1-weighted mid-sagittal DICOM sequences of the hindbrain and craniocervical junction from 99 Chihuahuas, 42 Affenpinschers and 132 CKCSs. The study compared 22 morphometric features (11 lines, eight angles and three ratios) of dogs with and without SM using refined techniques based on previous studies of the Griffon Bruxellois (GB) using Discriminant Function Analysis and ANOVA with post-hoc corrections. The analysis identified 14/22 significant traits for SM in the three dog breeds, five of which were identical to those reported for the GB and suggest inclusion of a common aetiology. One ratio, caudal fossa height to the length of the skull base extended to an imaginary point of alignment between the atlas and supraoccipital bones, was common to all three breeds (p values 0.029 to Chihuahua had a smaller angle between the dens, atlas and basioccipital bone (p value < 0.001); Affenpinschers had a smaller distance from atlas to dens (p value 0.009); CKCS had a shorter distance between the spheno-occipital synchondrosis and atlas (p value 0.007). The selected morphometries successfully characterised conformational changes in the brain and craniocervical junction that might form the basis of a diagnostic tool for all breeds. The severity of SM involved a spectrum of abnormalities, incurred by changes in both angulation and size that could alter neural parenchyma compliance and/or impede cerebrospinal fluid channels.
de Souza, Alessandra A; Ionescu, Michael; Baccari, Clelia; da Silva, Aline M; Lindow, Steven E
2013-06-01
Eal is an EAL domain protein in Xylella fastidiosa homologous to one involved in resistance to tobramycin in Pseudomonas aeruginosa. EAL and HD-GYP domain proteins are implicated in the hydrolysis of the secondary messenger bis-(3'-5')-cyclic dimeric GMP (cyclic di-GMP). Cell density-dependent communication mediated by a Diffusible Signal Factor (DSF) also modulates cyclic di-GMP levels in X. fastidiosa, thereby controlling the expression of virulence genes and genes involved in insect transmission. The possible linkage of Eal to both extrinsic factors such as antibiotics and intrinsic factors such as quorum sensing, and whether both affect virulence, was thus addressed. Expression of eal was induced by subinhibitory concentrations of tobramycin, and an eal deletion mutant was more susceptible to this antibiotic than the wild-type strain and exhibited phenotypes similar to those of an rpfF deletion mutant blocked in DSF production, such as hypermotility, reduced biofilm formation, and hypervirulence to grape. Consistent with that, the rpfF mutant was more susceptible than the wild-type strain to tobramycin. Therefore, we propose that cell-cell communication and antibiotic stress can apparently lead to similar modulations of cyclic di-GMP in X. fastidiosa, resulting in similar phenotypes. However, the effect of cell density is dominant compared to that of antibiotic stress, since eal is suppressed by RpfF, which may prevent inappropriate behavioral changes in response to antibiotic stress when DSF accumulates.
Nakamura, Alex Akira; Simões, Daniel Castendo; Antunes, Rômulo Godik; da Silva, Deuvânia Carvalho; Meireles, Marcelo Vasconcelos
2009-12-03
The aim of this study was to determine the prevalence of Cryptosporidium species and genotypes in birds kept in captivity in Brazil. A total of 966 samples from 18 families of birds was collected and stored in 5% potassium dichromate solution at 4 degrees C until processing. Oocysts were purified in Sheather sugar solution following extraction of genomic DNA. Molecular analyses were performed using nested-PCR for amplification of fragments of the 18S subunit of rRNA gene and of the actin gene. Amplification of Cryptosporidium DNA fragments was obtained in 47 (4.86%) samples. Sequencing of amplified fragments and phylogenetic analyses allowed the identification of Cryptosporidium baileyi in a black vulture (Coragyps atratus), a domestic chicken (Gallus gallus domesticus) and a saffron finch (Sicalis flaveola); Cryptosporidium galli in canaries (Serinus canaria), a cockatiel (Nymphicus hollandicus) and lesser seed-finches (Oryzoborus angolensis); Cryptosporidium meleagridis in a domestic chicken (G. g. domesticus); Cryptosporidium parvum in a cockatiel (N. hollandicus); Cryptosporidium avian genotype I in a canary (S. canaria) and an Indian peafowl (Pavo cristatus); Cryptosporidium avian genotype II in ostriches (Struthio camelus) and Cryptosporidium avian genotype III in a cockatiel (N. hollandicus) and a peach-faced lovebird (Agapornis roseicolis).
A SMAP Supervised Classification of Landsat Images for Urban Sprawl Evaluation
Directory of Open Access Journals (Sweden)
Flavia Di Palma
2016-07-01
Full Text Available The negative impacts of land take on natural components and economic resources affect planning choices and territorial policies. The importance of land take monitoring, in Italy, has been only recently considered, but despite this awareness, in the great part of the country, effective monitoring and containment measures have not been started, yet. This research proposes a methodology to map and monitor land use changes. To this end, a time series from 1985–2010, based on the multi-temporal Landsat data Thematic Mapper (TM, has been analyzed in the Vulture Alto-Bradano area, a mountain zone of the Basilicata region (Southern Italy. Results confirm a double potentiality of using these data: on the one hand, the use of multi-temporal Landsat data allows going very back in time, producing accurate datasets that provide a phenomenon trend over time; on the other hand, these data can be considered a first experience of open data in the field of spatial information. The proposed methodology provides agencies, local authorities and practitioners with a valuable tool to implement monitoring actions. This represents the first step to pursue territorial governance methods based on sustainability, limiting the land take.
Shape similarities and differences in the skulls of scavenging raptors.
Guangdi, S I; Dong, Yiyi; Ma, Yujun; Zhang, Zihui
2015-04-01
Feeding adaptations are a conspicuous feature of avian evolution. Bill and cranial shape as well as the jaw muscles are closely related to diet choice and feeding behaviors. Diurnal raptors of Falconiformes exhibit a wide range of foraging behaviors and prey preferences, and are assigned to seven dietary groups in this study. Skulls of 156 species are compared from the dorsal, lateral and ventral views, by using geometric morphometric techniques with those landmarks capturing as much information as possible on the overall shape of cranium, bill, orbits, nostrils and attachment area for different jaw muscles. The morphometric data showed that the skull shape of scavengers differ significantly from other raptors, primarily because of different feeding adaptations. As a result of convergent evolution, different scavengers share generalized common morphology, possessing relatively slender and lower skulls, longer bills, smaller and more sideward orbits, and more caudally positioned quadrates. Significant phylogenetic signals suggested that phylogeny also played important role in shape variation within scavengers. New World vultures can be distinguished by their large nostrils, narrow crania and small orbits; Caracaras typically show large palatines, crania and orbits, as well as short, deep and sharp bill.
Directory of Open Access Journals (Sweden)
Sánchez-Pedraza Ricardo
2012-05-01
Full Text Available Abstract Background Although Coragyps atratus has been used as a traditional therapy for patients with cancer, the scientific literature does not contain enough information on how this therapy is used or the mechanisms that explain this therapeutic practice. Objectives To understand the methods of use and the reasons given by patients and caregivers for the use of Coragyps atratus in cancer treatment. Methods This study used a qualitative design based on twenty in-depth interviews of patients with cancer or caregivers of patients with the disease. The analysis of the text was based on an inductive thematic approach. Results Resistance to disease and immune enhancement are properties attributed to Coragyps atratus when used for cancer treatment. The most recommended method of use is fresh blood ingestion, and the associated mechanism of action is transfer of immune factors to the individual who consumes it. Conclusions Use of Coragyps atratus as a treatment for cancer is a popular alternative therapy in Colombia. More studies are needed to understand the clinical effects of this intervention in cancer patients. Spanish abstract Introducción Aunque Coragyps atratus se usa tradicionalmente como terapia para pacientes con cáncer, no existe suficiente información en la literatura científica sobre su forma de utilización ni sobre los mecanismos explicativos que subyacen a esta práctica terapéutica. Objetivos Conocer métodos de utilización y mecanismos explicativos dados por los pacientes y cuidadores de pacientes sobre el uso de Coragyps atratus en el tratamiento del cáncer. Materiales y métodos Diseño cualitativo basado en veinte entrevistas en profundidad de pacientes con cáncer o cuidadores de pacientes con esta enfermedad. Análisis de texto basado en enfoque temático inductivo. Resultados Al Coragyps atratus se le atribuyen propiedades de resistencia y fortalecimiento del sistema inmune de personas enfermas de cáncer. La forma de utilización mas común es la ingesta de la sangre fresca y el mecanismo de acción asociado es la transferencia de defensas a quien lo consume. Conclusiones La utilización del Coragyps atratus como tratamiento para el cáncer es una terapia alternativa usada popularmente en Colombia. El uso de este animal debe estudiarse más a fondo para conocer los efectos clínicos en los pacientes con cáncer.
2012-01-01
Background Although Coragyps atratus has been used as a traditional therapy for patients with cancer, the scientific literature does not contain enough information on how this therapy is used or the mechanisms that explain this therapeutic practice. Objectives To understand the methods of use and the reasons given by patients and caregivers for the use of Coragyps atratus in cancer treatment. Methods This study used a qualitative design based on twenty in-depth interviews of patients with cancer or caregivers of patients with the disease. The analysis of the text was based on an inductive thematic approach. Results Resistance to disease and immune enhancement are properties attributed to Coragyps atratus when used for cancer treatment. The most recommended method of use is fresh blood ingestion, and the associated mechanism of action is transfer of immune factors to the individual who consumes it. Conclusions Use of Coragyps atratus as a treatment for cancer is a popular alternative therapy in Colombia. More studies are needed to understand the clinical effects of this intervention in cancer patients. Spanish abstract Introducción Aunque Coragyps atratus se usa tradicionalmente como terapia para pacientes con cáncer, no existe suficiente información en la literatura científica sobre su forma de utilización ni sobre los mecanismos explicativos que subyacen a esta práctica terapéutica. Objetivos Conocer métodos de utilización y mecanismos explicativos dados por los pacientes y cuidadores de pacientes sobre el uso de Coragyps atratus en el tratamiento del cáncer. Materiales y métodos Diseño cualitativo basado en veinte entrevistas en profundidad de pacientes con cáncer o cuidadores de pacientes con esta enfermedad. Análisis de texto basado en enfoque temático inductivo. Resultados Al Coragyps atratus se le atribuyen propiedades de resistencia y fortalecimiento del sistema inmune de personas enfermas de cáncer. La forma de utilización mas común es la ingesta de la sangre fresca y el mecanismo de acción asociado es la transferencia de defensas a quien lo consume. Conclusiones La utilización del Coragyps atratus como tratamiento para el cáncer es una terapia alternativa usada popularmente en Colombia. El uso de este animal debe estudiarse más a fondo para conocer los efectos clínicos en los pacientes con cáncer. PMID:22651097
Directory of Open Access Journals (Sweden)
Steven Schnoor
2017-12-01
Full Text Available Canadian mining activities have exploded throughout Latin America over the past 15-20 years, bringing a host of problems and leading to burgeoning resistance movements. This paper argues that a growing strategy deployed by Canadian mining companies, and the regimes that support them, in their engagements with Indigenous communities in the Global South who are resisting extractive activities on their territories, entails cultivating Indigenous subjectivities in ways that co-opt their aspirations for decolonization, self-determination, and demands for the recognition of Indigenous rights. That energy is then channelled into supporting, indeed demanding, the very model of extractive capitalism that Canadian mining regimes wish to develop in the region. Drawing upon theories of governmentality and the work of Canadian Indigenous scholars Glen Coulthard and Taiaiake Alfred on the politics of recognition and decolonization, this paper chronicles struggles over Indigeneity as a political subjectivity through three ongoing extractive-related conflicts in Guatemala, Chile, and Panama.
Smith, Joshua B; Laatsch, Lauren J; Beasley, James C
2017-08-31
Scavenging plays an important role in shaping communities through inter- and intra-specific interactions. Although vertebrate scavenger efficiency and species composition is likely influenced by the spatial complexity of environments, heterogeneity in carrion distribution has largely been disregarded in scavenging studies. We tested this hypothesis by experimentally placing juvenile bird carcasses on the ground and in nests in trees to simulate scenarios of nestling bird carrion availability. We used cameras to record scavengers removing carcasses and elapsed time to removal. Carrion placed on the ground was scavenged by a greater diversity of vertebrates and at > 2 times the rate of arboreal carcasses, suggesting arboreal carrion may represent an important resource to invertebrate scavengers, particularly in landscapes with efficient vertebrate scavenging communities. Nonetheless, six vertebrate species scavenged arboreal carcasses. Rat snakes (Elaphe obsolete), which exclusively scavenged from trees, and turkey vultures (Cathartes aura) were the primary scavengers of arboreal carrion, suggesting such resources are potentially an important pathway of nutrient acquisition for some volant and scansorial vertebrates. Our results highlight the intricacy of carrion-derived food web linkages, and how consideration of spatial complexity in carcass distribution (i.e., arboreal) may reveal important pathways of nutrient acquisition by invertebrate and vertebrate scavenging guilds.
The diversity and biogeography of late Pleistocene birds from the lowland Neotropics
Steadman, David W.; Oswald, Jessica A.; Rincón, Ascanio D.
2015-05-01
The Neotropical lowlands sustain the world's richest bird communities, yet little that we know about their history is based on paleontology. Fossils afford a way to investigate distributional shifts in individual species, and thus improve our understanding of long-term change in Neotropical bird communities. We report a species-rich avian fossil sample from a late Pleistocene tar seep (Mene de Inciarte) in northwestern Venezuela. A mere 175 identified fossils from Mene de Inciarte represent 73 species of birds, among which six are extinct, and eight others no longer occur within 100 km. These 14 species consist mainly of ducks (Anatidae), snipe (Scolopacidae), vultures/condors (Vulturidae), hawks/eagles (Accipitridae), and blackbirds (Icteridae). Neotropical bird communities were richer in the late Pleistocene than today; their considerable extinction may be related to collapse of the large mammal fauna at that time. The species assemblage at Mene de Inciarte suggests that biogeographic patterns, even at continental scales, have been remarkably labile over short geological time frames. Mene de Inciarte is but one of 300 + tar seeps in Venezuela, only two of which have been explored for fossils. We may be on the cusp of an exciting new era of avian paleontology in the Neotropics.
Avian risk behavior and fatalities at the Altamont Wind Resource Area: March 1998 - February 1999
Energy Technology Data Exchange (ETDEWEB)
Thelander, C.; Rugge, L.
2000-05-08
Since 1981, more than 7,000 wind turbines have been installed in the Altamont Wind Resource Area in north-central California. Currently, about 5,000 turbines are operating. Past research efforts demonstrated that wind turbines frequently kill birds, especially raptors. Little is known about the specific flight and perching behaviors by birds near wind turbines. A better understanding of these interactions may one day yield insights on how to minimize bird fatalities. This Phase 1 progress report summarizes research findings obtained at 20 study plots totaling 785 turbines of various configurations and conducted between March 1998 and February 1999. The authors examined bird use and behaviors and collected data on fatalities at the same turbines throughout the course of the surveys. They completed 745 30-minute point counts (1,702 bird observations) that quantified bird risk behaviors and bird use of the study plots. The four most frequently observed bird species were red-tailed hawks, common ravens, turkey vultures, and golden eagles. During the same period, the authors recorded 95 bird fatalities. Raptors represent 51% (n=49) of the kills found. The data indicate that the relative abundance of species observed does not predict the relative frequency of fatalities per species. Phase II of the research is underway.
Directory of Open Access Journals (Sweden)
Tirshem Kumar Kaushik
2014-01-01
Full Text Available Black Kite Milvus migrans was seen capturing and captivating everything nearby the offal and garbage sites in Kurukshetra environs until recent past. Today it has been observed that between 2000 and 2010, its depletion is speeding fast, although not noticed in the scientific and social world. The skies in late morning hours are empty. Garbage sites demonstrate the absence of criss-crossing flights of this Kite. The popular sites of the roosting in the shape of Peepal Ficus religiosa, Banyan Ficus benghalensis and Mango Mangifera indica trees have been cut down in the first place. In Kurukshetra, the prime reason for the depletion could be attributed to destruction of foraging grounds (Elimination of garbage dumping sites, cutting down of traditional roosting and nesting sites and construction of colonies in the nearby erstwhile agriculture fields. The contiguous agriculture fields are devoid of any traditional trees like Peepal, Mango and hence no roosting and nesting places. The soaring Kites in the high skies in the forenoon and afternoon sessions were more or less absent. So much so that huge Garbage sites at Panipat Railway compound had no Black Kites. Shockingly, it seems that like Vultures, Black Kites are on their way to elimination in Haryana.
Avian risk behavior and fatalities at the Altamont Wind Resource Area: March 1998 - February 1999
International Nuclear Information System (INIS)
Thelander, C.; Rugge, L.
2000-01-01
Since 1981, more than 7,000 wind turbines have been installed in the Altamont Wind Resource Area in north-central California. Currently, about 5,000 turbines are operating. Past research efforts demonstrated that wind turbines frequently kill birds, especially raptors. Little is known about the specific flight and perching behaviors by birds near wind turbines. A better understanding of these interactions may one day yield insights on how to minimize bird fatalities. This Phase 1 progress report summarizes research findings obtained at 20 study plots totaling 785 turbines of various configurations and conducted between March 1998 and February 1999. The authors examined bird use and behaviors and collected data on fatalities at the same turbines throughout the course of the surveys. They completed 745 30-minute point counts (1,702 bird observations) that quantified bird risk behaviors and bird use of the study plots. The four most frequently observed bird species were red-tailed hawks, common ravens, turkey vultures, and golden eagles. During the same period, the authors recorded 95 bird fatalities. Raptors represent 51% (n=49) of the kills found. The data indicate that the relative abundance of species observed does not predict the relative frequency of fatalities per species. Phase II of the research is underway
Directory of Open Access Journals (Sweden)
García Díez, Marcos
2011-06-01
Full Text Available Birds are very scarce in Palaeolithic rock art. Since 1907 figures of razorbill and raptors (probably vulture have been described at the end of the Pendo cave, both attributed to an Upper Palaeolithic origin (from Aurignacian to Lower Magdalenian, depending on the authors. The new revision of the group of engravings shows the presence of an unambiguous bird, but the morphology of the figure did not permit its precise taxonomic identification. The work also presents a revision of the birds known in Iberian Palaeolithic rock art.
La presencia de aves en el repertorio iconográfico del arte rupestre paleolítico es muy escasa. Desde 1907 se vienen describiendo unas figuras de alca y de rapaz (probablemente buitre en la parte final de la cueva de El Pendo. Los autores las asignan a un momento antiguo, desde el Auriñaciense hasta el Magdaleniense inferior. Una nueva lectura del conjunto de grabados permite apuntar la presencia inequívoca de una imagen de ave, sin características que permitan su identificación taxonómica precisa. El trabajo revisa, además, las imágenes de aves conocidas en el arte rupestre paleolítico de la Península Ibérica.
Directory of Open Access Journals (Sweden)
Susan P Knowler
Full Text Available To characterize and compare the phenotypic variables of the hindbrain and craniocervical junction associated with syringomyelia (SM in the Chihuahua, Affenpinscher and Cavalier King Charles Spaniel (CKCS.Analysis of 273 T1-weighted mid-sagittal DICOM sequences of the hindbrain and craniocervical junction from 99 Chihuahuas, 42 Affenpinschers and 132 CKCSs. The study compared 22 morphometric features (11 lines, eight angles and three ratios of dogs with and without SM using refined techniques based on previous studies of the Griffon Bruxellois (GB using Discriminant Function Analysis and ANOVA with post-hoc corrections.The analysis identified 14/22 significant traits for SM in the three dog breeds, five of which were identical to those reported for the GB and suggest inclusion of a common aetiology. One ratio, caudal fossa height to the length of the skull base extended to an imaginary point of alignment between the atlas and supraoccipital bones, was common to all three breeds (p values 0.029 to <0.001. Associated with SM were a reduced occipital crest and two acute changes in angulation i 'sphenoid flexure' at the spheno-occipital synchondrosis ii 'cervical flexure' at the foramen magnum allied with medulla oblongata elevation. Comparing dogs with and without SM, each breed had a unique trait: Chihuahua had a smaller angle between the dens, atlas and basioccipital bone (p value < 0.001; Affenpinschers had a smaller distance from atlas to dens (p value 0.009; CKCS had a shorter distance between the spheno-occipital synchondrosis and atlas (p value 0.007.The selected morphometries successfully characterised conformational changes in the brain and craniocervical junction that might form the basis of a diagnostic tool for all breeds. The severity of SM involved a spectrum of abnormalities, incurred by changes in both angulation and size that could alter neural parenchyma compliance and/or impede cerebrospinal fluid channels.
Syringomyelia and Craniocervical Junction Abnormalities in Chihuahuas.
Kiviranta, A-M; Rusbridge, C; Laitinen-Vapaavuori, O; Hielm-Björkman, A; Lappalainen, A K; Knowler, S P; Jokinen, T S
2017-11-01
Chiari-like malformation (CM) and syringomyelia (SM) are widely reported in Cavalier King Charles Spaniels and Griffon Bruxellois dogs. Increasing evidence indicates that CM and SM also occur in other small and toy breed dogs, such as Chihuahuas. To describe the presence of SM and craniocervical junction (CCJ) abnormalities in Chihuahuas and to evaluate the possible association of CCJ abnormalities with SM. To describe CM/SM-related clinical signs and neurologic deficits and to investigate the association of CM/SM-related clinical signs with signalment, SM, or CCJ abnormalities. Fifty-three client-owned Chihuahuas. Prospective study. Questionnaire analyses and physical and neurologic examinations were obtained before magnetic resonance and computed tomography imaging. Images were evaluated for the presence of SM, CM, and atlantooccipital overlapping. Additionally, medullary kinking, dorsal spinal cord compression, and their sum indices were calculated. Scratching was the most common CM/SM-related clinical sign and decreased postural reaction the most common neurologic deficit in 73 and 87% of dogs, respectively. Chiari-like malformation and SM were present in 100 and 38% of dogs, respectively. Syringomyelia was associated with the presence of CM/SM-related clinical signs (P = 0.034), and medullary kinking and sum indices were higher in dogs with clinical signs (P = 0.016 and P = 0.007, respectively). Syringomyelia and CCJ abnormalities are prevalent in Chihuahuas. Syringomyelia was an important factor for the presence of CM/SM-related clinical signs, but many dogs suffered from similar clinical signs without being affected by SM, highlighting the clinical importance of CCJ abnormalities in Chihuahuas. Copyright © 2017 The Authors. Journal of Veterinary Internal Medicine published by Wiley Periodicals, Inc. on behalf of the American College of Veterinary Internal Medicine.
Motivos paganos en mosaicos cristianos y judíos de Oriente : problemática e interpretación (IV
Directory of Open Access Journals (Sweden)
Pau Figueras
2002-01-01
Full Text Available Varias representaciones de escenas, personajes y animales de origen pagano fueron utilizadas por cristianos y judíos de Oriente en la decoración de sus iglesias y sinagogas. Sin que fuese considerada una alegoría, la figura de Orfeo inspiró algunas representaciones de Adán, del rey David y de Jesucristo. El ave fénix y los grifones formaban parte del bestiario cristiano, al igual que el águila de Zeus y el pavo real de Hera, ahora símbolos de vida eterna. La convivencia entre animales enemigos evocaba la esperada la paz paradisíaca, y lo mismo hacían las llamadas «vides pobladas» con sus recuerdos dionisíacos. Viejos mitos de maternidad pudieron haber inspirado la figura de una mujer amamantando su hijito, como tradicionales representaciones de filósofos paganos inspiraron las de Cristo y sus acompañantes en la escena de la Transfiguración.Christians and Jews in the East used certain representations of pagan origin to decórate their churches and synagogues. Without being considerad an allegory, Orpheus'figure inspirad soma representations of Adam, king David and Jesús Christ. Phoanix and griffon bacame part of tha Christian bestiary togethar with Zeus' eagle and Hara's paacock, now symbols of everlasting lifa. The axpactad peace of Paradisa was avoked by anamy animáis living togathar, and a similar role played the «populated» vinas with thair Dionisiac ramambrances. Ancient maternity myths might have inspirad the figure of a woman breastfeading har chiid, as tha traditional representation of pagan philosophers inspirad those of Christ and his companions in the scene of the Transfiguration.
Fault fluid evolution at the outermost edges of the southern Apennines fold-and-thrust belt, Italy
Agosta, Fabrizio; Belviso, Claudia; Cavalcante, Francesco; Vita Petrullo, Angela
2017-04-01
This work focuses on the structural architecture and mineralization of a high-angle, extensional fault zone that crosscuts the Middle Pleistocene tuffs and pyroclastites of the Vulture Volcano, southern Italy. This fault zone is topped by a few m-thick travertine deposit formed by precipitation, in a typical lacustrine depositional environment, from a fault fluid that included a mixed, biogenic- and mantle-derived CO2. The detailed analysis of its different mineralization can shed new lights into the shallow crustal fluid flow that took place during deformation of the outer edge of the southern Apennines fold-and-thrust belt. In fact, the study fault zone is interpreted as a shallow-seated, tear fault associated with a shallow thrust fault displacing the most inner portion of the Bradano foredeep basin infill, and was thus active during the latest stages of contractional deformation. Far from the fault zone, the fracture network is made up of three high-angle joint sets striking N-S, E-W and NW-SE, respectively. The former two sets can be interpreted as the older structural elements that pre-dated the latter one, which is likely due to the current stress state that affects the whole Italian peninsula. In the vicinity of the fault zone, a fourth joint high-angle set striking NE-SW is also present, which becomes the most dominant fracture set within the study footwall fault damage zone. Detailed X-ray diffraction analysis of the powder obtained from hand specimens representative of the multiple mineralization present within the fault zone, and in the surrounding volcanites, are consistent with circulation of a fault fluid that modified its composition with time during the latest stages of volcanic activity and contractional deformation. Specifically, veins infilled with and slickenside coated by jarosite, Opal A and/or goethite are found in the footwall fault damage zone. Based upon the relative timing of formation of the aforementioned joint sets, deciphered after
Cailly Arnulphi, Verónica B.; Lambertucci, Sergio A.
2017-01-01
Human-wildlife conflicts currently represent one of the main conservation problems for wildlife species around the world. Vultures have serious conservation concerns, many of which are related to people's adverse perception about them due to the belief that they prey on livestock. Our aim was to assess local perception and the factors influencing people's perception of the largest scavenging bird in South America, the Andean condor. For this, we interviewed 112 people from Valle Fértil, San Juan province, a rural area of central west Argentina. Overall, people in the area mostly have an elementary education, and their most important activity is livestock rearing. The results showed that, in general, most people perceive the Andean condor as an injurious species and, in fact, some people recognize that they still kill condors. We identified two major factors that affect this perception, the education level of villagers and their relationship with livestock ranching. Our study suggests that conservation of condors and other similar scavengers depends on education programs designed to change the negative perception people have about them. Such programs should be particularly focused on ranchers since they are the ones who have the worst perception of these scavengers. We suggest that highlighting the central ecological role of scavengers and recovering their cultural value would be fundamental to reverse their persecution and their negative perception by people. PMID:28950019
Directory of Open Access Journals (Sweden)
Ugo Mellone
Full Text Available BACKGROUND: Performance of migrating birds can be affected by a number of intrinsic and extrinsic factors like morphology, meteorological conditions and migration strategies. We compared travel speeds of four raptor species during their crossing of the Sahara desert. Focusing the analyses on this region allows us to compare different species under equivalent conditions in order to disentangle which factors affect migratory performance. METHODOLOGY/PRINCIPAL FINDING: We tracked raptors using GPS satellite transmitters from Sweden, Spain and Italy, and evaluated their migratory performance at both an hourly and a daily scale. Hourly data (flight speed and altitude for intervals of two hours were analyzed in relation to time of day, species and season, and daily data (distance between roosting sites in relation to species, season, day length and tailwind support. CONCLUSIONS/SIGNIFICANCE: Despite a clear variation in morphology, interspecific differences were generally very small, and did only arise in spring, with long-distance migrants (>5000 km: osprey and Western marsh-harrier being faster than species that migrate shorter distances (Egyptian vulture and short-toed eagle. Our results suggest that the most important factor explaining hourly variation in flight speed is time of day, while at a daily scale, tailwind support is the most important factor explaining variation in daily distance, raising new questions about the consequences of possible future changes in worldwide wind patterns.
Naturally induced humoral immunity to West Nile virus infection in raptors.
Nemeth, Nicole M; Kratz, Gail E; Bates, Rebecca; Scherpelz, Judy A; Bowen, Richard A; Komar, Nicholas
2008-09-01
West Nile virus (WNV) infection can be fatal to many bird species, including numerous raptors, though population- and ecosystem-level impacts following introduction of the virus to North America have been difficult to document. Raptors occupy a diverse array of habitats worldwide and are important to ecosystems for their role as opportunistic predators. We documented initial (primary) WNV infection and then regularly measured WNV-specific neutralizing antibody titers in 16 resident raptors of seven species, plus one turkey vulture. Most individuals were initially infected and seroconverted between July and September of 2003, though three birds remained seronegative until summer 2006. Many of these birds became clinically ill upon primary infection, with clinical signs ranging from loss of appetite to moderate neurological disease. Naturally induced WNV neutralizing antibody titers remained essentially unchanged in some birds, while eight individuals experienced secondary rises in titer presumably due to additional exposures at 1, 2, or 3 years following primary infection. No birds experienced clinical signs surrounding or following the time of secondary exposure, and therefore antibodies were considered protective. Results of this study have implications for transmission dynamics of WNV and health of raptor populations, as well as the interpretation of serologic data from free-ranging and captive birds. Antibodies in raptors surviving WNV may persist for multiple years and protect against potential adverse effects of subsequent exposures.
Meyers, R A; Mathias, E
1997-09-01
Gliding flight is a postural activity which requires the wings to be held in a horizontal position to support the weight of the body. Postural behaviors typically utilize isometric contractions in which no change in length takes place. Due to longer actin-myosin interactions, slow contracting muscle fibers represent an economical means for this type of contraction. In specialized soaring birds, such as vultures and pelicans, a deep layer of the pectoralis muscle, composed entirely of slow fibers, is believed to perform this function. Muscles involved in gliding posture were examined in California gulls (Larus californicus) and tested for the presence of slow fibers using myosin ATPase histochemistry and antibodies. Surprisingly small numbers of slow fibers were found in the M. extensor metacarpi radialis, M. coracobrachialis cranialis, and M. coracobrachialis caudalis, which function in wrist extension, wing protraction, and body support, respectively. The low number of slow fibers in these muscles and the absence of slow fibers in muscles associated with wing extension and primary body support suggest that gulls do not require slow fibers for their postural behaviors. Gulls also lack the deep belly to the pectoralis found in other gliding birds. Since bird muscle is highly oxidative, we hypothesize that fast muscle fibers may function to maintain wing position during gliding flight in California gulls.
Energy beyond food: foraging theory informs time spent in thermals by a large soaring bird.
Directory of Open Access Journals (Sweden)
Emily L C Shepard
Full Text Available Current understanding of how animals search for and exploit food resources is based on microeconomic models. Although widely used to examine feeding, such constructs should inform other energy-harvesting situations where theoretical assumptions are met. In fact, some animals extract non-food forms of energy from the environment, such as birds that soar in updraughts. This study examined whether the gains in potential energy (altitude followed efficiency-maximising predictions in the world's heaviest soaring bird, the Andean condor (Vultur gryphus. Animal-attached technology was used to record condor flight paths in three-dimensions. Tracks showed that time spent in patchy thermals was broadly consistent with a strategy to maximise the rate of potential energy gain. However, the rate of climb just prior to leaving a thermal increased with thermal strength and exit altitude. This suggests higher rates of energetic gain may not be advantageous where the resulting gain in altitude would lead to a reduction in the ability to search the ground for food. Consequently, soaring behaviour appeared to be modulated by the need to reconcile differing potential energy and food energy distributions. We suggest that foraging constructs may provide insight into the exploitation of non-food energy forms, and that non-food energy distributions may be more important in informing patterns of movement and residency over a range of scales than previously considered.
Sánchez-Pedraza Ricardo; Gamba-Rincón Magda R; González-Rangel Andrés L
2012-01-01
Abstract Background Although Coragyps atratus has been used as a traditional therapy for patients with cancer, the scientific literature does not contain enough information on how this therapy is used or the mechanisms that explain this therapeutic practice. Objectives To understand the methods of use and the reasons given by patients and caregivers for the use of Coragyps atratus in cancer treatment. Methods This study used a qualitative design based on twenty in-depth interviews of patients...
International Nuclear Information System (INIS)
Tongpim, Saowanit; Khammeng, Terdsak; Luanthisong, Pirat; Sakai, Kenji; Piadang, Nattayana
2006-09-01
This research work had an objective to employ the thermo tolerant, lactic acid-producing bacteria, Bacillus coagulans strain NF 1 7 as feed additive for swine raising. The bacterial isolate NF 1 7, kept in the culture collection of Khon Kaen University that could tolerate high temperature and produce lactic acid, was employed in this experiment. Cell suspension of isolate NF 1 7 was exposed to gamma irradiation at various doses (1-5 KGy). The isolated survivors were screened on the basis of forming larger colonies and clear zones than the parent strain NF 1 7 when grown on Glucose- Yeast extract-Peptone (GYP) containing CaCO 3 . We obtained 55 effective isolates which the isolate L 5 I2 to 14(5), designated as K 1 4 was chosen for further experiments. Isolate K 1 4 together with the parent strain were characterized using morphological, physiological and biochemical tests. They were all identified as Bacillus coagulans. All isolates had optimal growth pH of 6.5 and grew best at 42.50 o C. The strain K 1 4 could tolerate the temperature as high as 59 o C and was then employed in the fermentation of food waste that collected from the university cafeteria. It was found that food waste could support growth of Bacillus K 1 4 and produce about 107 to 108 CFU/g food waste within 1-3 days. Nutritional value of the fermented food waste in the form of protein was also increased. When mixing this selected bacterium as feed additive in daily pig rations, it was found that Bacillus K 1 4 helped increase feed conversion ratio and reduced the mortality in weaned piglets. Experiments were also performed with the growing pigs. It showed that Bacillus Sp. K 1 4 significantly improved the feed conversion ratio
Heterospecific sociality of birds on beaches from southeastern Brazil
Directory of Open Access Journals (Sweden)
César Cestari
2009-12-01
Full Text Available Studies on the sociality of heterospecific assemblages of birds have promoted a greater understanding of the types of interactions and survivorship between coexisting species. This study verified the group compositions in bird assemblages and analyzed the sociality of migratory and resident species on sandy beaches of southeastern Brazil. A transect was established on the median portion of beaches and all the groups of bird species (monospecific, heterospecific and solitary individuals were registered four days per month from November 2006 to April 2007. The sociality of each species was calculated by its frequency in heterospecific groups, its proportional number of contacts with other species in heterospecific groups, and the number of species that it associated with. Semipalmated Sandpiper Calidris pusilla (Linnaeus, 1766 and Semipalmated Plover Charadrius semipalmatus Bonaparte, 1825 (both migratory had the highest degree of sociality and did not show a preference to associate with either residents or migratory species. Sanderling Calidris alba (Pallas, 1764 (migratory occupied the third position in the sociality rank and associated with migratory species frequently. Southern Caracara Carara plancus (Miller, 1777 and Black Vulture Coragyps atratus (Beschstein, 1793 (both resident were uniquely found among heterospecific groups with necrophagous and resident species. Kelp Gull Larus dominicanus Lichtenstein, 1823 (resident associated more frequently with resident species. The sociality in assemblages of birds may promote advantages such as an increased collective awareness in dangerous situations and indication of sites with abundant food sources.
Lipegfilgrastim in the management of chemotherapy-induced neutropenia of cancer patients
Directory of Open Access Journals (Sweden)
Guariglia R
2016-01-01
Full Text Available Roberto Guariglia,1 Maria Carmen Martorelli,1 Rosa Lerose,2 Donatella Telesca,2 Maria Rita Milella,2 Pellegrino Musto3 1Unit of Hematology and Stem Cell Transplantation, 2Pharmacy Service, 3Scientific Direction, IRCCS, Referral Cancer Center of Basilicata, Rionero in Vulture, Potenza, Italy Abstract: Neutropenia and febrile neutropenia (FN are frequent and potentially fatal toxicities of myelosuppressive anticancer treatments. The introduction of granulocyte colony-stimulating factors (G-CSFs in clinical practice has remarkably reduced the duration and severity of neutropenia, as well as the incidence of FN, thus allowing the administration of chemotherapeutic agents at the optimal dose and time with lower risk. The current scenario of G-CSFs in Europe includes filgrastim, lenograstim, some G-CSF biosimilars, and pegfilgrastim. Recently, a novel long-acting G-CSF, lipegfilgrastim, became available. Lipegfilgrastim is a glycopegylated G-CSF, alternative to pegfilgrastim, and has shown in randomized trials, to be equivalent to pegfilgrastim in reducing the incidence of severe neutropenia and FN in patients with breast cancer receiving chemotherapy, with a similar safety profile. Furthermore, lipegfilgrastim was more effective than the placebo in reducing the incidence of severe neutropenia, its duration, and time to absolute neutrophil count recovery, in patients with non-small cell lung cancer receiving myelosuppressive therapy. Although the number of studies currently published is still limited, lipegfilgrastim seems to be a promising drug in the management of chemotherapy-induced neutropenia. Keywords: neutropenia, febrile neutropenia, granulocyte colony-stimulating factors, G-CSF, pegfilgrastim, lipegfilgrastim
Sutikna, Thomas; Saptomo, Wahyu; Jatmiko; Wasisto, Sri; Tocheri, Matthew W.; Mayr, Gerald
2017-01-01
Background Passerines (Aves: Passeriformes) dominate modern terrestrial bird communities yet their fossil record is limited. Liang Bua is a large cave on the Indonesian island of Flores that preserves Late Pleistocene–Holocene deposits (∼190 ka to present day). Birds are the most diverse faunal group at Liang Bua and are present throughout the stratigraphic sequence. Methods We examined avian remains from the Late Pleistocene deposits of Sector XII, a 2 × 2 m area excavated to about 8.5 m depth. Although postcranial passerine remains are typically challenging to identify, we found several humeral characters particularly useful in discriminating between groups, and identified 89 skeletal elements of passerines. Results At least eight species from eight families are represented, including the Large-billed Crow (Corvus cf. macrorhynchos), the Australasian Bushlark (Mirafra javanica), a friarbird (Philemon sp.), and the Pechora Pipit (Anthus cf. gustavi). Discussion These remains constitute the first sample of fossil passerines described in Wallacea. Two of the taxa no longer occur on Flores today; a large sturnid (cf. Acridotheres) and a grassbird (Megalurus sp.). Palaeoecologically, the songbird assemblage suggests open grassland and tall forests, which is consistent with conditions inferred from the non-passerine fauna at the site. Corvus cf. macrorhynchos, found in the Homo floresiensis-bearing layers, was likely part of a scavenging guild that fed on carcasses of Stegodon florensis insularis alongside vultures (Trigonoceps sp.), giant storks (Leptoptilos robustus), komodo dragons (Varanus komodoensis), and probably H. floresiensis as well. PMID:28828271
Nuisance ecology: do scavenging condors exact foraging costs on pumas in Patagonia?
Elbroch, L Mark; Wittmer, Heiko U
2013-01-01
Predation risk describes the energetic cost an animal suffers when making a trade off between maximizing energy intake and minimizing threats to its survival. We tested whether Andean condors (Vultur gryphus) influenced the foraging behaviors of a top predator in Patagonia, the puma (Puma concolor), in ways comparable to direct risks of predation for prey to address three questions: 1) Do condors exact a foraging cost on pumas?; 2) If so, do pumas exhibit behaviors indicative of these risks?; and 3) Do pumas display predictable behaviors associated with prey species foraging in risky environments? Using GPS location data, we located 433 kill sites of 9 pumas and quantified their kill rates. Based upon time pumas spent at a carcass, we quantified handling time. Pumas abandoned >10% of edible meat at 133 of 266 large carcasses after a single night, and did so most often in open grasslands where their carcasses were easily detected by condors. Our data suggested that condors exacted foraging costs on pumas by significantly decreasing puma handling times at carcasses, and that pumas increased their kill rates by 50% relative to those reported for North America to compensate for these losses. Finally, we determined that the relative risks of detection and associated harassment by condors, rather than prey densities, explained puma "giving up times" (GUTs) across structurally variable risk classes in the study area, and that, like many prey species, pumas disproportionately hunted in high-risk, high-resource reward areas.
Evolutionary computation in zoology and ecology.
Boone, Randall B
2017-12-01
Evolutionary computational methods have adopted attributes of natural selection and evolution to solve problems in computer science, engineering, and other fields. The method is growing in use in zoology and ecology. Evolutionary principles may be merged with an agent-based modeling perspective to have individual animals or other agents compete. Four main categories are discussed: genetic algorithms, evolutionary programming, genetic programming, and evolutionary strategies. In evolutionary computation, a population is represented in a way that allows for an objective function to be assessed that is relevant to the problem of interest. The poorest performing members are removed from the population, and remaining members reproduce and may be mutated. The fitness of the members is again assessed, and the cycle continues until a stopping condition is met. Case studies include optimizing: egg shape given different clutch sizes, mate selection, migration of wildebeest, birds, and elk, vulture foraging behavior, algal bloom prediction, and species richness given energy constraints. Other case studies simulate the evolution of species and a means to project shifts in species ranges in response to a changing climate that includes competition and phenotypic plasticity. This introduction concludes by citing other uses of evolutionary computation and a review of the flexibility of the methods. For example, representing species' niche spaces subject to selective pressure allows studies on cladistics, the taxon cycle, neutral versus niche paradigms, fundamental versus realized niches, community structure and order of colonization, invasiveness, and responses to a changing climate.
Directory of Open Access Journals (Sweden)
Hanneke J.M. Meijer
2017-08-01
Full Text Available Background Passerines (Aves: Passeriformes dominate modern terrestrial bird communities yet their fossil record is limited. Liang Bua is a large cave on the Indonesian island of Flores that preserves Late Pleistocene–Holocene deposits (∼190 ka to present day. Birds are the most diverse faunal group at Liang Bua and are present throughout the stratigraphic sequence. Methods We examined avian remains from the Late Pleistocene deposits of Sector XII, a 2 × 2 m area excavated to about 8.5 m depth. Although postcranial passerine remains are typically challenging to identify, we found several humeral characters particularly useful in discriminating between groups, and identified 89 skeletal elements of passerines. Results At least eight species from eight families are represented, including the Large-billed Crow (Corvus cf. macrorhynchos, the Australasian Bushlark (Mirafra javanica, a friarbird (Philemon sp., and the Pechora Pipit (Anthus cf. gustavi. Discussion These remains constitute the first sample of fossil passerines described in Wallacea. Two of the taxa no longer occur on Flores today; a large sturnid (cf. Acridotheres and a grassbird (Megalurus sp.. Palaeoecologically, the songbird assemblage suggests open grassland and tall forests, which is consistent with conditions inferred from the non-passerine fauna at the site. Corvus cf. macrorhynchos, found in the Homo floresiensis-bearing layers, was likely part of a scavenging guild that fed on carcasses of Stegodon florensis insularis alongside vultures (Trigonoceps sp., giant storks (Leptoptilos robustus, komodo dragons (Varanus komodoensis, and probably H. floresiensis as well.
Antibody Prevalence and Isolation of Viable Toxoplasma gondii from Raptors in the Southeastern USA.
Love, David; Kwok, Oliver C; Verma, Shiv Kumar; Dubey, Jitender P; Bellah, Jamie
2016-07-01
Raptors are good indicators of the prevalence of Toxoplasma gondii in the environment because they prey on small mammals and birds. These prey species are a major source of infection in domestic cats ( Felis catus ), which shed the environmentally resistant oocysts. We assessed T. gondii infection in 281 opportunistically available raptors at a rehabilitation facility between 2012 and 2014. Antibodies to T. gondii were assayed by a modified agglutination test (cutoff 1:25) and found in serum of 22/71 Red-tailed Hawks ( Buteo jamaicensis ), 25/54 Barred Owls ( Strix varia ), 9/41 Red-shouldered Hawks ( Buteo lineatus ), 13/28 Great Horned Owls ( Bubo virginianus ), 6/20 Broad-winged Hawks ( Buteo platypterus ), 2/16 Eastern Screech Owls (Megascops asio), 12/13 Bald Eagles ( Haliaeetus leucocephalus ), 6/12 Cooper's Hawks ( Accipiter cooperii ), 1/8 Black Vultures ( Coragyps atratus ), and 1/1 Golden Eagle ( Aquila chrysaetos ). Antibodies were not detected in 5 Barn Owls ( Tyto alba ), 3 American Kestrels ( Falco sparverius ), 1 Mississippi Kite ( Ictinia mississippiensis ), and 1 Osprey ( Pandion haliaetus ). Viable T. gondii was isolated from the tissues of 1 antibody-positive Barred Owl and identified as a strain having type II alleles at all 10 loci tested, except one (ToxoDB polymerase chain reaction-restriction fragment length polymorphism genotype 3). Type II strain is the most common strain in the US. Results of this study indicate a high prevalence of T. gondii in some raptor species and the first reported genotyping from a Barred Owl.
Directory of Open Access Journals (Sweden)
Susan P Knowler
Full Text Available To characterise the symptomatic phenotype of Chiari-like malformation (CM, secondary syringomyelia (SM and brachycephaly in the Cavalier King Charles Spaniel using morphometric measurements on mid-sagittal Magnetic Resonance images (MRI of the brain and craniocervical junction.This retrospective study, based on a previous quantitative analysis in the Griffon Bruxellois (GB, used 24 measurements taken on 130 T1-weighted MRI of hindbrain and cervical region. Associated brachycephaly was estimated using 26 measurements, including rostral forebrain flattening and olfactory lobe rotation, on 72 T2-weighted MRI of the whole brain. Both study cohorts were divided into three groups; Control, CM pain and SM and their morphometries compared with each other.Fourteen significant traits were identified in the hindbrain study and nine traits in the whole brain study, six of which were similar to the GB and suggest a common aetiology. The Control cohort had the most elliptical brain (p = 0.010, least olfactory bulb rotation (p = 0.003 and a protective angle (p = 0.004 compared to the other groups. The CM pain cohort had the greatest rostral forebrain flattening (p = 0.007, shortest basioccipital (p = 0.019, but a greater distance between the atlas and basioccipital (p = 0.002 which was protective for SM. The SM cohort had two conformation anomalies depending on the severity of craniocervical junction incongruities; i the proximity of the dens (p <0.001 ii increased airorhynchy with a smaller, more ventrally rotated olfactory bulb (p <0.001. Both generated 'concertina' flexures of the brain and craniocervical junction.Morphometric mapping provides a diagnostic tool for quantifying symptomatic CM, secondary SM and their relationship with brachycephaly. It is hypothesized that CM pain is associated with increased brachycephaly and SM can result from different combinations of abnormalities of the forebrain, caudal fossa and craniocervical junction which compromise
A reappraisal of azhdarchid pterosaur functional morphology and paleoecology.
Witton, Mark P; Naish, Darren
2008-05-28
Azhdarchid pterosaurs were among the most widespread and successful of pterosaur clades, but their paleoecology remains controversial. Morphological features common to all azhdarchids include a long, shallow rostrum; elongate, cylindrical cervical vertebrae that formed a long and unusually inflexible neck; and proportionally short wings with an abbreviated fourth phalanx. While azhdarchids have been imagined as vulture-like scavengers, sediment probers, swimmers, waders, aerial predators, or stork-like generalists, most recent authors have regarded them as skim-feeders, trawling their lower jaws through water during flight and seizing aquatic prey from the water's surface. Although apparently widely accepted, the skim-feeding model lacks critical support from anatomy and functional morphology. Azhdarchids lack the many cranial specialisations exhibited by extant skim-feeding birds, most notably the laterally compressed lower jaw and shock absorbing apparatus required for this feeding style. Well-preserved azhdarchid skulls are rare, but their rostra and lower jaws appear to have been sub-triangular in cross-section, and thus dissimilar to those of skim-feeders and sediment probers. Taphonomic data indicates that azhdarchids predominately inhabited inland settings, and azhdarchid morphology indicates that they were poorly suited for all proposed lifestyles bar wading and terrestrial foraging. However, azhdarchid footprints show that their feet were relatively small, padded and slender, and thus not well suited for wading. We argue that azhdarchids were stork- or ground hornbill-like generalists, foraging in diverse environments for small animals and carrion. Proficient terrestrial abilities and a relatively inflexible neck are in agreement with this interpretation.
A reappraisal of azhdarchid pterosaur functional morphology and paleoecology.
Directory of Open Access Journals (Sweden)
Mark P Witton
Full Text Available Azhdarchid pterosaurs were among the most widespread and successful of pterosaur clades, but their paleoecology remains controversial. Morphological features common to all azhdarchids include a long, shallow rostrum; elongate, cylindrical cervical vertebrae that formed a long and unusually inflexible neck; and proportionally short wings with an abbreviated fourth phalanx. While azhdarchids have been imagined as vulture-like scavengers, sediment probers, swimmers, waders, aerial predators, or stork-like generalists, most recent authors have regarded them as skim-feeders, trawling their lower jaws through water during flight and seizing aquatic prey from the water's surface. Although apparently widely accepted, the skim-feeding model lacks critical support from anatomy and functional morphology. Azhdarchids lack the many cranial specialisations exhibited by extant skim-feeding birds, most notably the laterally compressed lower jaw and shock absorbing apparatus required for this feeding style. Well-preserved azhdarchid skulls are rare, but their rostra and lower jaws appear to have been sub-triangular in cross-section, and thus dissimilar to those of skim-feeders and sediment probers. Taphonomic data indicates that azhdarchids predominately inhabited inland settings, and azhdarchid morphology indicates that they were poorly suited for all proposed lifestyles bar wading and terrestrial foraging. However, azhdarchid footprints show that their feet were relatively small, padded and slender, and thus not well suited for wading. We argue that azhdarchids were stork- or ground hornbill-like generalists, foraging in diverse environments for small animals and carrion. Proficient terrestrial abilities and a relatively inflexible neck are in agreement with this interpretation.
Aktualisasi Etika Kepemimpinan Jawa dalam Asthabrata
Directory of Open Access Journals (Sweden)
Pardi Suratno
2009-12-01
Full Text Available Nama Asthabrata sangat populer dalam kehidupan masyarakat Jawa karena sering muncul dalarn pagelaran wayang purwa. Ajaran Asthabrata mendapat apresiasi yang sangat luas oleh masyarakat Indonesia karena memuat ajaran kepemimpinan yang dapat dijadikan aspirasi bagi semua pihak yang sedang dan akan mengabdikan hidupnya bagi bangsa dan negara. Asthabrata merupakan kreativitas pujangga Jawa karena tidak dikcnal dalam Ramayana India (baru muncul dalam Ramayana Kakawin, Semua Asthabrata menampilkan figur pemimpin dalam sosok delapan dewa. Dalam perkernbangan lebih lanjut, budayawan Jawa memilih menampilkan figur pemimpin itu dalam sifat-sifat benda alam, yakni bumi, matahari, bulan, bintang, laut, angin, dan awan. Penampilan figur pernimpin dalam sifat benda-benda alam tersebut lebih netral sebagai pilihan cerdas pujangga Jawa. Abstract: The name of Asthabrata is very popular among Javanese live because of its frequent appearance in the wayang purwa performance. Asthabrata teachings have got a wide appreciation from Indonesian people because it carries leadership teachings which can be an aspiration to everyone who is dedicating and will dedicate their lives to their nation and country. Asthabrata is the creativity of the Javanese men of letters for not discovered in Indian's Ramayana (not until Ramayana Kakawin. All Asthabrata present a leader figure in the characters of eight gods. In further progress, Javanese culture vultures chose to present the leader figure in the characters of natural objects. namely earth, Sun, moon, star, ocean, wind, and cloud. The performance of a leader figure in the characters of the natural objects is more neutral as a smart choice of Javanese man of letters. " Keywords: creativity, Asthabrata, leader
Effects of exotic fish farms on bird communities in lake and marine ecosystems
Jiménez, Jaime E.; Arriagada, Aldo M.; Fontúrbel, Francisco E.; Camus, Patricio A.; Ávila-Thieme, M. Isidora
2013-08-01
Salmon farming is a widespread activity around the world, also known to promote diverse environmental effects on aquatic ecosystems. However, information regarding the impact of salmon farming on bird assemblages is notably scarce. We hypothesize that salmon farming, by providing food subsidies and physical structures to birds, will change their local community structure. To test this hypothesis, we conducted a seasonal monitoring of bird richness, abundance, and composition at paired salmon pen and control plots in two marine and two lake sites in southern Chile, from fall 2002 to summer 2004. Overall, salmon farming had no significant effects on species richness, but bird abundance was significantly and noticeably higher in salmon pens than in controls. Such aggregation was mainly accounted for by the trophic guilds of omnivores, diving piscivores, carrion eaters, and perching piscivores, but not by invertebrate feeders, herbivores, and surface feeders. Species composition was also significantly and persistently different between salmon pens and controls within each lake or marine locality. The patterns described above remained consistent across environment types and seasons indicating that salmon farming is changing the community structure of birds in both lake and marine habitats by promoting functional and aggregation responses, particularly by favoring species with broader niches. Such local patterns may thus anticipate potential threats from the ongoing expansion of the salmon industry to neighboring areas in Chile, resulting in regional changes of bird communities, toward a less diverse one and dominated by opportunistic, common, and generalist species such as gulls, vultures, and cormorants.
Energy Technology Data Exchange (ETDEWEB)
Tongpim, Saowanit [Dept. of Microbiology, Fac. of Science, Khon Kaen Univ., Khon Kaen (Thailand); Khammeng, Terdsak [Dept. of Animal Science, Fac. of Agriculture, Khon kaen Univ., Khon kaen (Thailand); Luanthisong, Pirat [Rajamangala Univ., of Technology Isan, Karasin Campus, Karasin (Thailand); Sakai, Kenji [Dept. of Agricultural Chemistry, Fac. of Engineering, Oita Univ., Oita (Japan); Piadang, Nattayana [Office of Atoms for Peace, Bangkok (Thailand)
2006-09-15
This research work had an objective to employ the thermo tolerant, lactic acid-producing bacteria, Bacillus coagulans strain NF{sub 1}7 as feed additive for swine raising. The bacterial isolate NF{sub 1}7, kept in the culture collection of Khon Kaen University that could tolerate high temperature and produce lactic acid, was employed in this experiment. Cell suspension of isolate NF{sub 1}7 was exposed to gamma irradiation at various doses (1-5 KGy). The isolated survivors were screened on the basis of forming larger colonies and clear zones than the parent strain NF{sub 1}7 when grown on Glucose- Yeast extract-Peptone (GYP) containing CaCO{sub 3}. We obtained 55 effective isolates which the isolate L{sub 5}I2 to 14(5), designated as K{sub 1}4 was chosen for further experiments. Isolate K{sub 1}4 together with the parent strain were characterized using morphological, physiological and biochemical tests. They were all identified as Bacillus coagulans. All isolates had optimal growth pH of 6.5 and grew best at 42.50 {sup o}C. The strain K{sub 1}4 could tolerate the temperature as high as 59 {sup o}C and was then employed in the fermentation of food waste that collected from the university cafeteria. It was found that food waste could support growth of Bacillus K{sub 1}4 and produce about 107 to 108 CFU/g food waste within 1-3 days. Nutritional value of the fermented food waste in the form of protein was also increased. When mixing this selected bacterium as feed additive in daily pig rations, it was found that Bacillus K{sub 1}4 helped increase feed conversion ratio and reduced the mortality in weaned piglets. Experiments were also performed with the growing pigs. It showed that Bacillus Sp. K{sub 1}4 significantly improved the feed conversion ratio
Energy Technology Data Exchange (ETDEWEB)
Saint-Georges, F.; Mulliez, P. [Hopital Saint Philibert - GHICL-FLM, Service de Pneumologie, 59 - Lomme (France); Saint-Georges, F.; Abbas, I.; Garcon, G.; Billet, S.; Verdin, A.; Shirali, P. [LCE-EA2598, Lab. de Recherche en toxicologie Industrielle et Environnementale - ULCO-MREI, 59 - Dunkerque (France); Gosset, P. [Hopital Saint Vincent, Laboratoire d' Anatomie et de Cytologie Pathologiques - GHICL-FLM, 59 - Lille (France); Courcot, D. [LCE-EA2598, Lab. de Catalyse et Environnement - ULCO-MREI, 59 - Dunkerque (France)
2009-01-15
To contribute to improve the knowledge of the underlying mechanisms of action involved in air pollution Particulate Matter (PM)-induced cytotoxicity, we were interested in the metabolic activation of Volatile Organic Compounds (VOC) and/or Polycyclic Aromatic Hydrocarbons (PAH)-coated onto Dunkerque City's PM{sub 2.5} in human Alveolar Macrophages (AM) isolated from Bronchoalveolar Lavage Fluid (BALF). This in vitro cell lung model is very close to the normal in vivo situation, notably in the characteristics that AM display in terms of gene expression of phase I and phase II-metabolizing enzymes. The bronchoscopic examinations and BAL procedures were carried out without any complications. The exposure of AM, during 24, 48 or 72 h, to increasing concentrations of the collected aerosol induced significant variations of the activities of the extracellular lactate dehydrogenase and the mitochondrial dehydrogenase. The lethal concentrations at 10% and 50% were 14.93 and 74.63 {mu}g/mL for AM, respectively, and indicated the relatively higher sensibility of such target lung cells. VOC and/or PAH-coated at low levels onto the surface of the particulate fraction significantly induced gene expression of cytochrome P450 (GYP) 1A1, CYP2E1, NADPH Quinone oxido-reductase (NQO)-1) and Glutathione S-Transferase (GST)P1 and M3, versus controls, suggesting thereby the formation of biologically reactive metabolites. Moreover, these results suggested the role of physical vector of carbonaceous core of PM, which can, therefore, increase both the penetration and the retention of attached-VOC into the cells, thereby enabling them to exert a more durable induction. Hence, we concluded that the metabolic activation of the very low doses of VOC and/or PAH-coated onto Dunkerque City's PM{sub 2.5} is one of the underlying mechanisms of action closely involved in its cytotoxicity in isolated human AM in culture. (author)
Soaring migratory birds avoid wind farm in the Isthmus of Tehuantepec, southern Mexico.
Villegas-Patraca, Rafael; Cabrera-Cruz, Sergio A; Herrera-Alsina, Leonel
2014-01-01
The number of wind farms operating in the Isthmus of Tehuantepec, southern Mexico, has rapidly increased in recent years; yet, this region serves as a major migration route for various soaring birds, including Turkey Vultures (Cathartes aura) and Swainson's Hawks (Buteo swainsoni). We analyzed the flight trajectories of soaring migrant birds passing the La Venta II wind farm during the two migratory seasons of 2011, to determine whether an avoidance pattern existed or not. We recorded three polar coordinates for the flight path of migrating soaring birds that were detected using marine radar, plotted the flight trajectories and estimated the number of trajectories that intersected the polygon defined by the wind turbines of La Venta II. Finally, we estimated the actual number of intersections per kilometer and compared this value with the null distributions obtained by running 10,000 simulations of our datasets. The observed number of intersections per kilometer fell within or beyond the lower end of the null distributions in the five models proposed for the fall season and in three of the four models proposed for the spring season. Flight trajectories had a non-random distribution around La Venta II, suggesting a strong avoidance pattern during fall and a possible avoidance pattern during spring. We suggest that a nearby ridgeline plays an important role in this pattern, an issue that may be incorporated into strategies to minimize the potential negative impacts of future wind farms on soaring birds. Studies evaluating these issues in the Isthmus of Tehuantepec have not been previously published; hence this work contributes important baseline information about the movement patterns of soaring birds and its relationship to wind farms in the region.
A pilot golden eagle population study in the Altamont Pass Wind Resource Area, California
Energy Technology Data Exchange (ETDEWEB)
Hunt, G. [California Univ., Santa Cruz, CA (United States). Predatory Bird Research Group
1995-05-01
Orloff and Flannery (1992) estimated that several hundred reports are annually killed by turbine collisions, wire strikes, and electrocutions at the Altamont Pass Wind Resource Area (WRA). The most common fatalities were those of red-tailed hawks (Buteo jamaicensis), American kestrels (Falco sparvatius), and golden eagles (Aquila chrysaetos), with lesser numbers of turkey vultures (Cathartes aura), common ravens (Corvus corax), bam owls (Tyto alba), and others. Among the species of raptors killed at Altamont Pass, the one whose local population is most likely to be impacted is the golden eagle. Besides its being less abundant than the others, the breeding and recruitment rates of golden eagles are naturally slow, increasing their susceptibility to decline as a result of mortality influences. The golden eagle is a species afforded special federal protection because of its inclusion within the Bald Eagle Protection Act as amended in 1963. There are no provisions within the Act which would allow the killing ``taking`` of golden eagles by WRA structures. This report details the results of field studies conducted during 19941. The primary purpose of the investigation is to lay the groundwork for determining whether or not turbine strikes and other hazards related to energy at Altamont Pass may be expected to affect golden eagles on a population basis. We also seek an understanding of the physical and biotic circumstances which attract golden eagles to the WRA within the context of the surrounding landscape and the conditions under which they are killed by wind turbines. Such knowledge may suggest turbine-related or habitat modifications that would result in a lower incidence of eagle mortality.
Clinical utility of a complete diagnostic protocol for the ocular evaluation of free-living raptors.
Labelle, Amber L; Whittington, Julia K; Breaux, Carrie B; Labelle, Philippe; Mitchell, Mark A; Zarfoss, Mitzi K; Schmidt, Stephanie A; Hamor, Ralph E
2012-01-01
To describe a protocol for the examination of free-living raptors and report the ophthalmic examination findings of seven raptor species native to central Illinois, namely the barred owl, Cooper's hawk, eastern screech owl, great horned owl, American kestrel, red-tailed hawk, and turkey vulture and to determine if the findings relative to visual prognosis affected eligibility for future release. Seventy-nine free-living raptors. Under manual restraint, complete ophthalmic examination including slit-lamp biomicroscopy and indirect funduscopy, applanation tonometry, rebound tonometry, ocular morphometrics, B-mode ultrasound, and electroretinography (ERG) were performed on each bird. Histopathology of enucleated globes was performed after euthanasia or death in selected cases. The examination protocol was easily performed using manual restraint alone on all birds. Ocular lesions were detected in 48.1% of birds, with 47.3% affected unilaterally and 52.6% affected bilaterally. Ocular lesions were considered to be vision threatening in 29.0% of the unilaterally affected birds and 29.0% of the bilaterally affected birds. The most common case outcomes were discharge from hospital to rehabilitation facility (45.6%) followed by euthanasia (43.0%). The presence of an ocular lesion or a vision-threatening ocular lesion was not significantly associated with outcome. Reference ranges are reported for B-mode ultrasound, ocular morphometrics, and horizontal corneal diameter in all species. Complete ophthalmic examination can be supplemented by the use of ocular morphometrics, ultrasound, and ERG in the manually restrained raptor. These advanced diagnostic techniques may be useful in developing more objective criteria for evaluating eligibility for release following rehabilitation of free-living birds of prey. © 2011 American College of Veterinary Ophthalmologists.
Wiemeyer, Guillermo M; Pérez, Miguel A; Torres Bianchini, Laura; Sampietro, Luciano; Bravo, Guillermo F; Jácome, N Luis; Astore, Vanesa; Lambertucci, Sergio A
2017-01-01
Wildlife lead exposure is an increasing conservation threat that is being widely investigated. However, for some areas of the world (e.g., South America) and certain species, research on this subject is still scarce or only local information is available. We analyzed the extent and intensity of lead exposure for a widely distributed threatened species, the Andean Condor (Vultur gryphus). We conducted the study at two different scales: 1) sampling of birds received for rehabilitation or necropsy in Argentina, and 2) bibliographic review and extensive survey considering exposure event for the species' distribution in South America. Wild condors from Argentina (n = 76) presented high lead levels consistent with both recent and previous exposure (up to 104 μg/dL blood level, mean 15.47 ± 21.21 μg/dL and up to 148.20 ppm bone level, mean 23.08 ± 31.39 ppm). In contrast, captive bred individuals -not exposed to lead contamination- had much lower lead levels (mean blood level 5.63 ± 3.08 μg/dL, and mean bone level 2.76 ± 3.06 ppm). Condors were exposed to lead throughout their entire range in continental Argentina, which represents almost sixty percent (>4000 km) of their geographical distribution. We also present evidence of lead exposure events in Chile, Ecuador, and Peru. Lead poisoning is a widespread major conservation threat for the Andean Condor, and probably other sympatric carnivores from South America. The high number and wide range of Andean Condors with lead values complement the results for the California Condor and other scavengers in North America suggesting lead poisoning is a continental threat. Urgent actions are needed to reduce this poison in the wild. Copyright © 2016 Elsevier Ltd. All rights reserved.
Effects of attitudes and demography on public support for endangered species conservation.
Liordos, Vasilios; Kontsiotis, Vasileios J; Anastasiadou, Magdalini; Karavasias, Efstathios
2017-10-01
It is critical for managers to understand how attitudes and demography affect public's preferences for species protection for designing successful conservation projects. 1080 adults in Greece were asked to rate pictures of 12 endangered species on aesthetic and negativistic attitudes, and intention to support their conservation. Factor analysis identified a group of animals for which respondents indicated high levels of support for their conservation (red deer, loggerhead sea turtle, brown bear, common pheasant, European ground squirrel, glossy ibis) and a group of animals for which respondents indicated low levels of support (black vulture, great white shark, fire-bellied toad, western barbastelle, Cretan tube web spider, Milos viper). The species that received the highest support were also rated as the most attractive and safest, excluding the fearsome brown bear. Structural models revealed that aesthetic, moralistic and negativistic attitudes were the stronger predictors of support. Aesthetic and moralistic attitudes were positively, and negativistic attitudes negatively, correlated with support for conservation in both groups. Consumptive users scored lower in aesthetics and were less supportive of protection in the high support group, while nonconsumptive users showed the opposite trend. Respondents residing in urban areas deemed animals of high support more attractive and less fearsome and were more supportive of conservation than rural residents in both groups. Females of higher education viewed animals of low support as fearsome, however they supported their conservation. Our study identified popular species that can be used as flagship species to facilitate the implementation of conservation projects. The results of this study could also be used to design a communication and outreach campaign to raise awareness about the ecosystem value of less attractive species. Copyright © 2017 Elsevier B.V. All rights reserved.
Risks to Birds Traded for African Traditional Medicine: A Quantitative Assessment
Williams, Vivienne L.; Cunningham, Anthony B.; Kemp, Alan C.; Bruyns, Robin K.
2014-01-01
Few regional or continent-wide assessments of bird use for traditional medicine have been attempted anywhere in the world. Africa has the highest known diversity of bird species used for this purpose. This study assesses the vulnerability of 354 bird species used for traditional medicine in 25 African countries, from 205 genera, 70 families, and 25 orders. The orders most represented were Passeriformes (107 species), Falconiformes (45 species), and Coraciiformes (24 species), and the families Accipitridae (37 species), Ardeidae (15 species), and Bucerotidae (12 species). The Barn owl (Tyto alba) was the most widely sold species (seven countries). The similarity of avifaunal orders traded is high (analogous to “morphospecies”, and using Sørensen's index), which suggests opportunities for a common understanding of cultural factors driving demand. The highest similarity was between bird orders sold in markets of Benin vs. Burkina Faso (90%), but even bird orders sold in two geographically separated countries (Benin vs. South Africa and Nigeria vs. South Africa) were 87% and 81% similar, respectively. Rabinowitz's “7 forms of rarity” model, used to group species according to commonness or rarity, indicated that 24% of traded bird species are very common, locally abundant in several habitats, and occur over a large geographical area, but 10% are rare, occur in low numbers in specific habitats, and over a small geographical area. The order with the highest proportion of rare species was the Musophagiformes. An analysis of species mass (as a proxy for size) indicated that large and/or conspicuous species tend to be targeted by harvesters for the traditional medicine trade. Furthermore, based on cluster analyses for species groups of similar risk, vultures, hornbills, and other large avifauna, such as bustards, are most threatened by selective harvesting and should be prioritised for conservation action. PMID:25162700
Directory of Open Access Journals (Sweden)
James W Rivers
Full Text Available Condors and vultures are distinct from most other terrestrial birds because they use extensive soaring flight for their daily movements. Therefore, assessing resource selection by these avian scavengers requires quantifying the availability of terrestrial-based habitats, as well as meteorological variables that influence atmospheric conditions necessary for soaring. In this study, we undertook the first quantitative assessment of habitat- and meteorological-based resource selection in the endangered California condor (Gymnogyps californianus within its California range and across the annual cycle. We found that condor use of terrestrial areas did not change markedly within the annual cycle, and that condor use was greatest for habitats where food resources and potential predators could be detected and where terrain was amenable for taking off from the ground in flight (e.g., sparse habitats, coastal areas. Condors originating from different release sites differed in their use of habitat, but this was likely due in part to variation in habitats surrounding release sites. Meteorological conditions were linked to condor use of ecological subregions, with thermal height, thermal velocity, and wind speed having both positive (selection and negative (avoidance effects on condor use in different areas. We found little evidence of systematic effects between individual characteristics (i.e., sex, age, breeding status or components of the species management program (i.e., release site, rearing method relative to meteorological conditions. Our findings indicate that habitat type and meteorological conditions can interact in complex ways to influence condor resource selection across landscapes, which is noteworthy given the extent of anthropogenic stressors that may impact condor populations (e.g., lead poisoning, wind energy development. Additional studies will be valuable to assess small-scale condor movements in light of these stressors to help minimize
Soaring migratory birds avoid wind farm in the Isthmus of Tehuantepec, southern Mexico.
Directory of Open Access Journals (Sweden)
Rafael Villegas-Patraca
Full Text Available The number of wind farms operating in the Isthmus of Tehuantepec, southern Mexico, has rapidly increased in recent years; yet, this region serves as a major migration route for various soaring birds, including Turkey Vultures (Cathartes aura and Swainson's Hawks (Buteo swainsoni. We analyzed the flight trajectories of soaring migrant birds passing the La Venta II wind farm during the two migratory seasons of 2011, to determine whether an avoidance pattern existed or not. We recorded three polar coordinates for the flight path of migrating soaring birds that were detected using marine radar, plotted the flight trajectories and estimated the number of trajectories that intersected the polygon defined by the wind turbines of La Venta II. Finally, we estimated the actual number of intersections per kilometer and compared this value with the null distributions obtained by running 10,000 simulations of our datasets. The observed number of intersections per kilometer fell within or beyond the lower end of the null distributions in the five models proposed for the fall season and in three of the four models proposed for the spring season. Flight trajectories had a non-random distribution around La Venta II, suggesting a strong avoidance pattern during fall and a possible avoidance pattern during spring. We suggest that a nearby ridgeline plays an important role in this pattern, an issue that may be incorporated into strategies to minimize the potential negative impacts of future wind farms on soaring birds. Studies evaluating these issues in the Isthmus of Tehuantepec have not been previously published; hence this work contributes important baseline information about the movement patterns of soaring birds and its relationship to wind farms in the region.
Lequaglie, Cosimo; Giudice, Gabriella; Marasco, Rita; Morte, Aniello Della; Gallo, Massimiliano
2012-10-08
Pulmonary air leaks are common complications of lung resection and result in prolonged hospital stays and increased costs. The purpose of this study was to investigate whether, compared with standard care, the use of a synthetic polyethylene glycol matrix (CoSeal®) could reduce air leaks detected by means of a digital chest drain system (DigiVent™), in patients undergoing lung resection (sutures and/or staples alone). Patients who intraoperatively showed moderate or severe air leaks (evaluated by water submersion tests) were intraoperatively randomized to receive just sutures/staples (control group) or sutures/staples plus CoSeal® (sealant group). Differences among the groups in terms of air leaks, prolonged air leaks, time to chest tube removal, length of hospital stay and related costs were assessed. In total, 216 lung resection patients completed the study. Nineteen patients (18.1%) in the control group and 12 (10.8%) patients in the sealant group experienced postoperative air leaks, while a prolonged air leak was recorded in 11.4% (n=12) of patients in the control group and 2.7% (n=3) of patients in the sealant group. The difference in the incidence of air leaks and prolonged air leaks between the two groups was statistically significant (p=0.0002 and p=0.0013). The mean length of hospital stay was significantly shorter in the sealant group (4 days) than the control group (8 days) (p=0.0001). We also observed lower costs in the sealant group than the control group. The use of CoSeal® may decrease the occurrence and severity of postoperative air leaks after lung resection and is associated with shorter hospital stay. Not registered. The trial was approved by the Institutional Review Board of the IRCCS-CROB Basilicata Regional Cancer Institute, Rionero in Vulture, Italy.
Soaring Migratory Birds Avoid Wind Farm in the Isthmus of Tehuantepec, Southern Mexico
Villegas-Patraca, Rafael; Cabrera-Cruz, Sergio A.; Herrera-Alsina, Leonel
2014-01-01
The number of wind farms operating in the Isthmus of Tehuantepec, southern Mexico, has rapidly increased in recent years; yet, this region serves as a major migration route for various soaring birds, including Turkey Vultures (Cathartes aura) and Swainson's Hawks (Buteo swainsoni). We analyzed the flight trajectories of soaring migrant birds passing the La Venta II wind farm during the two migratory seasons of 2011, to determine whether an avoidance pattern existed or not. We recorded three polar coordinates for the flight path of migrating soaring birds that were detected using marine radar, plotted the flight trajectories and estimated the number of trajectories that intersected the polygon defined by the wind turbines of La Venta II. Finally, we estimated the actual number of intersections per kilometer and compared this value with the null distributions obtained by running 10,000 simulations of our datasets. The observed number of intersections per kilometer fell within or beyond the lower end of the null distributions in the five models proposed for the fall season and in three of the four models proposed for the spring season. Flight trajectories had a non-random distribution around La Venta II, suggesting a strong avoidance pattern during fall and a possible avoidance pattern during spring. We suggest that a nearby ridgeline plays an important role in this pattern, an issue that may be incorporated into strategies to minimize the potential negative impacts of future wind farms on soaring birds. Studies evaluating these issues in the Isthmus of Tehuantepec have not been previously published; hence this work contributes important baseline information about the movement patterns of soaring birds and its relationship to wind farms in the region. PMID:24647442
Directory of Open Access Journals (Sweden)
Shu-Yi Yang
Full Text Available The importance of olfaction for various avian behaviors has become increasingly evident. So far, the use of olfaction for food detection among raptors has only been demonstrated for Cathartes vultures. The Oriental honey buzzard (Pernis orientalis is a resident and migrant in Taiwan and regularly forages in apiaries. One of its foods in apiaries is yellow pollen dough, a softball-sized mixture of pollen, soybeans, and sugar that beekeepers provide as a supplementary food for bees. Given that pollen dough is not similar to any naturally occurring food, we hypothesized that buzzards identify the dough's nutritious contents using olfaction, perhaps in combination with vision. Using a series of choice experiments in which individuals could choose between two doughs, we showed that (1 buzzards almost unerringly chose pollen-containing over pollen lacking doughs when otherwise the doughs were identical in size, shape, and yellow color; (2 buzzards always preferred yellow over black or green doughs if both doughs contained pollen; (3 buzzards still preferred pollen-containing over pollen-lacking doughs when both doughs were black, but at a lower rate than in (1. We statistically excluded the possible influences of the doughs' relative brightness or of repeat visits by the same individuals. Our experiments thus suggest the use of a 'multi-modal foraging strategy' among buzzards whereby olfaction and vision are likely to be both used in identifying food at close distances. We also estimated the olfactory receptor gene repertoire size in the buzzard's genome which is almost five times as large as that of three other raptor species. Therefore, olfaction is likely of far greater ecological importance to this species than to other raptor species. We suggest that olfaction should be considered in the design of behavioral and genetic studies to better understand the use of multiple senses in avian behaviors.
Risks to birds traded for African traditional medicine: a quantitative assessment.
Directory of Open Access Journals (Sweden)
Vivienne L Williams
Full Text Available Few regional or continent-wide assessments of bird use for traditional medicine have been attempted anywhere in the world. Africa has the highest known diversity of bird species used for this purpose. This study assesses the vulnerability of 354 bird species used for traditional medicine in 25 African countries, from 205 genera, 70 families, and 25 orders. The orders most represented were Passeriformes (107 species, Falconiformes (45 species, and Coraciiformes (24 species, and the families Accipitridae (37 species, Ardeidae (15 species, and Bucerotidae (12 species. The Barn owl (Tyto alba was the most widely sold species (seven countries. The similarity of avifaunal orders traded is high (analogous to "morphospecies", and using Sørensen's index, which suggests opportunities for a common understanding of cultural factors driving demand. The highest similarity was between bird orders sold in markets of Benin vs. Burkina Faso (90%, but even bird orders sold in two geographically separated countries (Benin vs. South Africa and Nigeria vs. South Africa were 87% and 81% similar, respectively. Rabinowitz's "7 forms of rarity" model, used to group species according to commonness or rarity, indicated that 24% of traded bird species are very common, locally abundant in several habitats, and occur over a large geographical area, but 10% are rare, occur in low numbers in specific habitats, and over a small geographical area. The order with the highest proportion of rare species was the Musophagiformes. An analysis of species mass (as a proxy for size indicated that large and/or conspicuous species tend to be targeted by harvesters for the traditional medicine trade. Furthermore, based on cluster analyses for species groups of similar risk, vultures, hornbills, and other large avifauna, such as bustards, are most threatened by selective harvesting and should be prioritised for conservation action.
Directory of Open Access Journals (Sweden)
Paul R Martin
Full Text Available Body size has long been recognized to play a key role in shaping species interactions. For example, while small species thrive in a diversity of environments, they typically lose aggressive contests for resources with larger species. However, numerous examples exist of smaller species dominating larger species during aggressive interactions, suggesting that the evolution of traits can allow species to overcome the competitive disadvantage of small size. If these traits accumulate as lineages diverge, then the advantage of large size in interspecific aggressive interactions should decline with increased evolutionary distance. We tested this hypothesis using data on the outcomes of 23,362 aggressive interactions among 246 bird species pairs involving vultures at carcasses, hummingbirds at nectar sources, and antbirds and woodcreepers at army ant swarms. We found the advantage of large size declined as species became more evolutionarily divergent, and smaller species were more likely to dominate aggressive contests when interacting with more distantly-related species. These results appear to be caused by both the evolution of traits in smaller species that enhanced their abilities in aggressive contests, and the evolution of traits in larger species that were adaptive for other functions, but compromised their abilities to compete aggressively. Specific traits that may provide advantages to small species in aggressive interactions included well-developed leg musculature and talons, enhanced flight acceleration and maneuverability, novel fighting behaviors, and traits associated with aggression, such as testosterone and muscle development. Traits that may have hindered larger species in aggressive interactions included the evolution of morphologies for tree trunk foraging that compromised performance in aggressive contests away from trunks, and the evolution of migration. Overall, our results suggest that fundamental trade-offs, such as those
Why are some animal populations unaffected or positively affected by roads?
Rytwinski, Trina; Fahrig, Lenore
2013-11-01
In reviews on effects of roads on animal population abundance we found that most effects are negative; however, there are also many neutral and positive responses [Fahrig and Rytwinski (Ecol Soc 14:21, 2009; Rytwinski and Fahrig (Biol Conserv 147:87-98, 2012)]. Here we use an individual-based simulation model to: (1) confirm predictions from the existing literature of the combinations of species traits and behavioural responses to roads that lead to negative effects of roads on animal population abundance, and (2) improve prediction of the combinations of species traits and behavioural responses to roads that lead to neutral and positive effects of roads on animal population abundance. Simulations represented a typical situation in which road mitigation is contemplated, i.e. rural landscapes containing a relatively low density (up to 1.86 km/km(2)) of high-traffic roads, with continuous habitat between the roads. In these landscapes, the simulations predict that populations of species with small territories and movement ranges, and high reproductive rates, i.e. many small mammals and birds, should not be reduced by roads. Contrary to previous suggestions, the results also predict that populations of species that obtain a resource from roads (e.g. vultures) do not increase with increasing road density. In addition, our simulations support the predation release hypothesis for positive road effects on prey (both small- and large-bodied prey), whereby abundance of a prey species increased with increasing road density due to reduced predation by generalist road-affected predators. The simulations also predict an optimal road density for the large-bodied prey species if it avoids roads or traffic emissions. Overall, the simulation results suggest that in rural landscapes containing high-traffic roads, there are many species for which road mitigation may not be necessary; mitigation efforts should be tailored to the species that show negative population responses to roads.
Use of a sealant to prevent prolonged air leaks after lung resection: a prospective randomized study
Directory of Open Access Journals (Sweden)
Lequaglie Cosimo
2012-10-01
Full Text Available Abstract Background Pulmonary air leaks are common complications of lung resection and result in prolonged hospital stays and increased costs. The purpose of this study was to investigate whether, compared with standard care, the use of a synthetic polyethylene glycol matrix (CoSeal® could reduce air leaks detected by means of a digital chest drain system (DigiVent™, in patients undergoing lung resection (sutures and/or staples alone. Methods Patients who intraoperatively showed moderate or severe air leaks (evaluated by water submersion tests were intraoperatively randomized to receive just sutures/staples (control group or sutures/staples plus CoSeal® (sealant group. Differences among the groups in terms of air leaks, prolonged air leaks, time to chest tube removal, length of hospital stay and related costs were assessed. Results In total, 216 lung resection patients completed the study. Nineteen patients (18.1% in the control group and 12 (10.8% patients in the sealant group experienced postoperative air leaks, while a prolonged air leak was recorded in 11.4% (n = 12 of patients in the control group and 2.7% (n = 3 of patients in the sealant group. The difference in the incidence of air leaks and prolonged air leaks between the two groups was statistically significant (p = 0.0002 and p = 0.0013. The mean length of hospital stay was significantly shorter in the sealant group (4 days than the control group (8 days (p = 0.0001. We also observed lower costs in the sealant group than the control group. Conclusion The use of CoSeal® may decrease the occurrence and severity of postoperative air leaks after lung resection and is associated with shorter hospital stay. Trial registration Not registered. The trial was approved by the Institutional Review Board of the IRCCS-CROB Basilicata Regional Cancer Institute, Rionero in Vulture, Italy.
Wang, Jun; He, Bingshu; Yan, Dan; Hu, Xiamin
2017-12-15
Environmental experts have made great efforts to control pharmaceutical pollution. However, the control of emerged environmental problems caused by medicines should draw more attention of pharmacy and pharmacovigilance researchers. Ecopharmacovigilance (EPV) as a kind of pharmacovigilance for the environment is recognized worldwide as crucial to minimize the environmental risk of pharmaceutical pollutants. But continuing to treat the pollution of pharmaceuticals as a group of substances instead of targeting individual pharmaceuticals on a prioritized basis will lead to a significant waste of resources. Considering vulture population decline caused by non-steroidal anti-inflammatory drugs (NSAIDs) residues, we presented a global-scale analysis of 139 reports of NSAIDs occurrence across 29 countries, in order to provide a specific context for implementing EPV. We found a heavy regional bias toward research in Europe, Asia and America. The top 5 most frequently studied NSAIDs included ibuprofen, diclofenac, naproxen, acetaminophen and ketoprofen. The profile of NSAIDs was dominated by acetaminophen in wastewater influents and effluents. Ibuprofen was the most abundant NSAID in surface water. Only 9 NSAIDs were reported in groundwater samples. And majority of NSAIDs were detected in solid matrices at below 1μg/g except for ketoprofen, diclofenac and ibuprofen. From a pharmacy perspective, we get some implication and propose some management practice options for EPV implementation. These include: Further popularizing and applying the concept of EPV, together with developing relevant regulatory guidance, is necessary; More attention should be paid to how to implement EPV for the pollution control of older established drugs; Triggering "a dynamic watch-list mechanism" in conjunction with "source control"; Implementing targeted sewage treatment technologies and strengthening multidisciplinary collaboration; Pharmaceutical levels in aquatic organisms as biological
Effects of Roads on Animal Abundance: an Empirical Review and Synthesis
Directory of Open Access Journals (Sweden)
Lenore Fahrig
2009-06-01
Full Text Available We attempted a complete review of the empirical literature on effects of roads and traffic on animal abundance and distribution. We found 79 studies, with results for 131 species and 30 species groups. Overall, the number of documented negative effects of roads on animal abundance outnumbered the number of positive effects by a factor of 5; 114 responses were negative, 22 were positive, and 56 showed no effect. Amphibians and reptiles tended to show negative effects. Birds showed mainly negative or no effects, with a few positive effects for some small birds and for vultures. Small mammals generally showed either positive effects or no effect, mid-sized mammals showed either negative effects or no effect, and large mammals showed predominantly negative effects. We synthesized this information, along with information on species attributes, to develop a set of predictions of the conditions that lead to negative or positive effects or no effect of roads on animal abundance. Four species types are predicted to respond negatively to roads: (i species that are attracted to roads and are unable to avoid individual cars; (ii species with large movement ranges, low reproductive rates, and low natural densities; and (iii and iv small animals whose populations are not limited by road-affected predators and either (a avoid habitat near roads due to traffic disturbance or (b show no avoidance of roads or traffic disturbance and are unable to avoid oncoming cars. Two species types are predicted to respond positively to roads: (i species that are attracted to roads for an important resource (e.g., food and are able to avoid oncoming cars, and (ii species that do not avoid traffic disturbance but do avoid roads, and whose main predators show negative population-level responses to roads. Other conditions lead to weak or non-existent effects of roads and traffic on animal abundance. We identify areas where further research is needed, but we also argue that the
Directory of Open Access Journals (Sweden)
Géraldine Jenvrin
2008-04-01
Full Text Available Le nouveau recueil de Mu/hammad ‘Abd al-Wakîl Jâzim témoigne d’une transformation capitale dans la littérature yéménite contemporaine : le passage d’une forme expérimentale en rupture avec les règles de la nouvelle traditionnelle et avec la réalité yéménite, à une autre forme plus accomplie dans laquelle les principes traditionnels de la nouvelle sont ici associés sans complexe aux formes renouvelées du genre. La nouvelle intitulée Le maître des vautours, présente, dans une structure narrative traditionnelle, un conte fantastique moderne qui mêle réalisme, symbolisme et poésie, et dans lequel l’auteur traite à sa manière les thèmes littéraires contemporains de la dualité du rêve et de la réalité, du désenchantement et de l’enfermement perpétuel. C’est notamment en s’inspirant de la langue, des pratiques orales, des croyances et de l’imaginaire populaire, que l’auteur, soucieux de donner un ancrage au texte dans la réalité yéménite, transfigure cette expérience existentielle moderne.The latest collection of short stories by Mu/hammad 'Abd al-Wakîl signals a major shift in contemporary Yemeni literature: from an experimental form, breaking away from both traditional short story conventions and Yemeni reality, to another, more accomplished form, unabashedly mixing traditional short story principles with renewed genre forms. The short story entitled The Vulture Master presents us, from within a traditional narrative structure, with a modern fantasy tale blending in realism, symbolism and poetry, and where the writer deals in his own way with such contemporary literary themes as disenchantment, perpetual captivity, and the duality of dream and reality. Drawing his inspiration from language itself, oral practices, beliefs and popular imagery, the writer, seeking to set his tale firmly in Yemeni reality, manages to transfigure this modern existential experiment.
Structure of the lithosphere-asthenosphere and volcanism in the Tyrrhenian Sea and surroundings
International Nuclear Information System (INIS)
Panza, G.F.; Aoudia, A.; Pontevivo, A.; Sarao, A.; Peccerillo, A.
2003-01-01
The Italian peninsula and the Tyrrhenian Sea are some of the geologically most complex regions on Earth. Such a complexity is expressed by large lateral and vertical variations of the physical properties as inferred from the lithosphere-asthenosphere structure and by the wide varieties of Polio-Quaternary magmatic rocks ranging from teacloth to calcalkaline to sodium- and potassium-alkaline and ultra- alkaline compositions. The integration of geophysical, petrological and geochemical data allows us to recognise various sectors in the Tyrrhenian Sea and surrounding areas and compare different volcanic complexes in order to better constrain the regional geodynamics. A thin crust overlying a soft mantle (10% of partial melting) is typical of the back arc volcanism of the central Tyrrhenian Sea (Magnaghi, Vavilov and Marsili) where tholeiitic rocks dominate. Similar lithosphere-asthenosphere structure is observed for Ustica, Vulture and Etna volcanoes where the geochemical signatures could be related to the contamination of the side intraplate mantle by material coming from the either ancient or active roll-back. The lithosphere-asthenosphere structure and geochemical-isotopic composition do not change significantly when we move to the Stromboli-Campanian volcanoes, where we identify a well developed low-velocity layer, about 10 km thick, below a thin lid, overlain by a thin continental crust. The geochemical signature of the nearby Ischia volcano is characteristic of the Campanian sector and the relative lithosphere-asthenosphere structure may likely represent a transition to the back arc volcanism sector acting in the central Tyrrhenian. The difference in terms of structure beneath Stromboli and the nearby Vulcano and Lipari is confirmed by different geochemical signatures. The affinity between Vulcano, Lipari and Etna could be explained by their common position along the Tindari-Letoianni-Malta fault zone. A low velocity mantle wedge, just below the Moho, is present
Directory of Open Access Journals (Sweden)
Konstantinos Poirazidis
2017-10-01
Full Text Available Dadia-Lefkimi-Soufli National Park forms part of the Natura 2000 network in a region of Greece and represents one of the most diverse landscapes for raptors (birds of prey breeding in Europe. It is adjacent to Bulgaria and Turkey and is a renowned biodiversity hotspot. WWF Greece established a Systematic Raptor Monitoring scheme in this area in 2001.This study summarises the results of the first 12 years of monitoring in the National Park. Overall, 25 to 27 raptor species were recorded by pooling data, of which20 species reproduced in the National Park. Raptors with continuous presence in the National Park exhibited stable, species-specific inter-annual variation. An average of 348±15.4 raptor territories were distributed throughout the National Park for all species. The Common buzzard (Buteo buteo and the Short-toed eagle (Circaetus gallicus were the most common species year-round, followed by the Lesser-spotted eagle (Clanga pomarina and Booted eagle (Aquila pennata. The Long-legged buzzard (Buteo rufinus, Honey buzzard (Pernis apivorus and Egyptian vulture (Neophron percnopterus exhibited a noticeable drop in population numbers over the study period. A significant new entry was the re-appearance of the White-tailed eagle (Haliaeetus albicilla, which was recorded breeding again in the region after a 21-year absence. Species trends, along with their ecological traits, are discussed with respect to landscape changes in Dadia NP and minimum viable population and territory thresholds are proposed to outline essential conservation issues. Although a multi-year balance of the total number of occupied territories for all species was recorded, the number of common species increased compared to specialist species which had smaller, declining populations. The abandoning of traditional livestock farming, which induces an increase in closed-canopy forest coverage, might have led to the decline of the Lesser-spotted eagle, Long-legged buzzard and Honey
Directory of Open Access Journals (Sweden)
Fabio Casale
2014-12-01
conservazionistico legate ad habitat montani, quali Bonasa bonasia (20-50 coppie, Tetrao tetrix (40-100 maschi adulti, Alectoris graeca saxatilis (20-50 coppie, Circaetus gallicus (4-5 coppie, Aquila chrysaetos (6-7 coppie, Falco peregrinus (4-5 coppie, Bubo bubo (4 coppie, Aegolius funereus, Dryocopus martius (30 coppie, Monticola saxatilis (5-10 coppie, Tichodroma muraria (5-10 coppie, Pyrrhocorax graculus (50-70 coppie, Prunella collaris (10-20 coppie, Emberiza cia (200-300 coppie, per la migrazione primaverile dei rapaci diurni (15 specie rilevate, delle quali 10 di interesse comunitario, soprattutto Pernis apivorus (21,3% degli individui censiti, Falco tinnunculus (16,7% e Buteo buteo (14,5% e per la migrazione autunnale dei Passeriformi (30 specie rilevate, soprattutto fringillidi (46,9% degli individui censiti, irundinidi (32,8% e motacillidi (15,6%. Gypaetus barbatus e Gyps fulvus vi vengono occasionalmente rilevati.
Harrison, Terry
2005-04-01
Recent paleontological investigations at the Pliocene site of Laetoli and at neighboring localities on the Eyasi Plateau of northern Tanzania have led to the recovery of a sizable collection of fossil bird eggs. The material comes from the Upper Laetolil Beds, dated at ˜3.6-3.8 Ma, and the Lower Laetolil Beds, dated at 3.8 Ma to older than 4.3 Ma. The preservation of relatively complete eggs (other than those of ratites) is an extremely rare occurrence in the fossil record, and Laetoli is the only locality in Africa that has produced such well-preserved eggs. Deposition of carbonatite air-fall tuffs led to the rapid burial of the eggs sub-aerially, and they were then preserved in paleosols that were geochemically conducive to their preservation. The collection of fossil eggs from Laetoli can be assigned to at least five different species of ground-nesting birds, including two or three species of francolins, a species of guineafowl, and a larger bird of uncertain taxonomic status about the size of a bustard. Most of the eggs can be assigned to a large species of Francolinus, similar in size to the extant F. afer and F. leucoscepus. A smaller species of francolin, about the size of Francolinus coqui or F. sephaena, is also represented, but is less common. A single egg may represent an even smaller species of francolin, about the size of Francolinus lathami or F. nahani, but its attribution to Francolinus is less certain. The evidence of at least two species of Francolinus at Laetoli indicates that francolins were already taxonomically diverse in East Africa by the mid-Pliocene. Three eggs are similar in their overall dimensions and morphology to the living Numida meleagris, the helmeted guineafowl. An avian community including at least one small species of francolin, a larger francolin, and a guineafowl (as well as ostriches and a vulture) implies that the paleoecology at Laetoli was likely to have been open woodland, bushland, savanna or grassland. However
Amaral, Fabio S Raposo do; Miller, Matthew J; Silveira, Luís Fábio; Bermingham, Eldredge; Wajntal, Anita
2006-02-07
The family Accipitridae (hawks, eagles and Old World vultures) represents a large radiation of predatory birds with an almost global distribution, although most species of this family occur in the Neotropics. Despite great morphological and ecological diversity, the evolutionary relationships in the family have been poorly explored at all taxonomic levels. Using sequences from four mitochondrial genes (12S, ATP8, ATP6, and ND6), we reconstructed the phylogeny of the Neotropical forest hawk genus Leucopternis and most of the allied genera of Neotropical buteonines. Our goals were to infer the evolutionary relationships among species of Leucopternis, estimate their relationships to other buteonine genera, evaluate the phylogenetic significance of the white and black plumage patterns common to most Leucopternis species, and assess general patterns of diversification of the group with respect to species' affiliations with Neotropical regions and habitats. Our molecular phylogeny for the genus Leucopternis and its allies disagrees sharply with traditional taxonomic arrangements for the group, and we present new hypotheses of relationships for a number of species. The mtDNA phylogenetic trees derived from analysis of the combined data posit a polyphyletic relationship among species of Leucopternis, Buteogallus and Buteo. Three highly supported clades containing Leucopternis species were recovered in our phylogenetic reconstructions. The first clade consisted of the sister pairs L. lacernulatus and Buteogallus meridionalis, and Buteogallus urubitinga and Harpyhaliaetus coronatus, in addition to L. schistaceus and L. plumbeus. The second clade included the sister pair Leucopternis albicollis and L. occidentalis as well as L. polionotus. The third lineage comprised the sister pair L. melanops and L. kuhli, in addition to L. semiplumbeus and Buteo buteo. According to our results, the white and black plumage patterns have evolved at least twice in the group. Furthermore
Directory of Open Access Journals (Sweden)
Bermingham Eldredge
2006-02-01
Full Text Available Abstract Background The family Accipitridae (hawks, eagles and Old World vultures represents a large radiation of predatory birds with an almost global distribution, although most species of this family occur in the Neotropics. Despite great morphological and ecological diversity, the evolutionary relationships in the family have been poorly explored at all taxonomic levels. Using sequences from four mitochondrial genes (12S, ATP8, ATP6, and ND6, we reconstructed the phylogeny of the Neotropical forest hawk genus Leucopternis and most of the allied genera of Neotropical buteonines. Our goals were to infer the evolutionary relationships among species of Leucopternis, estimate their relationships to other buteonine genera, evaluate the phylogenetic significance of the white and black plumage patterns common to most Leucopternis species, and assess general patterns of diversification of the group with respect to species' affiliations with Neotropical regions and habitats. Results Our molecular phylogeny for the genus Leucopternis and its allies disagrees sharply with traditional taxonomic arrangements for the group, and we present new hypotheses of relationships for a number of species. The mtDNA phylogenetic trees derived from analysis of the combined data posit a polyphyletic relationship among species of Leucopternis, Buteogallus and Buteo. Three highly supported clades containing Leucopternis species were recovered in our phylogenetic reconstructions. The first clade consisted of the sister pairs L. lacernulatus and Buteogallus meridionalis, and Buteogallus urubitinga and Harpyhaliaetus coronatus, in addition to L. schistaceus and L. plumbeus. The second clade included the sister pair Leucopternis albicollis and L. occidentalis as well as L. polionotus. The third lineage comprised the sister pair L. melanops and L. kuhli, in addition to L. semiplumbeus and Buteo buteo. According to our results, the white and black plumage patterns have evolved
Plasma B-esterase activities in European raptors.
Roy, Claudie; Grolleau, Gérard; Chamoulaud, Serge; Rivière, Jean-Louis
2005-01-01
B-esterases are serine hydrolases composed of cholinesterases, including acetylcholinesterase (AChE) and butyrylcholinesterase (BChE), and carboxylesterase (CbE). These esterases, found in blood plasma, are inhibited by organophosphorus (OP) and carbamate (CB) insecticides and can be used as nondestructive biomarkers of exposure to anticholinesterase insecticides. Furthermore, B-esterases are involved in detoxification of these insecticides. In order to establish the level of these enzymes and to have reference values for their normal activities, total plasma cholinesterase (ChE), AChE and BChE activities, and plasma CbE activity were determined in 729 European raptors representing 20 species, four families, and two orders. The diurnal families of the Falconiforme order were represented by Accipitridae and Falconidae and the nocturnal families of the Strigiforme order by Tytonidae and Strigidae. Intraspecies differences in cholinesterase activities according to sex and/or age were investigated in buzzards (Buteo buteo), sparrowhawks (Accipiter nisus), kestrels (Falco tinnunculus), barn owls (Tyto alba), and tawny owls (Strix aluco). Sex-related differences affecting ChE and AChE activities were observed in young kestrels (2-3-mo-old) and age-related differences in kestrels (ChE and AChE), sparrowhawks (AChE), and tawny owls (ChE, AChE, and BChE). The interspecies analysis yielded a negative correlation between ChE activity and body mass taking into account the relative contribution of AChE and BChE to ChE activity, with the exception of the honey buzzard (Pernis apivorus). The lowest ChE activities were found in the two largest species, Bonelli's eagle (Hieraaetus fasciatus) and Egyptian vulture (Neophron percnopterus) belonging to the Accipitridae family. The highest ChE activities were found in the relatively small species belonging to the Tytonidae and Strigidae families and in honey buzzard of the Accipitridae family. Species of the Accipitridae, Tytonidae, and
Directory of Open Access Journals (Sweden)
Hélio A.A. Fracasso
2012-06-01
Full Text Available Sterna hirundinacea (Lesson, 1831 is a migratory seabird that breeds in the Pacific Coast (from Peru to Chile and along the Atlantic coast of South America from Espírito Santo (Brazil to Terra del Fuego (Argentina. This paper describes the reproductive success of South American Terns on Cardos Island, Florianopolis, Brazil in the breeding seasons of 2003, 2005 and 2006. The colony was formed in mid-May in 2003 and early April in other years, with the total number of nests ranging from 1,852 in 2006 to 2,486 in 2005. Hatching success was estimated at 76.39% in 2006, 62.73% in 2003 and 41.1% in 2005, the lowest value that could be attributed to predation by hawks Caracara plancus, lizards Tupinambis merianae and black vulture Coragyps atratus. The chicks hatched in July in 2003, and in June 2005 and 2006, and fledging success was 50.94%, 35.96 and 53.47% respectively. Cardos Island has been constantly used as a breeding site by South American Terns, and therefore represents an important area for conservation of this species. This success could be attributed to low pressure of Kelp gulls (Larus dominicanus, the main predator of seabirds along the Brazilian coast.Sterna hirundinacea (Lesson, 1831 é uma ave migratória que nidifica na costa do Pacífico (do Peru ao Chile e ao longo do Atlântico Sul do Espírito Santo (Brasil até a Terra do Fogo (Argentina. Este trabalho descreve o sucesso reprodutivo do trinta-réis do bico-vermelho na ilha dos Cardos, Florianópolis, Brasil, durante as temporadas reprodutivas de 2003, 2005 e 2006. A formação da colônia ocorreu em maio de 2003 e inicio de abril nos outros anos, com um total de ninhos variando entre 1.852 em 2006 a 2.486 em 2005. O sucesso de incubação foi estimado em 76,39% (2006, 62,73% (2003 e 41,1% em 2005, sendo que os menores valores puderam ser atribuídos a predação dos gaviões Caracara plancus, lagartos Tupinambis merianae e urubus Coragyps atratus. As primeiras eclosões foram
Directory of Open Access Journals (Sweden)
Joaquim O. Branco
2005-06-01
.71 ± 2.64 to 35.92 ± 3.47 cm³ and the largest frequencies of nestlings in November, culminating the abandonment of the colony in the middle of January. They were identified seven items in the chick regurgitations of the nestlings, and the sea fish represented 44.4% of the total weight. The main predator in the colony was the black vulture, that it acted on the eggs in the beginning of the season and the nestlings in the end.
Wilson, Jordan L.; Schumacher, John G.; Burken, Joel G.
2014-01-01
(samples collected above the shoreline) than in samples collected in ankle-deep water below the shoreline, significantly larger in the left and middle areas of the beach than the right area, and substantially larger than similar studies at E. coli- contaminated beaches on Lake Erie in Ohio. Concentrations of E. coli in the water column also were significantly larger after resuspension of sediments. Results of MST indicate a predominance of waterfowl-associated markers in nearshore sediments at Grand Glaize Beach consistent with frequent observations of goose and vulture fecal matter in sediment, especially on the left and middle areas of the beach. The combination of spatial and temporal sampling and MST indicate that an important source of E. coli contamination at Grand Glaize Beach during 2012 was E. coli released into the water column by bathers resuspending E. coli-contaminated sediments, especially during high-use days early in the recreational season.
Directory of Open Access Journals (Sweden)
Giovanni Salera Junior
2009-03-01
Full Text Available Podocnemis expansa e P. unifilis são animais de vida longa, com uma demorada maturação sexual, o que influencia uma baixa taxa de substituição de indivíduos. Suas populações são caracterizadas por uma pequena mortalidade dos animais adultos, mas alta taxa de mortalidade de filhotes e embriões. Sendo a predação natural de ninhos e filhotes um dos fatores mais importantes do baixo sucesso de eclosão dessas espécies. No rio Javaés, os ovos e recém-eclodidos podem ser predados por uma grande diversidade de animais: dentre as aves, urubus (Coragyps atratus e Cathartes aura, carcará (Polyborus plancus, jaburu (Jabiru mycteria; lagartos (Tupinambis teguixin e mamíferos de pequeno porte, coati (Nasua nasua e cachorro-do-mato (Cerdocyon thous. Do total anual de desovas de P. unifilis em média 65,98% são predadas, sendo 41,68% de forma total e 24,30% parcialmente. Enquanto que apenas 5,31% das ninhadas de P. expansa são sempre parcialmente predadas. Dentre os predadores aquáticos existem diversos peixes, principalmente piranhas (Serrasalmus nattereri e jacarés (Melanosuchus niger e Caimam crocodilus. Os predadores das fêmeas de P. unifilis são: jacaré-açu (Melanosuchus niger, onça-pintada (Panthera onca e onça-parda (Puma concolor. Enquanto que as fêmeas de P. expansa em postura, somente são predadas por P. onca. As fêmeas de P. unifilis em postura são predadas num total médio de 3,93% anualmente, enquanto que para P. expansa a média anual é 5,66% das fêmeas.Podocnemis expansa and P. unifilis long lived with late sexual maturation, which influences a low replacement rate of individuals. Their populations are characterized by low adults mortality, but high mortality of embryos and hatchlings. The natural nest predation is an important factor for hatchling success. In Javaés River, the eggs and hatchlings can be predated by a large number of animals such as birds, vultures (Coragyps atratus and Cathartes aura, carcar
Aksu-Zhabagly Nature Reserve's 90-anniversary
Directory of Open Access Journals (Sweden)
Anatoliy F. Kovshar
2016-05-01
Full Text Available The Aksu-Zhabagly nature reserve is located in West Tien Shan in Kazakhstan, on the border of three countries – Kazakhstan, Kyrgyzstan and Uzbekistan (70°18'-57' E and 42°08'-30' N, with an area of 1281 km2; its length is 53 km from the most western to the most eastern point and 41 km from the most southern to the most northern point. It occupies the western limit of the Talasskiy Alatau ridge and its north-western spurs: Zhabaglytau mountains, Alatau, Bugultor, Aksutau and Ugam ridges. In the neighbouring Karatau ridge there is a palaeontological site with an area of 2.2 km2 with deposits of flora and fauna of the Jurassic period. The absolute heights above sea level are 1300–4200 m. The relief is alpine – deep canyons with steep slopes. The middle mountain zone (1300–2000 m is occupied by meadow-steppe formations with juniper sparse forests (Juniperus semiglobosa, J. seravschanica; subalpine meadows (2000–3000 m are alternated by creeping juniper thickets (Juniperus turkestanica and rocky outcrops; the alpine zone (higher than 3000 m is dominated by rocks and snowfields, and glaciers above 3500 m. The nature reserve's flora constitutes almost half of all West Tien Shan's flora and counts 1737 species, including: 235 species of fungi, 64 lichens, 63 species each of algae and mosses, as well as 1312 species of higher plants. Among those, 200 species are medicinal and 57 species are listed in the Red Data Books of Kazakhstan, Uzbekistan and Kyrgyzstan. The vertebrates fauna includes 320 species: mammals – 52 species, birds – 247 (130 of them are nesting, reptiles and amphibians – 14, fishes – 7 species. Animals inhabiting the territory include argali (Ovis ammon karelini, mountain goat (Capra sibirica, bear (Ursus arctos isabellinus, snow leopart (Uncia uncia, Turkestan lynx (Lynx lynx isabellinus; birds – bearded vulture (Gypaёtus barbatus, Himalayan snowcock (Tetraogallus himalayensis, chukar (Alectoris chukar, blue
Sauer, Daniela; Zucca, Claudio; Al-Sharif, Riyad; Zwanzig, Lisa; Madrau, Salvatore; Andreucci, Stefano; Pascucci, Vincenzo; Kadereit, Annette; Scarciglia, Fabio; Brückner, Helmut
2016-04-01
Several lakes on the southern Italian peninsula provide valuable palaeoenvironmental archives of the Last Glacial period. These archives include, e.g., the long high-resolution record from varved lake sediments of Lago Grande di Monticchio, the bigger one of two maar lakes situated on top of Mt. Vulture. Its pollen record indicates (1) temperate deciduous forest during MIS5.2-MIS5.1 (St. Germain 2); (2) frequent vegetation fluctuations, then Artemisia steppe during MIS5.1-MIS4; (3) alternations between open steppe (stadials) and wooded steppe (interstadials) during MIS3; and (4) open steppe during MIS2 (Last Glacial Maximum). However, only few palaeosol records of this period have been reported from southern Italy in the literature so far. Such records would allow for gaining insight also into spatial patterns of the vegetation cover during this period that should have formed, e.g., according to relief, elevation, and continentality gradient (related to the much lower coastline during the last glacial period). So far, we have studied three sediment-palaeosol successions in southern Italy, two in the Calabria region, and one in north-western Sardinia. All of them have developed in alluvial fan deposits resting on littoral sediments of the Last Interglacial period (MIS 5). The southernmost succession studied is located near Lazzaro (south of Reggio di Calabria). It is exposed in an alluvial fan overlying the MIS5.5 terrace. Due to strong tectonic uplift (1.3 m ka-1) the alluvial fan has been dissected by the same creek which previously had built it up. Therefore, its internal structure is exposed, exhibiting a detailed sediment-palaeosol sequence. The palaeosols are mainly characterized by accumulation of soil organic matter (SOM), bioturbation and secondary carbonates. They represent Chernozem- and Phaeozem-like soils that most likely formed under steppe to forest steppe. SOM of the two uppermost Lazzaro palaeosols was 14C-dated to 26.8-28.8 ka cal BP and 28