
Sample records for grass species brachypodium

  1. Genome sequence analysis of the model grass Brachypodium distachyon: insights into grass genome evolution

    Energy Technology Data Exchange (ETDEWEB)

    Schulman, Al


    Three subfamilies of grasses, the Erhardtoideae (rice), the Panicoideae (maize, sorghum, sugar cane and millet), and the Pooideae (wheat, barley and cool season forage grasses) provide the basis of human nutrition and are poised to become major sources of renewable energy. Here we describe the complete genome sequence of the wild grass Brachypodium distachyon (Brachypodium), the first member of the Pooideae subfamily to be completely sequenced. Comparison of the Brachypodium, rice and sorghum genomes reveals a precise sequence- based history of genome evolution across a broad diversity of the grass family and identifies nested insertions of whole chromosomes into centromeric regions as a predominant mechanism driving chromosome evolution in the grasses. The relatively compact genome of Brachypodium is maintained by a balance of retroelement replication and loss. The complete genome sequence of Brachypodium, coupled to its exceptional promise as a model system for grass research, will support the development of new energy and food crops

  2. Comparative and Evolutionary Analysis of Grass Pollen Allergens Using Brachypodium distachyon as a Model System.

    Directory of Open Access Journals (Sweden)

    Akanksha Sharma

    Full Text Available Comparative genomics have facilitated the mining of biological information from a genome sequence, through the detection of similarities and differences with genomes of closely or more distantly related species. By using such comparative approaches, knowledge can be transferred from the model to non-model organisms and insights can be gained in the structural and evolutionary patterns of specific genes. In the absence of sequenced genomes for allergenic grasses, this study was aimed at understanding the structure, organisation and expression profiles of grass pollen allergens using the genomic data from Brachypodium distachyon as it is phylogenetically related to the allergenic grasses. Combining genomic data with the anther RNA-Seq dataset revealed 24 pollen allergen genes belonging to eight allergen groups mapping on the five chromosomes in B. distachyon. High levels of anther-specific expression profiles were observed for the 24 identified putative allergen-encoding genes in Brachypodium. The genomic evidence suggests that gene encoding the group 5 allergen, the most potent trigger of hay fever and allergic asthma originated as a pollen specific orphan gene in a common grass ancestor of Brachypodium and Triticiae clades. Gene structure analysis showed that the putative allergen-encoding genes in Brachypodium either lack or contain reduced number of introns. Promoter analysis of the identified Brachypodium genes revealed the presence of specific cis-regulatory sequences likely responsible for high anther/pollen-specific expression. With the identification of putative allergen-encoding genes in Brachypodium, this study has also described some important plant gene families (e.g. expansin superfamily, EF-Hand family, profilins etc for the first time in the model plant Brachypodium. Altogether, the present study provides new insights into structural characterization and evolution of pollen allergens and will further serve as a base for their

  3. QTLs for resistance to the false brome rust Puccinia brachypodii in the model grass Brachypodium distachyon L.

    NARCIS (Netherlands)

    Barbieri, M.; Marcel, T.C.; Niks, R.E.; Francia, E.; Pasquariello, M.; Mazzamurro, V.; Garvin, D.F.; Pecchioni, N.


    The potential of the model grass Brachypodium distachyon L. (Brachypodium) for studying grass–pathogen interactions is still underexploited. We aimed to identify genomic regions in Brachypodium associated with quantitative resistance to the false brome rust fungus Puccinia brachypodii. The inbred

  4. Accelerated Growth Rate and Increased Drought Stress Resilience of the Model Grass Brachypodium distachyon Colonized by Bacillus subtilis B26.

    Directory of Open Access Journals (Sweden)

    François Gagné-Bourque

    Full Text Available Plant growth-promoting bacteria (PGB induce positive effects in plants, for instance, increased growth and reduced abiotic stresses susceptibility. The mechanisms by which these bacteria impact the host plant are numerous, diverse and often specific. Here, we studied the agronomical, molecular and biochemical effects of the endophytic PGB Bacillus subtilis B26 on the full life cycle of Brachypodium distachyon Bd21, an established model species for functional genomics in cereal crops and temperate grasses. Inoculation of Brachypodium with B. subtilis strain B26 increased root and shoot weights, accelerated growth rate and seed yield as compared to control plants. B. subtilis strain B26 efficiently colonized the plant and was recovered from roots, stems and blades as well as seeds of Brachypodium, indicating that the bacterium is able to migrate, spread systemically inside the plant, establish itself in the aerial plant tissues and organs, and is vertically transmitted to seeds. The presence of B. subtilis strain B26 in the seed led to systemic colonization of the next generation of Brachypodium plants. Inoculated Brachypodium seedlings and mature plants exposed to acute and chronic drought stress minimized the phenotypic effect of drought compared to plants not harbouring the bacterium. Protection from the inhibitory effects of drought by the bacterium was linked to upregulation of the drought-response genes, DREB2B-like, DHN3-like and LEA-14-A-like and modulation of the DNA methylation genes, MET1B-like, CMT3-like and DRM2-like, that regulate the process. Additionally, total soluble sugars and starch contents increased in stressed inoculated plants, a biochemical indication of drought tolerance. In conclusion, we show a single inoculation of Brachypodium with a PGB affected the whole growth cycle of the plant, accelerating its growth rates, shortening its vegetative period, and alleviating drought stress effects. These effects are relevant to

  5. Application of Tissue Culture and Transformation Techniques in Model Species Brachypodium distachyon. (United States)

    Sogutmaz Ozdemir, Bahar; Budak, Hikmet


    Brachypodium distachyon has recently emerged as a model plant species for the grass family (Poaceae) that includes major cereal crops and forage grasses. One of the important traits of a model species is its capacity to be transformed and ease of growing both in tissue culture and in greenhouse conditions. Hence, plant transformation technology is crucial for improvements in agricultural studies, both for the study of new genes and in the production of new transgenic plant species. In this chapter, we review an efficient tissue culture and two different transformation systems for Brachypodium using most commonly preferred gene transfer techniques in plant species, microprojectile bombardment method (biolistics) and Agrobacterium-mediated transformation.In plant transformation studies, frequently used explant materials are immature embryos due to their higher transformation efficiencies and regeneration capacity. However, mature embryos are available throughout the year in contrast to immature embryos. We explain a tissue culture protocol for Brachypodium using mature embryos with the selected inbred lines from our collection. Embryogenic calluses obtained from mature embryos are used to transform Brachypodium with both plant transformation techniques that are revised according to previously studied protocols applied in the grasses, such as applying vacuum infiltration, different wounding effects, modification in inoculation and cocultivation steps or optimization of bombardment parameters.

  6. Comparative analyses reveal potential uses of Brachypodium distachyon as a model for cold stress responses in temperate grasses

    Directory of Open Access Journals (Sweden)

    Li Chuan


    Full Text Available Abstract Background Little is known about the potential of Brachypodium distachyon as a model for low temperature stress responses in Pooideae. The ice recrystallization inhibition protein (IRIP genes, fructosyltransferase (FST genes, and many C-repeat binding factor (CBF genes are Pooideae specific and important in low temperature responses. Here we used comparative analyses to study conservation and evolution of these gene families in B. distachyon to better understand its potential as a model species for agriculturally important temperate grasses. Results Brachypodium distachyon contains cold responsive IRIP genes which have evolved through Brachypodium specific gene family expansions. A large cold responsive CBF3 subfamily was identified in B. distachyon, while CBF4 homologs are absent from the genome. No B. distachyon FST gene homologs encode typical core Pooideae FST-motifs and low temperature induced fructan accumulation was dramatically different in B. distachyon compared to core Pooideae species. Conclusions We conclude that B. distachyon can serve as an interesting model for specific molecular mechanisms involved in low temperature responses in core Pooideae species. However, the evolutionary history of key genes involved in low temperature responses has been different in Brachypodium and core Pooideae species. These differences limit the use of B. distachyon as a model for holistic studies relevant for agricultural core Pooideae species.

  7. Cell wall composition throughout development for the model grass Brachypodium distanchyon

    Directory of Open Access Journals (Sweden)

    David eRancour


    Full Text Available Temperate perennial grasses are important worldwide as a livestock nutritive energy source and a potential feedstock for lignocellulosic biofuel production. The annual temperate grass Brachypodium distanchyon has been championed as a useful model system to facilitate biological research in agriculturally important temperate forage grasses based on phylogenetic relationships. To physically corroborate genetic predictions, we determined the chemical composition profiles of organ-specific cell walls throughout the development of two common diploid accessions of Brachypodium distanchyon, Bd21-3 and Bd21. Chemical analysis was performed on cell walls isolated from distinct organs (i.e. leaves, sheaths, stems and roots at three developmental stages of 1 12-day seedling, 2 vegetative-to-reproductive transition, and 3 mature seed-fill. In addition, we have included cell wall analysis of embryonic callus used for genetic transformations. Composition of cell walls based on components lignin, hydroxycinnamates, uronosyls, neutral sugars, and protein suggests that Brachypodium distanchyon is similar chemically to agriculturally important forage grasses. There were modest compositional differences in hydroxycinnamate profiles between accessions Bd21-3 and Bd21. In addition, when compared to agronomical important C3 grasses, more mature Brachypodium stem cell walls have a relative increase in glucose of 48% and a decrease in lignin of 36%. Though differences exists between Brachypodium and agronomical important C3 grasses, Brachypodium distanchyon should be still a useful model system for genetic manipulation of cell wall composition to determine the impact upon functional characteristics such as rumen digestibility or energy conversion efficiency for bioenergy production.

  8. Cell wall composition throughout development for the model grass Brachypodium distachyon (United States)

    Rancour, David M.; Marita, Jane M.; Hatfield, Ronald D.


    Temperate perennial grasses are important worldwide as a livestock nutritive energy source and a potential feedstock for lignocellulosic biofuel production. The annual temperate grass Brachypodium distachyon has been championed as a useful model system to facilitate biological research in agriculturally important temperate forage grasses based on phylogenetic relationships. To physically corroborate genetic predictions, we determined the chemical composition profiles of organ-specific cell walls throughout the development of two common diploid accessions of Brachypodium distachyon, Bd21-3 and Bd21. Chemical analysis was performed on cell walls isolated from distinct organs (i.e., leaves, sheaths, stems, and roots) at three developmental stages of (1) 12-day seedling, (2) vegetative-to-reproductive transition, and (3) mature seed fill. In addition, we have included cell wall analysis of embryonic callus used for genetic transformations. Composition of cell walls based on components lignin, hydroxycinnamates, uronosyls, neutral sugars, and protein suggests that Brachypodium distachyon is similar chemically to agriculturally important forage grasses. There were modest compositional differences in hydroxycinnamate profiles between accessions Bd21-3 and Bd21. In addition, when compared to agronomical important C3 grasses, more mature Brachypodium stem cell walls have a relative increase in glucose of 48% and a decrease in lignin of 36%. Though differences exist between Brachypodium and agronomical important C3 grasses, Brachypodium distachyon should be still a useful model system for genetic manipulation of cell wall composition to determine the impact upon functional characteristics such as rumen digestibility or energy conversion efficiency for bioenergy production. PMID:23227028

  9. Brachypodium distachyon. A New Model System for Functional Genomics in Grasses1 (United States)

    Draper, John; Mur, Luis A.J.; Jenkins, Glyn; Ghosh-Biswas, Gadab C.; Bablak, Pauline; Hasterok, Robert; Routledge, Andrew P.M.


    A new model for grass functional genomics is described based on Brachypodium distachyon, which in the evolution of the Pooideae diverged just prior to the clade of “core pooid” genera that contain the majority of important temperate cereals and forage grasses. Diploid ecotypes of B. distachyon (2n = 10) have five easily distinguishable chromosomes that display high levels of chiasma formation at meiosis. The B. distachyon nuclear genome was indistinguishable in size from that of Arabidopsis, making it the simplest genome described in grasses to date. B. distachyon is a self-fertile, inbreeding annual with a life cycle of less than 4 months. These features, coupled with its small size (approximately 20 cm at maturity), lack of seed-head shatter, and undemanding growth requirements should make it amenable to high-throughput genetics and mutant screens. Immature embryos exhibited a high capacity for plant regeneration via somatic embryogenesis. Regenerated plants display very low levels of albinism and have normal fertility. A simple transformation system has been developed based on microprojectile bombardment of embryogenic callus and hygromycin selection. Selected B. distachyon ecotypes were resistant to all tested cereal-adapted Blumeria graminis species and cereal brown rusts (Puccinia reconditia). In contrast, different ecotypes displayed resistance or disease symptoms following challenge with the rice blast pathogen (Magnaporthe grisea) and wheat/barley yellow stripe rusts (Puccinia striformis). Despite its small stature, B. distachyon has large seeds that should prove useful for studies on grain filling. Such biological characteristics represent important traits for study in temperate cereals. PMID:11743099

  10. Analysis of two heterologous flowering genes in ¤Brachypodium distachyon¤ demonstrates its potential as a grass model plant

    DEFF Research Database (Denmark)

    Olsen, P.; Lenk, I.; Jensen, Christian S.


    Despite the great contribution of model organisms, such as Arabidopsis and rice to understand biological processes in plants, these models are less valuable for functional studies of particular genes from temperate grass crop species. Therefore a new model plant is required, displaying features...... including close phylogenetic relationship to the temperate grasses, vernalisation requirement, high transformation efficiency, small genome size and a rapid life cycle. These requirements are all fulfilled by the small annual grass Brachypodium distachyon. As a first step towards implementing this plant...

  11. Genotypic Diversity for Biomass Accumulation and Shoot-Root Allometry in the Grass Brachypodium distachyon (United States)

    Jansson, C.; Handakumbura, P. P.; Fortin, D.; Stanfill, B.; Rivas-Ubach, A.


    Predicting carbon uptake, assimilation and allocation for current and future biogeographical environments, including climate, is critical for our ability to select and/or design plant genotypes to meet increasing demand for plant biomass going into food, feed and energy production, while at the same time maintain or increase soil organic matter (SOM for soil fertility and carbon storage, and reduce emission of greenhouse gasses. As has been demonstrated for several plant species allometric relationships may differ between plant genotypes. Exploring plant genotypic diversity for biomass accumulation and allometry will potentially enable selection of genotypes with high CO2 assimilation and favorable allocation of recent photosynthate into above-ground and below-ground biomass. We are investigating genotypic diversity for PFTs in natural accessions of the annual C3 grass Brachypodium distachyon under current and future climate scenarios and how genotypic diversity correlates with metabolite profiles in aboveground and below-ground biomass. In the current study, we compare effects from non-stressed and drought conditions on biomass accumulation and shoot-root allometry.

  12. Grass cell wall feruloylation: distribution of bound ferulate and candidate gene expression in Brachypodium distachyon

    Directory of Open Access Journals (Sweden)

    Hugo Bruno Correa Molinari


    Full Text Available The cell walls of grasses such as wheat, maize, rice and sugar cane, contain large amounts of ferulate that is ester-linked to the cell wall polysaccharide glucuronoarabinoxylan (GAX. This ferulate is considered to limit the digestibility of polysaccharide in grass biomass as it forms covalent linkages between polysaccharide and lignin components. Candidate genes within a grass-specific clade of the BAHD acyl-coA transferase superfamily have been identified as being responsible for the ester linkage of ferulate to GAX. Manipulation of these BAHD genes may therefore be a biotechnological target for increasing efficiency of conversion of grass biomass into biofuel. Here, we describe the expression of these candidate genes and amounts of bound ferulate from various tissues and developmental stages of the model grass Brachypodium distachyon. BAHD candidate transcripts and significant amounts of bound ferulate were present in every tissue and developmental stage. We hypothesise that BAHD candidate genes similar to the recently described rice OsPMT gene (PMT sub-clade are principally responsible for the bound coumaric acid (pCA, and that other BAHD candidates (non-PMT sub-clade are responsible for bound ferulic acid (FA. There were some similarities with between the ratio of expression non-PMT / PMT genes and the ratio of bound FA / pCA between tissue types, compatible with this hypothesis. However, much further work to modify BAHD genes in grasses and to characterise the heterologously expressed proteins is required to demonstrate their function.

  13. Brachypodium distachyon

    DEFF Research Database (Denmark)

    Tanackovic, Vanja

    Starch is one of the most abundant polysaccharides on the Earth, the principal energy storage of most plant species and of crucial significance for humans as a major nutrient in human diet. The majority of produced starch comes from cereals, domesticated grasses, characterized by specific en......­hanced traits known as the domestication syndrome. Wild grasses, on the other side, still have traits lost during the process. Brachypodium distachyon (Brachypodium) is one of the wild grass recently introduced as a model plant for temperate cereals, closely related to pre-domesticated cereals such as barley...... (Hordeum vulgare). This thesis focuses on domestication of grasses – the cereal ancestors, starch in the grass Brachypodium distachyon, and its comparison to domesticated cereal. Grasses can potentially be used for the reintroduction of the lost grass traits, like health-promoting carbohydrates. Therefore...

  14. Using the Model Perennial Grass Brachypodium sylvaticum to Engineer Resistance to Multiple Abiotic Stresses

    Energy Technology Data Exchange (ETDEWEB)

    Gordon, Sean; Reguera, Maria; Sade, Nir; Cartwright, Amy; Tobias, Christian; Thilmony, Roger; Blumwald, Eduardo; Vogel, John


    We are using the perennial model grass Brachypodium sylvaticum to identify combinations of transgenes that enhance tolerance to multiple, simultaneous abiotic stresses. The most successful transgene combinations will ultimately be used to create improved switchgrass (Panicum virgatum L.) cultivars. To further develop B. sylvaticum as a perennial model grass, and facilitate our planned transcriptional profiling, we are sequencing and annotating the genome. We have generated ~40x genome coverage using PacBio sequencing of the largest possible size selected libraries (18, 22, 25 kb). Our initial assembly using only long-read sequence contained 320 Mb of sequence with an N50 contig length of 315 kb and an N95 contig length of 40 kb. This assembly consists of 2,430 contigs, the largest of which was 1.6 Mb. The estimated genome size based on c-values is 340 Mb indicating that about 20 Mb of presumably repetitive DNA remains yet unassembled. Significantly, this assembly is far superior to an assembly created from paired-end short-read sequence, ~100x genome coverage. The short-read-only assembly contained only 226 Mb of sequence in 19k contigs. To aid the assembly of the scaffolds into chromosome-scale assemblies we produced an F2 mapping population and have genotyped 480 individuals using a genotype by sequence approach. One of the reasons for using B. sylvaticum as a model system is to determine if the transgenes adversely affect perenniality and winter hardiness. Toward this goal, we examined the freezing tolerance of wild type B. sylvaticum lines to determine the optimal conditions for testing the freezing tolerance of the transgenics. A survey of seven accessions noted significant natural variation in freezing tolerance. Seedling or adult Ain-1 plants, the line used for transformation, survived an 8 hour challenge down to -6 oC and 50% survived a challenge down to -9 oC. Thus, we will be able to easily determine if the transgenes compromise freezing tolerance. In the

  15. Comparative study of transgenic Brachypodium distachyon expressing sucrose:fructan 6-fructosyltransferases from wheat and timothy grass with different enzymatic properties. (United States)

    Tamura, Ken-Ichi; Sanada, Yasuharu; Tase, Kazuhiro; Kawakami, Akira; Yoshida, Midori; Yamada, Toshihiko


    Fructans can act as cryoprotectants and contribute to freezing tolerance in plant species, such as in members of the grass subfamily Pooideae that includes Triticeae species and forage grasses. To elucidate the relationship of freezing tolerance, carbohydrate composition and degree of polymerization (DP) of fructans, we generated transgenic plants in the model grass species Brachypodium distachyon that expressed cDNAs for sucrose:fructan 6-fructosyltransferases (6-SFTs) with different enzymatic properties: one cDNA encoded PpFT1 from timothy grass (Phleum pratense), an enzyme that produces high-DP levans; a second cDNA encoded wft1 from wheat (Triticum aestivum), an enzyme that produces low-DP levans. Transgenic lines expressing PpFT1 and wft1 showed retarded growth; this effect was particularly notable in the PpFT1 transgenic lines. When grown at 22 °C, both types of transgenic line showed little or no accumulation of fructans. However, after a cold treatment, wft1 transgenic plants accumulated fructans with DP = 3-40, whereas PpFT1 transgenic plants accumulated fructans with higher DPs (20 to the separation limit). The different compositions of the accumulated fructans in the two types of transgenic line were correlated with the differences in the enzymatic properties of the overexpressed 6-SFTs. Transgenic lines expressing PpFT1 accumulated greater amounts of mono- and disaccharides than wild type and wft1 expressing lines. Examination of leaf blades showed that after cold acclimation, PpFT1 overexpression increased tolerance to freezing; by contrast, the freezing tolerance of the wft1 expressing lines was the same as that of wild type plants. These results provide new insights into the relationship of the composition of water-soluble carbohydrates and the DP of fructans to freezing tolerance in plants.

  16. Centromeric DNA characterization in the model grass Brachypodium distachyon provides insights on the evolution of the genus. (United States)

    Li, Yinjia; Zuo, Sheng; Zhang, Zhiliang; Li, Zhanjie; Han, Jinlei; Chu, Zhaoqing; Hasterok, Robert; Wang, Kai


    Brachypodium distachyon is a well-established model monocot plant, and its small and compact genome has been used as an accurate reference for the much larger and often polyploid genomes of cereals such as Avena sativa (oats), Hordeum vulgare (barley) and Triticum aestivum (wheat). Centromeres are indispensable functional units of chromosomes and they play a core role in genome polyploidization events during evolution. As the Brachypodium genus contains about 20 species that differ significantly in terms of their basic chromosome numbers, genome size, ploidy levels and life strategies, studying their centromeres may provide important insight into the structure and evolution of the genome in this interesting and important genus. In this study, we isolated the centromeric DNA of the B. distachyon reference line Bd21 and characterized its composition via the chromatin immunoprecipitation of the nucleosomes that contain the centromere-specific histone CENH3. We revealed that the centromeres of Bd21 have the features of typical multicellular eukaryotic centromeres. Strikingly, these centromeres contain relatively few centromeric satellite DNAs; in particular, the centromere of chromosome 5 (Bd5) consists of only ~40 kb. Moreover, the centromeric retrotransposons in B. distachyon (CRBds) are evolutionarily young. These transposable elements are located both within and adjacent to the CENH3 binding domains, and have similar compositions. Moreover, based on the presence of CRBds in the centromeres, the species in this study can be grouped into two distinct lineages. This may provide new evidence regarding the phylogenetic relationships within the Brachypodium genus. © 2018 The Authors The Plant Journal © 2018 John Wiley & Sons Ltd.

  17. Host status of false brome grass to the leaf rust fungus Puccinia brachypodii and the stripe rust fungus P. Striiformis

    NARCIS (Netherlands)

    Barbieri, M.; Marcel, T.C.; Niks, R.E.


    Purple false brome grass (Brachypodium distachyon) has recently emerged as a model system for temperate grasses and is also a potential model plant to investigate plant interactions with economically important pathogens such as rust fungi. We determined the host status of five Brachypodium species

  18. Dichotomy in the NRT gene families of dicots and grass species.

    Directory of Open Access Journals (Sweden)

    Darren Plett

    Full Text Available A large proportion of the nitrate (NO(3(- acquired by plants from soil is actively transported via members of the NRT families of NO(3(- transporters. In Arabidopsis, the NRT1 family has eight functionally characterised members and predominantly comprises low-affinity transporters; the NRT2 family contains seven members which appear to be high-affinity transporters; and there are two NRT3 (NAR2 family members which are known to participate in high-affinity transport. A modified reciprocal best hit (RBH approach was used to identify putative orthologues of the Arabidopsis NRT genes in the four fully sequenced grass genomes (maize, rice, sorghum, Brachypodium. We also included the poplar genome in our analysis to establish whether differences between Arabidopsis and the grasses may be generally applicable to monocots and dicots. Our analysis reveals fundamental differences between Arabidopsis and the grass species in the gene number and family structure of all three families of NRT transporters. All grass species possessed additional NRT1.1 orthologues and appear to lack NRT1.6/NRT1.7 orthologues. There is significant separation in the NRT2 phylogenetic tree between NRT2 genes from dicots and grass species. This indicates that determination of function of NRT2 genes in grass species will not be possible in cereals based simply on sequence homology to functionally characterised Arabidopsis NRT2 genes and that proper functional analysis will be required. Arabidopsis has a unique NRT3.2 gene which may be a fusion of the NRT3.1 and NRT3.2 genes present in all other species examined here. This work provides a framework for future analysis of NO(3(- transporters and NO(3(- transport in grass crop species.

  19. Fine mapping of the Bsr1 barley stripe mosaic virus resistance gene in the model grass Brachypodium distachyon.

    Directory of Open Access Journals (Sweden)

    Yu Cui

    Full Text Available The ND18 strain of Barley stripe mosaic virus (BSMV infects several lines of Brachypodium distachyon, a recently developed model system for genomics research in cereals. Among the inbred lines tested, Bd3-1 is highly resistant at 20 to 25 °C, whereas Bd21 is susceptible and infection results in an intense mosaic phenotype accompanied by high levels of replicating virus. We generated an F(6:7 recombinant inbred line (RIL population from a cross between Bd3-1 and Bd21 and used the RILs, and an F(2 population of a second Bd21 × Bd3-1 cross to evaluate the inheritance of resistance. The results indicate that resistance segregates as expected for a single dominant gene, which we have designated Barley stripe mosaic virus resistance 1 (Bsr1. We constructed a genetic linkage map of the RIL population using SNP markers to map this gene to within 705 Kb of the distal end of the top of chromosome 3. Additional CAPS and Indel markers were used to fine map Bsr1 to a 23 Kb interval containing five putative genes. Our study demonstrates the power of using RILs to rapidly map the genetic determinants of BSMV resistance in Brachypodium. Moreover, the RILs and their associated genetic map, when combined with the complete genomic sequence of Brachypodium, provide new resources for genetic analyses of many other traits.

  20. Quantitative Trait Loci Associated with Drought Tolerance in Brachypodium distachyon

    Directory of Open Access Journals (Sweden)

    Yiwei Jiang


    Full Text Available The temperate wild grass Brachypodium distachyon (Brachypodium serves as model system for studying turf and forage grasses. Brachypodium collections show diverse responses to drought stress, but little is known about the genetic mechanisms of drought tolerance of this species. The objective of this study was to identify quantitative trait loci (QTLs associated with drought tolerance traits in Brachypodium. We assessed leaf fresh weight (LFW, leaf dry weight (LDW, leaf water content (LWC, leaf wilting (WT, and chlorophyll fluorescence (Fv/Fm under well-watered and drought conditions on a recombinant inbred line (RIL population from two parents (Bd3-1 and Bd1-1 known to differ in their drought adaptation. A linkage map of the RIL population was constructed using 467 single nucleotide polymorphism (SNP markers obtained from genotyping-by-sequencing. The Bd3-1/Bd1-1 map spanned 1,618 cM and had an average distance of 3.5 cM between adjacent single nucleotide polymorphisms (SNPs. Twenty-six QTLs were identified in chromosome 1, 2, and 3 in two experiments, with 14 of the QTLs under well-watered conditions and 12 QTLs under drought stress. In Experiment 1, a QTL located on chromosome 2 with a peak at 182 cM appeared to simultaneously control WT, LWC, and Fv/Fm under drought stress, accounting for 11–18.7% of the phenotypic variation. Allelic diversity of candidate genes DREB2B, MYB, and SPK, which reside in one multi-QTL region, may play a role in the natural variation in whole plant drought tolerance in Brachypodium. Co-localization of QTLs for multiple drought-related traits suggest that the gene(s involved are important regulators of drought tolerance in Brachypodium.

  1. Annotation and comparative analysis of the glycoside hydrolase genes in Brachypodium distachyon

    Directory of Open Access Journals (Sweden)

    Wu Jiajie


    Full Text Available Abstract Background Glycoside hydrolases cleave the bond between a carbohydrate and another carbohydrate, a protein, lipid or other moiety. Genes encoding glycoside hydrolases are found in a wide range of organisms, from archea to animals, and are relatively abundant in plant genomes. In plants, these enzymes are involved in diverse processes, including starch metabolism, defense, and cell-wall remodeling. Glycoside hydrolase genes have been previously cataloged for Oryza sativa (rice, the model dicotyledonous plant Arabidopsis thaliana, and the fast-growing tree Populus trichocarpa (poplar. To improve our understanding of glycoside hydrolases in plants generally and in grasses specifically, we annotated the glycoside hydrolase genes in the grasses Brachypodium distachyon (an emerging monocotyledonous model and Sorghum bicolor (sorghum. We then compared the glycoside hydrolases across species, at the levels of the whole genome and individual glycoside hydrolase families. Results We identified 356 glycoside hydrolase genes in Brachypodium and 404 in sorghum. The corresponding proteins fell into the same 34 families that are represented in rice, Arabidopsis, and poplar, helping to define a glycoside hydrolase family profile which may be common to flowering plants. For several glycoside hydrolase familes (GH5, GH13, GH18, GH19, GH28, and GH51, we present a detailed literature review together with an examination of the family structures. This analysis of individual families revealed both similarities and distinctions between monocots and eudicots, as well as between species. Shared evolutionary histories appear to be modified by lineage-specific expansions or deletions. Within GH families, the Brachypodium and sorghum proteins generally cluster with those from other monocots. Conclusions This work provides the foundation for further comparative and functional analyses of plant glycoside hydrolases. Defining the Brachypodium glycoside hydrolases sets

  2. ROOT HAIR DEFECTIVE SIX-LIKE Class I Genes Promote Root Hair Development in the Grass Brachypodium distachyon.

    Directory of Open Access Journals (Sweden)

    Chul Min Kim


    Full Text Available Genes encoding ROOT HAIR DEFECTIVE SIX-LIKE (RSL class I basic helix loop helix proteins are expressed in future root hair cells of the Arabidopsis thaliana root meristem where they positively regulate root hair cell development. Here we show that there are three RSL class I protein coding genes in the Brachypodium distachyon genome, BdRSL1, BdRSL2 and BdRSL3, and each is expressed in developing root hair cells after the asymmetric cell division that forms root hair cells and hairless epidermal cells. Expression of BdRSL class I genes is sufficient for root hair cell development: ectopic overexpression of any of the three RSL class I genes induces the development of root hairs in every cell of the root epidermis. Expression of BdRSL class I genes in root hairless Arabidopsis thaliana root hair defective 6 (Atrhd6 Atrsl1 double mutants, devoid of RSL class I function, restores root hair development indicating that the function of these proteins has been conserved. However, neither AtRSL nor BdRSL class I genes is sufficient for root hair development in A. thaliana. These data demonstrate that the spatial pattern of class I RSL activity can account for the pattern of root hair cell differentiation in B. distachyon. However, the spatial pattern of class I RSL activity cannot account for the spatial pattern of root hair cells in A. thaliana. Taken together these data indicate that that the functions of RSL class I proteins have been conserved among most angiosperms-monocots and eudicots-despite the dramatically different patterns of root hair cell development.

  3. Population Structure in the Model Grass Brachypodium distachyon Is Highly Correlated with Flowering Differences across Broad Geographic Areas

    Directory of Open Access Journals (Sweden)

    Ludmila Tyler


    Full Text Available The small, annual grass (L. Beauv., a close relative of wheat ( L. and barley ( L., is a powerful model system for cereals and bioenergy grasses. Genome-wide association studies (GWAS of natural variation can elucidate the genetic basis of complex traits but have been so far limited in by the lack of large numbers of well-characterized and sufficiently diverse accessions. Here, we report on genotyping-by-sequencing (GBS of 84 , seven , and three accessions with diverse geographic origins including Albania, Armenia, Georgia, Italy, Spain, and Turkey. Over 90,000 high-quality single-nucleotide polymorphisms (SNPs distributed across the Bd21 reference genome were identified. Our results confirm the hybrid nature of the genome, which appears as a mosaic of -like and -like sequences. Analysis of more than 50,000 SNPs for the accessions revealed three distinct, genetically defined populations. Surprisingly, these genomic profiles are associated with differences in flowering time rather than with broad geographic origin. High levels of differentiation in loci associated with floral development support the differences in flowering phenology between populations. Genome-wide association studies combining genotypic and phenotypic data also suggest the presence of one or more photoperiodism, circadian clock, and vernalization genes in loci associated with flowering time variation within populations. Our characterization elucidates genes underlying population differences, expands the germplasm resources available for , and illustrates the feasibility and limitations of GWAS in this model grass.

  4. Expression atlas and comparative coexpression network analyses reveal important genes involved in the formation of lignified cell wall in Brachypodium distachyon. (United States)

    Sibout, Richard; Proost, Sebastian; Hansen, Bjoern Oest; Vaid, Neha; Giorgi, Federico M; Ho-Yue-Kuang, Severine; Legée, Frédéric; Cézart, Laurent; Bouchabké-Coussa, Oumaya; Soulhat, Camille; Provart, Nicholas; Pasha, Asher; Le Bris, Philippe; Roujol, David; Hofte, Herman; Jamet, Elisabeth; Lapierre, Catherine; Persson, Staffan; Mutwil, Marek


    While Brachypodium distachyon (Brachypodium) is an emerging model for grasses, no expression atlas or gene coexpression network is available. Such tools are of high importance to provide insights into the function of Brachypodium genes. We present a detailed Brachypodium expression atlas, capturing gene expression in its major organs at different developmental stages. The data were integrated into a large-scale coexpression database (, enabling identification of duplicated pathways and conserved processes across 10 plant species, thus allowing genome-wide inference of gene function. We highlight the importance of the atlas and the platform through the identification of duplicated cell wall modules, and show that a lignin biosynthesis module is conserved across angiosperms. We identified and functionally characterised a putative ferulate 5-hydroxylase gene through overexpression of it in Brachypodium, which resulted in an increase in lignin syringyl units and reduced lignin content of mature stems, and led to improved saccharification of the stem biomass. Our Brachypodium expression atlas thus provides a powerful resource to reveal functionally related genes, which may advance our understanding of important biological processes in grasses. © 2017 The Authors. New Phytologist © 2017 New Phytologist Trust.

  5. Time-dependent leaf proteome alterations of Brachypodium distachyon in response to drought stress. (United States)

    Tatli, Ozge; Sogutmaz Ozdemir, Bahar; Dinler Doganay, Gizem


    For the first time, a comprehensive proteome analysis was conducted on Brachypodium leaves under drought stress. Gradual changes in response to drought stress were monitored. Drought is one of the major stress factors that dramatically affect the agricultural productivity worldwide. Improving the yield under drought is an urgent challenge in agriculture. Brachypodium distachyon is a model species for monocot plants such as wheat, barley and several potential biofuel grasses. In the current study, a comprehensive proteome analysis was conducted on Brachypodium leaves under different levels of drought application. To screen gradual changes upon drought, Brachypodium leaves subjected to drought for 4, 8 and 12 days were collected for each treatment day and relative water content of the leaves was measured for each time point. Cellular responses of Brachypodium were investigated through a proteomic approach involving two dimensional difference gel electrophoresis (2D-DIGE) and mass spectrometry (MS). Among 497 distinct spots in Brachypodium protein repertoire, a total of 13 differentially expressed proteins (DEPs) were identified as responsive to drought by mass spectrometry and classified according to their functions using bioinformatics tools. The biological functions of DEPs included roles in photosynthesis, protein folding, antioxidant mechanism and metabolic processes, which responded differentially at each time point of drought treatment. To examine further transcriptional expression of the genes that code identified protein, quantitative real time PCR (qRT-PCR) was performed. Identified proteins will contribute to the studies involving development of drought-resistant crop species and lead to the delineation of molecular mechanisms in drought response.

  6. Soil nitrogen mineralization not affected by grass species traits (United States)

    Maged Ikram Nosshi; Jack Butler; M. J. Trlica


    Species N use traits was evaluated as a mechanism whereby Bromus inermis (Bromus), an established invasive, might alter soil N supply in a Northern mixed-grass prairie. We compared soils under stands of Bromus with those from three representative native grasses of different litter C/N: Andropogon...

  7. Genetic structure and diversity of the selfing model grass Brachypodium stacei (Poaceae in Western Mediterranean: out of the Iberian Peninsula and into the islands

    Directory of Open Access Journals (Sweden)

    Valeriia Shiposha


    Full Text Available Annual Mediterranean species of the genus Brachypodium are promising model plants for energy crops since their selfing nature and short-life cycles are an advantage in breeding programs. The false brome, B. distachyon, has already been sequenced and new genomic initiatives have triggered the de-novo genome sequencing of its close relatives such as B. stacei, a species that was until recently mistaken for B. distachyon. However, the success of these initiatives hinges on detailed knowledge about the distribution of genetic variation within and among populations for the effective use of germplasm in a breeding program. Understanding population genetic diversity and genetic structure is also an important prerequisite for designing effective experimental populations for genomic wide studies. However, population genetic data are still limited in B. stacei. We therefore selected and amplified 10 nuclear microsatellite markers to depict patterns of population structure and genetic variation among 181 individuals from 19 populations of B. stacei occurring in its predominant range, the western Mediterranean area: mainland Iberian Peninsula, continental Balearic Islands and oceanic Canary Islands. Our genetic results support the occurrence of a predominant selfing system with extremely high levels of homozygosity across the analyzed populations. Despite the low level of genetic variation found, two different genetic clusters were retrieved, one clustering all SE Iberian mainland populations and the island of Minorca and another one grouping all S Iberian mainland populations, the Canary Islands and all Majorcan populations except one that clustered with the former group. These results, together with a high sharing of alleles (89% suggest different colonization routes from the mainland Iberian Peninsula into the islands. A recent colonization scenario could explain the relatively low levels of genetic diversity and low number of alleles found in the Canary

  8. Genetic structure and diversity of the selfing model grass Brachypodium stacei (Poaceae) in Western Mediterranean: out of the Iberian Peninsula and into the islands. (United States)

    Shiposha, Valeriia; Catalán, Pilar; Olonova, Marina; Marques, Isabel


    Annual Mediterranean species of the genus Brachypodium are promising model plants for energy crops since their selfing nature and short-life cycles are an advantage in breeding programs. The false brome, B. distachyon, has already been sequenced and new genomic initiatives have triggered the de-novo genome sequencing of its close relatives such as B. stacei, a species that was until recently mistaken for B. distachyon. However, the success of these initiatives hinges on detailed knowledge about the distribution of genetic variation within and among populations for the effective use of germplasm in a breeding program. Understanding population genetic diversity and genetic structure is also an important prerequisite for designing effective experimental populations for genomic wide studies. However, population genetic data are still limited in B. stacei. We therefore selected and amplified 10 nuclear microsatellite markers to depict patterns of population structure and genetic variation among 181 individuals from 19 populations of B. stacei occurring in its predominant range, the western Mediterranean area: mainland Iberian Peninsula, continental Balearic Islands and oceanic Canary Islands. Our genetic results support the occurrence of a predominant selfing system with extremely high levels of homozygosity across the analyzed populations. Despite the low level of genetic variation found, two different genetic clusters were retrieved, one clustering all SE Iberian mainland populations and the island of Minorca and another one grouping all S Iberian mainland populations, the Canary Islands and all Majorcan populations except one that clustered with the former group. These results, together with a high sharing of alleles (89%) suggest different colonization routes from the mainland Iberian Peninsula into the islands. A recent colonization scenario could explain the relatively low levels of genetic diversity and low number of alleles found in the Canary Islands

  9. Grass pollen immunotherapy induces highly cross-reactive IgG antibodies to group V allergen from different grass species

    NARCIS (Netherlands)

    van Ree, R.; Brewczyński, P. Z.; Tan, K. Y.; Mulder-Willems, H. J.; Widjaja, P.; Stapel, S. O.; Aalberse, R. C.; Kroon, A. M.


    Sera from two groups of patients receiving grass pollen immunotherapy were tested on IgG reactivity with group V allergen from six different grass species. One group of patients was treated with a mixture of 10 grass species, and the other with a mixture of five. Only Lolium perenne, Dactylis

  10. Grass species selection patterns on rotationally-grazed Dohne ...

    African Journals Online (AJOL)

    Herbaceous species preference was studied during autumn and winter periods of occupation, on rotationally-grazed Dohne Sourveld, at four different stocking rates. Reports on species selection by cattle and sheep grazing together. Illustrates with graphsLanguage: English. Keywords: Grass species; Herbage availibility; ...

  11. Short Communication: Autelogical studies on grass species in ...

    African Journals Online (AJOL)

    A literature survey of autecological studies on southern African grass species was undertaken. Results revealed that there is a comparative lack of autecological versus community studies. Where autecological studies have been conducted, most of the attention was focused on 'pasture' or 'desirable' species with ...

  12. Adaptation of a decreaser and an increaser grass species to ...

    African Journals Online (AJOL)

    Grasses have developed through natural selection to deter, escape and tolerate herbivory, and to escape and tolerate fire. In the semi-arid grassveld of the Eastern Cape, the species Themeda triandra and Sporobolus fimbriatus have been classified as Decreaser and Increaser II plants respectively. Both species have ...

  13. Expression profiling of marker genes responsive to the defence-associated phytohormones salicylic acid, jasmonic acid and ethylene in Brachypodium distachyon. (United States)

    Kouzai, Yusuke; Kimura, Mamiko; Yamanaka, Yurie; Watanabe, Megumi; Matsui, Hidenori; Yamamoto, Mikihiro; Ichinose, Yuki; Toyoda, Kazuhiro; Onda, Yoshihiko; Mochida, Keiichi; Noutoshi, Yoshiteru


    Brachypodium distachyon is a promising model plants for grasses. Infections of Brachypodium by various pathogens that severely impair crop production have been reported, and the species accordingly provides an alternative platform for investigating molecular mechanisms of pathogen virulence and plant disease resistance. To date, we have a broad picture of plant immunity only in Arabidopsis and rice; therefore, Brachypodium may constitute a counterpart that displays the commonality and uniqueness of defence systems among plant species. Phytohormones play key roles in plant biotic stress responses, and hormone-responsive genes are used to qualitatively and quantitatively evaluate disease resistance responses during pathogen infection. For these purposes, defence-related phytohormone marker genes expressed at time points suitable for defence-response monitoring are needed. Information about their expression profiles over time as well as their response specificity is also helpful. However, useful marker genes are still rare in Brachypodium. We selected 34 candidates for Brachypodium marker genes on the basis of protein-sequence similarity to known marker genes used in Arabidopsis and rice. Brachypodium plants were treated with the defence-related phytohormones salicylic acid, jasmonic acid and ethylene, and their transcription levels were measured 24 and 48 h after treatment. Two genes for salicylic acid, 7 for jasmonic acid and 2 for ethylene were significantly induced at either or both time points. We then focused on 11 genes encoding pathogenesis-related (PR) 1 protein and compared their expression patterns with those of Arabidopsis and rice. Phylogenetic analysis suggested that Brachypodium contains several PR1-family genes similar to rice genes. Our expression profiling revealed that regulation patterns of some PR1 genes as well as of markers identified for defence-related phytohormones are closely related to those in rice. We propose that the Brachypodium immune

  14. The perennial ryegrass GenomeZipper: targeted use of genome resources for comparative grass genomics. (United States)

    Pfeifer, Matthias; Martis, Mihaela; Asp, Torben; Mayer, Klaus F X; Lübberstedt, Thomas; Byrne, Stephen; Frei, Ursula; Studer, Bruno


    Whole-genome sequences established for model and major crop species constitute a key resource for advanced genomic research. For outbreeding forage and turf grass species like ryegrasses (Lolium spp.), such resources have yet to be developed. Here, we present a model of the perennial ryegrass (Lolium perenne) genome on the basis of conserved synteny to barley (Hordeum vulgare) and the model grass genome Brachypodium (Brachypodium distachyon) as well as rice (Oryza sativa) and sorghum (Sorghum bicolor). A transcriptome-based genetic linkage map of perennial ryegrass served as a scaffold to establish the chromosomal arrangement of syntenic genes from model grass species. This scaffold revealed a high degree of synteny and macrocollinearity and was then utilized to anchor a collection of perennial ryegrass genes in silico to their predicted genome positions. This resulted in the unambiguous assignment of 3,315 out of 8,876 previously unmapped genes to the respective chromosomes. In total, the GenomeZipper incorporates 4,035 conserved grass gene loci, which were used for the first genome-wide sequence divergence analysis between perennial ryegrass, barley, Brachypodium, rice, and sorghum. The perennial ryegrass GenomeZipper is an ordered, information-rich genome scaffold, facilitating map-based cloning and genome assembly in perennial ryegrass and closely related Poaceae species. It also represents a milestone in describing synteny between perennial ryegrass and fully sequenced model grass genomes, thereby increasing our understanding of genome organization and evolution in the most important temperate forage and turf grass species.

  15. Linking dynamic phenotyping with metabolite analysis to study natural variation in drought responses of Brachypodium distachyon

    Directory of Open Access Journals (Sweden)

    Lorraine H.C. Fisher


    Full Text Available Drought is an important environmental stress limiting the productivity of major crops worldwide. Understanding drought tolerance and possible mechanisms for improving drought resistance is therefore a prerequisite to develop drought-tolerant crops that produce significant yields with reduced amounts of water. Brachypodium distachyon (Brachypodium is a key model species for cereals, forage grasses and energy grasses. In this study, initial screening of a Brachypodium germplasm collection consisting of 138 different ecotypes exposed to progressive drought, highlighted the natural variation in morphology, biomass accumulation and responses to drought stress. A core set of ten ecotypes, classified as being either tolerant, susceptible or intermediate, in response to drought stress, were exposed to mild or severe (respectively 15% and 0% soil water content drought stress and phenomic parameters linked to growth and colour changes were assessed. When exposed to severe drought stress, phenotypic data and metabolite profiling combined with multivariate analysis revealed a remarkable consistency in separating the selected ecotypes into their different pre-defined drought tolerance groups. Increases in several metabolites, including for the phytohormones jasmonic acid and salicylic acid, and TCA-cycle intermediates, were positively correlated with biomass yield and with reduced yellow pixel counts; suggestive of delayed senescence, both key target traits for crop improvement to drought stress. While metabolite analysis also separated ecotypes into the distinct tolerance groupings after exposure to mild drought stress, similar analysis of the phenotypic data failed to do so, confirming the value of metabolomics to investigate early responses to drought stress. The results highlight the potential of combining the analyses of phenotypic and metabolic responses to identify key mechanisms and markers associated with drought tolerance in both the Brachypodium

  16. The Perennial Ryegrass GenomeZipper – Targeted Use of Genome Resources for Comparative Grass Genomics

    DEFF Research Database (Denmark)

    Pfeiffer, Matthias; Martis, Mihaela; Asp, Torben


    (Lolium perenne) genome on the basis of conserved synteny to barley (Hordeum vulgare) and the model grass genome Brachypodium (Brachypodium distachyon) as well as rice (Oryza sativa) and sorghum (Sorghum bicolor). A transcriptome-based genetic linkage map of perennial ryegrass served as a scaffold......Whole-genome sequences established for model and major crop species constitute a key resource for advanced genomic research. For outbreeding forage and turf grass species like ryegrasses (Lolium spp.), such resources have yet to be developed. Here, we present a model of the perennial ryegrass...... to establish the chromosomal arrangement of syntenic genes from model grass species. This scaffold revealed a high degree of synteny and macrocollinearity and was then utilized to anchor a collection of perennial ryegrass genes in silico to their predicted genome positions. This resulted in the unambiguous...

  17. The Perennial Ryegrass GenomeZipper: Targeted Use of Genome Resources for Comparative Grass Genomics1[C][W (United States)

    Pfeifer, Matthias; Martis, Mihaela; Asp, Torben; Mayer, Klaus F.X.; Lübberstedt, Thomas; Byrne, Stephen; Frei, Ursula; Studer, Bruno


    Whole-genome sequences established for model and major crop species constitute a key resource for advanced genomic research. For outbreeding forage and turf grass species like ryegrasses (Lolium spp.), such resources have yet to be developed. Here, we present a model of the perennial ryegrass (Lolium perenne) genome on the basis of conserved synteny to barley (Hordeum vulgare) and the model grass genome Brachypodium (Brachypodium distachyon) as well as rice (Oryza sativa) and sorghum (Sorghum bicolor). A transcriptome-based genetic linkage map of perennial ryegrass served as a scaffold to establish the chromosomal arrangement of syntenic genes from model grass species. This scaffold revealed a high degree of synteny and macrocollinearity and was then utilized to anchor a collection of perennial ryegrass genes in silico to their predicted genome positions. This resulted in the unambiguous assignment of 3,315 out of 8,876 previously unmapped genes to the respective chromosomes. In total, the GenomeZipper incorporates 4,035 conserved grass gene loci, which were used for the first genome-wide sequence divergence analysis between perennial ryegrass, barley, Brachypodium, rice, and sorghum. The perennial ryegrass GenomeZipper is an ordered, information-rich genome scaffold, facilitating map-based cloning and genome assembly in perennial ryegrass and closely related Poaceae species. It also represents a milestone in describing synteny between perennial ryegrass and fully sequenced model grass genomes, thereby increasing our understanding of genome organization and evolution in the most important temperate forage and turf grass species. PMID:23184232

  18. Genome-wide distribution and organization of microsatellites in plants: an insight into marker development in Brachypodium.

    Directory of Open Access Journals (Sweden)

    Humira Sonah

    Full Text Available Plant genomes are complex and contain large amounts of repetitive DNA including microsatellites that are distributed across entire genomes. Whole genome sequences of several monocot and dicot plants that are available in the public domain provide an opportunity to study the origin, distribution and evolution of microsatellites, and also facilitate the development of new molecular markers. In the present investigation, a genome-wide analysis of microsatellite distribution in monocots (Brachypodium, sorghum and rice and dicots (Arabidopsis, Medicago and Populus was performed. A total of 797,863 simple sequence repeats (SSRs were identified in the whole genome sequences of six plant species. Characterization of these SSRs revealed that mono-nucleotide repeats were the most abundant repeats, and that the frequency of repeats decreased with increase in motif length both in monocots and dicots. However, the frequency of SSRs was higher in dicots than in monocots both for nuclear and chloroplast genomes. Interestingly, GC-rich repeats were the dominant repeats only in monocots, with the majority of them being present in the coding region. These coding GC-rich repeats were found to be involved in different biological processes, predominantly binding activities. In addition, a set of 22,879 SSR markers that were validated by e-PCR were developed and mapped on different chromosomes in Brachypodium for the first time, with a frequency of 101 SSR markers per Mb. Experimental validation of 55 markers showed successful amplification of 80% SSR markers in 16 Brachypodium accessions. An online database 'BraMi' (Brachypodium microsatellite markers of these genome-wide SSR markers was developed and made available in the public domain. The observed differential patterns of SSR marker distribution would be useful for studying microsatellite evolution in a monocot-dicot system. SSR markers developed in this study would be helpful for genomic studies in Brachypodium

  19. Responses of three grass species to creosote during phytoremediation

    International Nuclear Information System (INIS)

    Huang Xiaodong; El-Alawi, Yousef; Penrose, Donna M.; Glick, Bernard R.; Greenberg, Bruce M.


    Phytoremediation of creosote-contaminated soil was monitored in the presence of Tall fescue, Kentucky blue grass, or Wild rye. For all three grass species, plant growth promoting rhizobacteria (PGPR) were evaluated for plant growth promotion and protection of plants from contaminant toxicity. A number of parameters were monitored including plant tissue water content, root growth, plant chlorophyll content and the chlorophyll a/b ratio. The observed physiological data indicate that some plants mitigated the toxic effects of contaminants. In addition, in agreement with our previous experiments reported in the accompanying paper (Huang, X.-D., El-Alawi, Y., Penrose, D.M., Glick, B.R., Greenberg, B.M., 2004. A multi-process phytoremediation system for removal of polycyclic aromatic hydrocarbons from contaminated soil. Environ. Poll. doi: 10.1016/j.envpol.2003.09.031), PGPR were able to greatly enhance phytoremediation. PGPR accelerated plant growth, especially roots, in heavily contaminated soils, diminishing the toxic effects of contaminants to plants. Thus, the increased root biomass in PGPR-treated plants led to more effective remediation. - Plant growth promoting rhizobacteria enhanced growth and remediation of three grass species

  20. Indirect effects of an invasive annual grass on seed fates of two native perennial grass species. (United States)

    Meyer, Susan E; Merrill, Katherine T; Allen, Phil S; Beckstead, Julie; Norte, Anna S


    Invasive plants exhibit both direct and indirect negative effects on recruitment of natives following invasion. We examined indirect effects of the invader Bromus tectorum (cheatgrass) on seed fates of two native grass species, Elymus elymoides and Pseudoroegneria spicata, by removing B. tectorum and by adding inoculum of the shared seed pathogen Pyrenophora semeniperda in factorial experiments at xeric and mesic field sites. We also included a supplemental watering treatment to increase emergence and also the potential for pathogen escape. We recorded emergence and survival of native seedlings and also determined the fate of unemerged seeds. At the xeric site, Pyrenophora-caused mortality was high (34%), and effects of other pathogens and failed emergence of germinants were smaller. Cheatgrass removal negatively affected both emergence (35 vs. 25%) and spring survival (69 vs. 42%). Pyrenophora-caused seed mortality increased with inoculum augmentation for both species (22 vs. 47% overall), but emergence was negatively impacted only for P. spicata (20 vs. 34%). At the mesic site, Pyrenophora-caused mortality was low (6%). Cheatgrass removal doubled emergence (26 vs. 14%). Seed mortality increased significantly with inoculum augmentation for P. spicata (12 vs. 5%) but not E. elymoides, while emergence was not significantly affected in either species. A large fraction of seeds produced germinants that failed to emerge (37%), while another large fraction (35%) was killed by other pathogens. We conclude that facilitation by cheatgrass at the xeric site but interference at the mesic site was probably mediated through litter effects that could be ameliorative or suppressive. Apparent competition between cheatgrass and native grasses could occur through Pyrenophora, especially in a xeric environment, but effects were weak or absent at emergence. This was probably because Pyrenophora attacks the same slow-germinating fraction that is subject to pre-emergence mortality from

  1. Final technical report for: Insertional Mutagenesis of Brachypodium distachyon DE-AI02-07ER64452

    Energy Technology Data Exchange (ETDEWEB)

    John, Vogel P. [DOE Joint Genome Institute, Walnut Creek, CA (United States)


    Several bioenergy grasses are poised to become a major source of energy in the United States. Despite their increasing importance, we know little about the basic biology underlying the traits that control the utility of grasses as energy crops. Better knowledge of grass biology (e.g. identification of the genes that control cell wall composition, plant architecture, cell size, cell division, reproduction, nutrient uptake, carbon flux, etc.) could be used to design rational strategies for crop improvement and shorten the time required to domesticate these species. The use of an appropriate model system is an efficient way to gain this knowledge. Brachypodium distachyon is a small annual grass with all the attributes needed to be a modern model organism including simple growth requirements, fast generation time, small stature, small genome size and self-fertility. These attributes led to the recommendation in the DOE’s “Breaking the Biological Barriers to Cellulosic Ethanol: A Joint Research Agenda” report to propose developing and using B. distachyon as a model for energy crops to accelerate their domestication. Strategic investments (e.g. genome sequencing) in B. distachyon by the DOE are now bearing fruit and B. distachyon is being used as a model grass by hundreds of laboratories worldwide. Sequence indexed insertional mutants are an extremely powerful tool for both forward and reverse genetics. They allow researchers to order mutants in any gene tagged in the collection by simply emailing a request. The goal of this project was to create a collection of sequence indexed insertional mutants (T-DNA lines) for the model grass Brachypodium distachyon in order to facilitate research by the scientific community. During the course of this grant we created a collection of 23,649 B. distachyon T-DNA lines and identified 26,112 unique insertion sites. The collection can be queried through the project website (

  2. Extensive gene content variation in the Brachypodium distachyon pan-genome correlates with population structure. (United States)

    Gordon, Sean P; Contreras-Moreira, Bruno; Woods, Daniel P; Des Marais, David L; Burgess, Diane; Shu, Shengqiang; Stritt, Christoph; Roulin, Anne C; Schackwitz, Wendy; Tyler, Ludmila; Martin, Joel; Lipzen, Anna; Dochy, Niklas; Phillips, Jeremy; Barry, Kerrie; Geuten, Koen; Budak, Hikmet; Juenger, Thomas E; Amasino, Richard; Caicedo, Ana L; Goodstein, David; Davidson, Patrick; Mur, Luis A J; Figueroa, Melania; Freeling, Michael; Catalan, Pilar; Vogel, John P


    While prokaryotic pan-genomes have been shown to contain many more genes than any individual organism, the prevalence and functional significance of differentially present genes in eukaryotes remains poorly understood. Whole-genome de novo assembly and annotation of 54 lines of the grass Brachypodium distachyon yield a pan-genome containing nearly twice the number of genes found in any individual genome. Genes present in all lines are enriched for essential biological functions, while genes present in only some lines are enriched for conditionally beneficial functions (e.g., defense and development), display faster evolutionary rates, lie closer to transposable elements and are less likely to be syntenic with orthologous genes in other grasses. Our data suggest that differentially present genes contribute substantially to phenotypic variation within a eukaryote species, these genes have a major influence in population genetics, and transposable elements play a key role in pan-genome evolution.

  3. A Universal Genome Array and Transcriptome Atlas for Brachypodium Distachyon

    Energy Technology Data Exchange (ETDEWEB)

    Mockler, Todd [Oregon State Univ., Corvallis, OR (United States)


    Brachypodium distachyon is the premier experimental model grass platform and is related to candidate feedstock crops for bioethanol production. Based on the DOE-JGI Brachypodium Bd21 genome sequence and annotation we designed a whole genome DNA microarray platform. The quality of this array platform is unprecedented due to the exceptional quality of the Brachypodium genome assembly and annotation and the stringent probe selection criteria employed in the design. We worked with members of the international community and the bioinformatics/design team at Affymetrix at all stages in the development of the array. We used the Brachypodium arrays to interrogate the transcriptomes of plants grown in a variety of environmental conditions including diurnal and circadian light/temperature conditions and under a variety of environmental conditions. We examined the transciptional responses of Brachypodium seedlings subjected to various abiotic stresses including heat, cold, salt, and high intensity light. We generated a gene expression atlas representing various organs and developmental stages. The results of these efforts including all microarray datasets are published and available at online public databases.

  4. Effect of grass species on NDF ruminal degradability and ...

    African Journals Online (AJOL)


    Abstract. The objective of this study was to compare the ruminal degradability of neutral detergent fibre (NDF) .... Felina were evaluated in the present study. The grass was harvested from the primary growth of monocultured grasses on 19 and 26 May of 2004 and 27 May and 10 ...... Nutritional Ecology of the Ruminant.

  5. Construction of high quality Gateway™ entry libraries and their application to yeast two-hybrid for the monocot model plant Brachypodium distachyon

    Directory of Open Access Journals (Sweden)

    Kumimoto Roderick W


    Full Text Available Abstract Background Monocots, especially the temperate grasses, represent some of the most agriculturally important crops for both current food needs and future biofuel development. Because most of the agriculturally important grass species are difficult to study (e.g., they often have large, repetitive genomes and can be difficult to grow in laboratory settings, developing genetically tractable model systems is essential. Brachypodium distachyon (hereafter Brachypodium is an emerging model system for the temperate grasses. To fully realize the potential of this model system, publicly accessible discovery tools are essential. High quality cDNA libraries that can be readily adapted for multiple downstream purposes are a needed resource. Additionally, yeast two-hybrid (Y2H libraries are an important discovery tool for protein-protein interactions and are not currently available for Brachypodium. Results We describe the creation of two high quality, publicly available Gateway™ cDNA entry libraries and their derived Y2H libraries for Brachypodium. The first entry library represents cloned cDNA populations from both short day (SD, 8/16-h light/dark and long day (LD, 20/4-h light/dark grown plants, while the second library was generated from hormone treated tissues. Both libraries have extensive genome coverage (~5 × 107 primary clones each and average clone lengths of ~1.5 Kb. These entry libraries were then used to create two recombination-derived Y2H libraries. Initial proof-of-concept screens demonstrated that a protein with known interaction partners could readily re-isolate those partners, as well as novel interactors. Conclusions Accessible community resources are a hallmark of successful biological model systems. Brachypodium has the potential to be a broadly useful model system for the grasses, but still requires many of these resources. The Gateway™ compatible entry libraries created here will facilitate studies for multiple user

  6. Optimal prescribed burn frequency to manage foundation California perennial grass species and enhance native flora (United States)

    Grasslands can be diverse assemblages of grasses and forbs but not much is known how perennial grass species management affects native plant diversity except for in a few instances. We studied the use of late spring prescribed burns over a span of eleven years on experimental plots in which the pere...


    Directory of Open Access Journals (Sweden)



    Full Text Available Fusarium is one of the important genera associated with grasses as saprophytes, endophytes and pathogens. A study was carried out on distribution and diversity of Fusarium species associated with two groups of grasses in 10 states throughout Peninsular Malaysia i.e. agricultural grasses (Oryza sativa and Saccharum officinarum and non-agricultural grasses (Axonopus compressus, Centhotheca lappacea, Chloris barbata, Crysopogon aciculatus, Cyanadon dactylon, Dactyloctenium aegyptium, Digitaria ciliaris, Echinochloa colona, Eleusine indica, Eragrostis amabilis, Eragrostis malayana, Eragrostis uniloides, Ischaemum magnum, Panicum brevifolium, Panicum millaneum, Panicum repens, Paspalum commersonii, Paspalum conjugatum, Paspalum orbiculare, Pennisetum purpureum, Sacciolepis indica, Sporobolus diander and Sporobolus indicus. A total of 474 isolates were single-spored and identified by morphological characteristics. F. semitectum was frequently isolated (23.6%, followed by F. sacchari and F. fujikuroi with 15.4% and 14.6%, respectively. The other nine species were F. solani (10.3%, F. proliferatum (8.9%, F. oxysporum (7.4%, F. subglutinans (6.5%, F. equiseti (5.5%, F. verticillioides (3.4%, F. compactum (2.5%, F. chlamydosporum (1.1% and F. longipes (0.8%. Based on the Shannon-Weiner Index, F. solani was the highest (H' = 2.62 isolated from grasses. Species of Fusarium from O. sativa were widely diverse with 11 species, followed by non-agricultural grasses with nine species and S. officinarum with only six species. This is the first report on diversity of Fusarium associated with grasses in Malaysia.

  8. GeMprospector--online design of cross-species genetic marker candidates in legumes and grasses. (United States)

    Fredslund, Jakob; Madsen, Lene H; Hougaard, Birgit K; Sandal, Niels; Stougaard, Jens; Bertioli, David; Schauser, Leif


    The web program GeMprospector (URL: allows users to automatically design large sets of cross-species genetic marker candidates targeting either legumes or grasses. The user uploads a collection of ESTs from one or more legume or grass species, and they are compared with a database of clusters of homologous EST and genomic sequences from other legumes or grasses, respectively. Multiple sequence alignments between submitted ESTs and their homologues in the appropriate database form the basis of automated PCR primer design in conserved exons such that each primer set amplifies an intron. The only user input is a collection of ESTs, not necessarily from more than one species, and GeMprospector can boost the potential of such an EST collection by combining it with a large database to produce cross-species genetic marker candidates for legumes or grasses.

  9. Feed intake and milk production in dairy cows fed different grass and legume species: a meta-analysis

    DEFF Research Database (Denmark)

    Johansen, Marianne; Lund, Peter; Weisbjerg, Martin Riis


    The aim of this meta-analysis was to compare feed intake, milk production, milk composition and organic matter (OM) digestibility in dairy cows fed different grass and legume species. Data from the literature was collected and different data sets were made to compare families (grasses v. legumes...... tannins in birdsfoot trefoil. None of the included grass species differed in DMI, milk production, milk composition or OM digestibility, indicating that different grass species have the same value for milk production, if OM digestibility is comparable. However, the comparison of different grass species...

  10. Bacterial endophyte communities of three agricultural important grass species differ in their response towards management regimes (United States)

    Wemheuer, Franziska; Kaiser, Kristin; Karlovsky, Petr; Daniel, Rolf; Vidal, Stefan; Wemheuer, Bernd


    Endophytic bacteria are critical for plant growth and health. However, compositional and functional responses of bacterial endophyte communities towards agricultural practices are still poorly understood. Hence, we analyzed the influence of fertilizer application and mowing frequency on bacterial endophytes in three agriculturally important grass species. For this purpose, we examined bacterial endophytic communities in aerial plant parts of Dactylis glomerata L., Festuca rubra L., and Lolium perenne L. by pyrotag sequencing of bacterial 16S rRNA genes over two consecutive years. Although management regimes influenced endophyte communities, observed responses were grass species-specific. This might be attributed to several bacteria specifically associated with a single grass species. We further predicted functional profiles from obtained 16S rRNA data. These profiles revealed that predicted abundances of genes involved in plant growth promotion or nitrogen metabolism differed between grass species and between management regimes. Moreover, structural and functional community patterns showed no correlation to each other indicating that plant species-specific selection of endophytes is driven by functional rather than phylogenetic traits. The unique combination of 16S rRNA data and functional profiles provided a holistic picture of compositional and functional responses of bacterial endophytes in agricultural relevant grass species towards management practices.

  11. Differential growth responses of Brachypodium distachyon genotypes to inoculation with plant growth promoting rhizobacteria. (United States)

    do Amaral, Fernanda P; Pankievicz, Vânia C S; Arisi, Ana Carolina M; de Souza, Emanuel M; Pedrosa, Fabio; Stacey, Gary


    Plant growth promoting rhizobacteria (PGPR) can associate and enhance the growth of important crop grasses. However, in most cases, the molecular mechanisms responsible for growth promotion are not known. Such research could benefit by the adoption of a grass model species that showed a positive response to bacterial inoculation and was amenable to genetic and molecular research methods. In this work we inoculated different genotypes of the model grass Brachypodium distachyon with two, well-characterized PGPR bacteria, Azospirillum brasilense and Herbaspirillum seropedicae, and evaluated the growth response. Plants were grown in soil under no nitrogen or with low nitrogen (i.e., 0.5 mM KNO3). A variety of growth parameters (e.g., shoot height, root length, number of lateral roots, fresh and dry weight) were measured 35 days after inoculation. The data indicate that plant genotype plays a very important role in determining the plant response to PGPR inoculation. A positive growth response was observed with only four genotypes grown under no nitrogen and three genotypes tested under low nitrogen. However, in contrast, relatively good root colonization was seen with most genotypes, as measured by drop plate counting and direct, microscopic examination of roots. In particular, the endophytic bacteria H. seropedicae showed strong epiphytic and endophytic colonization of roots.

  12. Evolutionary relationships between Rhynchosporium lolii sp. nov. and other Rhynchosporium species on grasses.

    Directory of Open Access Journals (Sweden)

    Kevin M King

    Full Text Available The fungal genus Rhynchosporium (causative agent of leaf blotch contains several host-specialised species, including R. commune (colonising barley and brome-grass, R. agropyri (couch-grass, R. secalis (rye and triticale and the more distantly related R. orthosporum (cocksfoot. This study used molecular fingerprinting, multilocus DNA sequence data, conidial morphology, host range tests and scanning electron microscopy to investigate the relationship between Rhynchosporium species on ryegrasses, both economically important forage grasses and common wild grasses in many cereal growing areas, and other plant species. Two different types of Rhynchosporium were found on ryegrasses in the UK. Firstly, there were isolates of R. commune that were pathogenic to both barley and Italian ryegrass. Secondly, there were isolates of a new species, here named R. lolii, that were pathogenic only to ryegrass species. R. lolii was most closely related to R. orthosporum, but exhibited clear molecular, morphological and host range differences. The species was estimated to have diverged from R. orthosporum ca. 5735 years before the present. The colonisation strategy of all of the different Rhynchosporium species involved extensive hyphal growth in the sub-cuticular regions of the leaves. Finally, new species-specific PCR diagnostic tests were developed that could distinguish between these five closely related Rhynchosporium species.

  13. Variability of Pyrrolizidine Alkaloid Occurrence in Species of the Grass Subfamily Pooideae (Poaceae) (United States)

    Wesseling, Anne-Maria; Demetrowitsch, Tobias J.; Schwarz, Karin; Ober, Dietrich


    Pyrrolizidine alkaloids (PAs) are a class of secondary metabolites found in various unrelated angiosperm lineages including cool-season grasses (Poaceae, subfamily Pooideae). Thesinine conjugates, saturated forms of PA that are regarded as non-toxic, have been described to occur in the two grass species Lolium perenne and Festuca arundinacea (Poaceae, subfamily Pooideae). In a wider screen, we tested various species of the Pooideae lineage, grown under controlled conditions, for their ability to produce thesinine conjugates or related structures. Using an LC-MS based targeted metabolomics approach we were able to show that PA biosynthesis in grasses is limited to a group of very closely related Pooideae species that produce a limited diversity of PA structures. High variability in PA levels was observed even between individuals of the same species. These individual accumulation patterns are discussed with respect to a possible function and evolution of this type of alkaloid. PMID:29250094

  14. Variability of Pyrrolizidine Alkaloid Occurrence in Species of the Grass Subfamily Pooideae (Poaceae

    Directory of Open Access Journals (Sweden)

    Anne-Maria Wesseling


    Full Text Available Pyrrolizidine alkaloids (PAs are a class of secondary metabolites found in various unrelated angiosperm lineages including cool-season grasses (Poaceae, subfamily Pooideae. Thesinine conjugates, saturated forms of PA that are regarded as non-toxic, have been described to occur in the two grass species Lolium perenne and Festuca arundinacea (Poaceae, subfamily Pooideae. In a wider screen, we tested various species of the Pooideae lineage, grown under controlled conditions, for their ability to produce thesinine conjugates or related structures. Using an LC-MS based targeted metabolomics approach we were able to show that PA biosynthesis in grasses is limited to a group of very closely related Pooideae species that produce a limited diversity of PA structures. High variability in PA levels was observed even between individuals of the same species. These individual accumulation patterns are discussed with respect to a possible function and evolution of this type of alkaloid.

  15. Characterization of Brachypodium distachyon as a nonhost model against switchgrass rust pathogen Puccinia emaculata. (United States)

    Gill, Upinder S; Uppalapati, Srinivasa R; Nakashima, Jin; Mysore, Kirankumar S


    Switchgrass rust, caused by Puccinia emaculata, is an important disease of switchgrass, a potential biofuel crop in the United States. In severe cases, switchgrass rust has the potential to significantly affect biomass yield. In an effort to identify novel sources of resistance against switchgrass rust, we explored nonhost resistance against P. emaculata by characterizing its interactions with six monocot nonhost plant species. We also studied the genetic variations for resistance among Brachypodium inbred accessions and the involvement of various defense pathways in nonhost resistance of Brachypodium. We characterized P. emaculata interactions with six monocot nonhost species and identified Brachypodium distachyon (Bd21) as a suitable nonhost model to study switchgrass rust. Interestingly, screening of Brachypodium accessions identified natural variations in resistance to switchgrass rust. Brachypodium inbred accessions Bd3-1 and Bd30-1 were identified as most and least resistant to switchgrass rust, respectively, when compared to tested accessions. Transcript profiling of defense-related genes indicated that the genes which were induced in Bd21after P. emaculata inoculation also had higher basal transcript abundance in Bd3-1 when compared to Bd30-1 and Bd21 indicating their potential involvement in nonhost resistance against switchgrass rust. In the present study, we identified Brachypodium as a suitable nonhost model to study switchgrass rust which exhibit type I nonhost resistance. Variations in resistance response were also observed among tested Brachypodium accessions. Brachypodium nonhost resistance against P. emaculata may involve various defense pathways as indicated by transcript profiling of defense related genes. Overall, this study provides a new avenue to utilize novel sources of nonhost resistance in Brachypodium against switchgrass rust.

  16. Comparison of phytoremediation potential of three grass species in soil contaminated with cadmium

    Directory of Open Access Journals (Sweden)

    Gołda Sylwia


    Full Text Available The aim of the study was to compare the toleration of Poa pratensis, Lolium perenne and Festuca rubra to cadmium contamination as well as the phytoremediation potential of these three species of grass. The pot experiment was conducted in four replications in pots containing 2.0 kg of soil. The soil was contaminated with three doses of Cd – 30, 60 and 120 mg·kg−1. After two months, the aerial parts of plants were harvested. The roots were dug up, brushed off from the remaining soil and washed with water. The biomass was defined and the cadmium concentration was determined in aerial parts and roots. The phytoremediation potential of grasses was evaluated using biomass of grasses, bioaccumulation factor (BF and translocation factor (TF. All three tested species of grasses had TF 1. It indicates their suitability for phytostabilisation and makes them unsuitable for phytoextraction of Cd from the soil. Comparing the usefulness of the tested grasses for phytoremediation has shown that the phytostabilisation potential of P. pratensis was lower than that of L. perenne and F. rubra. P. pratensis was distinguished by higher TF, smaller root biomass and lower tolerance for Cd excess in the soil in comparison with the two other test grasses. At the same time, L. perenne was characterised by the smallest decrease in biomass and the largest Cd accumulation in roots at the lowest dose of Cd. It indicates good usefulness for phytostabilisation of soils characterised by a relatively small pollution by cadmium.

  17. Endophytic Epichloë species and their grass hosts: from evolution to applications. (United States)

    Saikkonen, Kari; Young, Carolyn A; Helander, Marjo; Schardl, Christopher L


    The closely linked fitness of the Epichloë symbiont and the host grass is presumed to align the coevolution of the species towards specialization and mutually beneficial cooperation. Ecological observations demonstrating that Epichloë-grass symbioses can modulate grassland ecosystems via both above- and belowground ecosystem processes support this. In many cases the detected ecological importance of Epichloë species is directly or indirectly linked to defensive mutualism attributable to alkaloids of fungal-origin. Now, modern genetic and molecular techniques enable the precise studies on evolutionary origin of endophytic Epichloë species, their coevolution with host grasses and identification the genetic variation that explains phenotypic diversity in ecologically relevant characteristics of Epichloë-grass associations. Here we briefly review the most recent findings in these areas of research using the present knowledge of the genetic variation that explains the biosynthetic pathways driving the diversity of alkaloids produced by the endophyte. These findings underscore the importance of genetic interplay between the fungus and the host in shaping their coevolution and ecological role in both natural grass ecosystems, and in the agricultural arena.

  18. Alley cropping of legumes with grasses as forages : Effect of different grass species and row spacing of gliricidia on the growth and biomass production of forages

    Directory of Open Access Journals (Sweden)

    Siti Yuhaeni


    Full Text Available A study to evaluate the effect of different grass species and row spacing of gliricidia (Gliricidia sepium on the growth and biomass production of forages in an alley cropping system was conducted in two different agroclimatical zones i.e. Bogor, located at 500 m a .s .l . with an average annual rainfall of 3,112 nun/year and Sukabumi located at 900 m a .s .l . with an average annual rainfall of 1,402 mm/year . Both locations have low N, P, and K content and the soil is classified as acidic. The experimental design used was a split plot design with 3 replicates . The main plots were different grass species i.e. king grass (Pennisetum purpureum x P. typhoides and elephant grass (P. purpureum. The sub plots were the row spacing of gliricidia at 2, 3, 4, 6 m (1 hedgerows and 4 m (2 hedgerows. The results indicated that the growth and biomass production of grasses were significantly affected (P<0 .05 by the treatments in Bogor. The highest biomass productions was obtained from the 2 m row spacing which gave the highest dry matter production of grasses (1 .65 kg/hill and gliricidia (0 .086 kg/tree . In Sukabumi the growth and biomass production of grasses and gliricidia were also significantly affected by the treatments . The highest dry matter production was obtained with 2 m row spacing (dry matter of grasses and gliricidia were 1 .12 kg/hill and 0 .026 kg/tree, respectively . The result further indicated that biomass production of forages increased with the increase in gliricidia population. The alley cropping system wich is suitable for Bogor was the 2 m row spacing of gliricidia intercropped with either king or elephant grass and for Sukabumi 2 and 4 m (2 rows of gliricidia row spacing intercropped with king or elephant grass .

  19. Soil nutrient heterogeneity alters competition between two perennial grass species

    NARCIS (Netherlands)

    Fransen, B.; Kroon, de H.; Berendse, F.


    Differences in root foraging behavior between species have been well documented, but the effects of these differences on belowground competitive ability are only beginning to be studied. Here we report the results of a competition experiment in homogeneous and heterogeneous soils between two species

  20. MT and WY Tamarix soil properties influence germination and early growth of three native grass species (United States)

    As a riparian invader, Tamarix spp. often leads to native species (e.g., plains cottonwood and willows, grasses) decline and lower habitat quality. Since Tamarix excretes excess salt and has high salt tolerance, negative soil feedback via high soil salinity may negatively affect native plants. Howev...

  1. Changes of biomass in some perennial grass species. | M.C. ...

    African Journals Online (AJOL)

    Patterns of seasonal herbaceous biomass change in a burned, ungrazed savanna woodland are reported. A standard clipping technique was used and material farmed in the current season was separated from that formed in the previous season for three perennial grass species: Brachiaria nigropedata, Andropogon ...

  2. Comparison of arsenic uptake ability of barnyard grass and rice species for arsenic phytoremediation. (United States)

    Sultana, Razia; Kobayashi, Katsuichiro; Kim, Ki-Hyun


    In this research, the relative performance in arsenic (As) remediation was evaluated among some barnyard grass and rice species under hydroponic conditions. To this end, four barnyard grass varieties and two rice species were selected and tested for their remediation potential of arsenic. The plants were grown for 2 weeks in As-rich solutions up to 10 mg As L(-1) to measure their tolerance to As and their uptake capabilities. Among the varieties of plants tested in all treatment types, BR-29 rice absorbed the highest amount of As in the root, while Nipponbare translocated the maximum amount of As in the shoot. Himetainubie barnyard grass produced the highest biomass, irrespective of the quantity of As in the solution. In all As-treated solutions, the maximum uptake of As was found in BR-29 followed by Choto shama and Himetainubie. In contrast, while the bioaccumulation factor was found to be the highest in Nipponbare followed by BR-29 and Himetainubie. The results suggest that both Choto shama and Himetainubie barnyard grass varieties should exhibit a great potential for As removal, while BR-29 and Nipponbare rice species are the best option for arsenic phytoremediation.

  3. Management techniques for the control of Melinis minutiflora P. Beauv. (molasses grass: ten years of research on an invasive grass species in the Brazilian Cerrado

    Directory of Open Access Journals (Sweden)

    Carlos Romero Martins


    Full Text Available ABSTRACT The invasion of exotic species is considered to be a major threat to the preservation of biodiversity. In the Parque Nacional de Brasília (National Park of Brasília, the invasive Melinis minutiflora (molasses grass occupies more than 10 % of the area of the park. The present, long-term, study compared two treatments of exposure to molasses grass: 1 fire and 2 integrated management (fire + herbicide sprays + manual removal. The aerial biomass of molasses grass in the experimental area initially represented ca. 55 % of the total aerial biomass, a percentage that apparently did not influence native plant species richness at this site. Fire alone was not sufficient to control molasses grass, which attained its pre-treatment biomass values after two years. Integrated management reduced, and maintained, biomass to less than 1 % of its original value after ten years, and maintained this level throughout the study, demonstrating that it is a promising strategy for the recovery of areas invaded by molasses grass in the Cerrado. However, because of the recolonization by molasses grass, long-term monitoring efforts are targeting outbreaks, which would require immediate intervention in order to maintain the native biological diversity of the region.

  4. Interactive effects of plant-available soil silicon and herbivory on competition between two grass species (United States)

    Garbuzov, Mihail; Reidinger, Stefan; Hartley, Susan E.


    Background and Aims The herbivore defence system of true grasses (Poaceae) is predominantly based on silicon that is taken up from the soil and deposited in the leaves in the form of abrasive phytoliths. Silicon uptake mechanisms can be both passive and active, with the latter suggesting that there is an energetic cost to silicon uptake. This study assessed the effects of plant-available soil silicon and herbivory on the competitive interactions between the grasses Poa annua, a species that has previously been reported to accumulate only small amounts of silicon, and Lolium perenne, a high silicon accumulator. Methods Plants were grown in mono- and mixed cultures under greenhouse conditions. Plant-available soil silicon levels were manipulated by adding silicon to the soil in the form of sodium silicate. Subsets of mixed culture pots were exposed to above-ground herbivory by desert locusts (Schistocerca gregaria). Key Results In the absence of herbivory, silicon addition increased biomass of P. annua but decreased biomass of L. perenne. Silicon addition increased foliar silicon concentrations of both grass species >4-fold. Under low soil-silicon availability the herbivores removed more leaf biomass from L. perenne than from P. annua, whereas under high silicon availability the reverse was true. Consequently, herbivory shifted the competitive balance between the two grass species, with the outcome depending on the availability of soil silicon. Conclusions It is concluded that a complex interplay between herbivore abundance, growth–defence trade-offs and the availability of soil silicon in the grasses' local environment affects the outcome of inter-specific competition, and so has the potential to impact on plant community structure. PMID:21868406

  5. Complementary DNA cloning of the major allergen Phl p I from timothy grass (Phleum pratense); recombinant Phl p I inhibits IgE binding to group I allergens from eight different grass species

    NARCIS (Netherlands)

    Laffer, S.; Valenta, R.; Vrtala, S.; Susani, M.; van Ree, R.; Kraft, D.; Scheiner, O.; Duchêne, M.


    BACKGROUND: Grass pollens, such as pollen from timothy grass (Phleum pratense), represent a major cause of type I allergy. OBJECTIVE: In this report we attempted to determine how cross-reactive allergenic components of grass pollens from different species can be represented by a minimum number of

  6. Plastome Sequence Determination and Comparative Analysis for Members of the Lolium-Festuca Grass Species Complex


    Hand, Melanie L.; Spangenberg, German C.; Forster, John W.; Cogan, Noel O. I.


    Chloroplast genome sequences are of broad significance in plant biology, due to frequent use in molecular phylogenetics, comparative genomics, population genetics, and genetic modification studies. The present study used a second-generation sequencing approach to determine and assemble the plastid genomes (plastomes) of four representatives from the agriculturally important Lolium-Festuca species complex of pasture grasses (Lolium multiflorum, Festuca pratensis, Festuca altissima, and Festuca...

  7. Systems Level Regulation of Rhythmic Growth Rate and Biomass Accumulation in Grasses

    Energy Technology Data Exchange (ETDEWEB)

    Kay, Steve A. [Scripps Research Inst., La Jolla, CA (United States); Hazen, Samuel [Scripps Research Inst., San Diego, CA (United States); Mullet, John [Texas A & M Univ., College Station, TX (United States)


    Critical to the development of renewable energy sources from biofuels is the improvement of biomass from energy feedstocks, such as sorghum and maize. The specific goals of this project include 1) characterize the growth and gene expression patterns under diurnal and circadian conditions, 2) select transcription factors associated with growth and build a cis-regulatory network in yeast, and 3) perturb these transcription factors in planta using transgenic Brachypodium and sorghum, and characterize the phenotypic outcomes as they relate to biomass accumulation. A better understanding of diurnally regulated growth behavior in grasses may lead to species-specific mechanisms highly relevant to future strategies to optimize energy crop biomass yield.

  8. Plastome Sequence Determination and Comparative Analysis for Members of the Lolium-Festuca Grass Species Complex (United States)

    Hand, Melanie L.; Spangenberg, German C.; Forster, John W.; Cogan, Noel O. I.


    Chloroplast genome sequences are of broad significance in plant biology, due to frequent use in molecular phylogenetics, comparative genomics, population genetics, and genetic modification studies. The present study used a second-generation sequencing approach to determine and assemble the plastid genomes (plastomes) of four representatives from the agriculturally important Lolium-Festuca species complex of pasture grasses (Lolium multiflorum, Festuca pratensis, Festuca altissima, and Festuca ovina). Total cellular DNA was extracted from either roots or leaves, was sequenced, and the output was filtered for plastome-related reads. A comparison between sources revealed fewer plastome-related reads from root-derived template but an increase in incidental bacterium-derived sequences. Plastome assembly and annotation indicated high levels of sequence identity and a conserved organization and gene content between species. However, frequent deletions within the F. ovina plastome appeared to contribute to a smaller plastid genome size. Comparative analysis with complete plastome sequences from other members of the Poaceae confirmed conservation of most grass-specific features. Detailed analysis of the rbcL–psaI intergenic region, however, revealed a “hot-spot” of variation characterized by independent deletion events. The evolutionary implications of this observation are discussed. The complete plastome sequences are anticipated to provide the basis for potential organelle-specific genetic modification of pasture grasses. PMID:23550121

  9. Efficacy of Biosolids in Assisted Phytostabilization of Metalliferous Acidic Sandy Soils with Five Grass Species (United States)

    Kacprzak, Malgorzata; Grobelak, Anna; Grosser, Anna; Prasad, M. N. V.


    The role of sewage sludge as an immobilising agent in the phytostabilization of metal-contaminated soil was evaluated using five grass species viz., Dactylis glomerata L., Festuca arundinacea Schreb., F. rubra L., Lolium perenne L., L. westerwoldicum L. The function of metal immobilization was investigated by monitoring pH, Eh and Cd, Pb, and Zn levels in column experiment over a period of 5-months. Grasses grown on sewage sludge-amendments produced high biomass in comparison to controls. A significant reduction in metal uptake by plants was also observed as a result of sewage sludge application, which was attributed to decreased bioavailability through soil stabilisation. We have observed that the sludge amendment decreased metal bioavailability and concentrations in soil at a depth of 25 cm, in contrast to untreated columns, where metal concentrations in the soil solution were very high. PMID:24912245

  10. [A comparative study on seed germination of 15 grass species in Keeqin Sandyland]. (United States)

    Liu, Zhimin; Li, Xuehua; Li, Rongping; Jiang, Deming; Cao, Chengyou


    A laboratory study was made on the germination characteristics of freshly-collected seeds of grass species at the Wulanaodu area of Keeqin Sandyland in Eastern Inner-Mongolia. Of the 15 species examined, 8 species including Clinelymus dahuricus, Cleistogenes squarrosa, Pappophorum boreale, Spodiopogon sibiricus, Phragmites communis, Chloris virgata, Arundinella hirta, Pennisetum alopecuroides had a germination rate of over 80%, but 4 species including Echinochloa hispidula, Hemarthria compressa, Tragus berteronianus and Setaria viridis had a value of less than 10%. Spodiopogon sibiricus, Eragrostis pilosa, Phragmites communis, Chloris virgata, Clinelymus dahuricus, Pappophorum boreale, Digitaria cilliaris and Cleistogenes squrrosa began to germinate within 1-3 days after the test began, while Setaria viridis, Tragus berteronianus and Hemarthria compressa failed to germinate in a period of more than 10 days. For the species such as Digitaria cilliaris, Echinochloa hispidula, Phragmites communis, Eragrostis pilosa and Spodiopogon sibiricus, their germination period was less than 10 days, while Clinelymus dahuricus and Pappophorum boreale had a germination period of more than 20 days. The days required for half the final germination rate to be reached were: 2 days for Chloris virgata, 3 days for Phragmites communis, 4 days for Spodiopogon sibiricus, 5 days for Clinelymus dahuricus and Cleistogenes squarrosa, 7 days for Arundinella hirta and Pappophorum boreale, and 10 days for Pennisetum alopecuriodes. Compared with the Sheffield region in Britain, the Wulanaodu area of Kerqin Sandyland had a higher proportion of annul grasses with a low germination rate and a longer germination period, and the perennial grasses at the Wulanaodu area had an approximately same germination rate, but a longer germination period. During germination, ruderals showed the potential for risk-sharring, and thus, they had a relatively higher disturbance-resistance capacity.

  11. Oxygen isotope fractionations across individual leaf carbohydrates in grass and tree species. (United States)

    Lehmann, Marco M; Gamarra, Bruno; Kahmen, Ansgar; Siegwolf, Rolf T W; Saurer, Matthias


    Almost no δ 18 O data are available for leaf carbohydrates, leaving a gap in the understanding of the δ 18 O relationship between leaf water and cellulose. We measured δ 18 O values of bulk leaf water (δ 18 O LW ) and individual leaf carbohydrates (e.g. fructose, glucose and sucrose) in grass and tree species and δ 18 O of leaf cellulose in grasses. The grasses were grown under two relative humidity (rH) conditions. Sucrose was generally 18 O-enriched compared with hexoses across all species with an apparent biosynthetic fractionation factor (ε bio ) of more than 27‰ relative to δ 18 O LW , which might be explained by isotopic leaf water and sucrose synthesis gradients. δ 18 O LW and δ 18 O values of carbohydrates and cellulose in grasses were strongly related, indicating that the leaf water signal in carbohydrates was transferred to cellulose (ε bio  = 25.1‰). Interestingly, damping factor p ex p x , which reflects oxygen isotope exchange with less enriched water during cellulose synthesis, responded to rH conditions if modelled from δ 18 O LW but not if modelled directly from δ 18 O of individual carbohydrates. We conclude that δ 18 O LW is not always a good substitute for δ 18 O of synthesis water due to isotopic leaf water gradients. Thus, compound-specific δ 18 O analyses of individual carbohydrates are helpful to better constrain (post-)photosynthetic isotope fractionation processes in plants. © 2017 John Wiley & Sons Ltd.

  12. Invasive species in the flora of the Starobilsk grass-meadow steppe (Ukraine

    Directory of Open Access Journals (Sweden)

    Kucher Oksana O.


    Full Text Available The results of an investigation of the invasive species in the flora of the Starobilsk grass-meadow steppe are presented. Check-list of alien plant has over 386 species of vascular plants of which 28 species are invasive. We have identified 6 transformer species from the invasive plants. We aggregate data on the entry, distribution history, ecology, occurrence in different plant communities, degree of their naturalization and the habitats where they occur. The leading families of invasive species are: Asteraceae. The basis for this group is presented by origin from the North America and the Mediterranean. With respect to the time of immigration, most of them are kenophytes. By the method of introduction, ksenophytes are dominated; according to the degree of naturalization epoecophytes and agriophytes dominate in this group. With regard to the characteristics of life forms, half of invasive species are terophytes. The vast majority of plants are heliophytes and xeromesophytes. Most species are found in biotopes group I: Cultivated agricultural biotopes; least of all species found in biotopes group F: Biotopes dominated by chamephytes and nanophanerophytes. Only 3 species found in biotopes group F: Biotopes dominated by chamephytesand nanophanerophytes. The maps of distribution of 28 invasive species are provided. Most of the species marked dispersed in more than 30 squares.

  13. Allelopathic activity of some grass species on Phleum pratense seed germination subject to their density

    Directory of Open Access Journals (Sweden)

    Halina Lipińska


    Full Text Available Efficient utilization of allelopathy in the agricultural practice requires searching for some species and developmental stages when the allelopathic substances are generated in bioactive concentrations. That also requires the knowledge of allelopathy mechanisms and primarily its separation from the other aspects of plant activity, mainly from competition for environmental resources. This task, however, has remained vital in the studies on plant interference, being extremely difficult to perform under field conditions. Therefore, the studies were conducted in the laboratory. To determine the activity of an allelopathic agent of the selected grass species, the density dependent phytotoxicity model was employed. The model is based on the fact that an increase of acceptor plants density evokes a decrease of their response to the allelopathic compounds, whereas the negative effects of the competition become more intense. A higher rate of acceptor plants growth accompanying their density increase in the given object does not agree with the competition rules and thus, it may imply an allelopathic background of the observed changes. In the presented studies, the allelopathic properties of grasses - donors were evaluated by studying the effect of two densities of the emerging seeds and two- and four weeks aged seedlings of F. arundinacea, L. multiflorum, L. perenne and P. pratensis. The tested species - acceptor Ph. pratensis was sown in the density of 10 and 20 seeds in a pan. The results revealed that the germination of acceptor seeds was differentiated depending on their density in the pan, and on the species, density and the age of the donor. Inhibition of Ph. pratense seed germination in objects with a lover density may prove allelopathic effects of the studied donor grasses.

  14. How Do Grass Species, Season and Ensiling Influence Mycotoxin Content in Forage?

    Directory of Open Access Journals (Sweden)

    Adam Nawrath


    Full Text Available Mycotoxins are secondary metabolites produced by fungal species that have harmful effects on mammals. The aim of this study was to assess the content of mycotoxins in fresh-cut material of selected forage grass species both during and at the end of the growing season. We further assessed mycotoxin content in subsequently produced first-cutting silages with respect to the species used in this study: Lolium perenne (cv. Kentaur, Festulolium pabulare (cv. Felina, Festulolium braunii (cv. Perseus, and mixtures of these species with Festuca rubra (cv. Gondolin or Poa pratensis (Slezanka. The mycotoxins deoxynivalenol, zearalenone and T-2 toxin were mainly detected in the fresh-cut grass material, while fumonisin and aflatoxin contents were below the detection limits. July and October were the most risky periods for mycotoxins to occur. During the cold temperatures in November and December, the occurrence of mycotoxins in fresh-cut material declined. Although June was a period with low incidence of mycotoxins in green silage, contents of deoxynivalenol and zearalenone in silages from the first cutting exceeded by several times those determined in their biomass collected directly from the field. Moreover, we observed that use of preservatives or inoculants did not prevent mycotoxin production.

  15. Soil modification by invasive plants: Effects on native and invasive species of mixed-grass prairies (United States)

    Jordan, N.R.; Larson, D.L.; Huerd, S.C.


    Invasive plants are capable of modifying attributes of soil to facilitate further invasion by conspecifics and other invasive species. We assessed this capability in three important plant invaders of grasslands in the Great Plains region of North America: leafy spurge (Euphorbia esula), smooth brome (Bromus inermis) and crested wheatgrass (Agropyron cristatum). In a glasshouse, these three invasives or a group of native species were grown separately through three cycles of growth and soil conditioning in both steam-pasteurized and non-pasteurized soils, after which we assessed seedling growth in these soils. Two of the three invasive species, Bromus and Agropyron, exhibited significant self-facilitation via soil modification. Bromus and Agropyron also had significant facilitative effects on other invasives via soil modification, while Euphorbia had significant antagonistic effects on the other invasives. Both Agropyron and Euphorbia consistently suppressed growth of two of three native forbs, while three native grasses were generally less affected. Almost all intra- and interspecific effects of invasive soil conditioning were dependent upon presence of soil biota from field sites where these species were successful invaders. Overall, these results suggest that that invasive modification of soil microbiota can facilitate plant invasion directly or via 'cross-facilitation' of other invasive species, and moreover has potential to impede restoration of native communities after removal of an invasive species. However, certain native species that are relatively insensitive to altered soil biota (as we observed in the case of the forb Linum lewisii and the native grasses), may be valuable as 'nurse'species in restoration efforts. ?? 2007 Springer Science+Business Media B.V.

  16. N transfer in three species grass-clover mixtures with chicory, ribwort plantain or caraway

    DEFF Research Database (Denmark)

    Dhamala, Nawa Raj; Rasmussen, Jim; Carlsson, Georg


    Background and aimsThere is substantial evidence that legume-derived Nitrogen (N) is transferred to neighboring non-legumes in grassland mixtures. However, there is sparse information about how deep rooted non-legume forage herbs (forbs) influence N transfer in multi-species grasslands. Methodology......Red clover (Trifolium pretense L.) was grown together with perennial ryegrass (Lolium perenne L.) and one of three forb species: chicory (Cichorium intybus L.), ribwort plantain (Plantago lanceolata L.) or caraway (Carum carvi L.) in a field experiment. During the first year after the establishment, red...... clover leaves were labeled with 15N-urea to determine the N transfer from red clover to companion ryegrass and forbs. ResultsOn an annual basis, up to 15 % of red clover N was transferred to the companion ryegrass and forbs, but predominantly to the grass. The forb species did not differ in their ability...

  17. Effects of species diversity on seasonal variation in herbage yield and nutritive value of seven binary grass-legume mixtures and pure grass under cutting

    DEFF Research Database (Denmark)

    Elgersma, Anjo; Søegaard, Karen


    Intensively managed sown temperate grasslands are generally of low species diversity, although swards based on grass-legume mixtures may have superior productivity and herbage quality than grass-only swards. We conducted a cutting experiment over two years to test the effect of species composition...... and diversity on herbage yield, contents of N, neutral detergent fibre (NDF) and in vitro organic matter digestibility (IVOMD). Perennial ryegrass (PR, Lolium perenne) was sown alone and with each of four forage legumes: red clover (RC, Trifolium pratense), lucerne (LU, Medicago sativa), birdsfoot trefoil (BT......, Lotus corniculatus) and white clover (WC, Trifolium repens); WC was also sown with hybrid ryegrass (HR, Lolium × boucheanum), meadow fescue (MF, Festuca pratensis) and timothy (TI, Phleum pratense). Herbage productivity was lowest in pure PR followed by PR/BT, and highest in PR/RC; this mixture had...

  18. Accumulation of 137Cs and 90Sr from contaminated soil by three grass species inoculated with mycorrhizal fungi

    International Nuclear Information System (INIS)

    Entry, J.A.; Watrud, L.S.; Reeves, M.


    The use of plants to accumulate low level radioactive waste from soil, followed by incineration of plant material to concentrate radionuclides may prove to be a viable and economical method of remediating contaminated areas. We tested the influence of arbuscular mycorrhizae on 137 Cs and 90 Sr uptake by bahia grass (Paspalum notatum), johnson grass (Sorghum halpense) and switchgrass (Panicum virginatum) for the effectiveness on three different contaminated soil types. Exposure to 137 Cs or 90 Sr over the course of the experiment did not affect above ground biomass of the three grasses. The above ground biomass of bahia, johnson and switchgrass plants accumulated from 26.3 to 71.7% of the total amount of the 137 Cs and from 23.8 to 88.7% of the total amount of the 90 Sr added to the soil after three harvests. In each of the three grass species tested, plants inoculated with Glomus mosseae or Glomus intraradices had greater aboveground plant biomass, higher concentrations of 137 Cs or 90 Sr in plant tissue, % accumulation of 137 Cs or 90 Sr from soil and plant bioconcentration ratios at each harvest than those that did not receive mycorrhizal inoculation. Johnson grass had greater aboveground plant biomass, greater accumulation of 137 Cs or 90 Sr from soil and plant higher bioconcentration ratios with arbuscular mycorrhizal fungi than bahia grass and switchgrass. The greatest accumulation of 137 Cs and 90 Sr was observed in johnson grass inoculated with G. mosseae. Grasses can grow in wide geographical ranges that include a broad variety of edaphic conditions. The highly efficient removal of these radionuclides by these grass species after inoculation with arbuscular mycorrhizae supports the concept that remediation of radionuclide contaminated soils using mycorrhizal plants may present a viable strategy to remediate and reclaim sites contaminated with radionuclides

  19. Tackling Contentious Invasive Plant Species: A Case Study of Buffel Grass in Australia (United States)

    Grice, Anthony C.; Friedel, Margaret H.; Marshall, Nadine A.; van Klinken, Rieks D.


    Introduced plants that have both production values and negative impacts can be contentious. Generally they are either treated as weeds and their use prohibited; or unfettered exploitation is permitted and land managers must individually contend with any negative effects. Buffel grass ( Cenchrus ciliaris) is contentious in Australia and there has been no attempt to broadly and systematically address the issues surrounding it. However, recent research indicates that there is some mutual acceptance by proponents and opponents of each others' perspectives and we contend that this provides the basis for a national approach. It would require thorough and on-going consultation with stakeholders and development of realistic goals that are applicable across a range of scales and responsive to regional differences in costs, benefits and socio-economic and biophysical circumstances. It would be necessary to clearly allocate responsibilities and ascertain the most appropriate balance between legislative and non-legislative mechanisms. A national approach could involve avoiding the introduction of additional genetic material, countering proliferation in regions where the species is sparse, preventing incursion into conservation reserves where it is absent, containing strategically located populations and managing communities to prevent or reduce dominance by buffel grass. This approach could be applied to other contentious plant species.

  20. Diversity and aggregation patterns of plant species in a grass community

    Directory of Open Access Journals (Sweden)

    Ran Li


    Full Text Available Both composition and aggregation patterns of species in a community are the outcome of community self-organizing. In this paper we conducted analysis on species diversity and aggregation patterns of plant species in a grass community, Zhuhai, China. According to the sampling survey, in total of 47 plant species, belonging to 16 families, were found. Compositae had 10 species (21.3%, seconded by Gramineae (9 species, 19.1%, Leguminosae (6 species, 12.8%, Cyperaceae (4 species, 8.5%, and Malvaceae (3 species, 6.4%. The results revealed that the means of aggregation indices Iδ, I and m*/m were 21.71, 15.71 and 19.89 respectively and thus individuals of most of plant species strongly followed aggregative distribution. Iwao analysis indicated that both individuals of all species and clumps of all individuals of all species followed aggregative distribution. Taylor's power law indicated that individuals of all species followed aggregative distribution and aggregation intensity strengthened as the increase of mean density. We held that the strong aggregation intensity of a species has been resulted from the strong adaptation ability to the environment, the strong interspecific competition ability and the earlier establishment of the species. Fitting goodness of the mean, I, Iδ, m*/m with probability distributions demonstrated that the mean (density, I, Iδ, and m*/m over all species followed Weibull distribution rather than normal distribution. Lophatherum gracile, Paederia scandens (Lour. Merr., Eleusine indica, and Alternanthera philoxeroides (Mart. Griseb. were mostly aggregative, and Oxalis sp., Eleocharis plantagineiformis, Vernonia cinerea (L. Less., and Sapium sebiferum (L. Roxb, were mostly uniform in the spatial distribution. Importance values (IV showed that Cynodon dactylon was the most important species, seconded by Desmodium triflorum (L. DC., Cajanus scarabaeoides (L. Benth., Paspalum scrobiculatum L., and Rhynchelytrum repens. Oxalis

  1. The family of DOF transcription factors in Brachypodium distachyon: phylogenetic comparison with rice and barley DOFs and expression profiling

    Directory of Open Access Journals (Sweden)

    Hernando-Amado Sara


    Full Text Available Abstract Background Transcription factors (TFs are proteins that have played a central role both in evolution and in domestication, and are major regulators of development in living organisms. Plant genome sequences reveal that approximately 7% of all genes encode putative TFs. The DOF (DNA binding with One Finger TF family has been associated with vital processes exclusive to higher plants and to their close ancestors (algae, mosses and ferns. These are seed maturation and germination, light-mediated regulation, phytohormone and plant responses to biotic and abiotic stresses, etc. In Hordeum vulgare and Oryza sativa, 26 and 30 different Dof genes, respectively, have been annotated. Brachypodium distachyon has been the first Pooideae grass to be sequenced and, due to its genomic, morphological and physiological characteristics, has emerged as the model system for temperate cereals, such as wheat and barley. Results Through searches in the B. distachyon genome, 27 Dof genes have been identified and a phylogenetic comparison with the Oryza sativa and the Hordeum vulgare DOFs has been performed. To explore the evolutionary relationship among these DOF proteins, a combined phylogenetic tree has been constructed with the Brachypodium DOFs and those from rice and barley. This phylogenetic analysis has classified the DOF proteins into four Major Cluster of Orthologous Groups (MCOGs. Using RT-qPCR analysis the expression profiles of the annotated BdDof genes across four organs (leaves, roots, spikes and seeds has been investigated. These results have led to a classification of the BdDof genes into two groups, according to their expression levels. The genes highly or preferentially expressed in seeds have been subjected to a more detailed expression analysis (maturation, dry stage and germination. Conclusions Comparison of the expression profiles of the Brachypodium Dof genes with the published functions of closely related DOF sequences from the cereal

  2. Daily changes in temperature, not the circadian clock, regulate growth rate in Brachypodium distachyon.

    Directory of Open Access Journals (Sweden)

    Dominick A Matos

    Full Text Available Plant growth is commonly regulated by external cues such as light, temperature, water availability, and internal cues generated by the circadian clock. Changes in the rate of growth within the course of a day have been observed in the leaves, stems, and roots of numerous species. However, the relative impact of the circadian clock on the growth of grasses has not been thoroughly characterized. We examined the influence of diurnal temperature and light changes, and that of the circadian clock on leaf length growth patterns in Brachypodium distachyon using high-resolution time-lapse imaging. Pronounced changes in growth rate were observed under combined photocyles and thermocycles or with thermocycles alone. A considerably more rapid growth rate was observed at 28°C than 12°C, irrespective of the presence or absence of light. In spite of clear circadian clock regulated gene expression, plants exhibited no change in growth rate under conditions of constant light and temperature, and little or no effect under photocycles alone. Therefore, temperature appears to be the primary cue influencing observed oscillations in growth rate and not the circadian clock or photoreceptor activity. Furthermore, the size of the leaf meristem and final cell length did not change in response to changes in temperature. Therefore, the nearly five-fold difference in growth rate observed across thermocycles can be attributed to proportionate changes in the rate of cell division and expansion. A better understanding of the growth cues in B. distachyon will further our ability to model metabolism and biomass accumulation in grasses.

  3. The Seed Semipermeable Layer and Its Relation to Seed Quality Assessment in Four Grass Species

    Directory of Open Access Journals (Sweden)

    Yan Y. Lv


    Full Text Available The existence of a semipermeable layer in grass seeds has been extensively reported, yet knowledge of its influence on tests for seed viability and vigor that depend upon measurement of electrical conductivity (EC is limited. This study determined the presence and location of the semipermeable layer, and its relation to seed viability and vigor assessment, in seeds of four important grass species-Elymus nutans Griseb., Lolium perenne L., Leymus chinensis (Trin. Tzvel., and Avena sativa L. Intact seeds of E. nutans, Lolium perenne, and Leymus chinensis exhibited little staining with triphenyl tetrazolium chloride (TTC, and there were no differences in EC between seeds with different germination percentage (GP (P > 0.05. After piercing the seed coat, however, all three species displayed positive staining with TTC, along with a significant negative correlation between EC and GP (E. nutans: R2 = 0.7708; Lolium perenne: R2= 0.8414; Leymus chinensis: R2 = 0.859; P < 0.01. In contrast, both intact and pierced seeds of A. sativa possessed a permeable seed coat that showed positive staining with TTC and EC values that were significantly negatively correlated with GP [R2 = 0.9071 (intact and 0.9597 (pierced; P < 0.01]. In commercial seed lots of A. sativa, a field emergence test indicated that EC showed a significant negative correlation with field emergence at two sowing dates (R2= 0.6069, P < 0.01 and 0.5316, P < 0.05. Analysis of seed coat permeability revealed the presence of a semipermeable layer located in the seed coat adjacent to the endosperm in E. nutans, Lolium perenne, and Leymus chinensis; however, no semipermeable layer was observed in A. sativa. This is the first report of the absence of a semipermeable layer in a grass species. The existence of a semipermeable layer is one of the most important factors affecting seed viability and vigor testing (based on EC measurement in E. nutans, Lolium perenne, and Leymus chinensis. Increasing the

  4. Influence of species and preservations on the quality and safety of grass silages

    Directory of Open Access Journals (Sweden)

    Jiří Skládanka


    Full Text Available The paper evaluates the quality of model silages made of wilted grass biomass and treated with silage additives. Grass species used for the production of silages were Lolium perenne, Festulolium pabulare and Festulolium braunii harvested in the first cut at the stage of earing. The assessed grass species were wilted after the cut for an identical time 36 hours (2008, resp. 24 hours (2009. The treatment was made either with a chemical preparation (formic acid, propionic acid, ammonium formate and/or with a bio­lo­gi­cal inoculant (Enterococcus faecium, Lactobacillus plantarum, Pediococcus acidilactici, Lactobacillus salivarius, cellulase, hemicellulase and amylase. The amount of the chemical ingredient was 4 l . t−1 and the amount of the biological additive was 10 g . t−1.The biomass was after wilting ensilaged in con­tai­ners whose diameter and height were 0.15 m and 0.64 m, respectively. After 60 days of ensilaging, the silages were assessed for pH, organic acids content, ethanol content and acidity of water extract (AWE; organic nutrients assessed in the silages were crude fibre (CF, neutral detergent fibre (NDF, acid detergent fibre (ADF, crude protein (CP and digestibility of organic matter (DOM. Hygienic safety was assessed from the contents of zearalenon, fumonisin and aflatoxin mycotoxins. The high (P < 0.05 dry matter (DM content in Festulolium pabulare silages indicates that the species tends to rapid wilting. The higher DM content reflected in lower biomass losses (P < 0.05. The lowest pH values (P < 0.05 were detected in silages made of Festulolium braunii. The fact relates to the higher content of lactic acid in the prepared microsilages. The use of ensiling additives affected the quality of extracts. Namely the application of the biological additive led to the increased content (P < 0.05 of not only lactic acid but acetic acid too. Titrable acidity was not affected by the ensiling additives. As to the

  5. Screening of Balansia epichloe-infected grass species for in situ ergot alkaloids using laser ablation electrospray ionization-mass spectrometry (United States)

    The Balansia are clavicipitaceous symbiotic species associated with various species of tropical grasses. Laboratory culture procedures established that the Balansia species are often conspecific with grasses in tall fescue pastures that produced ergot alkaloids. However, any effects of hosts on the...

  6. The Brachypodium-Puccinia graminis system: Solving a puzzle to uncover the underlying mechanisms of non-host resistance and plant immunity (United States)

    Brachypodium distachyon is regarded as non-host to the causal agent of stem rust in wheat and barley, P. graminis f. sp. tritici (Pgt), and a near-host to the pathogens of forage grasses, P. graminis f. sp. lolii (Pgl) and P. graminis f. sp. phlei-pratensis (Pgp). Given the devastating effect of ste...

  7. Pushing the boundaries of resistance: insights from Brachypodium-rust interactions

    Directory of Open Access Journals (Sweden)

    Melania eFigueroa


    Full Text Available The implications of global population growth urge transformation of current food and bioenergy production systems to sustainability. Members of the family Poaceae are of particular importance both in food security and for their applications as biofuel substrates. For centuries, rust fungi have threatened the production of valuable crops such as wheat, barley, oat and other small grains; similarly, biofuel crops can also be susceptible to these pathogens. Emerging rust pathogenic races with increased virulence and recurrent rust epidemics around the world point out the vulnerability of monocultures. Basic research in plant immunity, especially in model plants, can make contributions to understanding plant resistance mechanisms and improve disease management strategies. The development of the grass Brachypodium distachyon as a genetically tractable model for monocots, especially temperate cereals and grasses, offers the possibility to overcome the experimental challenges presented by the genetic and genomic complexities of economically valuable crop plants. The numerous resources and tools available in Brachypodium have opened new doors to investigate the underlying molecular and genetic bases of plant-microbe interactions in grasses and evidence demonstrating the applicability and advantages of working with B. distachyon is increasing. Importantly, several interactions between B. distachyon and devastating plant pathogens, such rust fungi, have been examined in the context of non-host resistance. Here, we discuss the use of B. distachyon in these various pathosystems. Exploiting B. distachyon to understand the mechanisms underpinning disease resistance to non-adapted rust fungi may provide effective and durable approaches to fend off these pathogens. The close phylogenetic relationship among Brachypodium spp. and grasses with industrial and agronomic value support harnessing this model plant to improve cropping systems and encourage its use in

  8. Early inflorescence development in the grasses (Poaceae

    Directory of Open Access Journals (Sweden)

    Elizabeth A. Kellogg


    Full Text Available The shoot apical meristem of grasses produces the primary branches of the inflorescence, controlling inflorescence architecture and hence seed production. Whereas leaves are produced in a distichous pattern, with the primordia separated from each other by an angle of 180o, inflorescence branches are produced in a spiral in most species. The morphology and developmental genetics of the shift in phyllotaxis have been studied extensively in maize and rice. However, in wheat, Brachypodium, and oats, all in the grass subfamily Pooideae, the change in phyllotaxis does not occur; primary inflorescence branches are produced distichously. It is unknown whether the distichous inflorescence originated at the base of Pooideae, or whether it appeared several times independently. In this study, we show that Brachyelytrum, the genus sister to all other Pooideae has spiral phyllotaxis in the inflorescence, but that in the remaining 3000+ species of Pooideae, the phyllotaxis is two-ranked. These two-ranked inflorescences are not perfectly symmetrical, and have a clear front and back; this developmental axis has never been described in the literature and it is unclear what establishes its polarity. Strictly distichous inflorescences appear somewhat later in the evolution of the subfamily. Two-ranked inflorescences also appear in a few grass outgroups and sporadically elsewhere in the family, but unlike in Pooideae do not generally correlate with a major radiation of species. After production of branches, the inflorescence meristem may be converted to a spikelet meristem or may simply abort; this developmental decision appears to be independent of the branching pattern.

  9. Biomass and leaf-level gas exchange characteristics of three African savanna C4 grass species under optimum growth conditions

    NARCIS (Netherlands)

    Mantlana, K.B.; Veenendaal, E.M.; Arneth, A.; Grispen, V.; Bonyongo, C.M.; Heitkönig, I.M.A.; Lloyd, J.


    C4 savanna grass species, Digitaria eriantha, Eragrostis lehmanniana and Panicum repens, were grown under optimum growth conditions with the aim of characterizing their above- and below-ground biomass allocation and the response of their gas exchange to changes in light intensity, CO2 concentration

  10. Deep sequencing of Brachypodium small RNAs at the global genome level identifies microRNAs involved in cold stress response

    Directory of Open Access Journals (Sweden)

    Chong Kang


    Full Text Available Abstract Background MicroRNAs (miRNAs are endogenous small RNAs having large-scale regulatory effects on plant development and stress responses. Extensive studies of miRNAs have only been performed in a few model plants. Although miRNAs are proved to be involved in plant cold stress responses, little is known for winter-habit monocots. Brachypodium distachyon, with close evolutionary relationship to cool-season cereals, has recently emerged as a novel model plant. There are few reports of Brachypodium miRNAs. Results High-throughput sequencing and whole-genome-wide data mining led to the identification of 27 conserved miRNAs, as well as 129 predicted miRNAs in Brachypodium. For multiple-member conserved miRNA families, their sizes in Brachypodium were much smaller than those in rice and Populus. The genome organization of miR395 family in Brachypodium was quite different from that in rice. The expression of 3 conserved miRNAs and 25 predicted miRNAs showed significant changes in response to cold stress. Among these miRNAs, some were cold-induced and some were cold-suppressed, but all the conserved miRNAs were up-regulated under cold stress condition. Conclusion Our results suggest that Brachypodium miRNAs are composed of a set of conserved miRNAs and a large proportion of non-conserved miRNAs with low expression levels. Both kinds of miRNAs were involved in cold stress response, but all the conserved miRNAs were up-regulated, implying an important role for cold-induced miRNAs. The different size and genome organization of miRNA families in Brachypodium and rice suggest that the frequency of duplication events or the selection pressure on duplicated miRNAs are different between these two closely related plant species.

  11. Evidence for adaptive evolution of low-temperature stress response genes in a Pooideae grass ancestor

    DEFF Research Database (Denmark)

    Vigeland, Magnus D; Spannagl, Manuel; Asp, Torben


    Adaptation to temperate environments is common in the grass subfamily Pooideae, suggesting an ancestral origin of cold climate adaptation. Here, we investigated substitution rates of genes involved in low-temperature-induced (LTI) stress responses to test the hypothesis that adaptive molecular...... evolution of LTI pathway genes was important for Pooideae evolution. Substitution rates and signatures of positive selection were analyzed using 4330 gene trees including three warm climate-adapted species (maize (Zea mays), sorghum (Sorghum bicolor), and rice (Oryza sativa)) and five temperate Pooideae...... species (Brachypodium distachyon, wheat (Triticum aestivum), barley (Hordeum vulgare), Lolium perenne and Festuca pratensis). Nonsynonymous substitution rate differences between Pooideae and warm habitat-adapted species were elevated in LTI trees compared with all trees. Furthermore, signatures...

  12. Sequencing and De Novo Transcriptome Assembly of Brachypodium sylvaticum (Poaceae

    Directory of Open Access Journals (Sweden)

    Samuel E. Fox


    Full Text Available Premise of the study: We report the de novo assembly and characterization of the transcriptomes of Brachypodium sylvaticum (slender false-brome accessions from native populations of Spain and Greece, and an invasive population west of Corvallis, Oregon, USA. Methods and Results: More than 350 million sequence reads from the mRNA libraries prepared from three B. sylvaticum genotypes were assembled into 120,091 (Corvallis, 104,950 (Spain, and 177,682 (Greece transcript contigs. In comparison with the B. distachyon Bd21 reference genome and GenBank protein sequences, we estimate >90% exome coverage for B. sylvaticum. The transcripts were assigned Gene Ontology and InterPro annotations. Brachypodium sylvaticum sequence reads aligned against the Bd21 genome revealed 394,654 single-nucleotide polymorphisms (SNPs and >20,000 simple sequence repeat (SSR DNA sites. Conclusions: To our knowledge, this is the first report of transcriptome sequencing of invasive plant species with a closely related sequenced reference genome. The sequences and identified SNP variant and SSR sites will provide tools for developing novel genetic markers for use in genotyping and characterization of invasive behavior of B. sylvaticum.

  13. Investigations of barley stripe mosaic virus as a gene silencing vector in barley roots and in Brachypodium distachyon and oat

    DEFF Research Database (Denmark)

    Pacak, Andrzej; Geisler, Katrin; Jørgensen, Bodil


    -expressed genes we wanted to explore the potential of BSMV for silencing genes in root tissues. Furthermore, the newly completed genome sequence of the emerging cereal model species Brachypodium distachyon as well as the increasing amount of EST sequence information available for oat (Avena species) have created...

  14. The Effect of Different levels of Soil Moisture on Visual Quality, Morphological and Physiological Characteristics of Three Native Grass Species

    Directory of Open Access Journals (Sweden)

    ramin mahdavi


    Full Text Available Introduction: Over the last three decades, turfgrass breeders have put significant effort into breeding and developing turf species that have good drought resistance. As water conservation becomes an important issue, an interest is increasing in identifying grasses that require less water. Lack of water resources is most problems to increasing urban green spaces. Plants with good drought resistance are those that are able to survive stress by means of drought avoidance, drought tolerance at leaf water potentials, or both. The efficient use of water is made possible by understanding the effects of soil moisture water on crop development and yield. Drought affects the visual quality, growth rate and evapotranspiration. Researchers reported that turfgrass subjected to drought conditions for short periods could sustain a fairly good appearance by soil moisture about half of its consumptive use whenever soil moisture level falls to near permanent wilting point. Drought stress caused decrease in RWC and visual quality of many grass cultivars. In drought conditions resistance grass showed increase in proline content on their leaves. Therefore the use of native grasses with high-strength instead of imported grass with low-resistance is one way to increase landscape areas and reduce costs. The purpose of this study was to be compared native grasses with commercial grass cultivar “Super sport”. Materials and Methods: The objective of this study was to evaluate the effect of soil moisture stress levels included 85% (control, 65% and 45% of field capacity on native species Brumos tomentellus, Festuca rubra and F. arundinacea and commercial cultivars Super sport (control under greenhouse conditions. Plants were cultured in PVC containers measuring 9 cm in diameter and 60 cm deep. Soil was mixture of 70% loam soil, 20% pit mass and 10% sand. Greenhouse air temperature was maintained between 22 and 28 centigrade degree. All plants were maintained under


    Directory of Open Access Journals (Sweden)

    Alexandru TELEUŢĂ


    Full Text Available The development and modernization of our country’s agriculture is related to the revitalization of the animal breeding sector along with the implementation of new genotypes of animals and diversification of fodder production, balanced in terms of quantity and quality throughout the year, suitable for the physiological requirements of animals, and qualitative products as required in the market. Scientific research conducted in the Botanical Garden (Institute of the ASM over decades was aimed at mobilization, improvement and implementation of new non-traditional plant species that use efficiently photosynthetic active radiation and land resources to obtain fodder with a high level of vegetable protein, the fodder leguminous grasses (fam. Fabaceae Lindl. play an important role. We have studied the biological peculiarities, productivity, chemical composition and nutritional value of new fodder leguminous plant species Astragalus galegiformis, Onobrychis inermis and Medicago tianschanica of the collection of non-traditional fodder plants of the Botanical Garden (Institute of the ASM, the traditional forage crop alfalfa served as control variant. The nutritional value of fresh mass accounts: the Astragalus galegiformis - 0.27 nutritive units, 3.26 MJ metabolizable energy and 146g digestible protein/nutritive unit; Onobrychis inermis - 0.25 nutritive units, 2.56 MJ metabolizable energy and 154 g digestible protein/nutritive unit; Medicago tianschanica - 0.24 nutritive units, 2.86 MJ metabolizable energy and 173 g digestible protein/nutritive unit and alfalfa - 0.21 nutritive units, 2.28 MJ metabolizable energy and 164 g digestible protein/nutritive unit. Due to the productivity and high and stable quality of fodder, use of the plantation for a long period of time, capacity of fixing atmospheric nitrogen, the new fodder leguminous species Astragalus galegiformis, Onobrychis inermis and Medicago tianschanica can serve as initial material for enriching

  16. Systems Level Regulation of Rhythmic Growth Rate and Biomass Accumulation in Grasses

    Energy Technology Data Exchange (ETDEWEB)

    Kay, Steve A. [Univ. of Southern California, Los Angeles, CA (United States)


    Objectives: Several breakthroughs have been recently made in our understanding of plant growth and biomass accumulation. It was found that plant growth is rhythmically controlled throughout the day by the circadian clock through a complex interplay of light and phytohormone signaling pathways. While plants such as the C4 energy crop sorghum (Sorghum bicolor (L.) Moench) and possibly the C3 grass Brachypodium distachyon also exhibit daily rhythms in growth rate, the molecular details of its regulation remain to be explored. A better understanding of diurnally regulated growth behavior in grasses may lead to species-specific mechanisms highly relevant to future strategies to optimize energy crop biomass yield. Here we propose to devise a systems approach to identify, in parallel, regulatory hubs associated with rhythmic growth in C3 and C4 plants. We propose to use rhythmicity in daily growth patterns to drive the discovery of regulatory network modules controlling biomass accumulation. Description: The project is divided in three main parts: 1) Performing time-lapse imaging and growth measurement in B. distachyon and S. bicolor to determine growth rate dynamic during the day/night cycle. Identifying growth-associated genes whose expression patterns follow the observed growth dynamics using deep sequencing technology, 2) identifying regulators of these genes by screening for DNA-binding proteins interacting with the growth-associated gene promoters identified in Aim 1. Screens will be performed using a validated yeast-one hybrid strategy paired with a specifically designed B. distachyon and S. bicolor transcription factor libraries (1000 clones each), and 3) Selecting 50 potential growth regulators from the screen for downstream characterization. The selection will be made by using a sytems biology approach by calculating the connectivity between growth rate, rhythmic gene expression profiles and TF expression profile and determine which TF is likely part of a hub

  17. Interference competition as a mechanism of coexistence between two sympatric species of the grass shrimp Palaemonetes (Decapoda: Palaemonidae)

    Energy Technology Data Exchange (ETDEWEB)

    Thorp, J.H.


    Various theories have been developed to explain the puzzling coexistence of species which have broad niche overlap in critical resource utilization. The coexistence of two sympatric species of grass shrimp, Palaemonetes pugio Holthuis and p. vulgaris (Say), whose niches overlap with respect to space, food, and time, was examined in an experimental field and laboratory study. A seasonal fluctuation between sympatric and contiguous allopatric distribution of the two species of grass shrimp on natural shell, mud, and eelgrass substrata suggests that competition may be an important factor determining distribution of Palaemonetes. Field and laboratory experiments confirm that P. vulgaris can competitively displace P. pugio from the preferred shell substratum by interference competition but the tendency of grass shrimp to separate spatially in winter by bottom-depths (as in field enclosure cages) could have allowed both species to coexist on shell. Spatial separation by bottom-depth was not so evident in spring, since P. vulgaris apparently displaced P. pugio from shell to mud substratum. Occupancy of shell substratum is shown to be adaptive in that shell provides greater protection from predators than does mud. It is suggested that the spatial partitioning resulting from this interference competition promotes coexistence by reducing agonism while permitting efficient utilization of other common resources.

  18. Competition between a Lawn-Forming Cynodon dactylon and a Tufted Grass Species Hyparrhenia hirta on a South-African Dystrophic Savanna

    NARCIS (Netherlands)

    Zwerts, J.A.; Prins, H.H.T.; Bomhoff, D.; Verhagen, I.; Swart, J.M.; Boer, de W.F.


    South African savanna grasslands are often characterised by indigestible tufted grass species whereas lawn grasses are far more desirable in terms of herbivore sustenance. We aimed to investigate the role of nutrients and/or the disturbance (grazing, trampling) by herbivores on the formation of

  19. In silico sequence analysis and homology modeling of predicted beta-amylase 7-like protein in Brachypodium distachyon L.

    Directory of Open Access Journals (Sweden)



    Full Text Available Beta-amylase (β-amylase, EC is an enzyme that catalyses hydrolysis of glucosidic bonds in polysaccharides. In this study, we analyzed protein sequence of predicted beta-amylase 7-like protein in Brachypodium distachyon. pI (isoelectric point value was found as 5.23 in acidic character, while the instability index (II was found as 50.28 with accepted unstable protein. The prediction of subcellular localization was revealed that the protein may reside in chloroplast by using CELLO v.2.5. The 3D structure of protein was performed using comparative homology modeling with SWISS-MODEL. The accuracy of the predicted 3D structure was checked using Ramachandran plot analysis showed that 95.4% in favored region. The results of our study contribute to understanding of β-amylase protein structure in grass species and will be scientific base for 3D modeling of beta-amylase proteins in further studies.

  20. Energy crop cultivations of reed canary grass - An inferior breeding habitat for the skylark, a characteristic farmland bird species

    Energy Technology Data Exchange (ETDEWEB)

    Vepsaelaeinen, Ville [Finnish Museum of Natural History, P.O. Box 17, University of Helsinki, FI-00014 Helsinki (Finland)


    Here, I present the first comparison of the abundance of farmland birds in energy grass fields and in cereal-dominated conventionally cultivated fields (CCFs). I demonstrate that in boreal farmland, skylark (Alauda arvensis) densities were significantly lower in reed canary grass (RCG) (Phalaris arundinacea) fields than in CCFs. I found that during the early breeding season RCG fields and CCFs are equally good habitats, but over the ensuing couple of weeks RCG rapidly grows too tall and dense for field-nesting species. Consequently, RCG is an inferior habitat for skylark for laying replacement clutches (after failure of first nesting) or for a second clutch after one successful nesting. The results imply that if RCG cultivation is to be expanded, the establishment of large monocultures should be avoided in farmland landscapes; otherwise the novel habitat may affect detrimentally the seriously depleted skylark population, and probably also other field-nesting bird species with similar breeding habitats. (author)

  1. Phylogeny in Defining Model Plants for Lignocellulosic Ethanol Production: A Comparative Study of Brachypodium distachyon, Wheat, Maize, and Miscanthus x giganteus Leaf and Stem Biomass (United States)

    Meineke, Till; Manisseri, Chithra; Voigt, Christian A.


    The production of ethanol from pretreated plant biomass during fermentation is a strategy to mitigate climate change by substituting fossil fuels. However, biomass conversion is mainly limited by the recalcitrant nature of the plant cell wall. To overcome recalcitrance, the optimization of the plant cell wall for subsequent processing is a promising approach. Based on their phylogenetic proximity to existing and emerging energy crops, model plants have been proposed to study bioenergy-related cell wall biochemistry. One example is Brachypodium distachyon, which has been considered as a general model plant for cell wall analysis in grasses. To test whether relative phylogenetic proximity would be sufficient to qualify as a model plant not only for cell wall composition but also for the complete process leading to bioethanol production, we compared the processing of leaf and stem biomass from the C3 grasses B. distachyon and Triticum aestivum (wheat) with the C4 grasses Zea mays (maize) and Miscanthus x giganteus, a perennial energy crop. Lambda scanning with a confocal laser-scanning microscope allowed a rapid qualitative analysis of biomass saccharification. A maximum of 108–117 mg ethanol·g−1 dry biomass was yielded from thermo-chemically and enzymatically pretreated stem biomass of the tested plant species. Principal component analysis revealed that a relatively strong correlation between similarities in lignocellulosic ethanol production and phylogenetic relation was only given for stem and leaf biomass of the two tested C4 grasses. Our results suggest that suitability of B. distachyon as a model plant for biomass conversion of energy crops has to be specifically tested based on applied processing parameters and biomass tissue type. PMID:25133818

  2. Two distinct Epichloë species symbiotic with Achnatherum inebrians, drunken horse grass. (United States)

    Chen, Li; Li, Xiuzhang; Li, Chunjie; Swoboda, Ginger A; Young, Carolyn A; Sugawara, Koya; Leuchtmann, Adrian; Schardl, Christopher L


    Achnatherum inebrians, colloquially known as drunken horse grass, is associated with livestock toxicity in northern China. Epichloë gansuensis (Eg) was described from endophyte isolates from A. inebrians in Sunan County, Gansu Province, whereas a morphologically distinct variety, E. gansuensis var. inebrians (Ei), was described based on two isolates from A. inebrians seeds collected in Urumqi County, Xinjiang Province. Genome sequencing and alkaloid analyses also distinguish these taxa; the Ei isolates produce neurotropic lysergic acid amides (ergot alkaloids), and an Eg isolate produces paxilline (an indole-diterpene alkaloid). To better elucidate the taxonomic diversity of Epichloë spp. symbiotic with A. inebrians, we surveyed eight populations in Xinjiang, Gansu and Inner Mongolia provinces of China and analyzed their genotypes by multiplex PCR for alkaloid biosynthesis genes and mating-type genes. Genotypes consistent with Ei were present in all eight populations, of which they dominated seven. The Ei isolates were all mating type A and tested positive for the ergot alkaloid gene, dmaW. In contrast Eg isolates were all mating type B and had the indole-diterpene gene, idtG. The genome was sequenced from an Ei isolate from seeds collected in Xiahe County, Gansu, and compared to that of the varietal ex type isolate from Urumqi. Alkaloid genes and four different housekeeping genes were nearly identical between the two sequenced Ei isolates and were distinct from a sequenced Eg isolate. Phylogenetic analysis placed Ei, Eg and Epichloë sibirica into respective subclades of a clade that emanated from the base of the Epichloë phylogeny. Given its chemotypic, genotypic, morphological and phylogenetic distinctiveness, its widespread occurrence in rangelands of northern China, and its importance in livestock toxicity, we propose raising Ei to species rank as Epichloë inebrians. © 2015 by The Mycological Society of America.

  3. Characterization of FLOWERING LOCUS T1 (FT1 gene in Brachypodium and wheat.

    Directory of Open Access Journals (Sweden)

    Bo Lv

    Full Text Available The phase transition from vegetative to reproductive growth is a critical event in the life cycle of flowering plants. FLOWERING LOCUS T (FT plays a central role in the regulation of this transition by integrating signals from multiple flowering pathways in the leaves and transmitting them to the shoot apical meristem. In this study, we characterized FT homologs in the temperate grasses Brachypodium distachyon and polyploid wheat using transgenic and mutant approaches. Downregulation of FT1 by RNAi was associated with a significant downregulation of the FT-like genes FT2 and FT4 in Brachypodium and FT2 and FT5 in wheat. In a transgenic wheat line carrying a highly-expressed FT1 allele, FT2 and FT3 were upregulated under both long and short days. Overexpression of FT1 caused extremely early flowering during shoot regeneration in both Brachypodium and hexaploid wheat, and resulted in insufficient vegetative tissue to support the production of viable seeds. Downregulation of FT1 transcripts by RNA interference (RNAi resulted in non-flowering Brachypodium plants and late flowering plants (2-4 weeks delay in wheat. A similar delay in heading time was observed in tetraploid wheat plants carrying mutations for both FT-A1 and FT-B1. Plants homozygous only for mutations in FT-B1 flowered later than plants homozygous only for mutations in FT-A1, which corresponded with higher transcript levels of FT-B1 relative to FT-A1 in the early stages of development. Taken together, our data indicate that FT1 plays a critical role in the regulation of flowering in Brachypodium and wheat, and that this role is associated with the simultaneous regulation of other FT-like genes. The differential effects of mutations in FT-A1 and FT-B1 on wheat heading time suggest that different allelic combinations of FT1 homoeologs could be used to adjust wheat heading time to improve adaptation to changing environments.

  4. Update on the genomics and basic biology of Brachypodium

    DEFF Research Database (Denmark)

    Catalan, Pilar; Chalhoub, Boulos; Chochois, Vincent


    The scientific presentations at the First International Brachypodium Conference (abstracts available at are evidence of the wide-spread adoption of Brachypodium distachyon as a model system. Furthermore, the wide range of topics presented (genome evolution, roots...

  5. New chloroplast microsatellite markers suitable for assessing genetic diversity of Lolium perenne and other related grass species. (United States)

    Diekmann, Kerstin; Hodkinson, Trevor R; Barth, Susanne


    Lolium perenne (perennial ryegrass) is the most important forage grass species of temperate regions. We have previously released the chloroplast genome sequence of L. perenne 'Cashel'. Here nine chloroplast microsatellite markers are published, which were designed based on knowledge about genetically variable regions within the L. perenne chloroplast genome. These markers were successfully used for characterizing the genetic diversity in Lolium and different grass species. Chloroplast genomes of 14 Poaceae taxa were screened for mononucleotide microsatellite repeat regions and primers designed for their amplification from nine loci. The potential of these markers to assess genetic diversity was evaluated on a set of 16 Irish and 15 European L. perenne ecotypes, nine L. perenne cultivars, other Lolium taxa and other grass species. All analysed Poaceae chloroplast genomes contained more than 200 mononucleotide repeats (chloroplast simple sequence repeats, cpSSRs) of at least 7 bp in length, concentrated mainly in the large single copy region of the genome. Nucleotide composition varied considerably among subfamilies (with Pooideae biased towards poly A repeats). The nine new markers distinguish L. perenne from all non-Lolium taxa. TeaCpSSR28 was able to distinguish between all Lolium species and Lolium multiflorum due to an elongation of an A(8) mononucleotide repeat in L. multiflorum. TeaCpSSR31 detected a considerable degree of microsatellite length variation and single nucleotide polymorphism. TeaCpSSR27 revealed variation within some L. perenne accessions due to a 44-bp indel and was hence readily detected by simple agarose gel electrophoresis. Smaller insertion/deletion events or single nucleotide polymorphisms detected by these new markers could be visualized by polyacrylamide gel electrophoresis or DNA sequencing, respectively. The new markers are a valuable tool for plant breeding companies, seed testing agencies and the wider scientific community due to

  6. Sediment trapping with indigenous grass species showing differences in plant traits in northwest Ethiopia

    NARCIS (Netherlands)

    Mekonnen, Mulatie; Keesstra, Saskia D.; Ritsema, Coen J.; Stroosnijder, Leo; Baartman, Jantiene E.M.


    Soil loss from an 8% sloping Teff field in north-western Ethiopia is significant (~ 70 t ha− 1 yr− 1), and thus found to be an important source of sediment. Grass barriers showing sediment trapping efficacy (STE) are important measures in trapping sediment inside Teff fields

  7. Estimation of extractable protein in botanical fractions of legume and grass species

    DEFF Research Database (Denmark)

    Solati, Zeinab; Jørgensen, Uffe; Eriksen, Jørgen


    With a globally strong interest in bio-based products such as fuels and chemicals, a feasible source of protein for the industry with positive economic impacts could be from leaves. However, more knowledge is needed on how to improve the content of extractable protein. Grasses and legumes have a ...

  8. Study on the mineral extraction of legume and grass species from various soil types, by instrumental neutron activation analysis

    International Nuclear Information System (INIS)

    Piasentin, R.M.; Armelin, M.J.A.; Cruvinel, P.E.


    Instrumental neutron activation analysis (INAA), followed by gamma-ray spectrometry, was used to determine the concentration of K, Ca, Mg, Na, Zn, Fe, Mn, Mo, Co, Cr, La, Eu and Th in six species of legumes and three species of grasses. Each species of forage was cultivated on two different oxisols, that is, a red yellow Latossol and a dark red Latossol, with the aim of comparing the influence of the soils in the mineral extraction. Besides, on each kind of soil, two different limestone concentrations were used in order to verify how the soil pH correction could influence the elemental absorption in each species, and at the same time; to search for an optimum value of limestone concentration for each soil. (author)

  9. Harvesting Effects on Species Composition and Distribution of Cover Attributes in Mixed Native Warm-Season Grass Stands

    Directory of Open Access Journals (Sweden)

    Vitalis W. Temu


    Full Text Available Managing grasslands for forage and ground-nesting bird habitat requires appropriate defoliation strategies. Subsequent early-summer species composition in mixed stands of native warm-season grasses (Indiangrass (IG, Sorghastrum nutans, big bluestem (BB, Andropogon gerardii and little bluestem (LB, Schizachyrium scoparium responding to harvest intervals (treatments, 30, 40, 60, 90 or 120 d and durations (years in production was assessed. Over three years, phased May harvestings were initiated on sets of randomized plots, ≥90 cm apart, in five replications (blocks to produce one-, two- and three-year-old stands. Two weeks after harvest, the frequencies of occurrence of plant species, litter and bare ground, diagonally across each plot (line intercept, were compared. Harvest intervals did not influence proportions of dominant plant species, occurrence of major plant types or litter, but increased that of bare ground patches. Harvest duration increased the occurrence of herbaceous forbs and bare ground patches, decreased that of tall-growing forbs and litter, but without affecting that of perennial grasses, following a year with more September rainfall. Data suggest that one- or two-year full-season forage harvesting may not compromise subsequent breeding habitat for bobwhites and other ground-nesting birds in similar stands. It may take longer than a year’s rest for similar stands to recover from such changes in species composition.

  10. The weed species composition in a reed canary grass (Phalaris arundinacea L. plantation for energy purposes depending on its age

    Directory of Open Access Journals (Sweden)

    Tomasz R. Sekutowski


    Full Text Available The present experiment, carried out in nine production fields of reed canary grass (Phalaris arundinacea grown for energy purposes, evaluated the effect of plantation age on the occurrence and species composition of weeds. The selected plantations were divided into 3 groups that were conventionally called “young” (1–2 years old, “middle-aged” (3–5 years old, and “older” plantations (6–8 years old. Regardless of plantation age, altogether 43 species were found in the experimental fields. Moreover, 6 species were common for all the plantations and were found in them regardless of plantation age. The least species, only 18, were found on the “young” plantations, almost twice more on the “older” ones (30 species, whereas the largest spectrum of species was found in the “middle-aged” plantations (33 species. In the “young” plantations, annual weeds were the most common, with the highest constancy and coverage index found for Chenopodium album, Matricaria maritima ssp. inodora and Echinochloa crus-galli. The greatest variation in species was found in the “middle-aged” plantations. However, only 4 species achieved the highest constancy and coverage index: Matricaria maritima ssp. inodora, Cirsium arvense, Poa trivialis and Taraxacum officinale. Furthermore, perennial weeds were found to be dominant in the “older” plantations. Within this group, Poa trivialis, Taraxacum officinale, Urtica dioica, Plantago maior, and Cirsium arvense had the highest constancy and coverage index.

  11. Ecological niche differentiation of polyploidization is not supported by environmental differences among species in a cosmopolitan grass genus. (United States)

    Visser, Vernon; Molofsky, Jane


    • Polyploidization frequently results in the creation of new plant species, the establishment of which is thought to often be facilitated by ecological niche differentiation from the diploid species. We tested this hypothesis using the cosmopolitan grass genus Phalaris (Poaceae), consisting of 19 species that range from diploid to tetraploid to hexaploid. Specifically, we tested whether (1) polyploids occupy more extreme environments and/or (2) have broader niche breadths and/or (3) whether the polyploid species' distributions indicate a niche shift from diploid species.• We employed a bootstrapping approach using distribution data for each species and eight environmental variables to investigate differences between species in the means, extremes, and breadths of each environmental variable. We used a kernel smoothing technique to quantify niche overlap between species.• Although we found some support for the three hypotheses for a few diploid-polyploid pairs and for specific environmental variables, none of these hypotheses were generally supported.• Our results suggest that these commonly held hypotheses about the effects of polyploidization on ecological distributions are not universally applicable. Correlative biogeographic studies like ours provide a necessary first step for suggesting specific hypotheses that require experimental verification. A combination of genetic, physiological, and ecological studies will be required to achieve a better understanding of the role of polyploidization in niche evolution. © 2015 Botanical Society of America, Inc.

  12. Genome Wide Analysis of Nucleotide-Binding Site Disease Resistance Genes in Brachypodium distachyon

    Directory of Open Access Journals (Sweden)

    Shenglong Tan


    Full Text Available Nucleotide-binding site (NBS disease resistance genes play an important role in defending plants from a variety of pathogens and insect pests. Many R-genes have been identified in various plant species. However, little is known about the NBS-encoding genes in Brachypodium distachyon. In this study, using computational analysis of the B. distachyon genome, we identified 126 regular NBS-encoding genes and characterized them on the bases of structural diversity, conserved protein motifs, chromosomal locations, gene duplications, promoter region, and phylogenetic relationships. EST hits and full-length cDNA sequences (from Brachypodium database of 126 R-like candidates supported their existence. Based on the occurrence of conserved protein motifs such as coiled-coil (CC, NBS, leucine-rich repeat (LRR, these regular NBS-LRR genes were classified into four subgroups: CC-NBS-LRR, NBS-LRR, CC-NBS, and X-NBS. Further expression analysis of the regular NBS-encoding genes in Brachypodium database revealed that these genes are expressed in a wide range of libraries, including those constructed from various developmental stages, tissue types, and drought challenged or nonchallenged tissue.

  13. Cell walls and the developmental anatomy of the Brachypodium distachyon stem internode.

    Directory of Open Access Journals (Sweden)

    Dominick A Matos

    Full Text Available While many aspects of plant cell wall polymer structure are known, their spatial and temporal distribution within the stem are not well understood. Here, we studied vascular system and fiber development, which has implication for both biofuel feedstock conversion efficiency and crop yield. The subject of this study, Brachypodium distachyon, has emerged as a grass model for food and energy crop research. Here, we conducted our investigation using B. distachyon by applying various histological approaches and Fourier transform infrared spectroscopy to the stem internode from three key developmental stages. While vascular bundle size and number did not change over time, the size of the interfascicular region increased dramatically, as did cell wall thickness. We also describe internal stem internode anatomy and demonstrate that lignin deposition continues after crystalline cellulose and xylan accumulation ceases. The vascular bundle anatomy of B. distachyon appears to be highly similar to domesticated grasses. While the arrangement of bundles within the stem is highly variable across grasses, B. distachyon appears to be a suitable model for the rind of large C4 grass crops. A better understanding of growth and various anatomical and cell wall features of B. distachyon will further our understanding of plant biomass accumulation processes.

  14. Grass and forb species for revegetation of mixed soil-lignite overburden in East Central Texas

    Energy Technology Data Exchange (ETDEWEB)

    Skousen, J.G.; Call, C.A. (West Virginia University, Morgantown, WV (USA). Division of Plant and Soil Sciences)

    Ten grasses and seven forbs were seeded into mixed soil-lignite overburden in the Post Oak Savannah region of Texas and monitored for establishment and growth over a 3-year period without fertilization. Buffelgrass (Cenchrus ciliaris), green sprangletop (Leptochloa dubia), switchgrass (Panicum virgatum), and kleingrass (P. coloratum) developed monotypic stands with sufficent density, aerial cover, and aboveground biomass to stabilize the mixed soil-lignite overburden surface by the end of the first growing season. Plant mortality eliminated buffelgrass and green sprangletop stands by the end of the third growing season. Indiangrass (Sorghastrum nutans) developed a satisfactory stand by the end of the third growing season, while Oldworld bluestem (Bothriochloa X Dicanthium), yellow bluestem (Bothriochloa ischaemum), and sideoats grama (Bouteloua curtipendula) established at a slower rate. Cover and biomass measurements from an adjacent, unfertilized stand of Coastal bermudagrass (Cynodon dactylon) were compared with those of seeded grasses throughout the study. Partidge pea (Cassia fasciculata) established rapidly and had the greatest cover and biomass of all seeded forbs by the end of the first growing season. Sericea lespedeza (Lespedeza cuneata), Illinois bundleflower (Desmanthus illinoensis), and western indigo (Indigofera miniata) developed adequate stands for surface stabilization by the end of the third growing season, while faseanil indigo (Indigofera suffruticosa), virgata lespedeza (Lespedeza virgata), and awnless bushsunflower (Simsia calva) showed slower establishment. 27 refs., 3 tabs.

  15. Classification of images of wheat, ryegrass and brome grass species at early growth stages using principal component analysis

    Directory of Open Access Journals (Sweden)

    Golzarian Mahmood R


    Full Text Available Abstract Wheat is one of the most important crops in Australia, and the identification of young plants is an important step towards developing an automated system for monitoring crop establishment and also for differentiating crop from weeds. In this paper, a framework to differentiate early narrow-leaf wheat from two common weeds from their digital images is developed. A combination of colour, texture and shape features is used. These features are reduced to three descriptors using Principal Component Analysis. The three components provide an effective and significant means for distinguishing the three grasses. Further analysis enables threshold levels to be set for the discrimination of the plant species. The PCA model was evaluated on an independent data set of plants and the results show accuracy of 88% and 85% in the differentiation of ryegrass and brome grass from wheat, respectively. The outcomes of this study can be integrated into new knowledge in developing computer vision systems used in automated weed management.

  16. Associations of Pseudomonas species and forage grasses enhance degradation of chlorinated benzoic acids in soil

    Energy Technology Data Exchange (ETDEWEB)

    Siciliano, S. D.


    Using chlorinated benzoic acid (CBA) as a model compound, this study attempted to show that microorganisms and plants can be used as bioremediation agents to clean up contaminated soil sites in a cost effective and environmentally friendly manner. CBA was used because it is present in soils contaminated with polychlorinated biphenyls (PCBs), or chlorinated pesticides. Sixteen forage grasses were screened in combination with 12 bacterial inoculants for their ability to promote the degradation of CBA in soil. Five associations of plants and bacteria were found to degrade CBA to a greater extent than plants without bacterial inoculants. Bacterial inoculants were shown to stimulate CBA degradation by altering the microbial community present on the root surface and thereby increasing the ability of this community to degrade CBA.

  17. Silicon affects seed development and leaf macrohair formation in Brachypodium distachyon

    DEFF Research Database (Denmark)

    Głazowska, Sylwia Emilia; Murozuka, Emiko; Persson, Daniel Olof


    Silicon (Si) has many beneficial effects in plants, especially for the survival from biotic and abiotic stresses. However, Si may negatively affect the quality of lignocellulosic biomass for bioenergy purposes. Despite many studies, the regulation of Si distribution and deposition in plants remains...... was similar to that in the wild-type. The Bdlsi1-1 plants supplied with Si had significantly lower seed weights, compared to the wild-type. In low-Si media, the seed weight of wild-type plants was similar to that of Bdlsi1-1 mutants supplied with Si, while the Bdlsi1-1 seed weight decreased further. We...... conclude that Si deficiency results in widespread alterations in leaf surface morphology and seed formation in Brachypodium, showing the importance of Si for successful development in grasses....

  18. Characterization of gene expression associated with drought avoidance and tolerance traits in a perennial grass species.

    Directory of Open Access Journals (Sweden)

    Peng Zhou

    Full Text Available To understand molecular mechanisms of perennial grass adaptation to drought stress, genes associated with drought avoidance or tolerance traits were identified and their expression patterns were characterized in C4 hybrid bermudagrass [Cynodon dactylon (L. Pers.×C. transvaalensis Burtt Davy, cv. Tifway] and common bermudagrass (C. dactylon, cv. C299. Plants of drought-tolerant 'Tifway' and drought-sensitive 'C299' were exposed to drought for 5 d (mild stress and 10 d (severe stress by withholding irrigation in a growth chamber. 'Tifway' maintained significantly lower electrolyte leakage and higher relative water content than 'C299' at both 5 and 10 d of drought stress. Four cDNA libraries via suppression subtractive hybridization analysis were constructed and identified 277 drought-responsive genes in the two genotypes at 5 and 10 d of drought stress, which were mainly classified into the functional categories of stress defense, metabolism, osmoregulation, membrane system, signal and regulator, structural protein, protein synthesis and degradation, and energy metabolism. Quantitative-PCR analysis confirmed the expression of 36 drought up-regulated genes that were more highly expressed in drought-tolerant 'Tifway' than drought-sensitive 'C299', including those for drought avoidance traits, such as cuticle wax formation (CER1 and sterol desaturase, for drought tolerance traits, such as dehydration-protective proteins (dehydrins, HVA-22-like protein and oxidative stress defense (superoxide dismutase, dehydroascorbate reductase, 2-Cys peroxiredoxins, and for stress signaling (EREBP-4 like protein and WRKY transcription factor. The results suggest that the expression of genes for stress signaling, cuticle wax accumulation, antioxidant defense, and dehydration-protective protein accumulation could be critically important for warm-season perennial grass adaptation to long-term drought stress.

  19. Loss of native herbaceous species due to woody plant encroachment facilitates the establishment of an invasive grass. (United States)

    Alofs, Karen M; Fowler, Norma L


    Although negative relationships between diversity (frequently measured as species richness) and invasibility at neighborhood or community scales have often been reported, realistic natural diversity gradients have rarely been studied at this scale. We recreated a naturally occurring gradient in species richness to test the effects of species richness on community invasibility. In central Texas savannas, as the proportion of woody plants increases (a process known as woody plant encroachment), herbaceous habitat is both lost and fragmented, and native herbaceous species richness declines. We examined the effects of these species losses on invasibility in situ by removing species that occur less frequently in herbaceous patches as woody plant encroachment advances. This realistic species removal was accompanied by a parallel and equivalent removal of biomass with no changes in species richness. Over two springs, the nonnative bunchgrass Bothriochloa ischaemum germinated significantly more often in the biomass-removal treatment than in unmanipulated control plots, suggesting an effect of native plant density independent of diversity. Additionally, significantly more germination occurred in the species-removal treatment than in the biomass-removal treatment. Changes in species richness had a stronger effect on B. ischaemum germination than changes in plant density, demonstrating that niche-related processes contributed more to biotic resistance in this system than did species-neutral competitive interactions. Similar treatment effects were found on transplant growth. Thus we show that woody plant encroachment indirectly facilitates the establishment of an invasive grass by reducing native diversity. Although we found a negative relationship between species richness and invasibility at the scale of plots with similar composition and environmental conditions, we found a positive relationship between species richness and invasibility at larger scales. This apparent

  20. Soil microorganisms alleviate the allelochemical effects of a thyme monoterpene on the performance of an associated grass species. (United States)

    Ehlers, Bodil K


    Plant allelochemicals released into the soil can significantly impact the performance of associated plant species thereby affecting their competitive ability. Soil microbes can potentially affect the interaction between plant and plant chemicals by degrading the allelochemicals. However, most often plant-plant chemical interactions are studied using filter paper bioassays examining the pair-wise interaction between a plant and a plant chemical, not taking into account the potential role of soil microorganisms. To explore if the allelopathic effects on a grass by the common thyme monoterpene "carvacrol" are affected by soil microorganisms. Seedlings of the grass Agrostis capillaris originating from 3 different thyme sites were raised in the greenhouse. Seedlings were grown under four different soil treatments in a 2*2 fully factorial experiment. The monoterpene carvacrol was either added to standard greenhouse soil or left out, and soil was either sterilized (no soil microorganisms) or not (soil microorganisms present in soil). The presence of carvacrol in the soil strongly increased mortality of Agrostis plants, and this increase was highest on sterile soil. Plant biomass was reduced on soil amended with carvacrol, but only when the soil was also sterilized. Plants originating from sites where thyme produces essential oils containing mostly carvacrol had higher survival on soil treated with that monoterpene than plants originating from a site where thyme produced different types of terpenes, suggesting an adaptive response to the locally occurring terpene. The study shows that presence of soil microorganisms can alleviate the negative effect of a common thyme monoterpene on the performance of an associated plant species, emphasizing the role of soil microbes in modulating plant-plant chemical interactions.

  1. Soil microorganisms alleviate the allelochemical effects of a thyme monoterpene on the performance of an associated grass species.

    Directory of Open Access Journals (Sweden)

    Bodil K Ehlers

    Full Text Available Plant allelochemicals released into the soil can significantly impact the performance of associated plant species thereby affecting their competitive ability. Soil microbes can potentially affect the interaction between plant and plant chemicals by degrading the allelochemicals. However, most often plant-plant chemical interactions are studied using filter paper bioassays examining the pair-wise interaction between a plant and a plant chemical, not taking into account the potential role of soil microorganisms.To explore if the allelopathic effects on a grass by the common thyme monoterpene "carvacrol" are affected by soil microorganisms. Seedlings of the grass Agrostis capillaris originating from 3 different thyme sites were raised in the greenhouse. Seedlings were grown under four different soil treatments in a 2*2 fully factorial experiment. The monoterpene carvacrol was either added to standard greenhouse soil or left out, and soil was either sterilized (no soil microorganisms or not (soil microorganisms present in soil. The presence of carvacrol in the soil strongly increased mortality of Agrostis plants, and this increase was highest on sterile soil. Plant biomass was reduced on soil amended with carvacrol, but only when the soil was also sterilized. Plants originating from sites where thyme produces essential oils containing mostly carvacrol had higher survival on soil treated with that monoterpene than plants originating from a site where thyme produced different types of terpenes, suggesting an adaptive response to the locally occurring terpene.The study shows that presence of soil microorganisms can alleviate the negative effect of a common thyme monoterpene on the performance of an associated plant species, emphasizing the role of soil microbes in modulating plant-plant chemical interactions.

  2. Soil Microorganisms Alleviate the Allelochemical Effects of a Thyme Monoterpene on the Performance of an Associated Grass Species (United States)

    Ehlers, Bodil K.


    Background Plant allelochemicals released into the soil can significantly impact the performance of associated plant species thereby affecting their competitive ability. Soil microbes can potentially affect the interaction between plant and plant chemicals by degrading the allelochemicals. However, most often plant-plant chemical interactions are studied using filter paper bioassays examining the pair-wise interaction between a plant and a plant chemical, not taking into account the potential role of soil microorganisms. Methodology/Principal findings To explore if the allelopathic effects on a grass by the common thyme monoterpene “carvacrol” are affected by soil microorganisms. Seedlings of the grass Agrostis capillaris originating from 3 different thyme sites were raised in the greenhouse. Seedlings were grown under four different soil treatments in a 2*2 fully factorial experiment. The monoterpene carvacrol was either added to standard greenhouse soil or left out, and soil was either sterilized (no soil microorganisms) or not (soil microorganisms present in soil). The presence of carvacrol in the soil strongly increased mortality of Agrostis plants, and this increase was highest on sterile soil. Plant biomass was reduced on soil amended with carvacrol, but only when the soil was also sterilized. Plants originating from sites where thyme produces essential oils containing mostly carvacrol had higher survival on soil treated with that monoterpene than plants originating from a site where thyme produced different types of terpenes, suggesting an adaptive response to the locally occurring terpene. Conclusions/Significance The study shows that presence of soil microorganisms can alleviate the negative effect of a common thyme monoterpene on the performance of an associated plant species, emphasizing the role of soil microbes in modulating plant-plant chemical interactions. PMID:22125596

  3. The WRKY transcription factor family in Brachypodium distachyon. (United States)

    Tripathi, Prateek; Rabara, Roel C; Langum, Tanner J; Boken, Ashley K; Rushton, Deena L; Boomsma, Darius D; Rinerson, Charles I; Rabara, Jennifer; Reese, R Neil; Chen, Xianfeng; Rohila, Jai S; Rushton, Paul J


    A complete assembled genome sequence of wheat is not yet available. Therefore, model plant systems for wheat are very valuable. Brachypodium distachyon (Brachypodium) is such a system. The WRKY family of transcription factors is one of the most important families of plant transcriptional regulators with members regulating important agronomic traits. Studies of WRKY transcription factors in Brachypodium and wheat therefore promise to lead to new strategies for wheat improvement. We have identified and manually curated the WRKY transcription factor family from Brachypodium using a pipeline designed to identify all potential WRKY genes. 86 WRKY transcription factors were found, a total higher than all other current databases. We therefore propose that our numbering system (BdWRKY1-BdWRKY86) becomes the standard nomenclature. In the JGI v1.0 assembly of Brachypodium with the MIPS/JGI v1.0 annotation, nine of the transcription factors have no gene model and eleven gene models are probably incorrectly predicted. In total, twenty WRKY transcription factors (23.3%) do not appear to have accurate gene models. To facilitate use of our data, we have produced The Database of Brachypodium distachyon WRKY Transcription Factors. Each WRKY transcription factor has a gene page that includes predicted protein domains from MEME analyses. These conserved protein domains reflect possible input and output domains in signaling. The database also contains a BLAST search function where a large dataset of WRKY transcription factors, published genes, and an extensive set of wheat ESTs can be searched. We also produced a phylogram containing the WRKY transcription factor families from Brachypodium, rice, Arabidopsis, soybean, and Physcomitrella patens, together with published WRKY transcription factors from wheat. This phylogenetic tree provides evidence for orthologues, co-orthologues, and paralogues of Brachypodium WRKY transcription factors. The description of the WRKY transcription factor

  4. Anaerobic mono-digestion of lucerne, grass and forbs – Influence of species and cutting frequency

    DEFF Research Database (Denmark)

    Wahid, Radziah; Feng, Lu; Cong, Wenfeng


    but it was not possible to ascertain whether this was due to organic overload alone or if high ammonia levels during Lu-4 digestion were contributing to the reduced performance. It was found that four cuts per year was suitable for a lab-scale mono-digestion system as the substrate was less fibrous and has lower dry......In the present study, biogas potentials of multispecies swards including grass, lucerne, caraway, ribwort plantain and chicory from two- and four-cut regimes (Mix-2 and Mix-4) for mono-digestion applying batch and continuous modes under lab-scale conditions were investigated. The gas yields...... confirmed with continuous experiments, during which the reactor digesting Mix-4 was stable throughout the experiment with low ammonia and volatile fatty acid (VFA) concentration. Meanwhile, mono-digestion of Lu-4 led to elevated VFA levels, even at a comparatively low organic loading rate of 1.76 g L−1 d−1...

  5. Coping with low nutrient availability and inundation: root growth responses of three halophytic grass species from different elevations along a flooding gradient

    NARCIS (Netherlands)

    Bouma, T.J.; Koutstaal, B.P.; Van Dongen, M.; Nielsen, K.F.


    We describe the responses of three halophytic grass species that dominate the low (Spartina anglica), middle (Puccinellia maritima) and high (Elymus pycnanthus) parts of a salt marsh, to soil conditions that are believed to favour contrasting root-growth strategies. Our hypotheses were: (1)

  6. Flavonoid concentrations in three grass species and a sedge grown in the field and under controlled environment conditions in response to enhanced UV-B radiation.

    NARCIS (Netherlands)

    van de Staaij, J.W.M.; Bakker, N.; Oosthoek, A.; Broekman, R.A.; van Beem, A.P.; Stroetenga, M.J.; Aerts, R.; Rozema, J.


    An investigation was carried out to find whether enhanced levels of UV-B radiation induce increased concentrations of flavonoids in the leaves of the grass species Deschampsia antarctica, Deschampsia borealis and Calamagrostis epigeios and the sedge Carex arenaria. Whether the enhanced levels of

  7. Disrupting the cinnamyl alcohol dehydrogenase 1 gene (BdCAD1) leads to altered lignification and improved saccharification in Brachypodium distachyon. (United States)

    Bouvier d'Yvoire, Madeleine; Bouchabke-Coussa, Oumaya; Voorend, Wannes; Antelme, Sébastien; Cézard, Laurent; Legée, Frédéric; Lebris, Philippe; Legay, Sylvain; Whitehead, Caragh; McQueen-Mason, Simon J; Gomez, Leonardo D; Jouanin, Lise; Lapierre, Catherine; Sibout, Richard


    Brachypodium distachyon (Brachypodium) has been proposed as a model for grasses, but there is limited knowledge regarding its lignins and no data on lignin-related mutants. The cinnamyl alcohol dehydrogenase (CAD) genes involved in lignification are promising targets to improve the cellulose-to-ethanol conversion process. Down-regulation of CAD often induces a reddish coloration of lignified tissues. Based on this observation, we screened a chemically induced population of Brachypodium mutants (Bd21-3 background) for red culm coloration. We identified two mutants (Bd4179 and Bd7591), with mutations in the BdCAD1 gene. The mature stems of these mutants displayed reduced CAD activity and lower lignin content. Their lignins were enriched in 8-O-4- and 4-O-5-coupled sinapaldehyde units, as well as resistant inter-unit bonds and free phenolic groups. By contrast, there was no increase in coniferaldehyde end groups. Moreover, the amount of sinapic acid ester-linked to cell walls was measured for the first time in a lignin-related CAD grass mutant. Functional complementation of the Bd4179 mutant with the wild-type BdCAD1 allele restored the wild-type phenotype and lignification. Saccharification assays revealed that Bd4179 and Bd7591 lines were more susceptible to enzymatic hydrolysis than wild-type plants. Here, we have demonstrated that BdCAD1 is involved in lignification of Brachypodium. We have shown that a single nucleotide change in BdCAD1 reduces the lignin level and increases the degree of branching of lignins through incorporation of sinapaldehyde. These changes make saccharification of cells walls pre-treated with alkaline easier without compromising plant growth. © 2012 The Authors The Plant Journal © 2012 Blackwell Publishing Ltd.

  8. The value of small habitat islands for the conservation of genetic variability in a steppe grass species (United States)

    Wódkiewicz, Maciej; Dembicz, Iwona; Moysiyenko, Ivan I.


    The habitat loss and fragmentation due to agricultural land-conversion affected the steppe throughout its range. In Ukraine, 95% of steppe was destroyed in the last two centuries. Remaining populations are confined to few refuges, like nature reserves, loess ravines, and kurgans (small burial mounds), the latter being often subject to destruction by archeological excavations. Stipa capillata L. is a typical grass species of Eurasian steppes and extrazonal dry grasslands, that was previously used as a model species in studies on steppe ecology. The aim of our research was to assess genetic diversity of S. capillata populations within different types of steppe refuges (loess ravines, biosphere reserve, kurgan) and to evaluate the value of the latter group for the preservation of genetic diversity in the study species. We assessed genetic diversity of 266 individuals from 15 populations (nine from kurgans, three from loess ravines and three from Askania-Nova Biosphere Reserve) with eight Universal Rice Primers (URPs). Studied populations showed high intra-population variability (I: 0.262-0.419, PPB: 52.08-82.64%). Populations from kurgans showed higher genetic differentiation (ΦST = 0.247) than those from loess ravines (ΦST = 0.120) and the biosphere reserve (ΦST = 0.142). Although the diversity metrics were to a small extent lower for populations from kurgans than from larger refugia we conclude that all studied populations of the species still preserve high genetic variability and are valuable for protection. To what extent this pattern holds true under continuous fragmentation in the future must be carefully monitored.

  9. Hazardous impact and translocation of vanadium (V) species from soil to different vegetables and grasses grown in the vicinity of thermal power plant

    International Nuclear Information System (INIS)

    Khan, Sumaira; Kazi, Tasneem Gul; Kolachi, Nida Fatima; Baig, Jameel Ahmed; Afridi, Hassan Imran; Shah, Abdul Qadir; Kumar, Sham; Shah, Faheem


    The distribution of vanadium (V) species in soil (test soil), vegetables and grasses, collected from the vicinity of a thermal power plant has been studied. For comparison purpose soil (control soil), same vegetable and grass samples were collected from agricultural land devoid of any industrial area. A simple and efficient ultrasonic assisted extraction method has been developed for the extraction of V 5+ species from soil, vegetable and grass samples using Na 2 CO 3 in the range of 0.1-0.5 mol/L. For comparison purpose same sub samples were also extracted by conventional heating method. The total and V species were determined by electrothermal atomic absorption spectrometry using different modifiers. The validity of V 5+ and V 4+ determination had been confirmed by the spike recovery and total amount of V by the analysis of CRM 1570 (spinach leave) and sub samples of agricultural soil. The concentration of total V was found in the range of 90-215 and 11.4-42.3 μg/g in test and control soil samples, respectively. The contents of V 5+ and total V in vegetables and grasses grown around the thermal power plant were found in the range of 2.9-5.25 and 8.74-14.9 μg/g, respectively, which were significantly higher than those values obtained from vegetables and fodders grown in non exposed agricultural site (P 5+ and V 4+ species was not significantly different from total concentration of V in same sub samples of vegetable, grass and soil of both origins, at 95% level of confidence.

  10. Hazardous impact and translocation of vanadium (V) species from soil to different vegetables and grasses grown in the vicinity of thermal power plant

    Energy Technology Data Exchange (ETDEWEB)

    Khan, Sumaira, E-mail: [Center of Excellence in Analytical Chemistry, University of Sindh, Jamshoro 76080 (Pakistan); Kazi, Tasneem Gul, E-mail: [Center of Excellence in Analytical Chemistry, University of Sindh, Jamshoro 76080 (Pakistan); Kolachi, Nida Fatima, E-mail: [Center of Excellence in Analytical Chemistry, University of Sindh, Jamshoro 76080 (Pakistan); Baig, Jameel Ahmed, E-mail: [Center of Excellence in Analytical Chemistry, University of Sindh, Jamshoro 76080 (Pakistan); Afridi, Hassan Imran, E-mail: [Center of Excellence in Analytical Chemistry, University of Sindh, Jamshoro 76080 (Pakistan); Shah, Abdul Qadir, E-mail: [Center of Excellence in Analytical Chemistry, University of Sindh, Jamshoro 76080 (Pakistan); Kumar, Sham; Shah, Faheem [Center of Excellence in Analytical Chemistry, University of Sindh, Jamshoro 76080 (Pakistan)


    The distribution of vanadium (V) species in soil (test soil), vegetables and grasses, collected from the vicinity of a thermal power plant has been studied. For comparison purpose soil (control soil), same vegetable and grass samples were collected from agricultural land devoid of any industrial area. A simple and efficient ultrasonic assisted extraction method has been developed for the extraction of V{sup 5+} species from soil, vegetable and grass samples using Na{sub 2}CO{sub 3} in the range of 0.1-0.5 mol/L. For comparison purpose same sub samples were also extracted by conventional heating method. The total and V species were determined by electrothermal atomic absorption spectrometry using different modifiers. The validity of V{sup 5+} and V{sup 4+} determination had been confirmed by the spike recovery and total amount of V by the analysis of CRM 1570 (spinach leave) and sub samples of agricultural soil. The concentration of total V was found in the range of 90-215 and 11.4-42.3 {mu}g/g in test and control soil samples, respectively. The contents of V{sup 5+} and total V in vegetables and grasses grown around the thermal power plant were found in the range of 2.9-5.25 and 8.74-14.9 {mu}g/g, respectively, which were significantly higher than those values obtained from vegetables and fodders grown in non exposed agricultural site (P < 0.01). Statistical evaluations indicate that the sum of concentrations of V{sup 5+} and V{sup 4+} species was not significantly different from total concentration of V in same sub samples of vegetable, grass and soil of both origins, at 95% level of confidence.

  11. Competition between two grass species with and without grazing over a productivity gradient

    NARCIS (Netherlands)

    Kuijper, D.P.J.; Dubbeld, J.; Bakker, J.P.


    Soil nutrient-level and herbivory are predicted to have opposing effects on the allocation pattern of the competitive dominant plant species. Lower stem and higher leaf allocation are favoured when plants are grazed, whereas a higher stem allocation is favoured at high nutrient levels. Grazing by

  12. Allelopathic activity of some grass species on Phleum pratense seed germination subject to their density


    Halina Lipińska


    Efficient utilization of allelopathy in the agricultural practice requires searching for some species and developmental stages when the allelopathic substances are generated in bioactive concentrations. That also requires the knowledge of allelopathy mechanisms and primarily its separation from the other aspects of plant activity, mainly from competition for environmental resources. This task, however, has remained vital in the studies on plant interference, being extremely difficult to perfo...

  13. Tubulin-isotype analysis of two grass species-resistant to dinitroaniline herbicides. (United States)

    Waldin, T R; Ellis, J R; Hussey, P J


    Trifluralin-resistant biotypes of Eleusine indica (L.) Gaertn. (goosegrass) and Setaria viridis (L.) Beauv. (green foxtail) exhibit cross-resistance to other dinitroaniline herbicides. Since microtubules are considered the primary target site for dinitroaniline herbicides we investigated whether the differential sensitivity of resistant and susceptible biotypes of these species results from modified tubulin polypeptides. One-dimensional and two-dimensional polyacrylamide gel electrophoresis combined with immunoblotting using well-characterised anti-tubulin monoclonal antibodies were used to display the family of tubulin isotypes in each species. Seedlings of E. indica exhibited four β-tubulin isotypes and one α-tubulin isotype, whereas those of S. viridis exhibited two β-tubulin and two α-tubulin isotypes. Comparison of the susceptible and resistant biotypes within each species revealed no differences in electrophoretic properties of the multiple tubulin isotypes. These results provide no evidence that resistance to dinitroaniline herbicides is associated with a modified tubulin polypeptide in these biotypes of E. indica or S. viridis.

  14. Starch bioengineering in Brachypodium distachyon

    DEFF Research Database (Denmark)

    Tanackovic, Vanja; Svensson, Jan Tommy; Buleon, A


    Brachypodium distachyon was recently introduced as a model plant for temperate cereals (Opanowicz et al., 2008). We aim to establish Brachypodium as a model for cereal starch metabolism. Grain starch from two lines: Bd21 and Bd21-3 are being characterized. Microscopic, chemical and structural data...... including amylopectin chain length distribution, phosphate content and amylose content provided further evidence for the close relationship to temperate cereals even though starch content and starch granule size were considerably lower than that for barley (Hordeum vulgare). Bioinformatics analyses...... in temperate cereals....

  15. Two new genera and five new species of Mugadina-like small grass cicadas (Hemiptera: Cicadidae: Cicadettini) from Central and Eastern Australia: comparative morphology, songs, behaviour and distributions. (United States)

    Ewart, A


    Moulds (2012) established the genus Mugadina for two small cicadas, M. marshalli (Distant) and M. emma (Goding and Froggatt), both grass inhabiting species known from Queensland and New South Wales. Both species are notable for their relatively simple 'ticking' songs. Moulds further noted that there were at least two superficially similar genera of cicadas, but each with different genitalia. This paper describes two new genera of small (9-15 mm body lengths) and distinctive grass cicadas with genitalia that are very similar to those of Mugadina, but possess clear morphological, colour and calling song differences. The new genera are: Heremusina n. gen. with two known species namely H. udeoecetes n. sp. and H. pipatio n. sp.; the second new genus is Xeropsalta n. gen., containing four known species, X. thomsoni n. sp., X. aridula n. sp., X. rattrayi n. sp., and X. festiva n. comb. Heremusina n. gen. species are described from the Alice Springs area of Northern Territory and the Cloncurry area of northwest Queensland, from arid to semi arid habitats. The Xeropsalta n. gen. species are described from western, southwest and central Queensland, and from the Simpson and Strzelecki Deserts in northeastern South Australia and northwestern New South Wales, respectively, all locations in very arid to arid habitats, but close to seasonal (often irregular) rivers and lakes. X. festiva n. comb. occurs in semi arid habitats in southern and southeastern Australia.        Detailed taxonomic descriptions are provided of the new species, together with distributions, habitats, and the calling songs. The Heremusina species emit songs with short repetitive buzzing echemes, the echeme durations differing between each species. The Xeropsalta songs are notable for their complexity, containing multiple elements with rapid changes of amplitudes and temporal structures, rather atypical of the songs of most small grass dwelling cicadas. Detailed song structures distinguishing each of

  16. Grass is not always greener: Rodenticide exposure of a threatened species near marijuana growing operations (United States)

    Franklin, Alan B.; Carlson, Peter C.; Rex, Angela; Rockweit, Jeremy T.; Garza, David; Culhane, Emily; Volker, Steven F; Dusek, Robert J.; Shearn-Bochsler, Valerie I.; Gabriel, Mourad W.; Horak, Katherine E.


    ObjectiveMarijuana (Cannabis spp.) growing operations (MGO) in California have increased substantially since the mid-1990s. One environmental side-effect of MGOs is the extensive use of anticoagulant rodenticides (AR) to prevent damage to marijuana plants caused by wild rodents. In association with a long-term demographic study, we report on an observation of brodifacoum AR exposure in a threatened species, the northern spotted owl (Strix occidentalis caurina), found freshly dead within 669–1347 m of at least seven active MGOs.ResultsLiver and blood samples from the dead northern spotted owl were tested for 12 rodenticides. Brodifacoum was the only rodenticide detected in the liver (33.3–36.3 ng/g) and blood (0.48–0.54 ng/ml). Based on necropsy results, it was unclear what role brodifacoum had in the death of this bird. However, fatal AR poisoning has been previously reported in owls with relatively low levels of brodifacoum residues in the liver. One likely mechanism of AR transmission from MGOs to northern spotted owls in California is through ingestion of AR contaminated prey that frequent MGOs. The proliferation of MGOs with their use of ARs in forested landscapes used by northern spotted owls may pose an additional stressor for this threatened species.

  17. A comparison of stable caesium uptake by six grass species of contrasting growth strategy

    International Nuclear Information System (INIS)

    Willey, N.J.; Martin, M.H.


    Six plants in the family Gramineae were used to investigate the relationship between Cs uptake, nutrient regime and plant growth strategy sensu Grime (1979: Plant Growth Strategies and Vegetation Processes, John Wiley). The roots of 66 day old Elymus repens (L.) Gould., Bromus sterilis L., Agrostis stolonifera L., Anthoxanthum odoratum L., Festuca ovina L. and Nardus stricta L. plants grown in acid-washed sand at high and low nutrient levels were exposed to a 96 h pulse of stable Cs at 0.05 mM, 0.15 mM, 0.3 mM, 1.0 mM and 3.0 mM concentrations. Different nutrient regimes induced large differences in dry wt in E. repens, B. sterilis and A. stolonifera plants but only small differences in N. stricta and F. ovina plants. At high nutrient concentrations, A. stolonifera, A. odoratum, F. ovina and N. stricta shoots showed significantly greater increases in internal Cs concentration with rising external Cs concentrations than did E. repens and B. sterilis shoots. The relationship between increases in shoot and external Cs concentrations was statistically indistinguishable between species in plants grown at the low nutrient concentration. These patterns of Cs uptake ensured that with long-term high K concentrations the more competitive plants (E. repens and B. sterilis) accumulated higher concentrations of Cs from low external concentrations than did non-competitive plants or competitive plants grown at low nutrient levels. It is suggested that the relationship between plant growth strategy sensu Grime (1979) and Cs accumulation patterns may help to explain the different concentrations to which species accumulate radiocaesium from the soil. (author)

  18. Grass survey of the Itremo Massif records endemic central highland ...

    African Journals Online (AJOL)

    Twenty species are endemic to the central highlands, and a further 1 4 species are restricted to Madagascar. Five ecological groups of grasses were identified in the Itremo Massif: shade species in gallery forests, open wet area species, fire grasses, anthropogenic disturbance associated grasses and rock-dwelling grasses.

  19. N2-fixation and residual N effect of four legume species and four companion grass species

    DEFF Research Database (Denmark)

    Rasmussen, Jim; Søegaard, Karen; Pirhofer-Walzl, Karin


    and climatic conditions. We conducted a field experiment on a sandy soil at two nitrogen levels with seven two-species forage mixtures: alfalfa, bird's-foot trefoil, red clover, or white clover in mixture with perennial ryegrass, and white clover in mixture with meadow fescue, timothy, or hybrid ryegrass. We...... found high N2-fixation of more than 300 kg N ha-1 from both red clover and alfalfa even when the two mixtures received 300 kg total-N ha-1 in cattle slurry. The addition of cattle slurry N fertilizer lowered N2-fixation for white clover and red clover as expected, but for bird's-foot trefoil and alfalfa...... no changes in the proportion of N derived from N2-fixation was observed. We conclude that the competition for available soil N from perennial ryegrass in mixture was an important factor for the proportion of N in alfalfa, white clover, and bird's-foot trefoil obtained from N2-fixation. White clover had...

  20. Comparative nutritional ecology of grass-feeding in a sub-Antarctic beetle: the impact of introduced species on Hydromedion sparsutum from South Georgia. (United States)

    Chown, S L; Block, W


    South Georgia has many introduced plant and animal species, a consequence of its long history of human habitation. Introduced reindeer have a strong effect on the vegetation of the Stromness Bay area by causing the replacement of indigenous species by grazing-tolerant grasses such as the exotic Poa annua, and in certain circumstances, the indigenous Festuca contracta. Recently it has been argued that an introduced predatory carabid has contributed to declines in the abundance and an increase in the body size of adults of the indigenous perimylopid beetle Hydromedion sparsutum. However, it also appears that body size of these beetles is smaller in areas where exotic grasses predominate compared to undisturbed areas. Here we test the hypothesis that by causing the spread of poorer quality grasses, especially the exotic Poa annua, reindeer may be having an indirect effect on H. sparsutum. To do this we examined the nutritional ecology of H. sparsutum larvae on four grass species which form a major part of its diet, viz. the indigenous Parodiochloa flabellata, Phleum alpinum and Festuca contracta, and the exotic Poa annua. Larvae showed the highest growth rate on Parodiochloa flabellata, followed by Phleum alpinum, F. contracta and Poa annua. These differences are due to poorer absorption of the exotic grass, and poorer utilization of the absorbed material in the case of F. contracta. Poor growth of larvae on F. contracta appears to be due to its low water and nitrogen contents, whereas in the case of P. annua a combination of low water content and high nitrogen content may be responsible for low growth rates. Low growth rates associated with poor-quality food may lead either to a prolongation of the life cycle or of the length of feeding bouts of an insect. Neither option appears to be feasible for H. sparsutum, and this means that the outcome of feeding on poorer-quality foods would be a reduction in final adult size. This has fitness consequences for the beetle

  1. Competition between a Lawn-Forming Cynodon dactylon and a Tufted Grass Species Hyparrhenia hirta on a South-African Dystrophic Savanna. (United States)

    Zwerts, J A; Prins, H H T; Bomhoff, D; Verhagen, I; Swart, J M; de Boer, W F


    South African savanna grasslands are often characterised by indigestible tufted grass species whereas lawn grasses are far more desirable in terms of herbivore sustenance. We aimed to investigate the role of nutrients and/or the disturbance (grazing, trampling) by herbivores on the formation of grazing lawns. We conducted a series of common garden experiments to test the effect of nutrients on interspecific competition between a typical lawn-forming grass species (Cynodon dactylon) and a species that is frequently found outside grazing lawns (Hyparrhenia hirta), and tested for the effect of herbivore disturbance in the form of trampling and clipping. We also performed a vegetation and herbivore survey to apply experimentally derived insights to field observations. Our results showed that interspecific competition was not affected by soil nutrient concentrations. C. dactylon did show much more resilience to disturbance than H. hirta, presumably due to the regenerative capacity of its rhizomes. Results from the field survey were in line with these findings, describing a correlation between herbivore pressure and C. dactylon abundance. We conclude that herbivore disturbance, and not soil nutrients, provide C. dactylon with a competitive advantage over H. hirta, due to vegetative regeneration from its rhizomes. This provides evidence for the importance of concentrated, high herbivore densities for the creation and maintenance of grazing lawns.

  2. The effect of hydraulic lift on organic matter decomposition, soil nitrogen cycling, and nitrogen acquisition by a grass species. (United States)

    Armas, Cristina; Kim, John H; Bleby, Timothy M; Jackson, Robert B


    Hydraulic lift (HL) is the passive movement of water through plant roots, driven by gradients in water potential. The greater soil-water availability resulting from HL may in principle lead to higher plant nutrient uptake, but the evidence for this hypothesis is not universally supported by current experiments. We grew a grass species common in North America in two-layer pots with three treatments: (1) the lower layer watered, the upper one unwatered (HL), (2) both layers watered (W), and (3) the lower layer watered, the upper one unwatered, but with continuous light 24 h a day to limit HL (no-HL). We inserted ingrowth cores filled with enriched-nitrogen organic matter ((15)N-OM) in the upper layer and tested whether decomposition, mineralization and uptake of (15)N were higher in plants performing HL than in plants without HL. Soils in the upper layer were significantly wetter in the HL treatment than in the no-HL treatment. Decomposition rates were similar in the W and HL treatments and lower in no-HL. On average, the concentration of NH(4)(+)-N in ingrowth cores was highest in the W treatment, and NO(3)(-)-N concentrations were highest in the no-HL treatment, with HL having intermediate values for both, suggesting differential mineralization of organic N among treatments. Aboveground biomass, leaf (15)N contents and the (15)N uptake in aboveground tissues were higher in W and HL than in no-HL, indicating higher nutrient uptake and improved N status of plants performing HL. However, there were no differences in total root nitrogen content or (15)N uptake by roots, indicating that HL affected plant allocation of acquired N to photosynthetic tissues. Our evidence for the role of HL in organic matter decomposition and nutrient cycling suggests that HL could have positive effects on plant nutrient dynamics and nutrient turnover.

  3. Neglected grass species of Southern Africa: Nutritive value of conserved Hyperthelia dissoluta harvested at different growth stages

    Directory of Open Access Journals (Sweden)

    Jacob Gusha


    Full Text Available Native species like Hyperthelia dissoluta have great potential in livestock production but not much has been done to improve their contribution to that sector.  This study examined 2 conservation methods (drying and ensiling and 3 different growth stages, namely: elongation stage (January, early flowering (February and late flowering stage (March of H. dissoluta in terms of nutritional composition and digestibility.  The method of conservation had a significant effect (P<0.05 on nutritive value, with silage having more P and CP than hay.  Stage of growth had an effect (P<0.05 on all nutritional properties of both hay and silage:  Phosphorus, Ca and CP concentrations and digestibility of hay and silage decreased with maturity, while NDF and ADF concentrations increased.  Silage pH value was significantly higher at elongation (5.2 and late flowering growth stages (5.7 than at early flowering (4.4.  Dry matter digestibility of the conserved material reached levels as high as 82% for silage made at the elongation stage with all values at least 60%.  We conclude that H. dissoluta can be conserved as both silage and hay to produce a good quality feed.  Harvesting at the early flowering stage would seem to provide a good compromise between quantity (not measured in this study and quality of harvested forage.  Further studies seem warranted to determine the acceptability and intake of the material by livestock, the advantages of adding fermentable carbohydrates during ensiling and DM yields in different areas and a range of seasonal conditions. Keywords: Air drying, hay, perennial native grasses, plastic bag silo, quality silage.DOI: 10.17138/TGFT(4179-184

  4. Cytomolecular analysis of ribosomal DNA evolution in a natural allotetraploid Brachypodium hybridum and its putative ancestors – dissecting complex repetitive structure of intergenic spacers

    Directory of Open Access Journals (Sweden)

    Natalia Borowska-Zuchowska


    Full Text Available Nucleolar dominance is an epigenetic phenomenon associated with nuclear 35S rRNA genes and consists in selective suppression of gene loci inherited from one of the progenitors in the allopolyploid. Our understanding of the exact mechanisms that determine this process is still fragmentary, especially in case of the grass species. This study aimed to shed some light on the molecular basis of this genome-specific inactivation of 35S rDNA loci in an allotetraploid Brachypodium hybridum (2n=30, which arose from the interspecific hybridization between two diploid ancestors that were very similar to modern B. distachyon (2n=10 and B. stacei (2n=20. Using fluorescence in situ hybridization with 25S rDNA and chromosome-specific BAC clones as probes we revealed that the nucleolar dominance is present not only in meristematic root-tip cells but also in differentiated cell fraction of B. hybridum. Additionally, the intergenic spacers (IGSs from both of the putative ancestors and the allotetraploid were sequenced and analyzed. The presumptive transcription initiation sites, spacer promoters and repeated elements were identified within the IGSs. Two different length variants, 2.3 kb and 3.5 kb, of IGSs were identified in B. distachyon and B. stacei, respectively, however only the IGS that had originated from B. distachyon-like ancestor was present in the allotetraploid. The amplification pattern of B. hybridum IGSs suggests that some genetic changes occurred in inactive B. stacei-like rDNA loci during the evolution of the allotetraploid. We hypothesize that their preferential silencing is an effect of structural changes in the sequence rather than just the result of the sole inactivation at the epigenetic level.

  5. The effect of ensiling and haymaking on the concentrations of steroidal saponin in two Brachiaria grass species (United States)

    Brachiaria (signalgrass) is now the most widely used tropical grass genus in Central and South America. However, Brachiaria spp. can cause hepatogenous photosensitization in livestock. Steroidal saponins, specifically protodioscin, present in Brachiaria spp. may be responsible for liver injury and s...

  6. Transfer factors of 226Ra, 210Pb and 210Po from NORM-contaminated oil field soil to some Atriplex species, Alfalfa and Bermuda grass

    International Nuclear Information System (INIS)

    Al-Masria, M.S.; Mukalallati, H.; Al-Hamwi, A.


    Transfer factors of 226 Ra, 210 Pb and 210 Po from soil contaminated with naturally occurring radioactive materials (NORM) in oil fields to some grazing plants were determined using pot experiments. Contaminated soil was collected from a dry surface evaporation pit from a Syrian oil field in the Der Ezzor area. Five types of plants (Atriplex halimus L., Atriplex canescens, Atriplex Leucoclada Bioss, Alfalfa and Bermuda grass) were grown and harvested three times over two years. The results show that the mean transfer factors of 226 Ra from the contaminated soil to the studied plant species were 1.6 x 10 -3 for Atriplex halimus L., 2.1 x 10 -3 for Atriplex canescens, 2.5 x 10 -3 for Atriplex Leucoclada Bioss, 8.2 x 10 -3 for Bermuda grass, and the highest value was 1.7 x 10 -2 for Alfalfa. Transfer factors of 210 Pb and 210 Po were higher than 226 Ra TFs by one order of magnitude and reached 7 x 10 -3 , 1.1 x 10 -2 , 1.2 x 10 -2 , 3.2 x 10 -2 and 2.5 x 10 -2 for Atriplex halimus, Atriplex canescens, Atriplex Leucoclada Bioss, Bermuda grass and Alfalfa, respectively. The results can be considered as base values for transfer factors of 226 Ra, 210 Pb and 210 Po in semiarid regions. (authors)

  7. Forage yield and nutritive value of Elephant grass, Italian ryegrass and spontaneous growing species mixed with forage peanut or red clover

    Directory of Open Access Journals (Sweden)

    Michelle Schalemberg Diehl


    Full Text Available The objective of this research was to evaluate of three grazing systems (GS with elephant grass (EG, Italian ryegrass (IR + spontaneous growing species (SGS; EG + IR + SGS + forage peanut (FP; and EG + IR + SGS + red clover (RC, during the winter and summer periods in rotational grazing with dairy cattle. Experimental design was completely randomized with three treatments, two replicates with repeated measures. Lactating Holstein cows receiving 1% BW-daily feed supplement with concentrate were used in the evaluation. Eight grazing cycles were performed during the experimental period. The values of pre forage mass and stocking rate were 2.52, 2.60 and 2.99 t ha-1 and 2.64, 2.77 and 3.14 animal unit ha-1, respectively for GS. Samples of forage were collected by hand-plucking technique to analyze the crude protein (CP, neutral detergent fiber (NDF, in situ dry matter digestibility (ISDMD, in situ organic matter digestibility (ISOMD of forage present between rows of elephant grass, in the rows of elephant grass and the legumes. Higher value of CP, ISOMD and lower of NDF were observed for the grazing systems mixed with legumes forage.

  8. Seasonal variations of cadmium and zinc in Arrhenatherum elatius, a perennial grass species from highly contaminated soils

    International Nuclear Information System (INIS)

    Deram, Annabelle; Denayer, Franck-Olivier; Petit, Daniel; Van Haluwyn, Chantal


    There is interest in studying bioaccumulation in plants because they form the base of the food chain as well as their potential use in phytoextraction. From this viewpoint, our study deals with the seasonal variation, from January to July, of Cd and Zn bioaccumulation in three metallicolous populations of Arrhenatherum elatius, a perennial grass with a high biomass production. In heavily polluted soils, while Zn bioaccumulation is weak, A. elatius accumulates more Cd than reported gramineous plants, with concentration of up to 100 μg g -1 . Our results also showed seasonal variations of bioaccumulation, underlying the necessity for in situ studies to specify the date of sampling and also the phenology of the collected plant sample. In our experimental conditions, accumulation is lower in June, leading us to the hypothesis of restriction in heavy metals translocation from roots to aerial parts during seed production. - Cd and Zn bioaccumulation varies seasonally in a perennial grass

  9. Seasonal variations of cadmium and zinc in Arrhenatherum elatius, a perennial grass species from highly contaminated soils

    Energy Technology Data Exchange (ETDEWEB)

    Deram, Annabelle [Institut Lillois d' Ingenierie de la Sante, Universite Droit et Sante de Lille, EA 2690, 42 rue Ambroise Pare, 59120 Loos (France)]. E-mail:; Denayer, Franck-Olivier [Institut Lillois d' Ingenierie de la Sante, Universite Droit et Sante de Lille, EA 2690, 42 rue Ambroise Pare, 59120 Loos (France); Petit, Daniel [Laboratoire de Genetique et Evolution des Populations Vegetales, UPRESA-CNRS 8016, Bat SN2, Universite des Sciences et Techniques de Lille, 59655 Villeneuve d' Ascq, F59655 France (France); Van Haluwyn, Chantal [Faculte des Sciences Pharmaceutiques et Biologiques, Departement de Botanique, Universite Droit et Sante de Lille, EA 2690, B.P. 83, 59006 Lille Cedex (France)


    There is interest in studying bioaccumulation in plants because they form the base of the food chain as well as their potential use in phytoextraction. From this viewpoint, our study deals with the seasonal variation, from January to July, of Cd and Zn bioaccumulation in three metallicolous populations of Arrhenatherum elatius, a perennial grass with a high biomass production. In heavily polluted soils, while Zn bioaccumulation is weak, A. elatius accumulates more Cd than reported gramineous plants, with concentration of up to 100 {mu}g g{sup -1}. Our results also showed seasonal variations of bioaccumulation, underlying the necessity for in situ studies to specify the date of sampling and also the phenology of the collected plant sample. In our experimental conditions, accumulation is lower in June, leading us to the hypothesis of restriction in heavy metals translocation from roots to aerial parts during seed production. - Cd and Zn bioaccumulation varies seasonally in a perennial grass.

  10. In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species

    Directory of Open Access Journals (Sweden)

    Ertuğrul Filiz


    Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.

  11. Cell wall composition and digestibility alterations in Brachypodium distachyon achieved through reduced expression of the UDP-arabinopyranose mutase (United States)

    Rancour, David M.; Hatfield, Ronald D.; Marita, Jane M.; Rohr, Nicholas A.; Schmitz, Robert J.


    Nucleotide-activated sugars are essential substrates for plant cell-wall carbohydrate-polymer biosynthesis. The most prevalent grass cell wall (CW) sugars are glucose (Glc), xylose (Xyl), and arabinose (Ara). These sugars are biosynthetically related via the UDP–sugar interconversion pathway. We sought to target and generate UDP–sugar interconversion pathway transgenic Brachypodium distachyon lines resulting in CW carbohydrate composition changes with improved digestibility and normal plant stature. Both RNAi-mediated gene-suppression and constitutive gene-expression approaches were performed. CWs from 336 T0 transgenic plants with normal appearance were screened for complete carbohydrate composition. RNAi mutants of BdRGP1, a UDP-arabinopyranose mutase, resulted in large alterations in CW carbohydrate composition with significant decreases in CW Ara content but with minimal change in plant stature. Five independent RNAi-RGP1 T1 plant lines were used for in-depth analysis of plant CWs. Real-time PCR analysis indicated that gene expression levels for BdRGP1, BdRGP2, and BdRGP3 were reduced in RNAi-RGP1 plants to 15–20% of controls. CW Ara content was reduced by 23–51% of control levels. No alterations in CW Xyl and Glc content were observed. Corresponding decreases in CW ferulic acid (FA) and ferulic acid-dimers (FA-dimers) were observed. Additionally, CW p-coumarates (pCA) were decreased. We demonstrate the CW pCA decrease corresponds to Ara-coupled pCA. Xylanase-mediated digestibility of RNAi-RGP1 Brachypodium CWs resulted in a near twofold increase of released total carbohydrate. However, cellulolytic hydrolysis of CW material was inhibited in leaves of RNAi-RGP1 mutants. Our results indicate that targeted manipulation of UDP–sugar biosynthesis can result in biomass with substantially altered compositions and highlights the complex effect CW composition has on digestibility. PMID:26136761

  12. Phytoextraction and accumulation of mercury in three plant species: Indian mustard (Brassica juncea), beard grass (Polypogon monospeliensis), and Chinese brake fern (Pteris vittata). (United States)

    Su, Yi; Han, Fengxiang X; Chen, Jian; Sridhar, B B Maruthi; Monts, David L


    The objective of this research was to screen and search for suitable plant species to phytoextract mercury-contaminated soil. Our effort focused on using some of the known metal-accumulating wild-type plants since no natural plant species with mercury-hyperaccumulat ing properties has yet been identified. Three plant species were evaluated for their uptake efficiency for mercury: Indian mustard (Brassica juncea), beard grass (Polypogon monospeliensis), and Chinese brake fern (Pteris vittata). Four sets of experiments were conducted to evaluate the phytoremediation potential of these three plant species: a pot study with potting mix where mercury was provided daily as HgCl2 solution; experiments with freshly mercury-spiked soil; and a study with aged soils contaminated with different mercury sources (HgCl2, Hg(NO3)2, and HgS). Homemade sunlit chambers were also used to study foliar uptake of Hg from ambient air. Among the three plant species, Chinese brake fern showed the least stress symptoms resulting from mercury exposure and had the highest mercury accumulation. Our results indicate that Chinese brake fern may be a potential candidate for mercury phytoextraction. We found that mercury contamination is biologically available for plant uptake and accumulation, even if the original and predominating mercury form is HgS, and also after multiple phytoremediation cycles.

  13. Brachypodium distachyon genomics for sustainable food and fuel production (United States)

    Grasses are a vital source of food for humanity and are projected to be become an important source of renewable fuel. To provide food, feed and fuel for an ever expanding human population it will be necessary to improve existing grass crops (e.g. wheat, maize, rice) and domesticate perennial grasses...

  14. Common mycelial networks impact competition in an invasive grass. (United States)

    Workman, Rachael E; Cruzan, Mitchell B


    Mycorrhizal hyphal complexes can connect multiple host plants to form common mycelial networks (CMNs) that may affect plant competitive outcomes and community composition through differential resource allocation. The impacts of CMN interactions on invasive plants are not well understood and could be crucial to the understanding of invasive plant establishment and success. We grew the invasive grass Brachypodium sylvaticum in intra- and interspecific pairings with native grass Bromus vulgaris in a greenhouse and controlled for the effects of CMN and root interactions by manipulating the belowground separation between competitors. Comparison of plant growth in pots that allowed CMN interactions and excluded root competition and vice versa, or both, allowed us to delineate the effects of network formation and root competition on invasive plant establishment and performance. Brachypodium sylvaticum grown in pots allowing for only hyphal interactions, but no root competition, displayed superior growth compared with conspecifics in other treatments. Invasive performance was poorest when pairs were not separated by a barrier. Shoot nitrogen content in B. sylvaticum was higher in mycorrhizal plants only when connections were allowed between competitors. Our results indicate that the presence of CMN networks can have positive effects on B. sylvaticum establishment and nutrient status, which may affect plant competition and invasion success. © 2016 Botanical Society of America.

  15. Five new species of grass cicadas in the genus Graminitigrina (Hemiptera: Cicadidae: Cicadettinae: Cicadettini) from Queensland and Northern Territory, Australia: comparative morphology, songs, behaviour and distributions. (United States)

    Ewart, A; Popple, L W; Hill, K B R


    Five new species of small grass cicadas belonging to the genus Graminitigrina Ewart and Marques are described, together with detailed analyses of their calling songs. Four species occur in Queensland, G. aurora n. sp. from eastern central Queensland near Fairbairn Dam; G. flindensis n. sp. from central Queensland between Hughenden northwards for at least 108 km; G. einasleighi n. sp. from near The Lynd, Einasleigh River, northeastern Queensland; G. selwynensis n. sp. from the Selwyn Range, northwestern Queensland, at locations about 40 km east of Mount Isa and 25 km southwest of Cloncurry, this latter here transferred from G. bowensis Ewart and Marques; G. uluruensis n. sp. from Uluru and the Olgas in southwestern Northern Territory, extending northwards through Tennant Creek and apparently further north to near Larrimah, a linear distance of approximately 1190 km. These new species bring the known Graminitigrina species to ten, all superficially similar in colour and morphology. A key to male specimens is provided for the 10 species. Additional distribution records and additional aural song recordings are presented for G. bowensis, these requiring the transfer of populations previously identified as G. bowensis from Croydon and Georgetown, northern Gulf region, to G. karumbae Ewart and Marques. Detailed comparative analyses, including NMDS analyses, of the songs of all 10 species are provided, which show that the song parameters are appropriate to distinguish the species, although some partial overlap is noted in the waveform plots between the songs of G. uluruensis n. sp. and G. flindensis n. sp. Regional variations of song parameters are noted in the calling songs of most of the species described.

  16. Patogenicidade de Helminthosporium oryzae a algumas espécies de gramíneas Pathogenicity of Helminthosporium oryzae against some grass species

    Directory of Open Access Journals (Sweden)

    V.H. Artigiani Filho


    Full Text Available O fungo Helminthosporium oryzae é um patógeno do arroz. Devido a sua variabilidade patogênica, foi investigada a possibilidade deste fungo infectar outras gramíneas. Através de inoculação artificial, ficou demonstrada a capacidade deste patógeno provocar infecção em aveia, cana, centeio, sorgo, trigo, Brachiaria decumbens e Panicum maximum. Assim, estas espécies vegetais podem ser consideradas potenciais hospedeiros do fungo na natureza.Helminthosporium oryzae is a rice pathogen. Due to its variability in pathogenicity, the possibility of this fungus Infecting other grasses was investigated. The capacity of this pathogen was demonstrated to be able to infect oat, sugar-cane, rye, sorghum, wheat, Brachiaria decumbens and Panicum maximum through artificial inoculations. Therefore, those plant species can be considered potencial hosts for the fungus in nature.

  17. Determining Optimal New Generation Satellite Derived Metrics for Accurate C3 and C4 Grass Species Aboveground Biomass Estimation in South Africa

    Directory of Open Access Journals (Sweden)

    Cletah Shoko


    Full Text Available While satellite data has proved to be a powerful tool in estimating C3 and C4 grass species Aboveground Biomass (AGB, finding an appropriate sensor that can accurately characterize the inherent variations remains a challenge. This limitation has hampered the remote sensing community from continuously and precisely monitoring their productivity. This study assessed the potential of a Sentinel 2 MultiSpectral Instrument, Landsat 8 Operational Land Imager, and WorldView-2 sensors, with improved earth imaging characteristics, in estimating C3 and C4 grasses AGB in the Cathedral Peak, South Africa. Overall, all sensors have shown considerable potential in estimating species AGB; with the use of different combinations of the derived spectral bands and vegetation indices producing better accuracies. However, WorldView-2 derived variables yielded better predictive accuracies (R2 ranging between 0.71 and 0.83; RMSEs between 6.92% and 9.84%, followed by Sentinel 2, with R2 between 0.60 and 0.79; and an RMSE 7.66% and 14.66%. Comparatively, Landsat 8 yielded weaker estimates, with R2 ranging between 0.52 and 0.71 and high RMSEs ranging between 9.07% and 19.88%. In addition, spectral bands located within the red edge (e.g., centered at 0.705 and 0.745 µm for Sentinel 2, SWIR, and NIR, as well as the derived indices, were found to be very important in predicting C3 and C4 AGB from the three sensors. The competence of these bands, especially of the free-available Landsat 8 and Sentinel 2 dataset, was also confirmed from the fusion of the datasets. Most importantly, the three sensors managed to capture and show the spatial variations in AGB for the target C3 and C4 grassland area. This work therefore provides a new horizon and a fundamental step towards C3 and C4 grass productivity monitoring for carbon accounting, forage mapping, and modelling the influence of environmental changes on their productivity.

  18. Establishment, Growth and Biomass yield of three Grass species on a degraded Ultisol and their effect on soil loss.

    Directory of Open Access Journals (Sweden)


    Full Text Available Erosion is a cause for concern; this is because of its effects on the soil used for both agricultural and non-agricultural purposes. Experiments were carried out to check the establishment, growth and biomass field of 3 tropical plants and their effects on soil loss during 2007 planting season. The treatments comprised 3 grasses viz. Azonopus compressus. Panicum maximum and Andropogon gayanus. The grasses were laid our in the field using a randomized complete block design replicated 4 times. Bare soil was used as the control. The parameters tested were plant height, leaf area index, root density, root establishment and the amount of soil loss using erosion pins. The result showed that Andropogon gayanus has an edge over Panicum maximum and Axonopus compressus with reference to plant height, root establishment, root density and leaf area index. Andropogon gayanus had a higher plant height from 3,6,9 and 12WAP with plant heights of 3.30cm, 3.63cm,3.93cm and 4.30cm representing 15.7%, 19.3% and 28.8% respectively. It was followed by P. maximum while A. compressus maintained the lowest plant height from 3,6,9 and 12 WAP with plant height of 2.83cm, 3.05cm, 3.20cm and 3.45cm respectively. In terms of root density, A. compressus did not have much root density which was 0.02t/ha, also at 12WAP, P. maximum did not have much root density which was 0.06t/ha though it was higher than A. compressus. The trend was the same for A. gayanus whose root density was 0.75t/ha. In terms of leaf area index (LAI, it was shown that at 3WAP and 6WAP, A. compressus had the lowest leaf area index of 58.25 and 65.75 respectively. Also at 9WAP and 12WAP A. compressus had 72.28 and 75.08t/ha respectively. At 3WAP and 6WAP P.maximum had a high leaf area index of 66.60 and 77.25 respectively. A. gayanus at 3WAP and 6WAP had 87.73 gayanus at 3WAP and 6WAP had 87.73 and 90.80 for 9WAP and 12WAP respectively. A. compressus protected the soil, reducing soil loss as a total of 9

  19. Recreating Stable Brachypodium hybridum Allotetraploids by Uniting the Divergent Genomes of B. distachyon and B. stacei (United States)

    Dinh Thi, Vinh Ha; Coriton, Olivier; Le Clainche, Isabelle; Arnaud, Dominique; Gordon, Sean P.; Linc, Gabriella; Catalan, Pilar; Hasterok, Robert; Vogel, John P.; Jahier, Joseph; Chalhoub, Boulos


    Brachypodium hybridum (2n = 30) is a natural allopolyploid with highly divergent sub-genomes derived from two extant diploid species, B. distachyon (2n = 10) and B. stacei (2n = 20) that differ in chromosome evolution and number. We created synthetic B. hybridum allotetraploids by hybridizing various lines of B. distachyon and B. stacei. The initial amphihaploid F1 interspecific hybrids were obtained at low frequencies when B. distachyon was used as the maternal parent (0.15% or 0.245% depending on the line used) and were sterile. No hybrids were obtained from reciprocal crosses or when autotetraploids of the parental species were crossed. Colchicine treatment was used to double the genome of the F1 amphihaploid lines leading to allotetraploids. The genome-doubled F1 plants produced a few S1 (first selfed generation) seeds after self-pollination. S1 plants from one parental combination (Bd3-1×Bsta5) were fertile and gave rise to further generations whereas those of another parental combination (Bd21×ABR114) were sterile, illustrating the importance of the parental lineages crossed. The synthetic allotetraploids were stable and resembled the natural B. hybridum at the phenotypic, cytogenetic and genomic levels. The successful creation of synthetic B. hybridum offers the possibility to study changes in genome structure and regulation at the earliest stages of allopolyploid formation in comparison with the parental species and natural B. hybridum. PMID:27936041

  20. Diurnal Transcriptome and Gene Network Represented through Sparse Modeling in Brachypodium distachyon

    Directory of Open Access Journals (Sweden)

    Satoru Koda


    Full Text Available We report the comprehensive identification of periodic genes and their network inference, based on a gene co-expression analysis and an Auto-Regressive eXogenous (ARX model with a group smoothly clipped absolute deviation (SCAD method using a time-series transcriptome dataset in a model grass, Brachypodium distachyon. To reveal the diurnal changes in the transcriptome in B. distachyon, we performed RNA-seq analysis of its leaves sampled through a diurnal cycle of over 48 h at 4 h intervals using three biological replications, and identified 3,621 periodic genes through our wavelet analysis. The expression data are feasible to infer network sparsity based on ARX models. We found that genes involved in biological processes such as transcriptional regulation, protein degradation, and post-transcriptional modification and photosynthesis are significantly enriched in the periodic genes, suggesting that these processes might be regulated by circadian rhythm in B. distachyon. On the basis of the time-series expression patterns of the periodic genes, we constructed a chronological gene co-expression network and identified putative transcription factors encoding genes that might be involved in the time-specific regulatory transcriptional network. Moreover, we inferred a transcriptional network composed of the periodic genes in B. distachyon, aiming to identify genes associated with other genes through variable selection by grouping time points for each gene. Based on the ARX model with the group SCAD regularization using our time-series expression datasets of the periodic genes, we constructed gene networks and found that the networks represent typical scale-free structure. Our findings demonstrate that the diurnal changes in the transcriptome in B. distachyon leaves have a sparse network structure, demonstrating the spatiotemporal gene regulatory network over the cyclic phase transitions in B. distachyon diurnal growth.

  1. Grass genomes


    Bennetzen, Jeffrey L.; SanMiguel, Phillip; Chen, Mingsheng; Tikhonov, Alexander; Francki, Michael; Avramova, Zoya


    For the most part, studies of grass genome structure have been limited to the generation of whole-genome genetic maps or the fine structure and sequence analysis of single genes or gene clusters. We have investigated large contiguous segments of the genomes of maize, sorghum, and rice, primarily focusing on intergenic spaces. Our data indicate that much (>50%) of the maize genome is composed of interspersed repetitive DNAs, primarily nested retrotransposons that in...

  2. Final technical report for Phenomic Analysis of Natural and Induced Variation in Brachypodium Distachyon DE-SC0001526

    Energy Technology Data Exchange (ETDEWEB)

    Vogel, John P. [USDA ARS Western Regional Research Center, Albany, NY (United States)


    The goal of this project was to apply high-throughput, non-destructive phenotyping (phenomics) to collections of natural variants and induced mutants of the model grass Brachypodium distachyon and characterize a small subset of that material in detail. B. distachyon is well suited to this phenomic approach because its small size and rapid generation time allow researchers to grow many plants under carefully controlled conditions. In addition, the simple diploid genetics, high quality genome sequence and existence of numerous experimental tools available for B. distachyon allow us to rapidly identify genes affecting specific phenotypes. Our phenomic analysis revealed great diversity in biofuel-relevant traits like growth rate, biomass and photosynthetic rate. This clearly demonstrated the feasibility of applying a phenomic approach to the model grass B. distachyon. We also demonstrated the utility of B. distachyon for studying mature root system, something that is virtually impossible to do with biomass crops. We showed tremendous natural variation in root architecture that can potentially be used to design crops with superior nutrient and water harvesting capability. Finally, we demonstrated the speed with which we can link specific genes to specific phenotypes by studying two mutants in detail. Importantly, in both cases, the specific biological lessons learned were grass-specific and could not have been learned from a dicot model system. Furthermore, one of the genes affects cell wall integrity and thus may be a useful target in the context of biomass crop improvement. Ultimately, all this information can be used to accelerate the creation of improved biomass crops.

  3. Grass species influence on plant N uptake - Determination of atmospheric N deposition to a semi-natural peat bog site using a 15N labelling approach (United States)

    Hurkuck, Miriam; Brümmer, Christian; Spott, Oliver; Flessa, Heinz; Kutsch, Werner L.


    Large areas of natural peat bogs in Northwestern Germany have been converted to arable land and were subjected to draining and peat cutting in the past. The few protected peatland areas remaining are affected by high nitrogen (N) deposition. Our study site - a moderately drained raised bog - is surrounded by highly fertilized agricultural land and livestock production. In this study, we used a 15N pool dilution technique called 'Integrated Total Nitrogen Input' (ITNI) to quantify annual deposition of atmospheric N into biomonitoring pots over a two-year period. Since it considers direct N uptake by plants, it was expected to result in higher N input than conventional methods for determination of N deposition (e.g. micrometeorological approaches, bulk N samplers). Using Lolium multiflorum and Eriophorum vaginatum as monitor plants and low, medium and high levels of fertilization, we aimed to simulate increasing N deposition to planted pots and to allocate airborne N after its uptake by the soil-plant system in aboveground biomass, roots and soil. Increasing N fertilization was positively correlated with biomass production of Eriophorum vaginatum, whereas atmospheric plant N uptake decreased and highest airborne N input of 899.8 ± 67.4 µg N d-1 pot-1 was found for low N fertilization. In contrast, Lolium multiflorum showed a clear dependency of N supply on plant N uptake and was highest (688.7 ± 41.4 µg N d-1 pot-1) for highly fertilized vegetation pots. Our results suggest that grass species respond differently to increasing N input. While crop grasses such as Lolium multiflorum take up N according to N availability, species adopted to nutrient-limited conditions like Eriophorum vaginatum show N saturation effects with increasing N supply. Total airborne N input ranged from about 24 to 66 kg N ha-1 yr-1 dependent on the used indicator plant and the amount of added fertilizer. Parallel determination of atmospheric N deposition using a micrometeorological approach

  4. Centromeres cluster de novo at the beginning of meiosis in Brachypodium distachyon.

    Directory of Open Access Journals (Sweden)

    Ruoyu Wen

    Full Text Available In most eukaryotes that have been studied, the telomeres cluster into a bouquet early in meiosis, and in wheat and its relatives and in Arabidopsis the centromeres pair at the same time. In Arabidopsis, the telomeres do not cluster as a typical telomere bouquet on the nuclear membrane but are associated with the nucleolus both somatically and at the onset of meiosis. We therefore assessed whether Brachypodium distachyon, a monocot species related to cereals and whose genome is approximately twice the size of Arabidopsis thaliana, also exhibited an atypical telomere bouquet and centromere pairing. In order to investigate the occurrence of a bouquet and centromere pairing in B distachyon, we first had to establish protocols for studying meiosis in this species. This enabled us to visualize chromosome behaviour in meiocytes derived from young B distachyon spikelets in three-dimensions by fluorescent in situ hybridization (FISH, and accurately to stage meiosis based on chromatin morphology in relation to spikelet size and the timing of sample collection. Surprisingly, this study revealed that the centromeres clustered as a single site at the same time as the telomeres also formed a bouquet or single cluster.

  5. Evolutionary modes of emergence of short interspersed nuclear element (SINE) families in grasses. (United States)

    Kögler, Anja; Schmidt, Thomas; Wenke, Torsten


    Short interspersed nuclear elements (SINEs) are non-autonomous transposable elements which are propagated by retrotransposition and constitute an inherent part of the genome of most eukaryotic species. Knowledge of heterogeneous and highly abundant SINEs is crucial for de novo (or improvement of) annotation of whole genome sequences. We scanned Poaceae genome sequences of six important cereals (Oryza sativa, Triticum aestivum, Hordeum vulgare, Panicum virgatum, Sorghum bicolor, Zea mays) and Brachypodium distachyon to examine the diversity and evolution of SINE populations. We comparatively analyzed the structural features, distribution, evolutionary relation and abundance of 32 SINE families and subfamilies within grasses, comprising 11 052 individual copies. The investigation of activity profiles within the Poaceae provides insights into their species-specific diversification and amplification. We found that Poaceae SINEs (PoaS) fall into two length categories: simple SINEs of up to 180 bp and dimeric SINEs larger than 240 bp. Detailed analysis at the nucleotide level revealed that multimerization of related and unrelated SINE copies is an important evolutionary mechanism of SINE formation. We conclude that PoaS families diversify by massive reshuffling between SINE families, likely caused by insertion of truncated copies, and provide a model for this evolutionary scenario. Twenty-eight of 32 PoaS families and subfamilies show significant conservation, in particular either in the 5' or 3' regions, across Poaceae species and share large sequence stretches with one or more other PoaS families. © 2017 The Authors The Plant Journal © 2017 John Wiley & Sons Ltd.

  6. Targeted genotyping-by-sequencing permits cost-effective identification and discrimination of pasture grass species and cultivars. (United States)

    Pembleton, Luke W; Drayton, Michelle C; Bain, Melissa; Baillie, Rebecca C; Inch, Courtney; Spangenberg, German C; Wang, Junping; Forster, John W; Cogan, Noel O I


    A targeted amplicon-based genotyping-by-sequencing approach has permitted cost-effective and accurate discrimination between ryegrass species (perennial, Italian and inter-species hybrid), and identification of cultivars based on bulked samples. Perennial ryegrass and Italian ryegrass are the most important temperate forage species for global agriculture, and are represented in the commercial pasture seed market by numerous cultivars each composed of multiple highly heterozygous individuals. Previous studies have identified difficulties in the use of morphophysiological criteria to discriminate between these two closely related taxa. Recently, a highly multiplexed single nucleotide polymorphism (SNP)-based genotyping assay has been developed that permits accurate differentiation between both species and cultivars of ryegrasses at the genetic level. This assay has since been further developed into an amplicon-based genotyping-by-sequencing (GBS) approach implemented on a second-generation sequencing platform, allowing accelerated throughput and ca. sixfold reduction in cost. Using the GBS approach, 63 cultivars of perennial, Italian and interspecific hybrid ryegrasses, as well as intergeneric Festulolium hybrids, were genotyped. The genetic relationships between cultivars were interpreted in terms of known breeding histories and indistinct species boundaries within the Lolium genus, as well as suitability of current cultivar registration methodologies. An example of applicability to quality assurance and control (QA/QC) of seed purity is also described. Rapid, low-cost genotypic assays provide new opportunities for breeders to more fully explore genetic diversity within breeding programs, allowing the combination of novel unique genetic backgrounds. Such tools also offer the potential to more accurately define cultivar identities, allowing protection of varieties in the commercial market and supporting processes of cultivar accreditation and quality assurance.

  7. Breeding for Grass Seed Yield

    DEFF Research Database (Denmark)

    Boelt, Birte; Studer, Bruno


    Seed yield is a trait of major interest for many fodder and amenity grass species and has received increasing attention since seed multiplication is economically relevant for novel grass cultivars to compete in the commercial market. Although seed yield is a complex trait and affected...... by agricultural practices as well as environmental factors, traits related to seed production reveal considerable genetic variation, prerequisite for improvement by direct or indirect selection. This chapter first reports on the biological and physiological basics of the grass reproduction system, then highlights...... important aspects and components affecting the seed yield potential and the agronomic and environmental aspects affecting the utilization and realization of the seed yield potential. Finally, it discusses the potential of plant breeding to sustainably improve total seed yield in fodder and amenity grasses....

  8. Variation in important pasture grasses: I. Morphological and ...

    African Journals Online (AJOL)

    Variation in important pasture grasses: I. Morphological and geographical variation. ... Seven species are important pasture grasses throughout the western Transvaal, Orange Free State, northern Cape and Natal. ... Language: English.

  9. Soil Microorganisms Alleviate the Allelochemical Effects of a Thyme Monoterpene on the Performance of an Associated Grass Species


    Ehlers, Bodil K.


    Background Plant allelochemicals released into the soil can significantly impact the performance of associated plant species thereby affecting their competitive ability. Soil microbes can potentially affect the interaction between plant and plant chemicals by degrading the allelochemicals. However, most often plant-plant chemical interactions are studied using filter paper bioassays examining the pair-wise interaction between a plant and a plant chemical, not taking into account the potential...

  10. Holocene re-colonisation, central-marginal distribution and habitat specialisation shape population genetic patterns within an Atlantic European grass species. (United States)

    Harter, D E V; Jentsch, A; Durka, W


    Corynephorus canescens (L.) P.Beauv. is an outbreeding, short-lived and wind-dispersed grass species, highly specialised on scattered and disturbance-dependent habitats of open sandy sites. Its distribution ranges from the Iberian Peninsula over Atlantic regions of Western and Central Europe, but excludes the two other classical European glacial refuge regions on the Apennine and Balkan Peninsulas. To investigate genetic patterns of this uncommon combination of ecological and biogeographic species characteristics, we analysed AFLP variation among 49 populations throughout the European distribution range, expecting (i) patterns of SW European glacial refugia and post-glacial expansion to the NE; (ii) decreasing genetic diversity from central to marginal populations; and (iii) interacting effects of high gene flow and disturbance-driven genetic drift. Decreasing genetic diversity from SW to NE and distinct gene pool clustering imply refugia on the Iberian Peninsula and in western France, from where range expansion originated towards the NE. High genetic diversity within and moderate genetic differentiation among populations, and a significant pattern of isolation-by-distance indicate a gene flow drift equilibrium within C. canescens, probably due to its restriction to scattered and dynamic habitats and limited dispersal distances. These features, as well as the re-colonisation history, were found to affect genetic diversity gradients from central to marginal populations. Our study emphasises the need for including the specific ecology into analyses of species (re-)colonisation histories and range centre-margin analyses. To account for discontinuous distributions, new indices of marginality were tested for their suitability in studies of centre-periphery gradients. © 2014 German Botanical Society and The Royal Botanical Society of the Netherlands.

  11. Effect of nitrogen fertilization, grass species and cultivar on sod production on Valkeasuo peat bog - a case study

    Directory of Open Access Journals (Sweden)

    Perttu Virkajärvi


    Full Text Available As part of a research project concerning the agricultural utilization of cut-away peat bogs, a sod production experiment was conducted at Valkeasuo, Tohmajärvi, in 1990-1993. The aim of the experiment was to study the effect of nitrogen and choice of cultivar on sod production and sod quality on peat bogs. The N fertilization rates were 50, 100 and 150kg ha-1. The Poa pratensis cultivars were ‘Conni’, ‘Cynthia’, ‘Haga’ and ‘Julia’, the Festuca rubra cultivars were ‘Center’, ‘Juliska’, ‘Koket’ and ‘Näpsä’ and the Agrostis capillaris cultivar was ‘Rasti’. Two mixtures of P. pratensis/F. rubra and one of A. capillaris/F. rubra imitated commercial sod products. Increasing of N fertilization from 50 kg up to 150 kg ha-1 a had positive effect on general the quality of sod as well as on the green cover before and after transplanting. It increased the thatch formation. The positive effect of N on the number of tillers and green cover in the year following transplanting was dependent on the species and the cultivar. Species and cultivar affected all measured variables excluding thatch formation. Generally, the P. pratensis cultivars tested suited better for sod production than cultivars of F. rubra, but there were clear differences between cultivars within species as well. Although the soil was infertile, the contents of Ca, K, Mg, P, Cu, Fe, Mn, Mo and Zn in the herbage samples were within normal range. The botanical purity was high, which supports the hypothesis that the absence of seed bank of weeds on peat bogs immediately after harvesting the peat can be utilized.

  12. The effects of recombination, mutation and selection on the evolution of the Rp1 resistance genes in grasses. (United States)

    Jouet, Agathe; McMullan, Mark; van Oosterhout, Cock


    Plant immune genes, or resistance genes, are involved in a co-evolutionary arms race with a diverse range of pathogens. In agronomically important grasses, such R genes have been extensively studied because of their role in pathogen resistance and in the breeding of resistant cultivars. In this study, we evaluate the importance of recombination, mutation and selection on the evolution of the R gene complex Rp1 of Sorghum, Triticum, Brachypodium, Oryza and Zea. Analyses show that recombination is widespread, and we detected 73 independent instances of sequence exchange, involving on average 1567 of 4692 nucleotides analysed (33.4%). We were able to date 24 interspecific recombination events and found that four occurred postspeciation, which suggests that genetic introgression took place between different grass species. Other interspecific events seemed to have been maintained over long evolutionary time, suggesting the presence of balancing selection. Significant positive selection (i.e. a relative excess of nonsynonymous substitutions (dN /dS >1)) was detected in 17-95 codons (0.42-2.02%). Recombination was significantly associated with areas with high levels of polymorphism but not with an elevated dN /dS ratio. Finally, phylogenetic analyses show that recombination results in a general overestimation of the divergence time (mean = 14.3%) and an alteration of the gene tree topology if the tree is not calibrated. Given that the statistical power to detect recombination is determined by the level of polymorphism of the amplicon as well as the number of sequences analysed, it is likely that many studies have underestimated the importance of recombination relative to the mutation rate. © 2015 John Wiley & Sons Ltd.

  13. Biosurfactant-producing microorganism Pseudomonas sp. SB assists the phytoremediation of DDT-contaminated soil by two grass species. (United States)

    Wang, Beibei; Wang, Qingling; Liu, Wuxing; Liu, Xiaoyan; Hou, Jinyu; Teng, Ying; Luo, Yongming; Christie, Peter


    Phytoremediation together with microorganisms may confer the advantages of both phytoremediation and microbial remediation of soils containing organic contaminants. In this system biosurfactants produced by Pseudomonas sp. SB may effectively help to increase the bioavailability of organic pollutants and thereby enhance their microbial degradation in soil. Plants may enhance the rhizosphere environment for microorganisms and thus promote the bioremediation of contaminants. In the present pot experiment study, dichlorodiphenyltrichloroethane (DDT) residues underwent an apparent decline after soil bioremediation compared with the original soil. The removal efficiency of fertilizer + tall fescue, fertilizer + tall fescue + Pseudomonas, fertilizer + perennial ryegrass, and fertilizer + perennial ryegrass + Pseudomonas treatments were 59.4, 65.6, 69.0, and 65.9%, respectively, and were generally higher than that in the fertilizer control (40.3%). Principal coordinates analysis (PCoA) verifies that plant species greatly affected the soil bacterial community irrespective of inoculation with Pseudomonas sp. SB. Furthermore, community composition analysis shows that Proteobacteria, Acidobacteria and Actinobacteria were the three dominant phyla in all groups. In particular, the relative abundance of Pseudomonas for fertilizer + tall fescue + Pseudomonas (0.25%) was significantly greater than fertilizer + tall fescue and this was related to the DDT removal efficiency. Copyright © 2017 Elsevier Ltd. All rights reserved.

  14. SQ grass sublingual allergy immunotherapy tablet for disease-modifying treatment of grass pollen allergic rhinoconjunctivitis

    DEFF Research Database (Denmark)

    Dahl, Ronald; Roberts, Graham; de Blic, Jacques


    BACKGROUND: Allergy immunotherapy is a treatment option for allergic rhinoconjunctivitis (ARC). It is unique compared with pharmacotherapy in that it modifies the immunologic pathways that elicit an allergic response. The SQ Timothy grass sublingual immunotherapy (SLIT) tablet is approved in North...... America and throughout Europe for the treatment of adults and children (≥5 years old) with grass pollen-induced ARC. OBJECTIVE: The clinical evidence for the use of SQ grass SLIT-tablet as a disease-modifying treatment for grass pollen ARC is discussed in this review. METHODS: The review included...... the suitability of SQ grass SLIT-tablet for patients with clinically relevant symptoms to multiple Pooideae grass species, single-season efficacy, safety, adherence, coseasonal initiation, and cost-effectiveness. The data from the long-term SQ grass SLIT-tablet clinical trial that evaluated a clinical effect 2...

  15. Interspecific and intraspecific hybrid Epichloë species symbiotic with the North American native grass Poa alsodes. (United States)

    Shymanovich, Tatsiana; Charlton, Nikki D; Musso, Ashleigh M; Scheerer, Jonathan; Cech, Nadja B; Faeth, Stanley H; Young, Carolyn A


    The endophyte presence and diversity in natural populations of Poa alsodes were evaluated along a latitudinal transect from the southern distribution range in North Carolina to New York. Two distinct Epichloë hybrid taxa were identified from 23 populations. Each taxon could easily be distinguished by polymerase chain reaction (PCR) genotyping with primers designed to mating type genes and alkaloid biosynthesis genes that encode key pathway steps for ergot alkaloids, indole-diterpenes, lolines, and peramine. The most commonly found Epichloë taxon, Poa alsodes Taxonomic Group-1 (PalTG-1), was detected in 22 populations at high infection frequencies (72-100%), with the exception of one population at high elevation (26% infection). The second taxon, PalTG-2, was observed only in five populations in Pennsylvania constituting 12% of infected samples. Phylogenetic analyses placed PalTG-1 as an interspecific hybrid of E. amarillans and E. typhina subsp. poae ancestors, and it is considered a new hybrid species, which the authors name Epichloë alsodes. PalTG-2 is an intraspecific hybrid of two E. typhina subsp. poae ancestors, similar to E. schardlii from the host Cinna arundinacea, which the authors propose as a new variety, Epichloë schardlii var. pennsylvanica. Epichloë alsodes isolates were all mating type MTA MTB and tested positive for dmaW, easC, perA, and some LOL genes, but only the alkaloid N-acetylnorloline was detected in E. alsodes-infected plant material. Epichloë schardlii var. pennsylvanica isolates were all mating type MTB MTB and tested positive for perA, but peramine was not produced. Both E. alsodes and E. schardlii var. pennsylvanica appeared to have complete perA genes, but point mutations were identified in E. alsodes that would render the encoded perA gene nonfunctional.

  16. The deposition and characterization of starch in Brachypodium distachyon

    DEFF Research Database (Denmark)

    Tanackovic, Vanja; Svensson, Jan T.; Jensen, Susanne Langgård


    doughnut shaped and bimodally distributed into distinct small B-type (2.5-10 µm) and very small C-type (0.5-2.5 µm) granules. Large A-type granules, typical of cereals, were absent. Starch-bound phosphate, important for starch degradation, was 2-fold lower in Brachypodium compared with barley indicating...... different requirements for starch mobilization. The amylopectin branch profiles were similar and the amylose content was only slightly higher compared with barley cv. Golden Promise. The crystallinity of Brachypodium starch granules was low (10%) compared to barley (20%) as determined by wide-angle X......-ray scattering (WAXS) and molecular disorder was confirmed by differential scanning calorimetry (DSC). The expression profiles in grain for most genes were distinctly different for Brachypodium compared to barley, typically showing earlier decline during the course of development, which can explain the low...

  17. Names of Southern African grasses: Name changes and additional ...

    African Journals Online (AJOL)

    The main reasons for changes in botanical names are briefly reviewed, with examples from the lists. At this time, about 1040 grass species and subspecific taxa are recognized in the subcontinent. Keywords: botanical research; botanical research institute; botany; grass; grasses; identification; name change; nomenclature; ...

  18. Response of dominant grass and shrub species to water manipulation: an ecophysiological basis for shrub invasion in a Chihuahuan Desert grassland. (United States)

    Throop, Heather L; Reichmann, Lara G; Sala, Osvaldo E; Archer, Steven R


    Increases in woody vegetation and declines in grasses in arid and semi-arid ecosystems have occurred globally since the 1800s, but the mechanisms driving this major land-cover change remain uncertain and controversial. Working in a shrub-encroached grassland in the northern Chihuahuan Desert where grasses and shrubs typically differ in leaf-level nitrogen allocation, photosynthetic pathway, and root distribution, we asked if differences in leaf-level ecophysiology could help explain shrub proliferation. We predicted that the relative performance of grasses and shrubs would vary with soil moisture due to the different morphological and physiological characteristics of the two life-forms. In a 2-year experiment with ambient, reduced, and enhanced precipitation during the monsoon season, respectively, the encroaching C(3) shrub (honey mesquite Prosopis glandulosa) consistently and substantially outperformed the historically dominant C(4) grass (black grama Bouteloua eriopoda) in terms of photosynthetic rates while also maintaining a more favorable leaf water status. These differences persisted across a wide range of soil moisture conditions, across which mesquite photosynthesis was decoupled from leaf water status and moisture in the upper 50 cm of the soil profile. Mesquite's ability to maintain physiologically active leaves for a greater fraction of the growing season than black grama potentially amplifies and extends the importance of physiological differences. These physiological and phenological differences may help account for grass displacement by shrubs in drylands. Furthermore, the greater sensitivity of the grass to low soil moisture suggests that grasslands may be increasingly susceptible to shrub encroachment in the face of the predicted increases in drought intensity and frequency in the desert of the southwestern USA.

  19. Development of innovative technique that may be used as models for the increase of biomass production with grasses and other species (United States)

    Burton, G. W.; Hanna, W. W.


    Techniques for biomass increase are discussed: irradiation breeding of sterile triploid turf bermuda grasses; irradiation breeding of sterile Coastcross-1, a forage grass hybrid to increase winter hardiness; heterosis resulting from crossing specific irradiation induced mutants with their normal inbred parent; use of mitomycin and streptomycin to create cytoplasmic male sterile mutants in pearl millet; biomass of napiergrass; evaluation of mutagen induced lignin mutants to maximize metabolizable energy in sorghum; interspecific crosses in Pennisetum; production of homozygous translocation tester stocks; use of radiation to induce and transfer reproductive behavior in plants; and genetics of radiation induced mutations.

  20. Checklist of Serengeti Ecosystem Grasses (United States)

    Ficinski, Paweł; Vorontsova, Maria


    Abstract We present the first taxonomic checklist of the Poaceae species of the Serengeti, Tanzania. A review of the literature and herbarium specimens recorded 200 species of grasses, in line with similar studies in other parts of East Africa. The checklist is supported by a total of 939 herbarium collections. Full georeferenced collection data is made available alongside a summary checklist in pdf format. More than a quarter of the species are known from a single collection highlighting the need for further research, especially concerning the rare species and their distribution. PMID:27226761

  1. Checklist of Serengeti Ecosystem Grasses. (United States)

    Williams, Emma Victoria; Elia Ntandu, John; Ficinski, Paweł; Vorontsova, Maria


    We present the first taxonomic checklist of the Poaceae species of the Serengeti, Tanzania. A review of the literature and herbarium specimens recorded 200 species of grasses, in line with similar studies in other parts of East Africa. The checklist is supported by a total of 939 herbarium collections. Full georeferenced collection data is made available alongside a summary checklist in pdf format. More than a quarter of the species are known from a single collection highlighting the need for further research, especially concerning the rare species and their distribution.

  2. Molecular Physiology of Root System Architecture in Model Grasses (United States)

    Hixson, K.; Ahkami, A. H.; Anderton, C.; Veličković, D.; Myers, G. L.; Chrisler, W.; Lindenmaier, R.; Fang, Y.; Yabusaki, S.; Rosnow, J. J.; Farris, Y.; Khan, N. E.; Bernstein, H. C.; Jansson, C.


    Unraveling the molecular and physiological mechanisms involved in responses of Root System Architecture (RSA) to abiotic stresses and shifts in microbiome structure is critical to understand and engineer plant-microbe-soil interactions in the rhizosphere. In this study, accessions of Brachypodium distachyon Bd21 (C3 model grass) and Setaria viridis A10.1 (C4 model grass) were grown in phytotron chambers under current and elevated CO2 levels. Detailed growth stage-based phenotypic analysis revealed different above- and below-ground morphological and physiological responses in C3 and C4 grasses to enhanced CO2 levels. Based on our preliminary results and by screening values of total biomass, water use efficiency, root to shoot ratio, RSA parameters and net assimilation rates, we postulated a three-phase physiological mechanism, i.e. RootPlus, BiomassPlus and YieldPlus phases, for grass growth under elevated CO2 conditions. Moreover, this comprehensive set of morphological and process-based observations are currently in use to develop, test, and calibrate biophysical whole-plant models and in particular to simulate leaf-level photosynthesis at various developmental stages of C3 and C4 using the model BioCro. To further link the observed phenotypic traits at the organismal level to tissue and molecular levels, and to spatially resolve the origin and fate of key metabolites involved in primary carbohydrate metabolism in different root sections, we complement root phenotypic observations with spatial metabolomics data using mass spectrometry imaging (MSI) methods. Focusing on plant-microbe interactions in the rhizosphere, six bacterial strains with plant growth promoting features are currently in use in both gel-based and soil systems to screen root growth and development in Brachypodium. Using confocal microscopy, GFP-tagged bacterial systems are utilized to study the initiation of different root types of RSA, including primary root (PR), coleoptile node axile root (CNR

  3. The effects of seed ingestion by livestock, dung fertilization, trampling, grass competition and fire on seedling establishment of two woody plant species

    CSIR Research Space (South Africa)

    Tjelele, J


    Full Text Available the objectives of an agricultural enterprise. The objectives of this study were to determine the effects of gut passage (goats, cattle), dung (nutrients), fire, grass competition and trampling on establishment of A. nilotica and D. cinerea seedlings. Germination...

  4. Use of Agrobacterium rhizogenes strain 18r12v and paromomycin selection for transformation of Brachypodium distachyon and Brachypodium sylvaticum (United States)

    The genetic transformation of monocot grasses is a resource intensive process, the quality and efficiency of which is dependent in part upon the method of DNA introduction, as well as the ability to effectively separate transformed from wildtype tissue. Agrobacterium-mediated transformation of Brac...

  5. Toward Genomics-Based Breeding in C3 Cool-Season Perennial Grasses (United States)

    Talukder, Shyamal K.; Saha, Malay C.


    Most important food and feed crops in the world belong to the C3 grass family. The future of food security is highly reliant on achieving genetic gains of those grasses. Conventional breeding methods have already reached a plateau for improving major crops. Genomics tools and resources have opened an avenue to explore genome-wide variability and make use of the variation for enhancing genetic gains in breeding programs. Major C3 annual cereal breeding programs are well equipped with genomic tools; however, genomic research of C3 cool-season perennial grasses is lagging behind. In this review, we discuss the currently available genomics tools and approaches useful for C3 cool-season perennial grass breeding. Along with a general review, we emphasize the discussion focusing on forage grasses that were considered orphan and have little or no genetic information available. Transcriptome sequencing and genotype-by-sequencing technology for genome-wide marker detection using next-generation sequencing (NGS) are very promising as genomics tools. Most C3 cool-season perennial grass members have no prior genetic information; thus NGS technology will enhance collinear study with other C3 model grasses like Brachypodium and rice. Transcriptomics data can be used for identification of functional genes and molecular markers, i.e., polymorphism markers and simple sequence repeats (SSRs). Genome-wide association study with NGS-based markers will facilitate marker identification for marker-assisted selection. With limited genetic information, genomic selection holds great promise to breeders for attaining maximum genetic gain of the cool-season C3 perennial grasses. Application of all these tools can ensure better genetic gains, reduce length of selection cycles, and facilitate cultivar development to meet the future demand for food and fodder. PMID:28798766

  6. Toward Genomics-Based Breeding in C3 Cool-Season Perennial Grasses

    Directory of Open Access Journals (Sweden)

    Shyamal K. Talukder


    Full Text Available Most important food and feed crops in the world belong to the C3 grass family. The future of food security is highly reliant on achieving genetic gains of those grasses. Conventional breeding methods have already reached a plateau for improving major crops. Genomics tools and resources have opened an avenue to explore genome-wide variability and make use of the variation for enhancing genetic gains in breeding programs. Major C3 annual cereal breeding programs are well equipped with genomic tools; however, genomic research of C3 cool-season perennial grasses is lagging behind. In this review, we discuss the currently available genomics tools and approaches useful for C3 cool-season perennial grass breeding. Along with a general review, we emphasize the discussion focusing on forage grasses that were considered orphan and have little or no genetic information available. Transcriptome sequencing and genotype-by-sequencing technology for genome-wide marker detection using next-generation sequencing (NGS are very promising as genomics tools. Most C3 cool-season perennial grass members have no prior genetic information; thus NGS technology will enhance collinear study with other C3 model grasses like Brachypodium and rice. Transcriptomics data can be used for identification of functional genes and molecular markers, i.e., polymorphism markers and simple sequence repeats (SSRs. Genome-wide association study with NGS-based markers will facilitate marker identification for marker-assisted selection. With limited genetic information, genomic selection holds great promise to breeders for attaining maximum genetic gain of the cool-season C3 perennial grasses. Application of all these tools can ensure better genetic gains, reduce length of selection cycles, and facilitate cultivar development to meet the future demand for food and fodder.

  7. Grasses as invasive plants in South Africa revisited: Patterns, pathways and management

    Directory of Open Access Journals (Sweden)

    Vernon Visser


    Full Text Available Background: In many countries around the world, the most damaging invasive plant species are grasses. However, the status of grass invasions in South Africa has not been documented recently. Objectives: To update Sue Milton’s 2004 review of grasses as invasive alien plants in South Africa, provide the first detailed species level inventory of alien grasses in South Africa and assess the invasion dynamics and management of the group. Method: We compiled the most comprehensive inventory of alien grasses in South Africa to date using recorded occurrences of alien grasses in the country from various literature and database sources. Using historical literature, we reviewed past efforts to introduce alien grasses into South Africa. We sourced information on the origins, uses, distributions and minimum residence times to investigate pathways and patterns of spatial extent. We identified alien grasses in South Africa that are having environmental and economic impacts and determined whether management options have been identified, and legislation created, for these species. Results: There are at least 256 alien grass species in the country, 37 of which have become invasive. Alien grass species richness increased most dramatically from the late 1800s to about 1940. Alien grass species that are not naturalised or invasive have much shorter residence times than those that have naturalised or become invasive. Most grasses were probably introduced for forage purposes, and a large number of alien grass species were trialled at pasture research stations. A large number of alien grass species in South Africa are of Eurasian origin, although more recent introductions include species from elsewhere in Africa and from Australasia. Alien grasses are most prevalent in the south-west of the country, and the Fynbos Biome has the most alien grasses and the most widespread species. We identified 11 species that have recorded environmental and economic impacts in the

  8. Seasonal variation of soluble carbohydrates and starch in Echinolaena inflexa, a native grass species from the Brazilian savanna, and in the invasive grass Melinis minutiflora Variações sazonais de carboidratos solúveis e amido em Echinolaena inflexa, uma espécie nativa do cerrado, e na gramínea invasora Melinis minutiflora

    Directory of Open Access Journals (Sweden)

    A. Souza


    Full Text Available Echinolaena inflexa (Poir. Chase is an abundant C3 grass species with high biomass production in the Brazilian savanna (cerrado; Melinis minutiflora Beauv. is an African C4 forage grass widespread in cerrado and probably displacing some native herbaceous species. In the present work, we analysed seasonally the content and composition of soluble carbohydrates, the starch amounts and the above-ground biomass (phytomass of E. inflexa and M. minutiflora plants harvested in two transects at 5 and 130 m from the border in a restrict area of cerrado at the Biological Reserve and Experimental Station of Mogi-Guaçu (SP, Brazil. Results showed that water soluble carbohydrates and starch amounts from the shoots of both species varied according to the time of the year, whilst in the underground organs, variations were observed mainly in relation to the transects. Marked differences in the pattern of the above-ground biomass production between these two grasses relative to their location in the Reserve were also observed, with two peaks of the invasive species (July and January at the Reserve border. The differences in carbohydrate accumulation, partitioning and composition of individual sugars concerning time of the year and location in the Reserve were more related to the annual growth cycle of both grasses and possibly to specific physiological responses of M. minutiflora to disturbed environments in the Reserve border.Echinolaena inflexa (Poir. Chase é uma gramínea C3 muito abundante em áreas de cerrado e com alta produção de biomassa. Melinis minutiflora Beauv. é uma gramínea C4 de origem africana introduzida no Brasil para fins forrageiros, que se espalhou amplamente por áreas de cerrado, provavelmente deslocando espécies nativas. No presente trabalho, o conteúdo e a composição de carboidratos solúveis, o teor de amido e a biomassa aérea foram analisados sazonalmente em plantas de E. inflexa e M. minutiflora coletadas em dois transectos

  9. Genetics and physiology of cell wall polysaccharides in the model C4 grass, Setaria viridis spp. (United States)

    Ermawar, Riksfardini A; Collins, Helen M; Byrt, Caitlin S; Henderson, Marilyn; O'Donovan, Lisa A; Shirley, Neil J; Schwerdt, Julian G; Lahnstein, Jelle; Fincher, Geoffrey B; Burton, Rachel A


    Setaria viridis has emerged as a model species for the larger C4 grasses. Here the cellulose synthase (CesA) superfamily has been defined, with an emphasis on the amounts and distribution of (1,3;1,4)-β-glucan, a cell wall polysaccharide that is characteristic of the grasses and is of considerable value for human health. Orthologous relationship of the CesA and Poales-specific cellulose synthase-like (Csl) genes among Setaria italica (Si), Sorghum bicolor (Sb), Oryza sativa (Os), Brachypodium distachyon (Bradi) and Hordeum vulgare (Hv) were compared using bioinformatics analysis. Transcription profiling of Csl gene families, which are involved in (1,3;1,4)-β-glucan synthesis, was performed using real-time quantitative PCR (Q-PCR). The amount of (1,3;1,4)-β-glucan was measured using a modified Megazyme assay. The fine structures of the (1,3;1,4)-β-glucan, as denoted by the ratio of cellotriosyl to cellotetraosyl residues (DP3:DP4 ratio) was assessed by chromatography (HPLC and HPAEC-PAD). The distribution and deposition of the MLG was examined using the specific antibody BG-1 and captured using fluorescence and transmission electron microscopy (TEM). The cellulose synthase gene superfamily contains 13 CesA and 35 Csl genes in Setaria. Transcript profiling of CslF, CslH and CslJ gene families across a vegetative tissue series indicated that SvCslF6 transcripts were the most abundant relative to all other Csl transcripts. The amounts of (1,3;1,4)-β-glucan in Setaria vegetative tissues ranged from 0.2% to 2.9% w/w with much smaller amounts in developing grain (0.003% to 0.013% w/w). In general, the amount of (1,3;1,4)-β-glucan was greater in younger than in older tissues. The DP3:DP4 ratios varied between tissue types and across developmental stages, and ranged from 2.4 to 3.0:1. The DP3:DP4 ratios in developing grain ranged from 2.5 to 2.8:1. Micrographs revealing the distribution of (1,3;1,4)-β-glucan in walls of different cell types and the data were

  10. resistance of napier grass clones to napier grass stunt disease

    African Journals Online (AJOL)


    Napier grass (Pennisetum purpureum Schumach) is the major livestock fodder under intensive and semi-intensive systems in East Africa. However, the productivity of the grass is constrained by Napier grass Stunt Disease. (NSD). The purpose of this study was to identify Napier grass clones with resistance to NSD.

  11. Resistance of Napier grass clones to Napier grass Stunt Disease ...

    African Journals Online (AJOL)

    Napier grass (Pennisetum purpureum Schumach) is the major livestock fodder under intensive and semi-intensive systems in East Africa. However, the productivity of the grass is constrained by Napier grass Stunt Disease (NSD). The purpose of this study was to identify Napier grass clones with resistance to NSD.

  12. A new species of Eimeria Schneider, 1875 from the Serra dos Órgãos National Park, Rio de Janeiro, Brazil, with notes on its endogenous development in the montane grass mouse, Akodon montensis Thomas, 1913 (Rodentia: Sigmodontinae). (United States)

    de Santana Miglionico, Marcos Tobias; Viana, Lúcio André; Barbosa, Helene Santos; Mota, Ester Maria; da Costa Neto, Sócrates Fraga; Frazão-Teixeira, Edwards; D'Andrea, Paulo Sergio


    A total of 53 specimens of the montane grass mouse, Akodon montensis Thomas, 1913 were collected in the Serra dos Órgãos National Park (SONP) in November 2014 and July 2015. The fecal material was analyzed, and a prevalence of 7.5% was recorded for a new coccidian species of the genus Eimeria Schneider, 1875, with part of its endogenous development recorded in the small intestine. The oocysts of a new coccidian species of genus Eimeria are ellipsoidal to subspherical. The wall is bi-layered, c. 1.5 μm (1.3-1.6 μm) thick, outer layer rough. Oocyst (n = 126) mean length is 25.3 μm (21.0-28.0 μm), with a width of 20.2 μm (17.0-22.0 μm) and mean length/width (L:W) ratio of 1.3 (1.2-1.4). Polar granule is present, with the oocyst residuum as a large spherical to subspherical globule. Sporocyst shape (n = 126) is ellipsoidal, with a mean length of 11.8 μm (9.3-14.4 μm), width of 7.9 μm (6.7-9.3 μm), and mean L:W ratio of 1.5 (1.4-1.7). Sporocysts with nipple-like Stieda body and sub-Stieda body are absent. A sporocyst residuum formed by several globules, usually along the sporocyst wall. This is the first record of Eimeria in the montane grass mouse from Brazil.

  13. Seed production and establishment of western Oregon native grasses (United States)

    Dale C. Darris


    It is well understood that native grasses are ecologically important and provide numerous benefits. However, unfavorable economics, low seed yields for some species, genetic issues, and a lack of experience behind the production and establishment of most western Oregon native grasses remain significant impediments for their expanded use. By necessity, adaptation of...

  14. Identification of grazed grasses using epidermal characters | R ...

    African Journals Online (AJOL)

    The use of anatomical features of the abaxial epidermis of grasses is discussed for the identification of fragments of epidermis present in samples of rumen. The reliability of this technique, and the variation of the epidermal characters in two widely distributed species of grass, is given. A "Key" to identity certain genera of ...

  15. Evaluating grasses as a long-term energy resource

    Energy Technology Data Exchange (ETDEWEB)

    Christian, D.G.; Riche, A.B.


    The work reported here is part of an ongoing project that aims to evaluate the yields of three perennial rhizomatous grasses and determine their suitability as bio-energy crops. The work began in 1993, and the grasses have been monitored continuously since that time. This report covers the period 1999/2000, and includes: the performance of plots of the energy grasses Miscanthus grass, switchgrass and reed canary grass seven years after they were planted; assessment of the yield of 15 genotypes of Miscanthus planted in 1997; monitoring all the species throughout the growing period for the presence of pests, weeds and diseases; measurement of the amount of nitrate leached from below Miscanthus grass; investigating the occurrence of lodging in switchgrass. (Author)

  16. Grass Rooting the System (United States)

    Perlman, Janice E.


    Suggests a taxonomy of the grass roots movement and gives a general descriptive over view of the 60 groups studied with respect to origin, constituency, size, funding, issues, and ideology. (Author/AM)

  17. The ITS1-5.8S rRNA gene -ITS2 sequence variability during the divergence of sweet-grass species (gen us Glyceria R. Br.

    Directory of Open Access Journals (Sweden)

    Alexander V Rodionov


    Full Text Available Comparative analysis of the sequence ITS1-5.8S rRNA gene-ITS2 of the nuclear genome of 13 species of genus Glyceria, 4 species of Melica and a species of monotypic genus Pleuropogon showed that the species of the genus Glyceria have 3 haplotypes: 1 Haplotype A was found only in species of the subgenus Glyceria section Glyceria (G. septentrionalis, G. fluitans, G. declinata, G. occidentalis, G. notata, G. borealis, G. leptostachya and in Pleuropogon sabinii; 2 Haplotype C is characteristic of the subgenus Hydropoa, section Hydropoa (G. grandis, G. х amurensis, G. triflora, G. maxima and sect. Lithuanicae (G. leptolepis; 3 Haplotype B is found in the species of the subgenus Hydropoa sections Striatae (G. elata, G. striata, G. neogaea, G. canadensis, Scolochloiformes (G. alnasteretum, G. spiculosa and G. lithuanica of sect. Lithuanicae. Species carring haplotype B are located at the base of the phylogenetic tree of the genus Glyceria and/or clustered with low bootstrap indices. On the phylogenetic trees inferred by the analysis of the sequences ITS and 5.8S rDNA both sect. Glyceria and sect. Hydropoa represented two sister monophyly branches. The species Pleuropogon sabinii belong to the branch of subgenus Glyceria as a sister monotypic branch to the branch of the sect. Glyceria.

  18. The carbon fertilization effect over a century of anthropogenic CO2 emissions: higher intracellular CO2 and more drought resistance among invasive and native grass species contrasts with increased water use efficiency for woody plants in the US Southwest. (United States)

    Drake, Brandon L; Hanson, David T; Lowrey, Timothy K; Sharp, Zachary D


    From 1890 to 2015, anthropogenic carbon dioxide emissions have increased atmospheric CO 2 concentrations from 270 to 400 mol mol -1 . The effect of increased carbon emissions on plant growth and reproduction has been the subject of study of free-air CO 2 enrichment (FACE) experiments. These experiments have found (i) an increase in internal CO 2 partial pressure (c i ) alongside acclimation of photosynthetic capacity, (ii) variable decreases in stomatal conductance, and (iii) that increases in yield do not increase commensurate with CO 2 concentrations. Our data set, which includes a 115-year-long selection of grasses collected in New Mexico since 1892, is consistent with an increased c i as a response to historical CO 2 increase in the atmosphere, with invasive species showing the largest increase. Comparison with Palmer Drought Sensitivity Index (PDSI) for New Mexico indicates a moderate correlation with Δ 13 C (r 2  = 0.32, P < 0.01) before 1950, with no correlation (r 2  = 0.00, P = 0.91) after 1950. These results indicate that increased c i may have conferred some drought resistance to these grasses through increased availability of CO 2 in the event of reduced stomatal conductance in response to short-term water shortage. Comparison with C 3 trees from arid environments (Pinus longaeva and Pinus edulis in the US Southwest) as well as from wetter environments (Bromus and Poa grasses in New Mexico) suggests differing responses based on environment; arid environments in New Mexico see increased intrinsic water use efficiency (WUE) in response to historic elevated CO 2 while wetter environments see increased c i . This study suggests that (i) the observed increases in c i in FACE experiments are consistent with historical CO 2 increases and (ii) the CO 2 increase influences plant sensitivity to water shortage, through either increased WUE or c i in arid and wet environments, respectively. © 2016 John Wiley & Sons Ltd.

  19. Genome-Wide Analysis of miRNA targets in Brachypodium and Biomass Energy Crops

    Energy Technology Data Exchange (ETDEWEB)

    Green, Pamela J. [Univ. of Delaware, Newark, DE (United States)


    MicroRNAs (miRNAs) contribute to the control of numerous biological processes through the regulation of specific target mRNAs. Although the identities of these targets are essential to elucidate miRNA function, the targets are much more difficult to identify than the small RNAs themselves. Before this work, we pioneered the genome-wide identification of the targets of Arabidopsis miRNAs using an approach called PARE (German et al., Nature Biotech. 2008; Nature Protocols, 2009). Under this project, we applied PARE to Brachypodium distachyon (Brachypodium), a model plant in the Poaceae family, which includes the major food grain and bioenergy crops. Through in-depth global analysis and examination of specific examples, this research greatly expanded our knowledge of miRNAs and target RNAs of Brachypodium. New regulation in response to environmental stress or tissue type was found, and many new miRNAs were discovered. More than 260 targets of new and known miRNAs with PARE sequences at the precise sites of miRNA-guided cleavage were identified and characterized. Combining PARE data with the small RNA data also identified the miRNAs responsible for initiating approximately 500 phased loci, including one of the novel miRNAs. PARE analysis also revealed that differentially expressed miRNAs in the same family guide specific target RNA cleavage in a correspondingly tissue-preferential manner. The project included generation of small RNA and PARE resources for bioenergy crops, to facilitate ongoing discovery of conserved miRNA-target RNA regulation. By associating specific miRNA-target RNA pairs with known physiological functions, the research provides insights about gene regulation in different tissues and in response to environmental stress. This, and release of new PARE and small RNA data sets should contribute basic knowledge to enhance breeding and may suggest new strategies for improvement of biomass energy crops.

  20. Controlling grass weeds on hard surfaces

    DEFF Research Database (Denmark)

    Rask, Anne Merete; Kristoffersen, Palle; Andreasen, Christian


    An experiment was conducted on a specially designed hard surface to study the impact of time interval between flaming treatments on the regrowth and flower production of two grass weeds. The goal of this experiment was to optimize the control of annual bluegrass and perennial ryegrass, both species...... that are very difficult to control without herbicides. Aboveground biomass from 72 plants per treatment was harvested and dry weights were recorded at regular intervals to investigate how the plants responded to flaming. Regrowth of the grasses was measured by harvesting aboveground biomass 2 wk after......, as they did not increase the reduction of aboveground biomass compared with the 7-d treatment interval. Knowledge on the regrowth of grass weeds after flaming treatments provided by this study can help improve recommendations given to road keepers and park managers for management on these weeds. Nomenclature...

  1. Genome-wide identification of galactinol synthase (GolS) genes in Solanum lycopersicum and Brachypodium distachyon. (United States)

    Filiz, Ertugrul; Ozyigit, Ibrahim Ilker; Vatansever, Recep


    GolS genes stand as potential candidate genes for molecular breeding and/or engineering programs in order for improving abiotic stress tolerance in plant species. In this study, a total of six galactinol synthase (GolS) genes/proteins were retrieved for Solanum lycopersicum and Brachypodium distachyon. GolS protein sequences were identified to include glyco_transf_8 (PF01501) domain structure, and to have a close molecular weight (36.40-39.59kDa) and amino acid length (318-347 aa) with a slightly acidic pI (5.35-6.40). The sub-cellular location was mainly predicted as cytoplasmic. S. lycopersicum genes located on chr 1 and 2, and included one segmental duplication while genes of B. distachyon were only on chr 1 with one tandem duplication. GolS sequences were found to have well conserved motif structures. Cis-acting analysis was performed for three abiotic stress responsive elements, including ABA responsive element (ABRE), dehydration and cold responsive elements (DRE/CRT) and low-temperature responsive element (LTRE). ABRE elements were found in all GolS genes, except for SlGolS4; DRE/CRT was not detected in any GolS genes and LTRE element found in SlGolS1 and BdGolS1 genes. AU analysis in UTR and ORF regions indicated that SlGolS and BdGolS mRNAs may have a short half-life. SlGolS3 and SlGolS4 genes may generate more stable transcripts since they included AATTAAA motif for polyadenylation signal POLASIG2. Seconder structures of SlGolS proteins were well conserved than that of BdGolS. Some structural divergences were detected in 3D structures and predicted binding sites exhibited various patterns in GolS proteins. Copyright © 2015 Elsevier Ltd. All rights reserved.

  2. Brassinosteroid Mediated Cell Wall Remodeling in Grasses under Abiotic Stress

    Directory of Open Access Journals (Sweden)

    Xiaolan Rao


    Full Text Available Unlike animals, plants, being sessile, cannot escape from exposure to severe abiotic stresses such as extreme temperature and water deficit. The dynamic structure of plant cell wall enables them to undergo compensatory changes, as well as maintain physical strength, with changing environments. Plant hormones known as brassinosteroids (BRs play a key role in determining cell wall expansion during stress responses. Cell wall deposition differs between grasses (Poaceae and dicots. Grass species include many important food, fiber, and biofuel crops. In this article, we focus on recent advances in BR-regulated cell wall biosynthesis and remodeling in response to stresses, comparing our understanding of the mechanisms in grass species with those in the more studied dicots. A more comprehensive understanding of BR-mediated changes in cell wall integrity in grass species will benefit the development of genetic tools to improve crop productivity, fiber quality and plant biomass recalcitrance.

  3. GUI development for GRASS GIS

    Directory of Open Access Journals (Sweden)

    Martin Landa


    Full Text Available This article discusses GUI development for GRASS GIS. Sophisticated native GUI for GRASS is one of the key points (besides the new 2D/3D raster library, vector architecture improvements, etc. for the future development of GRASS. In 2006 the GRASS development team decided to start working on the new generation of GUI instead of improving the current GUI based on Tcl/Tk.

  4. A new species of Stenodiplosis (Diptera: Cecidomyiidae) on Spartina grasses (Poaceae) with notes on its biology and its parasitoid Tetrastichus bromi (Hymenoptera: Eulophidae). (United States)

    López, J Manuel Perilla; Johnson, Paul J; Gagné, Raymond J; Boe, Arvid


    Stenodiplosis spartinae Gagné new species (Diptera: Cecidomyiidae) is described from eastern South Dakota and coastal North Carolina, and compared with other American congeners. The known host plants are Spartina alterniflora and S. pectinata. The larva is a seed predator of the ovule and immature caryopsis of the host plant. Adult activity is from the early emergence of the host inflorescence through anthesis. Oviposition occurs in the floret with eggs laid under the edges of the palea and lemma. The larva apparently overwinters in dehisced spikelets in the soil among rhizomes of S. pectinata, with pupation in late spring. Laboratory emergence and field activity of the adults suggest a potentialsecond or third generation developing on late emerging inflorescences. Larval feeding does not induce external color or shape changes in the spikelet. Apparently all three instars are ectoparasitized by Tetrastichus bromi Kostyukov (Hymenoptera: Eulophidae) that was probably introduced to North America in the late 1800's and is inculcated into parasitoid guilds of several Stenodiplosis species. Resource partitioning appears to occur between the gall midge and early instars of Aethes spartinana Barnes and McDunnough (Lepidoptera: Tortricidae) that feed on maturing caryopses. The feeding of this gall midge and the moth probably account for most of the reduced seed production in both natural and agronomic populations of S. pectinata.

  5. Establishing native warm season grasses on Eastern Kentucky strip mines

    Energy Technology Data Exchange (ETDEWEB)

    Barnes, T.G.; Larkin, J.L.; Arnett, M.B. [Univ. of Kentucky, Lexington, KY (United States). Dept. of Forestry


    The authors evaluated various methods of establishing native warm season grasses on two reclaimed Eastern Kentucky mines from 1994--1997. Most current reclamation practices incorporate the use of tall fescue (Festuca arundinacea) and other cool-season grasses/legumes that provide little wildlife habitats. The use of native warm season grasses will likely improve wildlife habitat on reclaimed strip mines. Objectives of this study were to compare the feasibility of establishing these grasses during fall, winter, or spring using a native rangeland seeder or hydroseeding; a fertilizer application at planting; or cold-moist stratification prior to hydroseeding. Vegetative cover, bare ground, species richness, and biomass samples were collected at the end of each growing season. Native warm season grass plantings had higher plant species richness compared to cool-season reclamation mixtures. There was no difference in establishment of native warm season grasses as a result of fertilization or seeding technique. Winter native warm season grass plantings were failures and cold-moist stratification did not increase plant establishment during any season. As a result of a drought during 1997, both cool-season and warm season plantings were failures. Cool-season reclamation mixtures had significantly more vegetative cover and biomass compared to native warm season grass mixtures and the native warm season grass plantings did not meet vegetative cover requirements for bond release. Forbs and legumes that established well included pale purple coneflower (Echinacea pallida), lance-leaf coreopsis (Coreopsis lanceolata), round-headed lespedeza (Lespedeza capitata), partridge pea (Cassia fasiculata), black-eyed susan (Rudbeckia hirta), butterfly milkweed (Asclepias tuberosa), and bergamot (Monarda fistulosa). Results from two demonstration plots next to research plots indicate it is possible to establish native warm season grasses on Eastern Kentucky strip mines for wildlife habitat.

  6. Establishing native warm season grasses on Eastern Kentucky strip mines

    International Nuclear Information System (INIS)

    Barnes, T.G.; Larkin, J.L.; Arnett, M.B.


    The authors evaluated various methods of establishing native warm season grasses on two reclaimed Eastern Kentucky mines from 1994--1997. Most current reclamation practices incorporate the use of tall fescue (Festuca arundinacea) and other cool-season grasses/legumes that provide little wildlife habitats. The use of native warm season grasses will likely improve wildlife habitat on reclaimed strip mines. Objectives of this study were to compare the feasibility of establishing these grasses during fall, winter, or spring using a native rangeland seeder or hydroseeding; a fertilizer application at planting; or cold-moist stratification prior to hydroseeding. Vegetative cover, bare ground, species richness, and biomass samples were collected at the end of each growing season. Native warm season grass plantings had higher plant species richness compared to cool-season reclamation mixtures. There was no difference in establishment of native warm season grasses as a result of fertilization or seeding technique. Winter native warm season grass plantings were failures and cold-moist stratification did not increase plant establishment during any season. As a result of a drought during 1997, both cool-season and warm season plantings were failures. Cool-season reclamation mixtures had significantly more vegetative cover and biomass compared to native warm season grass mixtures and the native warm season grass plantings did not meet vegetative cover requirements for bond release. Forbs and legumes that established well included pale purple coneflower (Echinacea pallida), lance-leaf coreopsis (Coreopsis lanceolata), round-headed lespedeza (Lespedeza capitata), partridge pea (Cassia fasiculata), black-eyed susan (Rudbeckia hirta), butterfly milkweed (Asclepias tuberosa), and bergamot (Monarda fistulosa). Results from two demonstration plots next to research plots indicate it is possible to establish native warm season grasses on Eastern Kentucky strip mines for wildlife habitat

  7. Evolution of the miR5200-FLOWERING LOCUS T flowering time regulon in the temperate grass subfamily Pooideae. (United States)

    McKeown, Meghan; Schubert, Marian; Preston, Jill C; Fjellheim, Siri


    Flowering time is a carefully regulated trait controlled primarily through the action of the central genetic regulator, FLOWERING LOCUS T (FT). Recently it was demonstrated that a microRNA, miR5200, targets the end of the second exon of FT under short-day photoperiods in the grass subfamily Pooideae, thus preventing FT transcripts from reaching threshold levels under non-inductive conditions. Pooideae are an interesting group in that they rapidly diversified from the tropics into the northern temperate region during a major global cooling event spanning the Eocene-Oligocene transition. We hypothesize that miR5200 photoperiod-sensitive regulation of Pooideae flowering time networks assisted their transition into northern seasonal environments. Here, we test predictions derived from this hypothesis that miR5200, originally found in bread wheat and later identified in Brachypodium distachyon, (1) was present in the genome of the Pooideae common ancestor, (2) is transcriptionally regulated by photoperiod, and (3) is negatively correlated with FT transcript abundance, indicative of miR5200 regulating FT. Our results demonstrate that miR5200 did evolve at or around the base of Pooideae, but only acquired photoperiod-regulated transcription within the Brachypodium lineage. Based on expression profiles and previous data, we posit that the progenitor of miR5200 was co-regulated with FT by an unknown mechanism. Copyright © 2017 The Author(s). Published by Elsevier Inc. All rights reserved.

  8. Identification of the sex-determining locus in grass puffer (Takifugu niphobles) provides evidence for sex-chromosome turnover in a subset of Takifugu species (United States)

    Atsumi, Kazufumi; Kamiya, Takashi; Nozawa, Aoi; Aoki, Yuma; Tasumi, Satoshi; Koyama, Takashi; Nakamura, Osamu; Suzuki, Yuzuru


    There is increasing evidence for frequent turnover in sex chromosomes in vertebrates. Yet experimental systems suitable for tracing the detailed process of turnover are rare. In theory, homologous turnover is possible if the new sex-determining locus is established on the existing sex-chromosome. However, there is no empirical evidence for such an event. The genus Takifugu includes fugu (Takifugu rubripes) and its two closely-related species whose sex is most likely determined by a SNP at the Amhr2 locus. In these species, males are heterozygous, with G and C alleles at the SNP site, while females are homozygous for the C allele. To determine if a shift in the sex-determining locus occurred in another member of this genus, we used genetic mapping to characterize the sex-chromosome systems of Takifugu niphobles. We found that the G allele of Amhr2 is absent in T. niphobles. Nevertheless, our initial mapping suggests a linkage between the phenotypic sex and the chromosome 19, which harbors the Amhr2 locus. Subsequent high-resolution analysis using a sex-reversed fish demonstrated that the sex-determining locus maps to the proximal end of chromosome 19, far from the Amhr2 locus. Thus, it is likely that homologous turnover involving these species has occurred. The data also showed that there is a male-specific reduction of recombination around the sex-determining locus. Nevertheless, no evidence for sex-chromosome differentiation was detected: the reduced recombination depended on phenotypic sex rather than genotypic sex; no X- or Y-specific maker was obtained; the YY individual was viable. Furthermore, fine-scale mapping narrowed down the new sex-determining locus to the interval corresponding to approximately 300-kb of sequence in the fugu genome. Thus, T. niphobles is determined to have a young and small sex-determining region that is suitable for studying an early phase of sex-chromosome evolution and the mechanisms underlying turnover of sex chromosome. PMID

  9. Grass-on-grass competition along a catenal gradient in mesic ...

    African Journals Online (AJOL)

    Three aboveground treatments (full light competition, no light competition and clipping to simulate grazing), and two belowground treatments (full belowground competition and belowground competition excluded by a root tube), were used. On all soil depths the three grass species differed in mean mass, with E. racemosa ...

  10. The effects of energy grass plantations on biodiversity

    Energy Technology Data Exchange (ETDEWEB)

    Semere, T; Slater, F


    The ecological impact on local wildlife of biomass plantations of three different species of grasses has been monitored in the years 2002 to 2004 inclusive at farms in Herefordshire UK. Two of the grasses were not native to Britain. Wildlife monitored included ground flora, beetles, insects, birds, small mammals, butterflies, bees and hoverflies. The results provide a baseline of biodiversity data from biomass farms in England, although due to poor crop growth, the data from the switch-grass plantation was incomplete. The surveys were carried out by Cardiff University supported financially by the DTI.

  11. The effects of energy grass plantations on biodiversity

    International Nuclear Information System (INIS)

    Semere, T.; Slater, F.


    The ecological impact on local wildlife of biomass plantations of three different species of grasses has been monitored in the years 2002 to 2004 inclusive at farms in Herefordshire UK. Two of the grasses were not native to Britain. Wildlife monitored included ground flora, beetles, insects, birds, small mammals, butterflies, bees and hoverflies. The results provide a baseline of biodiversity data from biomass farms in England, although due to poor crop growth, the data from the switch-grass plantation was incomplete. The surveys were carried out by Cardiff University supported financially by the DTI


    Directory of Open Access Journals (Sweden)

    Janaina Ribeiro Costa


    Full Text Available

    The objective of this study was to analyze the behavior of sixteen tree legume species introduced in tropical grass pastures, without seedling protection and in the presence of animals, in three municipalities of Rio de Janeiro State, Brazil. A multivariate factor analysis method was used with sixteen variables related to seven experimental units in the municipalities and ten variables related to leguminous species. The first rotative factor (F1, which explained the highest percentage of the observed variance (62.7%, showed that the Fazenda Santo Antônio experimental unit, in the Itatiaia municipality, presented the highest values for Ca+Mg, N, and Mg, and the lowest value for P (soil sample collected at the beginning of experimental period, while the opposite was observed for Sipa I unit, in the Seropédica municipality. The F1 factor also showed that the species Jurema branca (Mimosa artemisiana and Jurema preta (Mimosa tenuiflora presented the highest values for diameter growth rate of stem and crown, and the lowest percentage of pastured seedlings, while Leucena (Leucaena leucocephala showed the inverse behavior. Results indicate that M. artemisiana and M. tenuiflora present better potential for introduction in tropical grass pastures without seedling protection and without animal exclusion.

    KEY-WORDS: Tree seedling; factor analysis; communality, mimosa; Leucaena.

    O objetivo deste trabalho foi analisar o comportamento de dezesseis espécies leguminosas arbóreas introduzidas em pastagens de gramíneas tropicais, sem proteção das mudas e na presença de animais, em três municípios do estado do Rio de Janeiro. Para isso, utilizou-se a técnica multivariada da análise de fatores, considerando-se dezesseis variáveis relativas a sete unidades experimentais nos municípios e dez vari

  13. RNA-seq analysis of Brachypodium distachyon responses to Barley stripe mosaic virus infection

    Directory of Open Access Journals (Sweden)

    Guoxin Wang


    Full Text Available Barley stripe mosaic virus (BSMV is the type member of the genus Hordeivirus. Brachypodium distachyon line Bd3-1 shows resistance to the BSMV ND18 strain, but is susceptible to an ND18 double mutant (β NDTGB1R390K, T392K in which lysine is substituted for an arginine at position 390 and for threonine at position 392 of the triple gene block 1 (TGB1 protein. In order to understand differences in gene expression following infection with ND18 and double mutant ND18, Bd3-1 seedlings were subjected to RNA-seq analyses at 1, 6, and 14 days post inoculation (dpi. The results revealed that basal immunity genes involved in cellulose synthesis and pathogenesis-related protein biosynthesis were enhanced in incompatible interactions between Bd3-1 and ND18. Most of the differentially expressed transcripts are related to trehalose biosynthesis, ethylene, jasmonic acid metabolism, protein phosphorylation, protein ubiquitination, transcriptional regulation, and transport process, as well as pathogenesis-related protein biosynthesis. In compatible interactions between Bd3-1 and ND18 mutant, Bd3-1 developed weak basal resistance responses to the virus. Many genes involved in cellulose biosynthesis, protein amino acid phosphorylation, protein biosynthesis, protein glycosylation, glycolysis and cellular macromolecular complex assembly that may be related to virus replication, assembly and movement were up-regulated. Some genes involved in oxidative stress responses were also up-regulated at 14 dpi. BSMV ND18 mutant infection suppressed expression of genes functioning in regulation of transcription, protein kinase, cellular nitrogen compound biosynthetic process and photosynthesis. Differential expression patterns between compatible and incompatible interactions in Bd3-1 to the two BSMV strains provide important clues for understanding mechanism of resistance to BMSV in the model plant Brachypodium.

  14. Persistence of Overseeded Cool-Season Grasses in Bermudagrass Turf


    Thomas Serensits; Matthew Cutulle; Jeffrey F. Derr


    Cool-season grass species are commonly overseeded into bermudagrass turf for winter color. When the overseeded grass persists beyond the spring; however, it becomes a weed. The ability of perennial ryegrass, Italian (annual) ryegrass, intermediate ryegrass, and hybrid bluegrass to persist in bermudagrass one year after seeding was determined. Perennial ryegrass, intermediate ryegrass, and Italian ryegrass produced acceptable ground cover in the spring after fall seeding. Hybrid bluegrass di...

  15. Effects of feeding dairy cows different legume-grass silages on milk phytoestrogen concentration

    DEFF Research Database (Denmark)

    Höjer, A; Adler, S; Purup, Stig


    interval of legume-grass silage on phytoestrogen intake and milk phytoestrogen concentrations. In one experiment, 15 Swedish Red dairy cows were fed 2- or 3-cut red clover-grass silage, or 2-cut birdsfoot trefoil-grass silage. In a second experiment, 16 Norwegian Red dairy cows were fed short-term ley...... red clover-grass silage diet (1,494μg/kg of milk). Because of the metabolism of biochanin A, genistein, and prunetin, their concentrations in milk and the apparent recovery were low. Coumestrol was detected in only short-term and long-term ley silage mixtures, and its milk concentration was low....... Concentrations of secoisolariciresinol and matairesinol were higher in 2-cut birdsfoot trefoil-grass and long-term ley silage mixtures, those with legume species other than red clover, and the highest grass proportions. The 2-cut birdsfoot trefoil-grass silage diet also resulted in higher enterolactone...

  16. Identification of differentially accumulated proteins involved in regulating independent and combined osmosis and cadmium stress response in Brachypodium seedling roots. (United States)

    Chen, Ziyan; Zhu, Dong; Wu, Jisu; Cheng, Zhiwei; Yan, Xing; Deng, Xiong; Yan, Yueming


    In this study, we aimed to identify differentially accumulated proteins (DAPs) involved in PEG mock osmotic stress, cadmium (Cd 2+ ) stress, and their combined stress responses in Brachypodium distachyon seedling roots. The results showed that combined PEG and Cd 2+ stresses had more significant effects on Brachypodium seedling root growth, physiological traits, and ultrastructures when compared with each individual stress. Totally, 106 DAPs were identified that are responsive to individual and combined stresses in roots. These DAPs were mainly involved in energy metabolism, detoxification and stress defense and protein metabolism. Principal component analysis revealed that DAPs from Cd 2+ and combined stress treatments were grouped closer than those from osmotic stress treatment, indicating that Cd 2+ and combined stresses had more severe influences on the root proteome than osmotic stress alone. Protein-protein interaction analyses highlighted a 14-3-3 centered sub-network that synergistically responded to osmotic and Cd 2+ stresses and their combined stresses. Quantitative real-time polymerase chain reaction (qRT-PCR) analysis of 14 key DAP genes revealed that most genes showed consistency between transcriptional and translational expression patterns. A putative pathway of proteome metabolic changes in Brachypodium seedling roots under different stresses was proposed, which revealed a complicated synergetic responsive network of plant roots to adverse environments.

  17. Organ and Tissue-Specific Localisation of Selected Cell Wall Epitopes in the Zygotic Embryo of Brachypodium distachyon

    Directory of Open Access Journals (Sweden)

    Alexander Betekhtin


    Full Text Available The plant cell wall shows a great diversity regarding its chemical composition, which may vary significantly even during different developmental stages. In this study, we analysed the distribution of several cell wall epitopes in embryos of Brachypodium distachyon (Brachypodium. We also described the variations in the nucleus shape and the number of nucleoli that occurred in some embryo cells. The use of transmission electron microscopy, and histological and immunolocalisation techniques permitted the distribution of selected arabinogalactan proteins, extensins, pectins, and hemicelluloses on the embryo surface, internal cell compartments, and in the context of the cell wall ultrastructure to be demonstrated. We revealed that the majority of arabinogalactan proteins and extensins were distributed on the cell surface and that pectins were the main component of the seed coat and other parts, such as the mesocotyl cell walls and the radicula. Hemicelluloses were localised in the cell wall and outside of the radicula protodermis, respectively. The specific arrangement of those components may indicate their significance during embryo development and seed germination, thus suggesting the importance of their protective functions. Despite the differences in the cell wall composition, we found that some of the antibodies can be used as markers to identify specific cells and the parts of the developing Brachypodium embryo.

  18. Analysis of global gene expression in Brachypodium distachyon reveals extensive network plasticity in response to abiotic stress.

    Directory of Open Access Journals (Sweden)

    Henry D Priest

    Full Text Available Brachypodium distachyon is a close relative of many important cereal crops. Abiotic stress tolerance has a significant impact on productivity of agriculturally important food and feedstock crops. Analysis of the transcriptome of Brachypodium after chilling, high-salinity, drought, and heat stresses revealed diverse differential expression of many transcripts. Weighted Gene Co-Expression Network Analysis revealed 22 distinct gene modules with specific profiles of expression under each stress. Promoter analysis implicated short DNA sequences directly upstream of module members in the regulation of 21 of 22 modules. Functional analysis of module members revealed enrichment in functional terms for 10 of 22 network modules. Analysis of condition-specific correlations between differentially expressed gene pairs revealed extensive plasticity in the expression relationships of gene pairs. Photosynthesis, cell cycle, and cell wall expression modules were down-regulated by all abiotic stresses. Modules which were up-regulated by each abiotic stress fell into diverse and unique gene ontology GO categories. This study provides genomics resources and improves our understanding of abiotic stress responses of Brachypodium.

  19. Evapotranspiration and water use efficiency of different grass ...

    African Journals Online (AJOL)

    Evapotranspiration (Et) and water use efficiency (WUE) were determined for each of seven grass species during the 1986/87 seasons. The highest and lowest mean daily Et of 2, 39 and 1, 66 mm were recorded respectively for Themeda triandra and Sporobolus fimbriatus. Between species, the average Et for the two ...

  20. A new grass frog from Namibia | Channing | African Zoology

    African Journals Online (AJOL)

    A new species of grass frog of lhe genus Ptychadena is described from northern Namibia. Although superficially similar to Ptychadena schillukorum and Ptychadena mossambica, the new species differs In advertisement call, and external characters. An examination of a series of published sonagrams indicates that ...

  1. Seasonal variation in diurnal atmospheric grass pollen concentration profiles

    DEFF Research Database (Denmark)

    Peel, Robert George; Ørby, Pia Viuf; Skjøth, Carsten Ambelas


    the time of day when peak concentrations are most likely to occur using seasonally averaged diurnal profiles. Atmospheric pollen loads are highly dependent upon emissions, and different species of grass are known to flower and emit pollen at different times of the day and during different periods......In this study, the diurnal atmospheric grass pollen concentration profile within the Danish city of Aarhus was shown to change in a systematic manner as the pollen season progressed. Although diurnal grass pollen profiles can differ greatly from day-to-day, it is common practice to establish...... of the pollen season. Pollen concentrations are also influenced by meteorological factors - directly through those parameters that govern pollen dispersion and transport, and indirectly through the weather-driven flowering process. We found that three different profiles dominated the grass pollen season...

  2. Meadow-grass gall midge

    DEFF Research Database (Denmark)

    Hansen, Lars Monrad

    The area with meadow-grass (Poa pratensis, L.) grown for seed production in Den-mark is a significant proportion of the entire seed production. The meadow-grass gall midge (Mayetiola schoberi, Barnes 1958) is of considerable economic importance since powerful attacks can reduce the yield...

  3. Comparative growth analysis of cool- and warm-season grasses in a cool-temperate environment

    International Nuclear Information System (INIS)

    Belesky, D.P.; Fedders, J.M.


    Using both cool-season (C3) and warm-season (C4) species is a viable means of optimizing herbage productivity over varying climatic conditions in temperate environments. Despite well-documented differences in water, N, and radiation use, no consistent evidence demonstrates productivity differences among C3 and C4 perennial grass species under identical management. A field study was conducted to determine relative growth rates (RGR), nitrogen productivity (NP), and mean radiation productivity (RP) (dry matter production as a function of incident radiation) of cool- and warm-season grasses managed identically. Results were used to identify management practices thd could lead to optimal productivity in combinations or mixtures of cool- and warm-season grasses. Dry matter yields of warm-season grasses equaled or surpassed those of cool-season grasses, despite a 40% shorter growth interval. Certain cool- and warm-season grasses appear to be suitable for use in mixtures, based on distribution of herbage production; however, actual compatibility may be altered by defoliation management. Relative growth rates varied among years and were about 40% lower for canopies clipped to a 10-cm residue height each time 20-cm of growth accumulated compared with other treatments. The RGR of warm-season grasses was twice that of cool-season grasses Nitrogen productivity (g DM g-1 N d -1) and mean radiation productivity (g DM MJ-1) for warm-season grasses was also more than twice that of cool-season grasses. Radiation productivity of cool-season grasses was dependent on N, while this was not always the case for warm-season grasses. The superior production capability of certain warm-season compared with cool-season grasses in a cool-temperate environment can be sustained under a range of defoliation treatments and demonstrates suitability for use in frequently defoliated situations

  4. Extending juvenility in grasses

    Energy Technology Data Exchange (ETDEWEB)

    Kaeppler, Shawn; de Leon Gatti, Natalia; Foerster, Jillian


    The present invention relates to compositions and methods for modulating the juvenile to adult developmental growth transition in plants, such as grasses (e.g. maize). In particular, the invention provides methods for enhancing agronomic properties in plants by modulating expression of GRMZM2G362718, GRMZM2G096016, or homologs thereof. Modulation of expression of one or more additional genes which affect juvenile to adult developmental growth transition such as Glossy15 or Cg1, in conjunction with such modulation of expression is also contemplated. Nucleic acid constructs for down-regulation of GRMZM2G362718 and/or GRMZM2G096016 are also contemplated, as are transgenic plants and products produced there from, that demonstrate altered, such as extended juvenile growth, and display associated phenotypes such as enhanced yield, improved digestibility, and increased disease resistance. Plants described herein may be used, for example, as improved forage or feed crops or in biofuel production.

  5. Genome-wide evolutionary characterization and expression analyses of WRKY family genes in Brachypodium distachyon. (United States)

    Wen, Feng; Zhu, Hong; Li, Peng; Jiang, Min; Mao, Wenqing; Ong, Chermaine; Chu, Zhaoqing


    Members of plant WRKY gene family are ancient transcription factors that function in plant growth and development and respond to biotic and abiotic stresses. In our present study, we have investigated WRKY family genes in Brachypodium distachyon, a new model plant of family Poaceae. We identified a total of 86 WRKY genes from B. distachyon and explored their chromosomal distribution and evolution, domain alignment, promoter cis-elements, and expression profiles. Combining the analysis of phylogenetic tree of BdWRKY genes and the result of expression profiling, results showed that most of clustered gene pairs had higher similarities in the WRKY domain, suggesting that they might be functionally redundant. Neighbour-joining analysis of 301 WRKY domains from Oryza sativa, Arabidopsis thaliana, and B. distachyon suggested that BdWRKY domains are evolutionarily more closely related to O. sativa WRKY domains than those of A. thaliana. Moreover, tissue-specific expression profile of BdWRKY genes and their responses to phytohormones and several biotic or abiotic stresses were analysed by quantitative real-time PCR. The results showed that the expression of BdWRKY genes was rapidly regulated by stresses and phytohormones, and there was a strong correlation between promoter cis-elements and the phytohormones-induced BdWRKY gene expression. © The Author 2014. Published by Oxford University Press on behalf of Kazusa DNA Research Institute.


    Directory of Open Access Journals (Sweden)

    Aditya Dev


    Full Text Available The Shikimate pathway is an attractive target for herbicides and antimicrobial agents because it is essential in microbes and plants but absent in animals. The 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase (DAHPS is the first enzyme of this pathway, which is involved in the condensation of phosphoenolpyruvate (PEP and D-erythrose 4-phosphate (E4P to produce 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP. DAHPS enzymes have been divided into two types, class I and class II, based on their primary amino acid sequence and three dimensional structures. The plant DAHPS belongs to class II and is regulated differently than DAHPS from microorganisms. To understand the structural basis of such differences in DAHPS from plants and its catalytic mechanism, we have used sequence analysis, homology modeling and docking approach to generate the three dimensional models of DAHP synthase from Brachypodium distachyon (Bd-DAHPS complexed with substrate PEP for the first time. The three dimensional models of Bd-DAHPS provides a detailed knowledge of the active site and the important secondary structural regions that play significant roles in the regulatory mechanism and further may be helpful for design of specific inhibitors towards herbicide development.

  7. Dose-response relationship of a new Timothy grass pollen allergoid in comparison with a 6-grass pollen allergoid. (United States)

    Pfaar, O; Hohlfeld, J M; Al-Kadah, B; Hauswald, B; Homey, B; Hunzelmann, N; Schliemann, S; Velling, P; Worm, M; Klimek, L


    Subcutaneous allergen immunotherapy with grass pollen allergoids has been proven to be effective and safe in the treatment of patients with allergic rhinoconjunctivitis. Based on the extensive cross-reactivity among Pooideae species, it has been suggested that grass pollen extracts could be prepared from a single species, rather than from a multiple species mixture. To find the optimal dose of a Phleum pratense (P. pratense) allergoid preparation and compare its efficacy and safety to a 6-grass pollen allergoid preparation. In this double-blind, placebo-controlled study (EudraCT: 2011-000674-58), three doses of P. pratense allergoid (1800 therapeutic units (TU), standard-dose 6000 TU and 18 000 TU) were compared with placebo and the marketed 6-grass pollen allergoid (6000 TU). In a pre-seasonal dosing regimen, 102 patients were randomized to five treatment groups and received nine subcutaneous injections. The primary efficacy endpoint was the change in weal size (late-phase reaction [LPR]) in response to the intracutaneous testing (ICT) before and after treatment, comparing the active allergoids to placebo. Secondary outcomes were the change in Total Nasal Symptom Score (TNSS) assessed in the allergen exposure chamber (AEC), the changes in P. pratense-serum-specific IgG 4 and the incidence of adverse events (AEs). All three doses of the P. pratense and the 6-grass pollen allergoid preparations were significantly superior to placebo for the primary outcome, whereas there were no significant differences in the change in TNSS. Compared to the standard-dose, the high-dose of P. pratense did not produce any additional significant benefit, but showed a slight increase in AEs. Yet this increase in AEs was lower than for the 6-grass pollen preparation. The standard-dose of the new P. pratense allergoid was comparable to the marketed 6-grass pollen preparation at equal dose for the parameters measured. © 2017 The Authors. Clinical & Experimental Allergy Published by John

  8. Taxonomic studies of grasses and their indigenous uses in the salt ...

    African Journals Online (AJOL)



    Jan 19, 2009 ... countries like United States, the principal sources of meat ... Many species of native and introduced grasses are utilized in improved ... turning northwest to cross the river Indus near Kalabagh. (Ahmad and ... Key to the identification of grasses of Salt Range of Pakistan. S. No ...... Under shade of trees.

  9. Improved quality of beneath-canopy grass in South African savannas: Local and seasonal variation

    NARCIS (Netherlands)

    Treydte, A.C.; Looringh van Beeck, F.A.; Ludwig, F.; Heitkonig, I.M.A.


    Questions: Do large trees improve the nutrient content and the structure of the grass layer in savannas? Does the magnitude of this improvement differ with locality ( soil nutrients) and season ( water availability)? Are grass structure and species composition beneath tree canopies influenced by

  10. Effect of short-duration overnight cattle kraaling on grass production ...

    African Journals Online (AJOL)

    ... grass species, such as Urochloa mosambicensis and Panicum maximum, were more abundant in abandoned kraal sites than the surrounding vegetation. We conclude that shortduration overnight cattle kraaling improves grass quality and biomass. Keywords: biomass, crude protein, diversity, fibre, nutrient hotspots ...

  11. On the number of genes controlling the grass stage in longleaf pine (United States)

    C. Dana Nelson; C. Weng; Thomas L. Kubisiak; M. Stine; C.L. Brown


    The grass stage is an inherent and distinctive developmental trait of longleaf pine (Pinus palustris), in which height growth in the first few years after germination is suppressed. In operational forestry practice the grass stage extends for nvo to several years and often plays a role in planting failures and decisions to plant alternative species....


    Jarrod M. Thaxton; Skip J. Van Bloem; Stefanie Whitmire


    Exotic grasses capable of increasing frequency and intensity of anthropogenic fire have invaded subtropical and tropical dry forests worldwide. Since many dry forest trees are susceptible to fire, this can result in decline of native species and loss of forest cover. While the contribution of exotic grasses to altered fire regimes has been well documented, the role of...

  13. Status and use of important native grasses adapted to sagebrush communities (United States)

    Thomas A. Jones; Steven R. Larson


    Due to the emphasis on restoration, native cool-season grass species are increasing in importance in the commercial seed trade in the Western U.S. Cultivated seed production of these native grasses has often been hampered by seed dormancy, seed shattering, and pernicious awns that are advantageous outside of cultivation. Relatively low seed yields and poor seedling...

  14. Ensiling as pretreatment of grass for lignocellulosic biomass conversion

    DEFF Research Database (Denmark)

    Ambye-Jensen, Morten

    for subsequent enzymatic saccharification of cellulose and hemicellulose, by using the temperate grass Festulolium Hykor. The method was additionally combined with hydrothermal treatment, in order to decrease the required severity of an industrial applied pretreatment method. The first part of the project...... conditions providing the best possible pretreatment effect. The parameters were biomass composition, varied by ensiling of four seasonal cuts of grass, different dry matter (DM) content at ensiling, and an addition of different lactic acid bacteria species. First of all, the study confirmed that ensiling can...... act as a method of pretreatment and improve the enzymatic cellulose convertibility of grass. Furthermore, low DM ensiling was found to improve the effects of pretreatment due to a higher production of organic acids in the silage. The effect of applied lactic acid bacteria species was, however...

  15. Urban Rights-of-Way as Reservoirs for Tall-Grass Prairie Plants and Butterflies (United States)

    Leston, Lionel; Koper, Nicola


    Urban rights-of-way may be potential reservoirs of tall-grass prairie plants and butterflies. To determine if this is true, in 2007-2008, we conducted vegetation surveys of species richness and cover, and butterfly surveys of species richness and abundance, along 52 transmission lines and four remnant prairies in Winnipeg, Manitoba. We detected many prairie plants and butterflies within transmission lines. Some unmowed and infrequently managed transmission lines had native plant species richness and total percent cover of native plants comparable to that of similar-sized remnant tall-grass prairies in the region. Although we did not find significant differences in overall native butterfly numbers or species richness between rights-of-way and remnant prairies, we found lower numbers of some prairie butterflies along frequently mowed rights-of-way than within remnant tall-grass prairies. We also observed higher butterfly species richness along sites with more native plant species. By reducing mowing and spraying and reintroducing tall-grass prairie plants, urban rights-of-way could serve as extensive reservoirs for tall-grass prairie plants and butterflies in urban landscapes. Eventually, managing urban rights-of-way as reservoirs for tall-grass prairie plants and animals could contribute to the restoration of tall-grass prairie in the North American Midwest.

  16. Urban Rights-of-Way as Reservoirs for Tall-Grass Prairie Plants and Butterflies. (United States)

    Leston, Lionel; Koper, Nicola


    Urban rights-of-way may be potential reservoirs of tall-grass prairie plants and butterflies. To determine if this is true, in 2007-2008, we conducted vegetation surveys of species richness and cover, and butterfly surveys of species richness and abundance, along 52 transmission lines and four remnant prairies in Winnipeg, Manitoba. We detected many prairie plants and butterflies within transmission lines. Some unmowed and infrequently managed transmission lines had native plant species richness and total percent cover of native plants comparable to that of similar-sized remnant tall-grass prairies in the region. Although we did not find significant differences in overall native butterfly numbers or species richness between rights-of-way and remnant prairies, we found lower numbers of some prairie butterflies along frequently mowed rights-of-way than within remnant tall-grass prairies. We also observed higher butterfly species richness along sites with more native plant species. By reducing mowing and spraying and reintroducing tall-grass prairie plants, urban rights-of-way could serve as extensive reservoirs for tall-grass prairie plants and butterflies in urban landscapes. Eventually, managing urban rights-of-way as reservoirs for tall-grass prairie plants and animals could contribute to the restoration of tall-grass prairie in the North American Midwest.

  17. Prospects for Hybrid Breeding in Bioenergy Grasses

    DEFF Research Database (Denmark)

    Aguirre, Andrea Arias; Studer, Bruno; Frei, Ursula


    , we address crucial topics to implement hybrid breeding, such as the availability and development of heterotic groups, as well as biological mechanisms for hybridization control such as self-incompatibility (SI) and male sterility (MS). Finally, we present potential hybrid breeding schemes based on SI...... of different hybrid breeding schemes to optimally exploit heterosis for biomass yield in perennial ryegrass (Lolium perenne L.) and switchgrass (Panicum virgatum), two perennial model grass species for bioenergy production. Starting with a careful evaluation of current population and synthetic breeding methods...

  18. Factors influencing seed germination in Cerrado grasses

    Directory of Open Access Journals (Sweden)

    Rosana Marta Kolb


    Full Text Available Few studies address the ecology of herbs of Cerrado grasslands, which are ecosystems where the long dry season, high temperatures, insolation, fire and invasive grasses greatly influencing germination and the establishment of plants. We assessed germination of 13 species of Poaceae from Cerrado grasslands under nursery conditions or in germination chambers, the latter with i recently collected seeds and seeds after six months storage, ii under constant and alternating temperatures, and iii in the presence and absence of light. Germinability, mean germination time (MGT and required light were quantified to elucidate factors involved in successful germination. Germinability was low for most grasses, probably because of low seed viability. For most species, germinability and MGT were not altered by seed storage. Germination percentages were higher at alternating temperatures and in the presence of light, factors that are more similar to natural environmental situations compared with constant temperature or the absence of light. Our findings indicate that alternating temperatures and light incidence are key factors for germination of species of Poaceae. The maintenance of these environmental factors, which are crucial for the conservation of Cerrado grasslands, depends on appropriate management interventions, such as fire management and the control of biological invasion.

  19. Grado di cheratinizzazione dell'epitelio ruminale e valutazione dello stato corporeo in ovini tenuti su pascoli di Brachypodium rupestre

    Directory of Open Access Journals (Sweden)

    Paola Scocco


    Full Text Available L'articolo valuta e mette in correlazione i cambiamenti del grado di cheratinizzazione della mucosa ruminale con lo stato corporeo di ovini tenuti a pascolare per 20 giorni in un'area ad elevata copertura di paléo rupestre (Brachypodium rupestre. Il pascolo degli ovini in queste aree riduce il rischio di incendi boschivi. Tuttavia, l'assunzione di Brachypodium rupestre protratta per lunghi periodi può compromettere la salute generale degli animali. Lo scopo di questo studio è di determinare il periodo massimo di permanenza degli animali in queste aree. Ovini mantenuti su un pascolo semi-mesofilo sono stati utilizzati come gruppo di controllo. Nei giorni 1, 10 e 20 della sperimentazione, 5 animali di ogni gruppo sono stati sacrificati per la valutazione delle modificazioni del grado di cheratinizzazione dell'epitelio dell'atrio e del sacco ventrale del rumine. La valutazione dello stato corporeo, o body condition score (BCS, e il peso vivo (PV sono stati monitorati su altri 10 soggetti per gruppo. Il gruppo di controllo ha mostrato piccole variazioni del grado di cheratinizzazione del rumine che non hanno inciso negativamente sul BCS o sul PV. Il gruppo sperimentale ha mostrato un significativo incremento del grado di cheratinizzazione, già entro i primi dieci giorni, che ha portato ad un graduale abbassamento del BCS e ad un calo di peso tra il decimo e il ventesimo giorno. I dati ottenuti suggeriscono che al fine della prevenzione degli incendi boschivi gli ovini dovrebbero essere utilizzati a turno con periodi di permanenza nei pascoli ad alta copertura di Brachypodium rupestre non superiori ai 10-12 giorni.


    African Journals Online (AJOL)


    E-mail addresses: 1, 2, ... machine design was considered for processing biomass of grass origin. The machine operations include pulverization, compaction and extrusion of the briquettes.

  1. Grass and weed killer poisoning (United States)

    ... Grass and weed killer poisoning To use the sharing features on this page, please enable JavaScript. Many weed killers contain dangerous chemicals that are harmful if ...

  2. A novel method to characterize silica bodies in grasses. (United States)

    Dabney, Clemon; Ostergaard, Jason; Watkins, Eric; Chen, Changbin


    The deposition of silicon into epidermal cells of grass species is thought to be an important mechanism that plants use as a defense against pests and environmental stresses. There are a number of techniques available to study the size, density and distribution pattern of silica bodies in grass leaves. However, none of those techniques can provide a high-throughput analysis, especially for a great number of samples. We developed a method utilizing the autofluorescence of silica bodies to investigate their size and distribution, along with the number of carbon inclusions within the silica bodies of perennial grass species Koeleria macrantha. Fluorescence images were analyzed by image software Adobe Photoshop CS5 or ImageJ that remarkably facilitated the quantification of silica bodies in the dry ash. We observed three types of silica bodies or silica body related mineral structures. Silica bodies were detected on both abaxial and adaxial epidermis of K. macrantha leaves, although their sizes, density, and distribution patterns were different. No auto-fluorescence was detected from carbon inclusions. The combination of fluorescence microscopy and image processing software displayed efficient utilization in the identification and quantification of silica bodies in K. macrantha leaf tissues, which should applicable to biological, ecological and geological studies of grasses including forage, turf grasses and cereal crops.

  3. The grasses (Poaceae) of the Colombian Guyana: analyses on their composition, richness, endemism, and invasion

    International Nuclear Information System (INIS)

    Giraldo Canas, Diego


    The checklist of grasses from Colombian Guyana is presented. In all, 152 species, 69 genera, and six subfamilies were recorded. Thus, in the Colombian Guyana is represented the 18.7 and 43.7% of the species and genera of Colombian grasses, respectively. The subfamilies with the highest number of species were Panicoideae (110 species/46 genera), Chloridoideae (21/9), and Bambusoideae (11/9). The most diverse genera were Paspalum (19 species), Panicum (16), Axonopus (14), Eragrostis (9), and Digitaria (8). Nineteen species are introduced and naturalized in the Colombian Guyana, which represent 12.5% of the agrostological flora for the Colombian Guyana. There were 8 endemic species (5.3% of Colombian Guayanan grasses). In addition, some species are reported for the first time for Colombian flora (belonging to Axonopus, Cyphonanthus, Gymnopogon, and Paspalum), and some species are new to science (belonging to Axonopus, Digitaria, Eragrostis, and Sacciolepis). On the other hand, some preliminary biogeographical aspect are analyzed.

  4. High green fodder yielding new grass varieties


    C. Babu, K. Iyanar and A. Kalamani


    Two high biomass yielding forage grass varieties one each in Cumbu Napier hybrid and Guinea grass have been evolved at the Department of Forage Crops, Centre for Plant Breeding and Genetics, Tamil Nadu Agricultural University, Coimbatore and identified for release at national (All India) level as Cumbu Napier hybrid grass CO (BN) 5 and Guinea grass CO (GG) 3 during 2012 and 2013 respectively. Cumbu Napier hybrid grass CO (BN) 5 secured first rank at all national level with reference to green ...

  5. Non-native grass removal and shade increase soil moisture and seedling performance during Hawaiian dry forest restoration (United States)

    Jared M. Thaxton; Susan Cordell; Robert J. Cabin; Darren R. Sandquist


    Invasive non-native species can create especially problematic restoration barriers in subtropical and tropical dry forests. Native dry forests in Hawaii presently cover less than 10% of their original area. Many sites that historically supported dry forest are now completely dominated by non-native species, particularly grasses. Within a grass-dominated site in leeward...

  6. How far can we simplify in vitro diagnostics for grass pollen allergy?: A study with 17 whole pollen extracts and purified natural and recombinant major allergens

    NARCIS (Netherlands)

    van Ree, R.; van Leeuwen, W. A.; Aalberse, R. C.


    BACKGROUND: Current diagnostics for grass pollen allergy are composed of mixtures of pollen of different grass species. Their complex composition hampers accurate standardization. OBJECTIVE: The aim of the study was to investigate whether mixtures of grass pollen extracts can be replaced by a single

  7. Effects of soil microorganisms on uptake of 89Sr by ryegrass and bahia grass

    International Nuclear Information System (INIS)

    Zhong Weiliang; Liu Kexing


    In present study, 60 Co γ-rays was used to irradiate soil with doses of 3.0 kGy and 25.0 kGy, respectively, to discriminate between arbuscular mycorrhizal (AM) fungi and other soil microorganisms, while soil without irradiation was used as control to study the effects of soil microorganisms on uptake of 89 Sr by ryegrass and bahia grass. The results showed that the AM infection rates in ryegrass and bahia grass were 48.0% and 28.0% in the control soil, respectively which indicated that both grass species were prone to forming AM symbiosis with AM fungi. Although AM fungi and other soil microorganisms had no significant effect on above ground biomass in ryegrass and bahia grass, both AM fungi and other soil microorganisms decreased the uptake of 89 Sr in the two grass species, though to a more or less extant. (authors)

  8. Transcriptome-wide Identification and Expression Analysis of Brachypodium distachyon Transposons in Response to Viral Infection

    Directory of Open Access Journals (Sweden)

    Tuğba Gürkök


    Full Text Available Transposable elements (TEs are the most abundant group of genomic elements in plants that can be found in genic or intergenic regions of their host genomes. Several stimuli such as biotic or abiotic stress have roles in either activating their transcription or transposition. Here the effect of the Panicum mosaic virus (PMV and its satellite virus (SPMV infection on the transposon transcription of the Brachypodium distachyon model plant was investigated. To evaluate the transcription activity of TEs, transcriptomic data of mock and virus inoculated plants were compared. Our results indicate that major components of TEs are retroelements in all RNA-seq libraries. The number of transcribed TEs detected in mock inoculated plants is higher than virus inoculated plants. In comparison with mock inoculated plants 13% of the TEs showed at least two folds alteration upon PMV infection and 21% upon PMV+SPMV infection. Rather than inoculation with PMV alone inoculation with PMV+SPMV together also increased various TE encoding transcripts expressions. MuDR-N78C_OS encoding transcript was strongly up-regulated against both PMV and PMV+SPMV infection. The synergism generated by PMV and SPMV together enhanced TE transcripts expressions than PMV alone. It was observed that viral infection induced the transcriptional activity of several transposons. The results suggest that increased expressions of TEs might have a role in response to biotic stress in B. distachyon. Identification of TEs which are taking part in stress can serve useful information for functional genomics and designing novel breeding strategies in developing stress resistance crops.

  9. Evaluation of six candidate DNA barcode loci for identification of five important invasive grasses in eastern Australia.

    Directory of Open Access Journals (Sweden)

    Aisuo Wang

    Full Text Available Invasive grass weeds reduce farm productivity, threaten biodiversity, and increase weed control costs. Identification of invasive grasses from native grasses has generally relied on the morphological examination of grass floral material. DNA barcoding may provide an alternative means to identify co-occurring native and invasive grasses, particularly during early growth stages when floral characters are unavailable for analysis. However, there are no universal loci available for grass barcoding. We herein evaluated the utility of six candidate loci (atpF intron, matK, ndhK-ndhC, psbE-petL, ETS and ITS for barcode identification of several economically important invasive grass species frequently found among native grasses in eastern Australia. We evaluated these loci in 66 specimens representing five invasive grass species (Chloris gayana, Eragrostis curvula, Hyparrhenia hirta, Nassella neesiana, Nassella trichotoma and seven native grass species. Our results indicated that, while no single locus can be universally used as a DNA barcode for distinguishing the grass species examined in this study, two plastid loci (atpF and matK showed good distinguishing power to separate most of the taxa examined, and could be used as a dual locus to distinguish several of the invasive from the native species. Low PCR success rates were evidenced among two nuclear loci (ETS and ITS, and few species were amplified at these loci, however ETS was able to genetically distinguish the two important invasive Nassella species. Multiple loci analyses also suggested that ETS played a crucial role in allowing identification of the two Nassella species in the multiple loci combinations.

  10. Genome wide identification of wheat and Brachypodium type one protein phosphatases and functional characterization of durum wheat TdPP1a.

    Directory of Open Access Journals (Sweden)

    Mariem Bradai

    Full Text Available Reversible phosphorylation is an essential mechanism regulating signal transduction during development and environmental stress responses. An important number of dephosphorylation events in the cell are catalyzed by type one protein phosphatases (PP1, which catalytic activity is driven by the binding of regulatory proteins that control their substrate specificity or subcellular localization. Plants harbor several PP1 isoforms accounting for large functional redundancies. While animal PP1s were reported to play relevant roles in controlling multiple cellular processes, plant orthologs remain poorly studied. To decipher the role of plant PP1s, we compared PP1 genes from three monocot species, Brachypodium, common wheat and rice at the genomic and transcriptomic levels. To gain more insight into the wheat PP1 proteins, we identified and characterized TdPP1a, the first wheat type one protein phosphatase from a Tunisian durum wheat variety Oum Rabiaa3. TdPP1a is highly conserved in sequence and structure when compared to mammalian, yeast and other plant PP1s. We demonstrate that TdPP1a is an active, metallo-dependent phosphatase in vitro and is able to interact with AtI2, a typical regulator of PP1 functions. Also, TdPP1a is capable to complement the heat stress sensitivity of the yeast mutant indicating that TdPP1a is functional also in vivo. Moreover, transient expression of TdPP1a::GFP in tobacco leaves revealed that it is ubiquitously distributed within the cell, with a strong accumulation in the nucleus. Finally, transcriptional analyses showed similar expression levels in roots and leaves of durum wheat seedlings. Interestingly, the expression in leaves is significantly induced following salinity stress, suggesting a potential role of TdPP1a in wheat salt stress response.

  11. Brachypodium distachyon line Bd3-1 resistance is elicited by the barley stripe mosaic virus triple gene block 1 movement protein

    NARCIS (Netherlands)

    Lee, M.Y.; Yan, L.J.; Gorter, F.A.; Kim, B.Y.T.; Cui, Y.; Hu, Y.; Yuan, C.; Grindheim, J.; Ganesan, U.; Liu, Z.Y.; Han, C.G.; Yu, J.L.; Li, D.W.; Jackson, A.O.


    Barley stripe mosaic virus North Dakota 18 (ND18), Beijing (BJ), Xinjiang (Xi), Type (TY) and CV21 strains are unable to infect the Brachypodium distachyon Bd3-1 inbred line, which harbours a resistance gene designated Bsr1, but the Norwich (NW) strain is virulent on Bd3-1. Analysis of ND18 and NW

  12. Climate change and the invasion of California by grasses

    DEFF Research Database (Denmark)

    Sandel, Brody Steven; Dangremond, Emily


    Over the next century, changes in the global climate are expected to have major consequences for plant communities, possibly including the exacerbation of species invasions. We evaluated this possibility in the grass flora of California, which is economically and ecologically important and heavily...... invaded. We used a novel, trait-based approach involving two components: identifying differences in trait composition between native and exotic components of the grass flora and evaluating contemporary trait–climate relationships across the state. The combination of trait–climate relationships and trait...

  13. Additions to the grasses (Poaceae of Telangana from Kawal Tiger Reserve, Adilabad District, India

    Directory of Open Access Journals (Sweden)

    Alok Chorghe


    Full Text Available Three species of grasses viz., Dimeria orissae, Iseilema holei and Spodiopogon rhizophorus are being reported for the first time as new distributional records to Telangana from the Kawal Tiger Reserve. Detailed description and illustrations are provided here.

  14. How much gas can we get from grass?

    International Nuclear Information System (INIS)

    Nizami, A.S.; Orozco, A.; Groom, E.; Dieterich, B.; Murphy, J.D.


    Highlights: ► We highlight the various results for biomethane potential that may be obtained from the same grass silage. ► The results indicated that methane potential varied from 350 to 493 L CH 4 kg −1 VS added for three different BMP procedures. ► We compare two distinct digestion systems using the same grass. ► A two stage wet system achieved 451 L CH 4 kg −1 VS added over a 50 day retention period. ► A two phase system achieved 341 L CH 4 kg −1 VS added at a 30 day retention time. -- Abstract: Grass biomethane has been shown to be a sustainable gaseous transport biofuel, with a good energy balance, and significant potential for economic viability. Of issue for the designer is the variation in characteristics of the grass depending on location of source, time of cut and species. Further confusion arises from the biomethane potential tests (BMP) which have a tendency to give varying results. This paper has dual ambitions. One of these is to highlight the various results for biomethane potential that may be obtained from the same grass silage. The results indicated that methane potential from the same grass silage varied from 350 to 493 L CH 4 kg −1 VS added for three different BMP procedures. The second ambition is to attempt to compare two distinct digestion systems again using the same grass: a two stage continuously stirred tank reactor (CSTR); and a sequentially fed leach bed reactor connected to an upflow anaerobic sludge blanket (SLBR–UASB). The two engineered systems were designed, fabricated, commissioned and operated at small pilot scale until stable optimal operating conditions were reached. The CSTR system achieved 451 L CH 4 kg −1 VS added over a 50 day retention period. The SLBR–UASB achieved 341 L CH 4 kg −1 VS added at a 30 day retention time.

  15. Anaerobic co-digestion of sewage sludge with shredded grass from public green spaces. (United States)

    Hidaka, Taira; Arai, Sayuri; Okamoto, Seiichiro; Uchida, Tsutomu


    Adding greenery from public spaces to the co-digestion process with sewage sludge was evaluated by shredding experiments and laboratory-scale batch and continuous mesophilic anaerobic fermentation experiments. The ratio of the shredded grass with 20mm or less in length by a commercially available shredder was 93%. The methane production was around 0.2NL/gVS-grass in the batch experiment. The continuous experiment fed with sewage sludge and shredded grass was stably operated for 81days. The average methane production was 0.09NL/gVS-grass when the TS ratio of the sewage sludge and the grass was 10:1. This value was smaller than those of other reports using grass silage, but the grass species in this study were not managed, and the collected grass was just shredded and not ensiled before feeding to the reactor for simple operation. The addition of grass to a digester can improve the carbon/nitrogen ratio, methane production and dewaterability. Copyright © 2013 Elsevier Ltd. All rights reserved.

  16. Sonoran Desert ecosystem transformation by a C4 grass without the grass/fire cycle (United States)

    Olsson, Aaryn D.; Betancourt, Julio; McClaran, Mitchel P.; Marsh, Stuart E.


    Aim Biological invasions facilitate ecosystem transformation by altering the structure and function, diversity, dominance and disturbance regimes. A classic case is the grass–fire cycle in which grass invasion increases the frequency, scale and/or intensity of wildfires and promotes the continued invasion of invasive grasses. Despite wide acceptance of the grass–fire cycle, questions linger about the relative roles that interspecific plant competition and fire play in ecosystem transformations. Location Sonoran Desert Arizona Upland of the Santa Catalina Mountains, Arizona, USA. Methods We measured species cover, density and saguaro (Carnegiea gigantea) size structure along gradients of Pennisetum ciliare invasion at 10 unburned/ungrazed P. ciliare patches. Regression models quantified differences in diversity, cover and density with respect to P. ciliare cover, and residence time and a Fisher's exact test detected demographic changes in saguaro populations. Because P. ciliare may have initially invaded locations that were both more invasible and less diverse, we ran analyses with and without the plots in which initial infestations were located. Results Richness and diversity decreased with P. ciliare cover as did cover and density of most dominant species. Richness and diversity declined with increasing time since invasion, suggesting an ongoing transformation. The proportion of old-to-young Carnegiea gigantea was significantly lower in plots with dominant P. ciliare cover. Main conclusions Rich desert scrub (15–25 species per plot) was transformed into depauperate grassland (2–5 species per plot) within 20 years following P. ciliare invasion without changes to the fire regime. While the onset of a grass–fire cycle may drive ecosystem change in the later stages and larger scales of grass invasions of arid lands, competition by P. ciliare can drive small-scale transformations earlier in the invasion. Linking competition-induced transformation rates with

  17. Meiosis in elephant grass (Pennisetum purpureum), pearl millet (Pennisetum glaucum) (Poaceae, Poales) and their interspecific hybrids


    Techio, Vânia Helena; Davide, Lisete Chamma; Pereira, Antônio Vander


    The cultivated and sexually compatible species Pennisetum purpureum (elephant grass, 2n = 4x = 28) and Pennisetum glaucum (pearl millet, 2n = 2x = 14) can undergo hybridization which favors the amplification of their genetic background and the introgression of favorable alleles into breeding programs. The main problem with interspecific hybrids of these species is infertility due to triploidy (2n = 3x = 21). This study describes meiosis in elephant grass x pearl millet hybrids and their proge...

  18. A proteomic style approach to characterize a grass mix product reveals potential immunotherapeutic benefit. (United States)

    Bullimore, Alan; Swan, Nicola; Alawode, Wemimo; Skinner, Murray


    Grass allergy immunotherapies often consist of a mix of different grass extracts, each containing several proteins of different physiochemical properties; however, the subtle contributions of each protein are difficult to elucidate. This study aimed to identify and characterize the group 1 and 5 allergens in a 13 grass extract and to standardize the extraction method. The grass pollens were extracted in isolation and pooled and also in combination and analyzed using a variety of techniques including enzyme-linked immunosorbent assay, liquid chromatog-raphy-mass spectrometry, and sodium dodecyl sulfate-polyacrylam-ide gel electrophoresis. Gold-staining and IgE immunoblotting revealed a high degree of homology of protein bands between the 13 species and the presence of a densely stained doublet at 25-35 kD along with protein bands at approximately 12.5, 17, and 50 kD. The doublet from each grass species demonstrated a high level of group 1 and 5 interspecies homology. However, there were a number of bands unique to specific grasses consistent with evolutionary change and indicative that a grass mix immunotherapeutic could be considered broad spectrum. Sodium dodecyl sulfate-polyacrylamide gel electro-phoresis and IgE immunoblotting showed all 13 grasses share a high degree of homology, particularly in terms of group 1 and 5 allergens. IgE and IgG enzyme-linked immunosorbent assay potencies were shown to be independent of extraction method.

  19. Reversing land degradation through grasses: a systematic meta-analysis in the Indian tropics (United States)

    Mandal, Debashis; Srivastava, Pankaj; Giri, Nishita; Kaushal, Rajesh; Cerda, Artemi; Meherul Alam, Nurnabi


    Although intensive agriculture is necessary to sustain the world's growing population, accelerated soil erosion contributes to a decrease in the environmental health of ecosystems at local, regional and global scales. Reversing the process of land degradation using vegetative measures is of utmost importance in such ecosystems. The present study critically analyzes the effect of grasses in reversing the process of land degradation using a systematic review. The collected information was segregated under three different land use and land management situations. Meta-analysis was applied to test the hypothesis that the use of grasses reduces runoff and soil erosion. The effect of grasses was deduced for grass strip and in combination with physical structures. Similarly, the effects of grasses were analyzed in degraded pasture lands. The overall result of the meta-analysis showed that infiltration capacity increased approximately 2-fold after planting grasses across the slopes in agricultural fields. Grazing land management through a cut-and-carry system increased conservation efficiencies by 42 and 63 % with respect to reduction in runoff and erosion, respectively. Considering the comprehensive performance index (CPI), it has been observed that hybrid Napier (Pennisetum purpureum) and sambuta (Saccharum munja) grass seem to posses the most desirable attributes as an effective grass barrier for the western Himalayas and Eastern Ghats, while natural grass (Dichanthium annulatum) and broom grass (Thysanolaena maxima) are found to be most promising grass species for the Konkan region of the Western Ghats and the northeastern Himalayan region, respectively. In addition to these benefits, it was also observed that soil carbon loss can be reduced by 83 % with the use of grasses. Overall, efficacy for erosion control of various grasses was more than 60 %; hence, their selection should be based on the production potential of these grasses under given edaphic and agro

  20. Bud-bank and tiller dynamics of co-occurring C3 caespitose grasses in mixed-grass prairie. (United States)

    Ott, Jacqueline P; Hartnett, David C


    Tiller recruitment from the belowground bud bank of caespitose grasses influences their ability to monopolize local resources and, hence, their genet fitness. Differences in bud production and outgrowth among tiller types within a genet and among species may explain co-occurrence of caespitose grasses. This study aimed to characterize genet bud-bank and tiller production and dynamics in two co-occurring species and compare their vegetative reproductive strategies. Bud-bank and tiller dynamics of Hesperostipa comata and Nassella viridula, dominant C3 caespitose grasses in the northern mixed-grass prairie of North America, were assessed throughout an annual cycle. The two species showed similar strategies, maintaining polycyclic tillers and thus creating mixed-age genet bud banks comprising multiple bud cohorts produced in different years. Vegetative tillers produced the majority of buds, whereas flowering tillers contributed little to the bud bank. Buds lived for at least 2 yr and were maintained in multiple developmental stages throughout the year. Because bud longevity rarely exceeded tiller longevity, tiller longevity drove turnover within the bud bank. Tiller population dynamics, more than bud production per tiller, determined the differential contribution of tiller types to the bud bank. Nassella viridula had higher bud production per tiller, a consistent annual tiller recruitment density, and greater longevity of buds on senesced and flowering tillers than H. comata. Co-occurring C3 caespitose grasses had similar bud-bank and tiller dynamics contributing to genet persistence but differed in bud characteristics that could affect genet longevity and species coexistence. © 2015 Botanical Society of America.

  1. Diversification of the Histone Acetyltransferase GCN5 through Alternative Splicing in Brachypodium distachyon

    Directory of Open Access Journals (Sweden)

    Alexandre Martel


    Full Text Available The epigenetic modulatory SAGA complex is involved in various developmental and stress responsive pathways in plants. Alternative transcripts of the SAGA complex's enzymatic subunit GCN5 have been identified in Brachypodium distachyon. These splice variants differ based on the presence and integrity of their conserved domain sequences: the histone acetyltransferase domain, responsible for catalytic activity, and the bromodomain, involved in acetyl-lysine binding and genomic loci targeting. GCN5 is the wild-type transcript, while alternative splice sites result in the following transcriptional variants: L-GCN5, which is missing the bromodomain and S-GCN5, which lacks the bromodomain as well as certain motifs of the histone acetyltransferase domain. Absolute mRNA quantification revealed that, across eight B. distachyon accessions, GCN5 was the dominant transcript isoform, accounting for up to 90% of the entire transcript pool, followed by L-GCN5 and S-GCN5. A cycloheximide treatment further revealed that the S-GCN5 splice variant was degraded through the nonsense-mediated decay pathway. All alternative BdGCN5 transcripts displayed similar transcript profiles, being induced during early exposure to heat and displaying higher levels of accumulation in the crown, compared to aerial tissues. All predicted protein isoforms localize to the nucleus, which lends weight to their purported epigenetic functions. S-GCN5 was incapable of forming an in vivo protein interaction with ADA2, the transcriptional adaptor that links the histone acetyltransferase subunit to the SAGA complex, while both GCN5 and L-GCN5 interacted with ADA2, which suggests that a complete histone acetyltransferase domain is required for BdGCN5-BdADA2 interaction in vivo. Thus, there has been a diversification in BdGCN5 through alternative splicing that has resulted in differences in conserved domain composition, transcript fate and in vivo protein interaction partners. Furthermore, our

  2. Spatiotemporal Variation in the Environmental Controls of C4-Grass Origin and Ecology: Insights from Grass-Pollen δ13C Data (United States)

    Nelson, D. M.; Urban, M.; Hu, F.


    Understanding the environmental factors controlling the origin and shifting abundance of C4 grasses in Earth's history is useful for projecting the response of C4-grass dominated grasslands to future environmental change. Unfortunately, grass pollen is typically morphologically indistinct, making palynological analysis a blunt tool for studying C4-grasses in the paleorecord. δ13C of individual grass-pollen grains using a spooling wire microcombustion device interfaced with an isotope ratio mass spectrometer (Single Pollen Isotope Ratio AnaLysis, SPIRAL) overcomes this challenge and the potential biases of δ13C data from other substrates (e.g. leaf waxes). To assess the presence and relative abundance of C3- and C4-grass pollen in samples of unknown composition, we developed a hierarchical Bayesian model, trained with ~1,900 δ13C values from pollen grains of 31 grass species. Surface-sediment data from Africa, Australia, and North America demonstrate the reliability of this technique for quantifying C4-grass abundance on the landscape. To investigate the timing and control of the origin of C4-grasses we analyzed samples from the Oligocene-Miocene from Europe and from the Eocene from North America. Results indicate that C4 grasses appeared on the landscape of southwest Europe no later than the early Oligocene, implying that low atmospheric pCO2 may not have been the main driver and/or precondition for the development of C4 photosynthesis in the grass family. In contrast, we found no evidence for C4 grasses in the southeast United States before pCO2 fell. In application of SPIRAL to the late Quaternary, we found that shifts in pCO2 and moisture balance exerted key controls on the relative abundance of C3 and C4 grasses in Africa and Australia. Overall, our results imply that as in the past, future changes in the C3/C4 composition of grass-dominated ecosystems will likely exhibit striking spatiotemporal variability as a result of differing combinations of

  3. Status of exotic grasses and grass-like vegetation and potential impacts on wildlife in New England (United States)

    DeStefano, Stephen


    The Northeastern section of the United States, known as New England, has seen vast changes in land cover and human population over the past 3 centuries. Much of the region is forested; grasslands and other open-land cover types are less common, but provide habitat for many species that are currently declining in abundance and distribution. New England also consists of some of the most densely populated and developed states in the country. The origin, distribution, and spread of exotic species are highly correlated with human development. As such, exotics are common throughout much of New England, including several species of graminoids (grasses and grass-like plants such as sedges and rushes). Several of the more invasive grass species can form expansive dense mats that exclude native plants, alter ecosystem structure and functions, and are perceived to provide little-to-no value as wildlife food or cover. Although little research has been conducted on direct impacts of exotic graminoids on wildlife populations in New England, several studies on the common reed (Phragmites australis) in salt marshes have shown this species to have variable effects as cover for birds and other wildlife, depending on the distribution of the plant (e.g., patches and borders of reeds are used more by wildlife than expansive densely growing stands). Direct impacts of other grasses on wildlife populations are largely unknown. However, many of the invasive graminoid species that are present in New England have the capability of outcompeting native plants and thereby potentially affecting associated fauna. Preservation, protection, and restoration of grassland and open-land cover types are complex but necessary challenges in the region to maintain biological and genetic diversity of grassland, wetland, and other open-land obligate species.

  4. Genetic modification of wetland grasses for phytoremediation

    Energy Technology Data Exchange (ETDEWEB)

    Czako, M.; Liang Dali; Marton, L. [Dept. of Biological Sciences, Univ. of South Carolina, Columbia, SC (United States); Feng Xianzhong; He Yuke [National Lab. of Plant Molecular Genetics, Shanghai Inst. of Plant Physiology, Chinese Academy of Sciences, Shanghai, SH (China)


    Wetland grasses and grass-like monocots are very important natural remediators of pollutants. Their genetic improvement is an important task because introduction of key transgenes can dramatically improve their remediation potential. Tissue culture is prerequisite for genetic manipulation, and methods are reported here for in vitro culture and micropropagation of a number of wetland plants of various ecological requirements such as salt marsh, brackish water, riverbanks, and various zones of lakes and ponds, and bogs. The monocots represent numerous genera in various families such as Poaceae, Cyperaceae, Juncaceae, and Typhaceae. The reported species are in various stages of micropropagation and Arundo donax is scaled for mass propagation for selecting elite lines for pytoremediation. Transfer of key genes for mercury phytoremediation into the salt marsh cordgrass (Spartina alterniflora) is also reported here. All but one transgenic lines contained both the organomercurial lyase (merB) and mercuric reductase (merA) sequences showing that co-introduction into Spartina of two genes from separate Agrobacterium strains is possible. (orig.)

  5. Swine wastewater treatment using vertical subsurface flow constructed wetland planted with Napier grass

    Directory of Open Access Journals (Sweden)

    Pantip Klomjek


    Full Text Available This research aims to investigate the pollutant removal efficiencies in swine wastewater using a vertical subsurface flow constructed wetland (VSF CW planted with two species of Napier grass. The grass productivities were also cultivated and compared in order to provide information for species selection. Twelve treatment units were set up with the VSF CWs planted with Giant Napier grass (Pennisetum purpureum cv. King grass and Dwarf Napier grass (Pennisetum purpureum cv. Mott. with 2 and 5 cm d−1 of hydraulic loading rates (HLR. Comparisons of removal efficiency and grass productivity were analyzed using Duncan's Multiple Range Test and t-test at the significant level 0.05. Both species of Napier grass performed more than 70% of removal efficiency of BOD and TKN. The VSF CW planted with Giant Napier grass at 5 cm d−1 HLR performed the highest BOD removal efficiency of 94 ± 1%, while the 2 cm d−1 HLR removed COD with efficiency of 64 ± 6%. The results also showed the effluent from all treatment units contained averages of BOD, COD, TSS, TKN and pH that followed Thailand's swine wastewater quality standard. Average fresh yields and dry yields were between 4.6 ± 0.4 to 15.2 ± 1.2 and 0.5 ± 0.1 to 2.2 ± 0.1 kg m−2, respectively. The dry yields obtained from four cutting cycles in five months of CW system operation were higher than the ones planted with a traditional method, but declined continuously after each cutting cycle. Both species of Napier grass indicated their suitability to be used in the VSF CW for swine wastewater treatment.

  6. Bioenergy production from roadside grass

    DEFF Research Database (Denmark)

    Meyer, Ane Katharina Paarup; Ehimen, Ehiazesebhor Augustine; Holm-Nielsen, Jens Bo


    This paper presents a study of the feasibility of utilising roadside vegetation for biogas production in Denmark. The potential biomass yield, methane yields, and the energy balances of using roadside grass for biogas production was investigated based on spatial analysis. The results show...


    Directory of Open Access Journals (Sweden)

    Andi Lagaligo Amar


    Full Text Available A research study was undertaken to study the grass layer across a mini landscape dominated by tree legume Albizia lebbeck to explore the nutritional differences of two introduced grasses, guinea grass (Panicum maximum and sabi grass (Urochloa mosambicensis, paying particular attention to the presence or absence of tree legume canopy of Albizia lebbeck. The two grass species showed a tendency to replace the native spear grass (Heteropogon contortus; their dominance was more or less complete under tree canopies but was increasing in open areas between trees. Nutritional differences were examined by nitrogen concentration and dry matter digestibility. For comparison, Heteropogon contortus, a native species only found in the open, was included in the nutritional determination using the same methods as the guinea and sabi grasses. The quality parameters of the pasture species were statistically compared (LSD, P=0.05. The quality of herbage was different between the species. Urochloa mosambicensis was better than Panicum maximum. In the open, sabi grass has higher N content (0.62% than guinea grass (0.55%, but they were similar when grown under the canopy (0.69% and 0.72%, respectively. Sabi grass has consistently higher dry matter digestibility (41.39% and 36.83%, respectively under the canopy and in the open, than guinea grass (27.78% and 24.77%. These two species are much higher in both N concentration and dry matter digestibility than the native spear grass. The native species has contained 0.28% N, and 17.65% digestible dry matter. The feeding values of herbage were influenced by the canopy factor. Both guinea and sabi grasses have better quality when grown under the tree canopies than in between canopies. Nitrogen concentration and dry matter digestibility of the guinea grass under canopy were, 0.72% and 27.78%, respectively, significantly higher than those from the open area, 0.55% and 24.77%. Similarly, herbage of sabi grass under canopy has 0

  8. Relevance of Allergenic Sensitization to Cynodon dactylon and Phragmites communis: Cross-reactivity With Pooideae Grasses. (United States)

    López-Matas, M A; Moya, R; Cardona, V; Valero, A; Gaig, P; Malet, A; Viñas, M; García-Moral, A; Labrador, M; Alcoceba, E; Ibero, M; Carnés, J

    The homologous group of sweet grasses belongs to the Pooideae subfamily, but grass pollen species from other subfamilies can also cause allergy, such as Cynodon dactylon (Chloridoideae) and Phragmites communis (Arundinoideae). C dactylon and P communis have not been included in the sweet grasses homologous group because of their low cross-reactivity with other grasses. The aims of this study were to investigate the profile of sensitization to C dactylon and P communis in patients sensitized to grasses and to analyze cross-reactivity between these 2 species and temperate grasses. Patients were skin prick tested with a grass mixture (GM). Specific IgE to GM, C dactylon, P communis, Cyn d 1, and Phl p 1 was measured by ImmunoCAP. A pool of sera was used for the immunoblot assays. Cross-reactivity was studied by ELISA and immunoblot inhibition. Thirty patients had sIgE to GM. Twenty-four (80%) had positive results for C dactylon, 27 (90%) for P communis, 22 (73.3%) for nCyn d 1, and 92.9% for rPhl p 1. Bands were detected in the 3 extracts by immunoblot. Inhibition of GM was not observed with C dactylon or P communis by immunoblot or ELISA inhibition. When C dactylon or P communis were used in the solid phase, GM produced almost complete inhibition. Eighty percent of patients sensitized to grasses were also sensitized to C dactylon and 90% were sensitized to P communis. Sensitization to these species seems to be induced by allergens different to those in sweet grasses.

  9. Feasibility of Invasive Grass Detection in a Desertscrub Community Using Hyperspectral Field Measurements and Landsat TM Imagery


    Olsson, Aaryn D.; Leeuwen, Willem J.D. van; Marsh, Stuart E.


    Invasive species’ phenologies often contrast with those of native species, representing opportunities for detection of invasive species with multi-temporal remote sensing. Detection is especially critical for ecosystem-transforming species that facilitate changes in disturbance regimes. The African C4 grass, Pennisetum ciliare, is transforming ecosystems on three continents and a number of neotropical islands by introducing a grass-fire cycle. However, previous attempts at discriminating P. c...

  10. Interspecific associations and community structure: A local survey and analysis in a grass community

    Directory of Open Access Journals (Sweden)

    WenJun Zhang


    Full Text Available Interspecific associations in the plant community may help to understand the self-organizing assembly and succession of the community. In present study, Pearson correlation, net correlation, Spearman rank correlation, and point correlation were used to detect the interspecific (inter-family associations of grass species (families using the sampling data collected in a grass community of Zhuhai, China. We found that most associations between grass species (families were positive associations. The competition/interference/niche separation between grass species (families was not significant. A lot of pairs of grass species and families with statistically significant interspecific (inter-family associations based on four correlation measures were discovered. Cluster trees for grass species/families were obtained by using cluster analysis. Relationship among positive/negative associations, interspecific relationship and community succession/stability/robustness was discussed. I held that species with significant positive or negative associations are generally keystone species in the community. Although both negative and positive associations occur in the community succession, the adaptation and selection will finally result in the successful coexistence of the species with significant positive associations in the climax community. As the advance of community succession, the significant positive associations increase and maximize in climax community, and the significant negative associations increase to a maximum and then decline into climax community. Dominance of significant positive associations in the climax community means the relative stablility and equilibrium of the community. No significant associations usually account for the majority of possible interspecific associations at each phase of community succession. They guarantee the robustness of community. They are candidates of keystone species. Lose of some existing keystone species might be


    Directory of Open Access Journals (Sweden)



    Full Text Available The present study was conducted to investigate the prevalence of lernaeid ectoparasites in grass carp (Ctenopharyngodon idella. For this purpose, 597 fishes (Ctenopharyngodon idella were examined for lernaeid ectoparasites at a private fish farm located in Multan, Pakistan. Four species of the genus Lernaea i.e. L. cyprinacea, L. polymorpha, L. oryzophila, and L. lophiara were recorded. It was observed that L. polymorpha had the highest (P20 cm.



    A.O. Idris; C. Kijora; A.M. Salih; I. Bushara; H.A.A. Elbukhary


    Eighteen plant species, three ingredients, and six diets were studied for their degradation characteristics, using gas production techniques. The palatable grasses were selected during the rainy season from the range land of Kordofan, Sudan. The ingredients were Roselle seeds, Sorghum grain and Groundnut cake. The samples were incubated for 4, 8, 12, 24, 48, 72 and 96 h, using rumen inoculum of three of the sheep used for the nylon bag. The results showed a large variation between the differe...

  13. Forage mass and stocking rate of elephant grass pastures managed under agroecological and conventional systems


    Clair Jorge Olivo; Carlos Alberto Agnolin; Priscila Flôres Aguirre; Cláudia Marques de Bem; Tiago Luís da Ros de Araújo; Michelle Schalemberg Diehl; Gilmar Roberto Meinerz


    The objective was to evaluate elephant grass (Pennisetum purpureum Schum.) pastures, under the agroecological and conventional systems, as forage mass and stocking rate. In the agroecological system, the elephant grass was established in rows spaced by 3.0 m from each other. During the cool season ryegrass (Lolium multiflorum Lam.) was established between these rows, which allowed the development of spontaneous growth species during the warm season. In the conventional system the elephant gra...

  14. Photosynthetic pathways and the geographical distribution of grasses in South West Africa/Namibia

    International Nuclear Information System (INIS)

    Ellis, R.P.; Vogel, J.C.; Fuls, A.


    Analysis of floristic lists for South West Africa/Namibia shows that, throughout the territory, more than 95% of the grass species occurring in any given area display the C 4 photosynthetic pathway. Exceptions are areas in the north-east and southwest where between 5% and 18% of the grass species are of the C 3 type. The south-western district of Luderitz falls within the winter rainfall area and it is only here that temperate C 3 genera are found. The C 3 species in the north-east belong to tropical groups. Most of the South West African C 3 grasses grow in specialized habitats and are either hydrophytes or sciophytes. Subdivision of the C 4 grasses into the three subtypes of the C 4 pathway reveals distinctive distributional trends. Malate formers or NADP-me species clearly become more abundant with increasing rainfall, whereas the aspartate formers show the opposite tendency. However, within the aspartate forming group the results show that it is specifically the NAD-me type of species which dominate in areas of very low precipitation, notably in the Namib and pre-Namib areas where rainfall is less than 200 mm/yr. The PEP-ck species form a group intermediate between the malate formers and the NAD-me grasses, especially as far as their water requirements are concerned [af

  15. Photosynthetic pathways and the geographical distribution of grasses in South West Africa/Namibia

    Energy Technology Data Exchange (ETDEWEB)

    Ellis, R P [Department of Agriculture and Fisheries, Pretoria (South Africa). Botanical Research Institute; Vogel, J C; Fuls, A [Council for Scientific and Industrial Research, Pretoria (South Africa). National Physical Research Lab.


    Analysis of floristic lists for South West Africa/Namibia shows that, throughout the territory, more than 95% of the grass species occurring in any given area display the C/sub 4/ photosynthetic pathway. Exceptions are areas in the north-east and southwest where between 5% and 18% of the grass species are of the C/sub 3/ type. The south-western district of Luderitz falls within the winter rainfall area and it is only here that temperate C/sub 3/ genera are found. The C/sub 3/ species in the north-east belong to tropical groups. Most of the South West African C/sub 3/ grasses grow in specialized habitats and are either hydrophytes or sciophytes. Subdivision of the C/sub 4/ grasses into the three subtypes of the C/sub 4/ pathway reveals distinctive distributional trends. Malate formers or NADP-me species clearly become more abundant with increasing rainfall, whereas the aspartate formers show the opposite tendency. However, within the aspartate forming group the results show that it is specifically the NAD-me type of species which dominate in areas of very low precipitation, notably in the Namib and pre-Namib areas where rainfall is less than 200 mm/yr. The PEP-ck species form a group intermediate between the malate formers and the NAD-me grasses, especially as far as their water requirements are concerned.

  16. The Neutral Detergent Fiber Digestibility of Some Tropical Grasses at Different Stage of Maturity

    Directory of Open Access Journals (Sweden)

    P Mahyuddin


    Full Text Available The digestibility of neutral detergent fiber (IVNDFD was determined by Telly and Terry methods in vitro on 5 tropical grasses species, Sorghum, Themeda, Iseilema, Brachyacne and Dicanthium. Stem and leaf samples were harvested at different maturity stages, started from early flowering stage to the stage when the grasses were dried. In general, IVNDFD ranged from 22% to 41%. Stages of maturity affected IVNDFD in 4 species; IVNDFD was higher in the stems than in the leaves for 2 species out of 5 species of grasses; the rest was similar. There was no correlation between NDF and IVNDFD, showing that NDF degradability in the rumen was vary. Digestibility potential of NDF (PDNDF varied from 21% to 44% and has negative correlation with IVNDFD (r=0.75. Growth affected PDNDF in 2 species; and 3 out 5 species observed showed PDNDF in the leaves was higher than that in the stems. Negative correlation was exist between dry matter digestibility (IVDMD, water soluble extract (WSE and protein with PDNDF. Grasses with stated PDNDF values have relatively high NDF retention in the rumen, which will cause low NDF or dry matter consumption. (Animal Production 11(3: 189-195 (2009Key Words: NDF digestibility, tropical grasses, stem, leaves, maturity stage

  17. Using multi-date satellite imagery to monitor invasive grass species distribution in post-wildfire landscapes: An iterative, adaptable approach that employs open-source data and software (United States)

    West, Amanda M.; Evangelista, Paul H.; Jarnevich, Catherine S.; Kumar, Sunil; Swallow, Aaron; Luizza, Matthew; Chignell, Steve


    Among the most pressing concerns of land managers in post-wildfire landscapes are the establishment and spread of invasive species. Land managers need accurate maps of invasive species cover for targeted management post-disturbance that are easily transferable across space and time. In this study, we sought to develop an iterative, replicable methodology based on limited invasive species occurrence data, freely available remotely sensed data, and open source software to predict the distribution of Bromus tectorum (cheatgrass) in a post-wildfire landscape. We developed four species distribution models using eight spectral indices derived from five months of Landsat 8 Operational Land Imager (OLI) data in 2014. These months corresponded to both cheatgrass growing period and time of field data collection in the study area. The four models were improved using an iterative approach in which a threshold for cover was established, and all models had high sensitivity values when tested on an independent dataset. We also quantified the area at highest risk for invasion in future seasons given 2014 distribution, topographic covariates, and seed dispersal limitations. These models demonstrate the effectiveness of using derived multi-date spectral indices as proxies for species occurrence on the landscape, the importance of selecting thresholds for invasive species cover to evaluate ecological risk in species distribution models, and the applicability of Landsat 8 OLI and the Software for Assisted Habitat Modeling for targeted invasive species management.

  18. A genomic approach to elucidating grass flower development

    Directory of Open Access Journals (Sweden)

    Dornelas Marcelo C.


    Full Text Available In sugarcane (Saccharum sp as with other species of grass, at a certain moment of its life cycle the vegetative meristem is converted into an inflorescence meristem which has at least two distinct inflorescence branching steps before the spikelet meristem terminates in the production of a flower (floret. In model dicotyledonous species such successive conversions of meristem identities and the concentric arrangement of floral organs in specific whorls have both been shown to be genetically controlled. Using data from the Sugarcane Expressed Sequence Tag (EST Project (SUCEST database, we have identified all sugarcane proteins and genes putatively involved in reproductive meristem and flower development. Sequence comparisons of known flower-related genes have uncovered conserved evolutionary pathways of flower development and flower pattern formation between dicotyledons and monocotyledons, such as some grass species. We have paid special attention to the analysis of the MADS-box multigene family of transcription factors that together with the APETALA2 (AP2 family are the key elements of the transcriptional networks controlling plant reproductive development. Considerations on the evolutionary developmental genetics of grass flowers and their relation to the ABC homeotic gene activity model of flower development are also presented.

  19. Dynamika przyrostu masy i produktywność stokłosy bezostnej i stokłosy uniolowatej przy zróżnieowanym nawożeniu azotem w doświadczeniu polowym. Cz. II. Jakość plonu [Dynamics of mass increase and productivity of smooth brome grass and rescue grass with different nitrogen fertilization in field experiments. Part II. Quality of yield

    Directory of Open Access Journals (Sweden)

    Henryk Skrabka


    Full Text Available The contents of protein, amino acids, reducing sugars, fibre (ADF, lignin (ADL and mineral components in tissues of smooth brome grass – Bromus inermis and rescue grass – Bromus unioloides were determined. The purpose of this investigation was to compare the nutritive value of either species of grass.

  20. A consensus linkage map of the grass carp (Ctenopharyngodon idella based on microsatellites and SNPs

    Directory of Open Access Journals (Sweden)

    Li Jiale


    Full Text Available Abstract Background Grass carp (Ctenopharyngodon idella belongs to the family Cyprinidae which includes more than 2000 fish species. It is one of the most important freshwater food fish species in world aquaculture. A linkage map is an essential framework for mapping traits of interest and is often the first step towards understanding genome evolution. The aim of this study is to construct a first generation genetic map of grass carp using microsatellites and SNPs to generate a new resource for mapping QTL for economically important traits and to conduct a comparative mapping analysis to shed new insights into the evolution of fish genomes. Results We constructed a first generation linkage map of grass carp with a mapping panel containing two F1 families including 192 progenies. Sixteen SNPs in genes and 263 microsatellite markers were mapped to twenty-four linkage groups (LGs. The number of LGs was corresponding to the haploid chromosome number of grass carp. The sex-specific map was 1149.4 and 888.8 cM long in females and males respectively whereas the sex-averaged map spanned 1176.1 cM. The average resolution of the map was 4.2 cM/locus. BLAST searches of sequences of mapped markers of grass carp against the whole genome sequence of zebrafish revealed substantial macrosynteny relationship and extensive colinearity of markers between grass carp and zebrafish. Conclusions The linkage map of grass carp presented here is the first linkage map of a food fish species based on co-dominant markers in the family Cyprinidae. This map provides a valuable resource for mapping phenotypic variations and serves as a reference to approach comparative genomics and understand the evolution of fish genomes and could be complementary to grass carp genome sequencing project.

  1. A molecular identification system for grasses: a novel technology for forensic botany. (United States)

    Ward, J; Peakall, R; Gilmore, S R; Robertson, J


    Our present inability to rapidly, accurately and cost-effectively identify trace botanical evidence remains the major impediment to the routine application of forensic botany. Grasses are amongst the most likely plant species encountered as forensic trace evidence and have the potential to provide links between crime scenes and individuals or other vital crime scene information. We are designing a molecular DNA-based identification system for grasses consisting of several PCR assays that, like a traditional morphological taxonomic key, provide criteria that progressively identify an unknown grass sample to a given taxonomic rank. In a prior study of DNA sequences across 20 phylogenetically representative grass species, we identified a series of potentially informative indels in the grass mitochondrial genome. In this study we designed and tested five PCR assays spanning these indels and assessed the feasibility of these assays to aid identification of unknown grass samples. We confirmed that for our control set of 20 samples, on which the design of the PCR assays was based, the five primer combinations produced the expected results. Using these PCR assays in a 'blind test', we were able to identify 25 unknown grass samples with some restrictions. Species belonging to genera represented in our control set were all correctly identified to genus with one exception. Similarly, genera belonging to tribes in the control set were correctly identified to the tribal level. Finally, for those samples for which neither the tribal or genus specific PCR assays were designed, we could confidently exclude these samples from belonging to certain tribes and genera. The results confirmed the utility of the PCR assays and the feasibility of developing a robust full-scale usable grass identification system for forensic purposes.

  2. The potential of C4 grasses for cellulosic biofuel production

    Directory of Open Access Journals (Sweden)

    Tim eWeijde


    Full Text Available With the advent of biorefinery technologies enabling plant biomass to be processed into biofuel, many researchers set out to study and improve candidate biomass crops. Many of these candidates are C4 grasses, characterized by a high productivity and resource use efficiency. In this review the potential of five C4 grasses as lignocellulose feedstock for biofuel production is discussed. These include three important field crops - maize, sugarcane and sorghum - and two undomesticated perennial energy grasses - miscanthus and switchgrass. Although all these grasses are high yielding, they produce different products. While miscanthus and switchgrass are exploited exclusively for lignocellulosic biomass, maize, sorghum and sugarcane are dual-purpose crops. It is unlikely that all the prerequisites for the sustainable and economic production of biomass for a global cellulosic biofuel industry will be fulfilled by a single crop. High and stable yields of lignocellulose are required in diverse environments worldwide, to sustain a year-round production of biofuel. A high resource use efficiency is indispensable to allow cultivation with minimal inputs of nutrients and water and the exploitation of marginal soils for biomass production. Finally, the lignocellulose composition of the feedstock should be optimized to allow its efficient conversion into biofuel and other by-products. Breeding for these objectives should encompass diverse crops, to meet the demands of local biorefineries and provide adaptability to different environments. Collectively, these C4 grasses are likely to play a central role in the supply of lignocellulose for the cellulosic ethanol industry. Moreover, as these species are evolutionary closely related, advances in each of these crops will expedite improvements in the other crops. This review aims to provide an overview of their potential, prospects and research needs as lignocellulose feedstocks for the commercial production of

  3. Differentiation of plant age in grasses using remote sensing (United States)

    Knox, Nichola M.; Skidmore, Andrew K.; van der Werff, Harald M. A.; Groen, Thomas A.; de Boer, Willem F.; Prins, Herbert H. T.; Kohi, Edward; Peel, Mike


    Phenological or plant age classification across a landscape allows for examination of micro-topographical effects on plant growth, improvement in the accuracy of species discrimination, and will improve our understanding of the spatial variation in plant growth. In this paper six vegetation indices used in phenological studies (including the newly proposed PhIX index) were analysed for their ability to statistically differentiate grasses of different ages in the sequence of their development. Spectra of grasses of different ages were collected from a greenhouse study. These were used to determine if NDVI, NDWI, CAI, EVI, EVI2 and the newly proposed PhIX index could sequentially discriminate grasses of different ages, and subsequently classify grasses into their respective age category. The PhIX index was defined as: (AVNIRn+log(ASWIR2n))/(AVNIRn-log(ASWIR2n)), where AVNIRn and ASWIR2n are the respective normalised areas under the continuum removed reflectance curve within the VNIR (500-800 nm) and SWIR2 (2000-2210 nm) regions. The PhIX index was found to produce the highest phenological classification accuracy (Overall Accuracy: 79%, and Kappa Accuracy: 75%) and similar to the NDVI, EVI and EVI2 indices it statistically sequentially separates out the developmental age classes. Discrimination between seedling and dormant age classes and the adult and flowering classes was problematic for most of the tested indices. Combining information from the visible near infrared (VNIR) and shortwave infrared region (SWIR) region into a single phenological index captures the phenological changes associated with plant pigments and the ligno-cellulose absorption feature, providing a robust method to discriminate the age classes of grasses. This work provides a valuable contribution into mapping spatial variation and monitoring plant growth across savanna and grassland ecosystems.

  4. Overlap in nitrogen sources and redistribution of nitrogen between trees and grasses in a semi-arid savanna. (United States)

    Priyadarshini, K V R; Prins, Herbert H T; de Bie, Steven; Heitkönig, Ignas M A; Woodborne, Stephan; Gort, Gerrit; Kirkman, Kevin; Fry, Brian; de Kroon, Hans


    A key question in savanna ecology is how trees and grasses coexist under N limitation. We used N stable isotopes and N content to study N source partitioning across seasons from trees and associated grasses in a semi-arid savanna. We also used (15)N tracer additions to investigate possible redistribution of N by trees to grasses. Foliar stable N isotope ratio (δ(15)N) values were consistent with trees and grasses using mycorrhiza-supplied N in all seasons except in the wet season when they switched to microbially fixed N. The dependence of trees and grasses on mineralized soil N seemed highly unlikely based on seasonal variation in mineralization rates in the Kruger Park region. Remarkably, foliar δ(15)N values were similar for all three tree species differing in the potential for N fixation through nodulation. The tracer experiment showed that N was redistributed by trees to understory grasses in all seasons. Our results suggest that the redistribution of N from trees to grasses and uptake of N was independent of water redistribution. Although there is overlap of N sources between trees and grasses, dependence on biological sources of N coupled with redistribution of subsoil N by trees may contribute to the coexistence of trees and grasses in semi-arid savannas.

  5. Ecology, genetics, and biological control of invasive annual grasses in the Great Basin (United States)

    Several annual grass species native to Eurasia, including cheatgrass (Bromus tectorum), red brome (B. rubens), and medusahead (Taeniatherum caput-medusae) have become invasive in the western USA. These invasive species degrade rangelands by compromising forage, outcompeting native flora, and exacerb...

  6. Overexpression of the WOX gene STENOFOLIA improves biomass yield and sugar release in transgenic grasses and display altered cytokinin homeostasis.

    Directory of Open Access Journals (Sweden)

    Hui Wang


    Full Text Available Lignocellulosic biomass can be a significant source of renewable clean energy with continued improvement in biomass yield and bioconversion strategies. In higher plants, the leaf blade is the central energy convertor where solar energy and CO2 are assimilated to make the building blocks for biomass production. Here we report that introducing the leaf blade development regulator STENOFOLIA (STF, a WOX family transcription factor, into the biofuel crop switchgrass, significantly improves both biomass yield and sugar release. We found that STF overexpressing switchgrass plants produced approximately 2-fold more dry biomass and release approximately 1.8-fold more solubilized sugars without pretreatment compared to controls. The biomass increase was attributed mainly to increased leaf width and stem thickness, which was also consistent in STF transgenic rice and Brachypodium, and appeared to be caused by enhanced cell proliferation. STF directly binds to multiple regions in the promoters of some cytokinin oxidase/dehydrogenase (CKX genes and represses their expression in all three transgenic grasses. This repression was accompanied by a significant increase in active cytokinin content in transgenic rice leaves, suggesting that the increase in biomass productivity and sugar release could at least in part be associated with improved cytokinin levels caused by repression of cytokinin degrading enzymes. Our study provides a new tool for improving biomass feedstock yield in bioenergy crops, and uncovers a novel mechanistic insight in the function of STF, which may also apply to other repressive WOX genes that are master regulators of several key plant developmental programs.

  7. Transfer of radiocaesium to barley, rye grass and pea

    International Nuclear Information System (INIS)

    Oehlenschlaeger, M.; Gissel-Nielsen, G.


    In areas with intensive farming, as in Denmark, it is of great interest to identify possible countermeasures to be taken in order to reduce the longterm effects of radioactive contamination of arable land. The most important longer-lived radionuclides from the Chernobyl were 137 Cs and 134 Cs. The aim of the present project was to identify crops with relatively low or high root uptake of these two isotopes. Although such differences may be small, a shift in varieties might be a cost-effective way to reduce collective doses. The experiment was carried out at Risoe National Laboratory in the summer of 1988. The species used were: spring barley (Hordeum vulgare L) varieties: Golf, Apex, Anker, Sila; Perennial rye grass (Lolium perenne L.) varieties: Darbo (early) and Patoro (late); Italian rye-grass (Lolium multiflorum) variety: Prego; and pea (Pisum arvense L.) variety: Bodil. Each crop was grown in two types of soil, a clay-loam and an organic soil. 137 Cs was added to the clay-loam. The organic soil, which was contaminated with 137 Cs from the Chernobyl accident, was supplied with 134 Cs. Sila barley and Italian rye-grass were identified among the species tested as plants with a relative high uptake of radio-caesium. (author)

  8. Monoclonal antibodies to the major Lolium perenne (rye grass) pollen allergen Lol p I (Rye I). (United States)

    Kahn, C R; Marsh, D G


    Thirteen monoclonal antibodies (MAbs) were produced against Lol p I (Rye I), the major Lolium perenne (rye grass) pollen allergen. Spleen cells from A/J and SJL mice immunized with highly purified Lol p I (Lol I) were allowed to fuse with cells from the non-secreting Sp2/0-Ag14 myeloma cell line. Each MAb was analyzed for antigenic specificity by radioimmunoassay (RIA) using 125I-Lol I. The epitope specificities of seven of the MAbs were examined by competitive binding against a labelled standard MAb for the Lol I antigen (Ag). The dissociation constant, Kd, of one MAb (No. 3.2) that was studied most extensively was determined by double Ab RIA to be 3.5 X 10(-6) L/M. This MAb recognized the related 27,000-30,000 Group I glycoproteins found in the pollens of nine other species of grass pollens tested, including weak binding to Bermuda grass Group I (Cyn d I), which by conventional analysis using polyclonal anti-Lol I serum shows no detectable binding. Monoclonal antibody No. 3.2 was coupled covalently to Sepharose 4B and used to prepare highly purified Lol I from a partially purified rye pollen extract. Finally, an RIA was developed which permitted the analysis of the Group I components in rye grass and nine other grass pollen species. The latter assay is likely to prove useful in the standardization of grass pollen extracts according to their Group I contents.

  9. Deciphering the genomic structure, function and evolution of carotenogenesis related phytoene synthases in grasses

    Directory of Open Access Journals (Sweden)

    Dibari Bianca


    Full Text Available Abstract Background Carotenoids are isoprenoid pigments, essential for photosynthesis and photoprotection in plants. The enzyme phytoene synthase (PSY plays an essential role in mediating condensation of two geranylgeranyl diphosphate molecules, the first committed step in carotenogenesis. PSY are nuclear enzymes encoded by a small gene family consisting of three paralogous genes (PSY1-3 that have been widely characterized in rice, maize and sorghum. Results In wheat, for which yellow pigment content is extremely important for flour colour, only PSY1 has been extensively studied because of its association with QTLs reported for yellow pigment whereas PSY2 has been partially characterized. Here, we report the isolation of bread wheat PSY3 genes from a Renan BAC library using Brachypodium as a model genome for the Triticeae to develop Conserved Orthologous Set markers prior to gene cloning and sequencing. Wheat PSY3 homoeologous genes were sequenced and annotated, unravelling their novel structure associated with intron-loss events and consequent exonic fusions. A wheat PSY3 promoter region was also investigated for the presence of cis-acting elements involved in the response to abscisic acid (ABA, since carotenoids also play an important role as precursors of signalling molecules devoted to plant development and biotic/abiotic stress responses. Expression of wheat PSYs in leaves and roots was investigated during ABA treatment to confirm the up-regulation of PSY3 during abiotic stress. Conclusions We investigated the structural and functional determinisms of PSY genes in wheat. More generally, among eudicots and monocots, the PSY gene family was found to be associated with differences in gene copy numbers, allowing us to propose an evolutionary model for the entire PSY gene family in Grasses.

  10. Invasive Andropogon gayanus (gamba grass) is an ecosystem transformer of nitrogen relations in Australian savanna. (United States)

    Rossiter-Rachor, N A; Setterfield, S A; Douglas, M M; Hutley, L B; Cook, G D; Schmidt, S


    Invasion by the African grass Andropogon gayanus is drastically altering the understory structure of oligotrophic savannas in tropical Australia. We compared nitrogen (N) relations and phenology of A. gayanus and native grasses to examine the impact of invasion on N cycling and to determine possible reasons for invasiveness of A. gayanus. Andropogon gayanus produced up to 10 and four times more shoot phytomass and root biomass, with up to seven and 2.5 times greater shoot and root N pools than native grass understory. These pronounced differences in phytomass and N pools between A. gayanus and native grasses were associated with an altered N cycle. Most growth occurs in the wet season when, compared with native grasses, dominance of A. gayanus was associated with significantly lower total soil N pools, lower nitrification rates, up to three times lower soil nitrate availability, and up to three times higher soil ammonium availability. Uptake kinetics for different N sources were studied with excised roots of three grass species ex situ. Excised roots of A. gayanus had an over six times higher-uptake rate of ammonium than roots of native grasses, while native grass Eriachne triseta had a three times higher uptake rate of nitrate than A. gayanus. We hypothesize that A. gayanus stimulates ammonification but inhibits nitrification, as was shown to occur in its native range in Africa, and that this modification of the soil N cycle is linked to the species' preference for ammonium as an N source. This mechanism could result in altered soil N relations and could enhance the competitive superiority and persistence of A. gayanus in Australian savannas.

  11. Enhancing GRASS data communication with videographic technology

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, R.G. [Argonne National Lab., IL (United States); Gerdes, D.; Youngs, D. [Army Construction Engineering Research Lab., Champaign, IL (United States)


    Research at Argonne National Laboratory and the US Army Construction Engineering Research Laboratory has shown that computer videographic technology can be used to assist visualization and communication of GIS-generated geographic information. Videographic tools can be used to make results of GRASS analyses clear to decision-makers and to public interest groups, as well as to help GRASS users visualize geographic data more easily. Useful videographic visualization tools include graphic overlay of GRASS layers onto panchromatic images, allowing landscape features to be associated with GIS classifications; draping of GIS layers onto terrain models to create shaded relief maps; and incorporation of photographic imagery into GIS graphics. Useful videographic communications capabilities include convenient, direct interface to video formats, allowing incorporation of live video into GRASS graphics and output of GRASS graphics to video; convenient output of high-quality slides and prints; and enhanced labeling and editing of GRASS images. Conversion of GRASS imagery to standard videographic file formats also facilitates incorporation of GRASS images into other software programs, such as database and work-processing packages.

  12. Enhancing GRASS data communication with videographic technology

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, R.G. (Argonne National Lab., IL (United States)); Gerdes, D.; Youngs, D. (Army Construction Engineering Research Lab., Champaign, IL (United States))


    Research at Argonne National Laboratory and the US Army Construction Engineering Research Laboratory has shown that computer videographic technology can be used to assist visualization and communication of GIS-generated geographic information. Videographic tools can be used to make results of GRASS analyses clear to decision-makers and to public interest groups, as well as to help GRASS users visualize geographic data more easily. Useful videographic visualization tools include graphic overlay of GRASS layers onto panchromatic images, allowing landscape features to be associated with GIS classifications; draping of GIS layers onto terrain models to create shaded relief maps; and incorporation of photographic imagery into GIS graphics. Useful videographic communications capabilities include convenient, direct interface to video formats, allowing incorporation of live video into GRASS graphics and output of GRASS graphics to video; convenient output of high-quality slides and prints; and enhanced labeling and editing of GRASS images. Conversion of GRASS imagery to standard videographic file formats also facilitates incorporation of GRASS images into other software programs, such as database and work-processing packages.

  13. Thermogravimetric analysis of forest understory grasses (United States)

    Thomas Elder; John S. Kush; Sharon M. Hermann


    Forest understory grasses are of significance in the initiation, establishment and maintenance of fire, whether used as a management tool or when occurring as wildfire. The fundamental thermal properties of such grasses are critical to their behavior in fire situations and have been investigated in the current work by the application of thermogravimetric analysis (TGA...

  14. Evaluation of Brachypodium distachyon L-Tyrosine Decarboxylase Using L-Tyrosine Over-Producing Saccharomyces cerevisiae.

    Directory of Open Access Journals (Sweden)

    Shuhei Noda

    Full Text Available To demonstrate that herbaceous biomass is a versatile gene resource, we focused on the model plant Brachypodium distachyon, and screened the B. distachyon for homologs of tyrosine decarboxylase (TDC, which is involved in the modification of aromatic compounds. A total of 5 candidate genes were identified in cDNA libraries of B. distachyon and were introduced into Saccharomyces cerevisiae to evaluate TDC expression and tyramine production. It is suggested that two TDCs encoded in the transcripts Bradi2g51120.1 and Bradi2g51170.1 have L-tyrosine decarboxylation activity. Bradi2g51170.1 was introduced into the L-tyrosine over-producing strain of S. cerevisiae that was constructed by the introduction of mutant genes that promote deregulated feedback inhibition. The amount of tyramine produced by the resulting transformant was 6.6-fold higher (approximately 200 mg/L than the control strain, indicating that B. distachyon TDC effectively converts L-tyrosine to tyramine. Our results suggest that B. distachyon possesses enzymes that are capable of modifying aromatic residues, and that S. cerevisiae is a suitable host for the production of L-tyrosine derivatives.

  15. Satellite Phenology Observations Inform Peak Season of Allergenic Grass Pollen Aerobiology across Two Continents (United States)

    Huete, A. R.; Devadas, R.; Davies, J.


    Pollen exposure and prevalence of allergenic diseases have increased in many parts of the world during the last 30 years, with exposure to aeroallergen grass pollen expected to intensify with climate change, raising increased concerns for allergic diseases. The primary contributing factors to higher allergenic plant species presence are thought to be climate change, land conversion, and biotic mixing of species. Conventional methods for monitoring airborne pollen are hampered by a lack of sampling sites and heavily rely on meteorology with less attention to land cover updates and monitoring of key allergenic species phenology stages. Satellite remote sensing offers an alternative method to overcome the restrictive coverage afforded by in situ pollen networks by virtue of its synoptic coverage and repeatability of measurements that enable timely updates of land cover and land use information and monitoring landscape dynamics and interactions with human activity and climate. In this study, we assessed the potential of satellite observations of urban/peri-urban environments to directly inform landscape conditions conducive to pollen emissions. We found satellite measurements of grass cover phenological evolution to be highly correlated with in situ aerobiological grass pollen concentrations in five urban centres located across two hemispheres (Australia and France). Satellite greenness data from the Moderate Resolution Imaging Spectroradiometer (MODIS) were found to be strongly synchronous with grass pollen aerobiology in both temperate grass dominated sites (France and Melbourne), as well as in Sydney, where multiple pollen peaks coincided with the presence of subtropical grasses. Employing general additive models (GAM), the satellite phenology data provided strong predictive capabilities to inform airborne pollen levels and forecast periods of grass pollen emissions at all five sites. Satellite phenology offer promising opportunities of improving public health risk


    Directory of Open Access Journals (Sweden)

    N. V. Miroshnik


    Full Text Available Pine forests Chigirinsky Bor grow on fresh sod-podzolic soils formed on ancient alluvial deposits. Pine forests are characterized by stringent moisture regimes and constantly suffer from lack of productive moisture in soil.  Industrial development of Cherkasy in 60th years of ХХ century leaded air pollution and emissions of SO2, NOx, NH3, and dust. This contributed to significant negative influence on the surrounding forest ecosystems from enterprises of  Cherkassy industrial agglomeration. The grass cover in pine stands of Chigirinsky Bor transforms into xerophytic grasses and ruderal communities under the impact of negative biotic and abiotic factors. They are namely the anthropogenic violation of forest conditions, stands decline, recreational and industrial tree crowns understocking, xerophytic and heliophytic transformations of forest conditions. All the above mentioned caused strong ruderal and adventive transformation of grass cover. We registered the changes in nitrophilous plant spread regards the Cherkasy industrial agglomeration approaching which emits toxic with nitrogen-containing gases. Adventive and other non-forest species displace ferns and mosses, the ratio of ecomorfs is also changes due to increase of the quantity and development activation of annuals, xerophytic, ruderal, and nitrofil plants. The Asteraceae/Brassicaceae 3:1 ratio indicates significant anthropogenic violations in the region. We fixed the xerophytic, ruderal, and adventive transformation of grass cover in forest ecosystems. It is also founded the tendency of expanding the fraction of mesophilic plant species due to alterations in water regime (creation of Kremenchug reservoir and draining of floodplain Tyasmyn. When approaching the Cherkasy industrial agglomeration the grass cover degradation is clearly observed on the environmental profile. All this causes the forest ecosystem degradation and gradual loss of forest vegetation typical characteristics. We

  17. Molecular cloning, characterization and expression analysis of coagulation factor VII gene in grass carp (Ctenopharyngodon idella). (United States)

    Liu, Qiaolin; Xu, Baohong; Xiao, Tiaoyi; Su, Jianming; Zhong, Lei


    Coagulation factor VII has been studied in several species but, to date, not in grass carp (Ctenopharyngodon idella), a commercially important freshwater fish found in China. In this study, the full-length cDNA of grass carp coagulation factor VII (GcCFVII) was cloned using a RACE-Ready cDNA Kit, grass carp were challenged with a hemorrhagic virus, and temporal expression profiles of GcCFVII in the thymus, gills, liver, spleen, and head kidney were examined at 0 h, 24 h, 48 h, 72 h, 96 h, and 138 h using fluorescence quantitative PCR. The results showed the 1480 bp GcCFVII to contain three conservative motifs: Gla, EGF-CA, and Tryp-SPc, similar to other species. Phylogenetic analysis showed the evolution of GcCFVII gene to be consistent with the evolution of the species. After viral challenge, GcCFVII expression in five tissues of grass carp showed different patterns of fluctuation. These results provide a solid basis for further investigation of GcCFVII and its relationship with grass carp hemorrhage. Copyright © 2013 Elsevier Ltd. All rights reserved.

  18. Detrimental and neutral effects of a wild grass-fungal endophyte symbiotum on insect preference and performance. (United States)

    Clement, Stephen L; Hu, Jinguo; Stewart, Alan V; Wang, Bingrui; Elberson, Leslie R


    Seed-borne Epichloë/Neotyphodium Glenn, Bacon, Hanlin (Ascomycota: Hypocreales: Clavicipitaceae) fungal endophytes in temperate grasses can provide protection against insect attack with the degree of host resistance related to the grass-endophyte symbiotum and the insect species involved in an interaction. Few experimental studies with wild grass-endophyte symbiota, compared to endophyte-infected agricultural grasses, have tested for anti-insect benefits, let alone for resistance against more than one insect species. This study quantified the preference and performance of the bird cherry oat-aphid, Rhopalosiphum padi (L.) (Hemiptera: Aphididae) and the cereal leaf beetle, Oulema melanopus (L.) (Coleoptera: Chrysomelidae), two important pests of forage and cereal grasses, on Neotyphodium-infected (E+) and uninfected (E-) plants of the wild grass Alpine timothy, Phleum alpinum L. (Poales: Poaceae). The experiments tested for both constitutive and wound-induced resistance in E+ plants to characterize possible plasticity of defense responses by a wild E+ grass. The aphid, R. padi preferred E- over E+ test plants in choice experiments and E+ undamaged test plants constitutively expressed antibiosis resistance to this aphid by suppressing population growth. Prior damage of E+ test plants did not induce higher levels of resistance to R. padi. By contrast, the beetle, O. melanopus showed no preference for E+ or E- test plants and endophyte infection did not adversely affect the survival and development of larvae. These results extend the phenomenon of variable effects of E+ wild grasses on the preference and performance of phytophagous insects. The wild grass- Neotyphodium symbiotum in this study broadens the number of wild E+ grasses available for expanded explorations into the effects of endophyte metabolites on insect herbivory.

  19. Production of tropical forage grasses under different shading levels

    Directory of Open Access Journals (Sweden)

    Francisco Eduardo Torres


    Full Text Available This study aimed to evaluate the forage production of three tropical forage grasses under different shading levels. The experiment was conducted in a greenhouse at Universidade Estadual de Mato Grosso do Sul, University Unit of Aquidauana (UEMS/UUA, in a soil classified as Ultisol sandy loam texture. The treatments consisted of three grasses species combinations (B. brizantha cv. Marandu, B. decumbens cv. Basilisck and Panicum maximum cv. Tanzania, submitted to four shading levels (0, 30, 50 and 75%, arranged in a completely randomized blocks design in a factorial 3 x 4, with eight replications. After harvest, the plants were separated into shoot and roots for determination of shoot fresh mass (SFM, shoot dry mass (SDM and roots dry mass production. After analysis of variance, the qualitative factor was subjected to comparison of averages by Tukey’s test, and the quantitative factor to analysis of polynomial regression, being interactions appropriately unfolded. It was verified that B. decumbens, by its linearly increasing production of forage and less decrease of root formation, is the most recommended for shading conditions compared to grasses Tanzania and Marandu.

  20. Capim - gordura (Melinis minutiflora P. Beauv., uma gramínea exótica que compromete a recuperação de áreas degradadas em unidades de conservação Molasses grass (Melinis minutiflora P. Beauv., an exotic species compromising the recuperation of degraded areas in conservation units

    Directory of Open Access Journals (Sweden)

    Carlos Romero Martins


    Full Text Available O capim-gordura, Melinis minutiflora, é uma gramínea de origem africana que invade áreas degradadas da região do Cerrado em detrimento das espécies nativas. A interferência do capim-gordura no processo de sucessão e o efeito da queimada controlada sobre essa gramínea foram estudados em uma cascalheira localizada no Parque Nacional de Brasília. O estudo foi realizado numa área experimental em que, em 1993, havia sido implantado um experimento para avaliar o estabelecimento de gramíneas nativas pela técnica do "coquetel de sementes". Mesmo não estando entre as espécies semeadas, o capim-gordura estabeleceu-se nas parcelas experimentais, onde se incorporou torta de mamona ou turfa. Metade das parcelas que apresentaram os melhores índices de cobertura do solo foi queimada no final da estação seca, em setembro de 1998. Em maio de 1999, oito meses após a queimada verificou-se redução da cobertura do substrato superior a 50%, em comparação com a cobertura antes da queimada. Nos anos subseqüentes, o índice de cobertura do substrato voltou a crescer, atingindo, em maio de 2001, os valores observados antes da queimada. Durante esse período, notou-se, nas parcelas queimadas e nãoqueimadas, aumento na contribuição do capim-gordura para o índice total de cobertura do solo, em detrimento das espécies nativas. O uso do fogo não foi eficaz no controle dessa invasora. Assim, em programas de recuperação de áreas degradadas em áreas protegidas é necessário controlar as espécies invasoras exóticas para permitir o estabelecimento de um maior número de espécies nativas do Cerrado.Melinis minutiflora is an African grass that invades degraded areas in the cerrado endangering native species. The effects of this invasion and of burning on Melinis minutiflora propagation were investigated in a gravel-mining pit, within the National Park of Brasilia. This study was conducted in an area where an experimental field was set up in 1993

  1. Grass leaves as potential hominin dietary resources. (United States)

    Paine, Oliver C C; Koppa, Abigale; Henry, Amanda G; Leichliter, Jennifer N; Codron, Daryl; Codron, Jacqueline; Lambert, Joanna E; Sponheimer, Matt


    Discussions about early hominin diets have generally excluded grass leaves as a staple food resource, despite their ubiquity in most early hominin habitats. In particular, stable carbon isotope studies have shown a prevalent C 4 component in the diets of most taxa, and grass leaves are the single most abundant C 4 resource in African savannas. Grass leaves are typically portrayed as having little nutritional value (e.g., low in protein and high in fiber) for hominins lacking specialized digestive systems. It has also been argued that they present mechanical challenges (i.e., high toughness) for hominins with bunodont dentition. Here, we compare the nutritional and mechanical properties of grass leaves with the plants growing alongside them in African savanna habitats. We also compare grass leaves to the leaves consumed by other hominoids and demonstrate that many, though by no means all, compare favorably with the nutritional and mechanical properties of known primate foods. Our data reveal that grass leaves exhibit tremendous variation and suggest that future reconstructions of hominin dietary ecology take a more nuanced approach when considering grass leaves as a potential hominin dietary resource. Copyright © 2017. Published by Elsevier Ltd.

  2. Congo grass grown in rotation with soybean affects phosphorus bound to soil carbon

    Directory of Open Access Journals (Sweden)

    Alexandre Merlin


    Full Text Available The phosphorus supply to crops in tropical soils is deficient due to its somewhat insoluble nature in soil, and addition of P fertilizers has been necessary to achieve high yields. The objective of this study was to examine the mechanisms through which a cover crop (Congo grass - Brachiaria ruziziensis in rotation with soybean can enhance soil and fertilizer P availability using long-term field trials and laboratory chemical fractionation approaches. The experimental field had been cropped to soybean in rotation with several species under no-till for six years. An application rate of no P or 240 kg ha-1 of P2O5 had been applied as triple superphosphate or as Arad rock phosphate. In April 2009, once more 0.0 or 80.0 kg ha-1 of P2O5 was applied to the same plots when Congo grass was planted. In November 2009, after Congo grass desiccation, soil samples were taken from the 0-5 and 5-10 cm depth layer and soil P was fractionated. Soil-available P increased to the depth of 10 cm through growing Congo grass when P fertilizers were applied. The C:P ratio was also increased by the cover crop. Congo grass cultivation increased P content in the soil humic fraction to the depth of 10 cm. Congo grass increases soil P availability by preventing fertilizer from being adsorbed and by increasing soil organic P.

  3. Plant litter effects on soil nutrient availability and vegetation dynamics: changes that occur when annual grasses invade shrub-steppe communities (United States)

    Sheel Bansal; Roger L. Sheley; Bob Blank; Edward A. Vasquez


    Changes in the quantity and quality of plant litter occur in many ecosystems as they are invaded by exotic species, which impact soil nutrient cycling and plant community composition. Such changes in sagebrush-steppe communities are occurring with invasion of annual grasses (AG) into a perennial grass (PG) dominated system. We conducted a 5-year litter manipulation...

  4. Does crotalaria (Crotalaria breviflora or pumpkin (Cucurbita moschata inter-row cultivation in restoration plantings control invasive grasses?

    Directory of Open Access Journals (Sweden)

    Ricardo Gomes César


    Full Text Available Alternative methods to control invasive fodder grasses are necessary to reduce the use of herbicides in forest restoration, which has been carried out primarily in riparian zones. We sought to investigate if inter-row cultivation of crotalaria (Crotalaria breviflora DC or pumpkin (Cucurbita moschata Duschene ex. Poir with native tree species is an efficient strategy to control invasive fodder grasses in restoration plantings. We tested five treatments in a randomized block design, namely (1 control of brachiaria grass (Urochloa decumbens (Stapf. Webster with glyphosate in the implementation and post-planting grass control of the reforestation, (2 and 3 glyphosate use in the implementation and inter-row sowing of crotalaria (2 or pumpkin (3, and control of brachiaria by mowing in the post-planting phase, (4 and 5 mowing in the implementation and inter-row sowing of crotalaria (4 or pumpkin (5, and control of brachiaria by mowing in the post-planting phase. Post-planting grass control was carried out four and nine months after tree seedling planting. Throughout 13 months, we evaluated the percentage of ground cover by brachiaria grass, pumpkin production, and native tree seedling mortality, height and crown cover. The exclusive use of glyphosate, without inter-row sowing of pumpkin or crotalaria showed the most favorable results for controlling brachiaria grass and, consequently, for tree seedling development. Hence, inter-row cultivation of green manure or short-lived crop species is not enough to control invasive grasses in restoration plantings, and complementary weeding is necessary to reduce the highly competitive potential of C4 grasses for supporting native species seedlings growth.

  5. Distribution, Diversity, and Long-Term Retention of Grass Short Interspersed Nuclear Elements (SINEs). (United States)

    Mao, Hongliang; Wang, Hao


    Instances of highly conserved plant short interspersed nuclear element (SINE) families and their enrichment near genes have been well documented, but little is known about the general patterns of such conservation and enrichment and underlying mechanisms. Here, we perform a comprehensive investigation of the structure, distribution, and evolution of SINEs in the grass family by analyzing 14 grass and 5 other flowering plant genomes using comparative genomics methods. We identify 61 SINE families composed of 29,572 copies, in which 46 families are first described. We find that comparing with other grass TEs, grass SINEs show much higher level of conservation in terms of genomic retention: The origin of at least 26% families can be traced to early grass diversification and these families are among most abundant SINE families in 86% species. We find that these families show much higher level of enrichment near protein coding genes than families of relatively recent origin (51%:28%), and that 40% of all grass SINEs are near gene and the percentage is higher than other types of grass TEs. The pattern of enrichment suggests that differential removal of SINE copies in gene-poor regions plays an important role in shaping the genomic distribution of these elements. We also identify a sequence motif located at 3' SINE end which is shared in 17 families. In short, this study provides insights into structure and evolution of SINEs in the grass family. © The Author 2017. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

  6. Predicting Dry Matter Composition of Clover Grass Leys Using Data Simulation and Camera-based Segmentation of Field Canopies into White Clover, Red Clover, Grass and Weeds

    DEFF Research Database (Denmark)

    Skovsen, Søren; Dyrmann, Mads; Eriksen, Jørgen


    species in the biomass. In our setup, we exploit the top-down canopy view of the clover grass ley to estimate the volumetric composition of the yield, and predict the composition of the dry matter of the forage. Using a deep learning approach, the canopy image is automatically pixel-wise segmented....... The biggest hindrance to training a fully convolutional deep neural network is the requirement of labeled data. Due to the complexity, the high number of leaves and high levels of occlusions in clover grass canopies, hand labeling the data requires roughly 20 hours of manual labor per image. The need...... for hundreds or thousands labeled training images renders this approach unfeasible. We have shown that implementation of image simulation of distinct clover grass fields can reduce the labeling task significantly. Investing less than 20 hours of labor, thousands of simulated images and corresponding labels can...

  7. Grass Biomethane for Agriculture and Energy

    DEFF Research Database (Denmark)

    Korres, N.E.; Thamsiriroj, T.; Smith, B.


    have advanced the role of grassland as a renewable source of energy in grass biomethane production with various environmental and socio-economic benefits. It is underlined that the essential question whether the gaseous biofuel meets the EU sustainability criteria of 60% greenhouse gas emission savings...... by 2020 can be met since savings up to 89.4% under various scenarios can be achieved. Grass biomethane production compared to other liquid biofuels either when these are produced by indigenous of imported feedstocks is very promising. Grass biomethane, given the mature and well known technology...

  8. A grass molecular identification system for forensic botany: a critical evaluation of the strengths and limitations. (United States)

    Ward, Jodie; Gilmore, Simon R; Robertson, James; Peakall, Rod


    Plant material is frequently encountered in criminal investigations but often overlooked as potential evidence. We designed a DNA-based molecular identification system for 100 Australian grasses that consisted of a series of polymerase chain reaction assays that enabled the progressive identification of grasses to different taxonomic levels. The identification system was based on DNA sequence variation at four chloroplast and two mitochondrial loci. Seventeen informative indels and 68 single-nucleotide polymorphisms were utilized as molecular markers for subfamily to species-level identification. To identify an unknown sample to subfamily level required a minimum of four markers or nine markers for species identification. The accuracy of the system was confirmed by blind tests. We have demonstrated "proof of concept" of a molecular identification system for trace botanical samples. Our evaluation suggests that the adoption of a system that combines this approach with DNA sequencing could assist the morphological identification of grasses found as forensic evidence.

  9. The grasses (Poaceae) of the Colombian guayana: analyses on their composition, richness, endemism, and invasion

    International Nuclear Information System (INIS)

    Canas, Diego Giraldo


    The checklist of grasses from Colombian Guayana is presented. In all, 152 species, 69 genera, and six subfamilies were recorded. Thus, in the Colombian Guayana is represented the 18.7 and 43.7% of the species and genera of Colombian grasses, respectively. The subfamilies with the highest number of species were Panicoideae (110 species/46 genera), Chloridoideae (21/9), and Bambusoideae (11/9). The most diverse genera were Paspalum (19 species), Panicum (16), Axonopus (14), Eragrostis (9), and Digitaria (8). Nineteen species are introduced and naturalized in the Colombian Guayana, which represent 12.5% of the agrostological flora for the Colombian Guayana. There were 8 endemic species (5.3% of Colombian Guayanan grasses). In addition, some species are reported for the first time for Colombian flora (belonging to Axonopus, Cyphonanthus, Gymnopogon, and Paspalum), and some species are new to science (belonging to Axonopus, Digitaria, Eragrostis, and Sacciolepis). On the other hand, some preliminary biogeographical aspect are analyzed Flora of Colombia,

  10. Use of ionizing radiation in grass breeding. I

    International Nuclear Information System (INIS)

    Indruch, I.; Svetlik, V.; Ligocki, J.


    Two subspecies of F. rubra occurring in natural localities of north-east Moravia (CSSR) in the Beskydy Mts. were used. In Festuca rubra L. ssp. genuina grandiflora (Hack.) 2n=8x=56, F. rubra represented a model species used for testing the effects of both acute and chronic gamma irradiation. In Festuca rubra L. ssp. vulgaris (Gaud.) Hay 2n=6x=42, new breeding was realized with success. The effects on important features of grasses were identical in both cases. The extension of combining abilities is especially important because it allows the production of forms less frequent in natural populations. (author)

  11. Phenology largely explains taller grass at successful nests in greater sage-grouse. (United States)

    Smith, Joseph T; Tack, Jason D; Doherty, Kevin E; Allred, Brady W; Maestas, Jeremy D; Berkeley, Lorelle I; Dettenmaier, Seth J; Messmer, Terry A; Naugle, David E


    Much interest lies in the identification of manageable habitat variables that affect key vital rates for species of concern. For ground-nesting birds, vegetation surrounding the nest may play an important role in mediating nest success by providing concealment from predators. Height of grasses surrounding the nest is thought to be a driver of nest survival in greater sage-grouse ( Centrocercus urophasianus ; sage-grouse), a species that has experienced widespread population declines throughout their range. However, a growing body of the literature has found that widely used field methods can produce misleading inference on the relationship between grass height and nest success. Specifically, it has been demonstrated that measuring concealment following nest fate (failure or hatch) introduces a temporal bias whereby successful nests are measured later in the season, on average, than failed nests. This sampling bias can produce inference suggesting a positive effect of grass height on nest survival, though the relationship arises due to the confounding effect of plant phenology, not an effect on predation risk. To test the generality of this finding for sage-grouse, we reanalyzed existing datasets comprising >800 sage-grouse nests from three independent studies across the range where there was a positive relationship found between grass height and nest survival, including two using methods now known to be biased. Correcting for phenology produced equivocal relationships between grass height and sage-grouse nest survival. Viewed in total, evidence for a ubiquitous biological effect of grass height on sage-grouse nest success across time and space is lacking. In light of these findings, a reevaluation of land management guidelines emphasizing specific grass height targets to promote nest success may be merited.

  12. Improving our understanding of environmental controls on the distribution of C3 and C4 grasses. (United States)

    Pau, Stephanie; Edwards, Erika J; Still, Christopher J


    A number of studies have demonstrated the ecological sorting of C3 and C4 grasses along temperature and moisture gradients. However, previous studies of C3 and C4 grass biogeography have often inadvertently compared species in different and relatively unrelated lineages, which are associated with different environmental settings and distinct adaptive traits. Such confounded comparisons of C3 and C4 grasses may bias our understanding of ecological sorting imposed strictly by photosynthetic pathway. Here, we used MaxEnt species distribution modeling in combination with satellite data to understand the functional diversity of C3 and C4 grasses by comparing both large clades and closely related sister taxa. Similar to previous work, we found that C4 grasses showed a preference for regions with higher temperatures and lower precipitation compared with grasses using the C3 pathway. However, air temperature differences were smaller (2 °C vs. 4 °C) and precipitation and % tree cover differences were larger (1783 mm vs. 755 mm, 21.3% vs. 7.7%, respectively) when comparing C3 and C4 grasses within the same clade vs. comparing all C4 and all C3 grasses (i.e., ignoring phylogenetic structure). These results were due to important differences in the environmental preferences of C3 BEP and PACMAD clades (the two main grass clades). Winter precipitation was found to be more important for understanding the distribution and environmental niche of C3 PACMADs in comparison with both C3 BEPs and C4 taxa, for which temperature was much more important. Results comparing closely related C3 -C4 sister taxa supported the patterns derived from our modeling of the larger clade groupings. Our findings, which are novel in comparing the distribution and niches of clades, demonstrate that the evolutionary history of taxa is important for understanding the functional diversity of C3 and C4 grasses, and should have implications for how grasslands will respond to global change. © 2012

  13. Pampas Grass - Orange Co. [ds351 (United States)

    California Natural Resource Agency — This dataset provides the known distribution of pampas grass (Cortaderia selloana) in southern Orange County. The surveys were conducted from May to June, 2007 and...

  14. Tree-grass interactions in savannas

    CSIR Research Space (South Africa)

    Scholes, RJ


    Full Text Available Savannas occur where trees and grasses interact to create a biome that is neither grassland nor forest. Woody and gramineous plants interact by many mechanisms, some negative (competition) and some positive (facilitation). The strength and sign...


    African Journals Online (AJOL)


    Potentials of some agricultural waste and grasses were investigated. ... to education, printing, publishing and ... technical form, paper is an aqueous deposit ..... Period of. Soaking. Overnight. Overnight. Overnight. Overnight. Overnight.

  16. Grasses for energy production: hydrological guidelines

    Energy Technology Data Exchange (ETDEWEB)

    Hall, R.L.


    This report provides hydrological guidelines for growers, land and water resource managers, environmental groups and other parties interested in utilising grasses for energy production. The aim of the report is to help interested parties decide if a location is suitable for planting energy grasses by considering whether potential hydrological impacts will have an adverse effect on crop productivity and yield. The guidelines consider: the water use of energy grasses compared with other crops; the factors governing water use; the water requirements for a productive crop; and the likely impacts on the availability and quantity of water. The report points out that there are still gaps in our knowledge of the processes controlling the water use and growth of energy grasses and notes that, in some situations, there will be considerable uncertainty in predictions of water use and the magnitude of the associated hydrological impacts.

  17. Imaging spectroscopy for characterisation of grass swards

    NARCIS (Netherlands)

    Schut, A.G.T.


    Keywords: Imaging spectroscopy, imaging spectrometry, remote sensing, reflection, reflectance, grass sward, white clover, recognition, characterisation, ground cover, growth monitoring, stress detection, heterogeneity quantification

    The potential of imaging spectroscopy as a tool for

  18. Karl Konrad Grass jumalainimeste uurijana / Alar Laats

    Index Scriptorium Estoniae

    Laats, Alar


    Karl Konrad Grass oli 19. sajandil Dorpati keiserliku ülikooli usuteaduskonna Uue Testamendi õppejõud, kes tegeles hobi korras idakristluse (vene sektid) uurimisega. Tema peateoseks on uurimus "Die russischen Sekten". Ettekanne konverentsil 15.-16. aprill 2005. a.

  19. Detrimental and Neutral Effects of a Wild Grass-Fungal Endophyte Symbiotum on Insect Preference and Performance


    Clement, Stephen L.; Hu, Jinguo; Stewart, Alan V.; Wang, Bingrui; Elberson, Leslie R.


    Seed-borne Epichloë/Neotyphodium Glenn, Bacon, Hanlin (Ascomycota: Hypocreales: Clavicipitaceae) fungal endophytes in temperate grasses can provide protection against insect attack with the degree of host resistance related to the grass—endophyte symbiotum and the insect species involved in an interaction. Few experimental studies with wild grass—endophyte symbiota, compared to endophyte-infected agricultural grasses, have tested for anti-insect benefits, let alone for resistance against more...

  20. Genetic compatibility determines endophyte-grass combinations.

    Directory of Open Access Journals (Sweden)

    Kari Saikkonen

    Full Text Available Even highly mutually beneficial microbial-plant interactions, such as mycorrhizal- and rhizobial-plant exchanges, involve selfishness, cheating and power-struggles between the partners, which depending on prevailing selective pressures, lead to a continuum of interactions from antagonistic to mutualistic. Using manipulated grass-endophyte combinations in a five year common garden experiment, we show that grass genotypes and genetic mismatches constrain genetic combinations between the vertically (via host seeds transmitted endophytes and the out-crossing host, thereby reducing infections in established grass populations. Infections were lost in both grass tillers and seedlings in F(1 and F(2 generations, respectively. Experimental plants were collected as seeds from two different environments, i.e., meadows and nearby riverbanks. Endophyte-related benefits to the host included an increased number of inflorescences, but only in meadow plants and not until the last growing season of the experiment. Our results illustrate the importance of genetic host specificity and trans-generational maternal effects on the genetic structure of a host population, which act as destabilizing forces in endophyte-grass symbioses. We propose that (1 genetic mismatches may act as a buffering mechanism against highly competitive endophyte-grass genotype combinations threatening the biodiversity of grassland communities and (2 these mismatches should be acknowledged, particularly in breeding programmes aimed at harnessing systemic and heritable endophytes to improve the agriculturally valuable characteristics of cultivars.

  1. Arabidopsis and Brachypodium distachyon Transgenic Plants Expressing Aspergillus nidulans Acetylesterases Have Decreased Degree of Polysaccharide Acetylation and Increased Resistance to Pathogens1[C][W][OA (United States)

    Pogorelko, Gennady; Lionetti, Vincenzo; Fursova, Oksana; Sundaram, Raman M.; Qi, Mingsheng; Whitham, Steven A.; Bogdanove, Adam J.; Bellincampi, Daniela; Zabotina, Olga A.


    The plant cell wall has many significant structural and physiological roles, but the contributions of the various components to these roles remain unclear. Modification of cell wall properties can affect key agronomic traits such as disease resistance and plant growth. The plant cell wall is composed of diverse polysaccharides often decorated with methyl, acetyl, and feruloyl groups linked to the sugar subunits. In this study, we examined the effect of perturbing cell wall acetylation by making transgenic Arabidopsis (Arabidopsis thaliana) and Brachypodium (Brachypodium distachyon) plants expressing hemicellulose- and pectin-specific fungal acetylesterases. All transgenic plants carried highly expressed active Aspergillus nidulans acetylesterases localized to the apoplast and had significant reduction of cell wall acetylation compared with wild-type plants. Partial deacetylation of polysaccharides caused compensatory up-regulation of three known acetyltransferases and increased polysaccharide accessibility to glycosyl hydrolases. Transgenic plants showed increased resistance to the fungal pathogens Botrytis cinerea and Bipolaris sorokiniana but not to the bacterial pathogens Pseudomonas syringae and Xanthomonas oryzae. These results demonstrate a role, in both monocot and dicot plants, of hemicellulose and pectin acetylation in plant defense against fungal pathogens. PMID:23463782

  2. Identification of genes that regulate phosphate acquisition and plant performance during arbuscular my corrhizal symbiosis in medicago truncatula and brachypodium distachyon

    Energy Technology Data Exchange (ETDEWEB)

    Harrison, Maria J [Boyce Thompson Institute, Ithaca, NY (United States); Hudson, Matthew E [Univ. of Illinois, Champaign, IL (United States)


    Most vascular flowering plants have the ability to form symbiotic associations with arbuscular mycorrhizal (AM) fungi. The symbiosis develops in the roots and can have a profound effect on plant productivity, largely through improvements in plant mineral nutrition. Within the root cortical cells, the plant and fungus create novel interfaces specialized for nutrient transfer, while the fungus also develops a network of hyphae in the rhizosphere. Through this hyphal network, the fungus acquires and delivers phosphate and nitrogen to the root. In return, the plant provides the fungus with carbon. In addition, to enhancing plant mineral nutrition, the AM symbiosis has an important role in the carbon cycle, and positive effects on soil health. Here we identified and characterized plant genes involved in the regulation and functioning of the AM symbiosis in Medicago truncatula and Brachypodium distachyon. This included the identification and and characterization of a M. truncatula transcription factors that are required for symbiosis. Additionally, we investigated the molecular basis of functional diversity among AM symbioses in B. distachyon and analysed the transcriptome of Brachypodium distachyon during symbiosis.

  3. Interacting effects of grass height and herbivores on the establishment of an encroaching savanna shrub

    NARCIS (Netherlands)

    Hagenah, N.; Munkert, H.; Gerhardt, K.; Olff, H.


    Shrub encroachment is a widely observed problem in Southern African savannas. Although the effects of herbivory and grass height on woody species recruitment have been studied individually, little information exists about how these factors interact. In this study seeds and seedlings of the

  4. Earthworm activity and decomposition of 14C-labelled grass root systems

    NARCIS (Netherlands)

    Uyl, A.; Didden, W.A.M.; Marinussen, J.


    Decomposition of 14C-labelled root systems of the grass species Holcus lanatus and Festuca ovina, representative of mesotrophic and oligotrophic situations, respectively, was monitored during 14 months under field conditions in the presence or absence of earthworms (Lumbricus rubellus). During the

  5. Community structure affects annual grass weed invasion during restoration of a shrub-steppe ecosystem (United States)

    Phil S. Allen; Susan E. Meyer


    Ecological restoration of shrub-steppe communities in the western United States is often hampered by invasion of exotic annual grasses during the process. An important question is how to create restored communities that can better resist reinvasion by these weeds. One hypothesis is that communities comprised of species that are functionally similar to the invader will...

  6. Leaf silicification in grasses - a review. | P.J. | African Journal of ...

    African Journals Online (AJOL)

    Silica is absorbed from the soil by many grasses in an active or passive manner depending upon depending upon the species involved. It is carried upwards in the transpiration stream and deposited throughout the plant where it polymerizes to form amorphous silica gel. Deposition appears to be a passive process but ...

  7. Influência do intervalo entre cortes sobre a produção de biomassa de duas espécies de capim limão Influence of the interval between cuts on biomass yield of two lemon grass species

    Directory of Open Access Journals (Sweden)

    André May


    Full Text Available Foi estudada a influência do intervalo entre cortes na produção de massa seca da parte aérea de duas espécies de capim limão. O experimento foi realizado no Instituto Agronômico, em Campinas-SP, 04 de junho/05 a 28 de agosto/06. O delineamento experimental utilizado foi em blocos ao acaso, com três repetições, com os tratamentos em esquema fatorial 2 x 4, sendo duas espécies (C. citratus e C. flexuosus e quatro intervalos entre cortes (40; 60; 80 e 100 dias. Para C. flexuosus, maiores intervalos entre cortes proporcionaram maior massa seca acumulada ao longo do ciclo de cultivo, partindo de 329,04 para 704,16 g planta-1 de massa seca acumulada da parte aérea, para intervalos entre cortes de 40 e 100 dias, respectivamente. A espécie C. citratus apresentou resposta linear decrescente da massa seca acumulada da parte aérea quanto maior o intervalo entre cortes utilizado, produzindo 238,68 g planta-1 utilizando intervalo entre cortes de 40 dias.The aim of this study was to analyze the influence of the interval between cuts on the dry mass yield of the aerial part of two lemon grass species. The experiment was conducted at Agronomical Institute (IAC, in Campinas - SP, from June 4th, 2005 through August 28th, 2006. The experiment was carried out in a completely randomized block design, with three replications, and the treatments in a 2 x 4 factorial design, corresponding two species (C. citratus and C. flexuosus and four intervals between cuts (40; 60; 80 and 100 days. For C. flexuosus, longer intervals between cuts generated more dry mass accumulated throughout the cultivation cycle, beginning on 329,04 to 704,16 g plant-1 of accumulated dry mass of the aerial part, for intervals between cuts of 40 and 100 days, respectively. The C. citratus species showed a decrease in its linear response for the accumulated dry mass of the aerial part the longer the interval between cuts was, yielding 238,68 g plant-1 for a 40 day interval between

  8. Treatment with grass allergen peptides improves symptoms of grass pollen-induced allergic rhinoconjunctivitis. (United States)

    Ellis, Anne K; Frankish, Charles W; O'Hehir, Robyn E; Armstrong, Kristen; Steacy, Lisa; Larché, Mark; Hafner, Roderick P


    Synthetic peptide immunoregulatory epitopes are a new class of immunotherapy to treat allergic rhinoconjunctivitis (ARC). Grass allergen peptides, comprising 7 synthetic T-cell epitopes derived from Cyn d 1, Lol p 5, Dac g 5, Hol l 5, and Phl p 5, is investigated for treatment of grass pollen-induced ARC. We sought to evaluate the efficacy, safety, and tolerability of intradermally administered grass allergen peptides. A multicenter, randomized, double-blind, placebo-controlled study evaluated 3 regimens of grass allergen peptides versus placebo in patients with grass pollen-induced allergy (18-65 years). After a 4-day baseline challenge to rye grass in the environmental exposure unit (EEU), subjects were randomized to receive grass allergen peptides at 6 nmol at 2-week intervals for a total of 8 doses (8x6Q2W), grass allergen peptides at 12 nmol at 4-week intervals for a total of 4 doses (4x12Q4W), or grass allergen peptides at 12 nmol at 2-week intervals for a total of 8 doses (8x12Q2W) or placebo and treated before the grass pollen season. The primary efficacy end point was change from baseline in total rhinoconjunctivitis symptom score across days 2 to 4 of a 4-day posttreatment challenge (PTC) in the EEU after the grass pollen season. Secondary efficacy end points and safety were also assessed. Two hundred eighty-two subjects were randomized. Significantly greater improvement (reduction of total rhinoconjunctivitis symptom score from baseline to PTC) occurred across days 2 to 4 with grass allergen peptide 8x6Q2W versus placebo (-5.4 vs -3.8, respectively; P = .0346). Greater improvement at PTC also occurred for grass allergen peptide 8x6Q2W versus placebo (P = .0403) in patients with more symptomatic ARC. No safety signals were detected. Grass allergen peptide 8x6Q2W significantly improved ARC symptoms after rye grass allergen challenge in an EEU with an acceptable safety profile. Copyright © 2017 American Academy of Allergy, Asthma & Immunology

  9. Effect of grazing system and the grass species on the pasture infestation and on the nematode gastrointestinal parasitism in beef cattle Efeito de sistema de pastejo e de espécies forrageiras na contaminação da pastagem e no parasitismo por nematóides gastrintestinais em bovinos de corte

    Directory of Open Access Journals (Sweden)

    Ivo Bianchin


    Full Text Available During two years, the infestation of infecting larvae on grazing grass and the level of gastrointestinal nematodes in beef cattle, in the region of the Brazilian Cerrado, were monitored. In the first study, parasitological variables were investigated on pasture of Panicum maximum cv Mombaça, under continuous or rotational grazing, with four (36 resting days and 12 occupation days and ten paddocks (36 resting days and 4 occupation days. In the second study, these variables were evaluated with different forage species (Panicum maximum cv Mombaça, Braquiaria brizantha cv Marandu and Cynodon spp. (Tifton 85, under rotational grazing on eight paddocks (28 resting days and 4 occupation days. In the first study, and only in the first year, the infestation of pasture with infecting larvae was lower (P<0.05 in the rotation system with ten divisions. For the remaining observations of both studies, there were no significant effects of grazing systems and grass species on the fecal egg count and the number of infecting larvae in the pasture. These results indicated that, in the conditions the studies were carried out, the pasture resting for 36 days was insufficient to decrease the EPF and the infestation of pasture.Durante dois anos, acompanhou-se a infestação das pastagens por larvas infectantes e o nível de parasitismo por nematódeos gastrintestinais em bovinos de corte, na região do Cerrado. No primeiro estudo as variáveis parasitológicas foram acompanhadas em pastagens de Panicum maximum cv Mombaça, submetidas ao pastejo continuo e ao rotacionado, com 4 (36 dias de descanso e 12 dias de ocupação e 10 piquetes (36 dias de descanso e 4 dias de ocupação. No segundo estudo, essas variáveis foram avaliadas com diferentes espécies forrageiras (Panicum maximum cv Mombaça, Braquiaria brizantha cv Marandu e Cynodon spp (Tifton 85, sob pastejo rotacionado em 8 piquetes (28 dias de descanso e 4 dias de ocupação. No primeiro estudo, e apenas no

  10. Nutritional value of cabbage and kikuyu grass as food for grass carp ...

    African Journals Online (AJOL)

    and digestibility coefficients were obtained for the protein, fibre, ash and fat contents of both ... Cabbage is a superior feed compared to grass for raising grass carp and a suitable low-cost alternative ... Materials and Methods ... from jumping out and was fitted with an air lift under- .... In: Aquatic weeds in South East Asia.

  11. Gene Expression Profiling of Grass Carp (Ctenopharyngodon idellus and Crisp Grass Carp

    Directory of Open Access Journals (Sweden)

    Ermeng Yu


    Full Text Available Grass carp (Ctenopharyngodon idellus is one of the most important freshwater fish that is native to China, and crisp grass carp is a kind of high value-added fishes which have higher muscle firmness. To investigate biological functions and possible signal transduction pathways that address muscle firmness increase of crisp grass carp, microarray analysis of 14,900 transcripts was performed. Compared with grass carp, 127 genes were upregulated and 114 genes were downregulated in crisp grass carp. Gene ontology (GO analysis revealed 30 GOs of differentially expressed genes in crisp grass carp. And strong correlation with muscle firmness increase of crisp grass carp was found for these genes from differentiation of muscle fibers and deposition of ECM, and also glycolysis/gluconeogenesis pathway and calcium metabolism may contribute to muscle firmness increase. In addition, a number of genes with unknown functions may be related to muscle firmness, and these genes are still further explored. Overall, these results had been demonstrated to play important roles in clarifying the molecular mechanism of muscle firmness increase in crisp grass carp.

  12. Different techniques to study rumen fermentation characteristics of maturing grass and grass silage

    NARCIS (Netherlands)

    Cone, J.W.; Gelder, van A.H.; Soliman, I.A.; Visser, de H.; Vuuren, van A.M.


    Grass samples were harvested during the 1993 growing season after a precut on April 27, 1993 and were stored frozen or left to ensile in 30-L buckets. Effects on chemical composition and fermentation kinetics of the maturation of the grass and of ensiling were investigated. Chemical composition and

  13. Analysis of the soil food web structure under grass and grass clover

    NARCIS (Netherlands)

    Eekeren, van N.J.M.; Smeding, F.W.; Vries, de F.T.; Bloem, J.


    The below ground biodiversity of soil organisms plays an important role in the functioning of the the soil ecosystem, and consequently the above ground plant production. The objective of this study is to investigate the effect of grass or grass-clover in combination with fertilisation on the soil

  14. Post-ruminal digestibility of crude protein from grass and grass silages in cows

    NARCIS (Netherlands)

    Cone, J.W.; Gelder, van A.H.; Mathijssen-Kamman, A.A.; Hindle, V.A.


    Grass samples were grown on a clay or sandy soil, fertilised with 150 or 300 kg N/ha per year, and harvested on different days during two consecutive growing seasons. The grass samples were stored frozen or ensiled after wilting to approximately 250 or 450 g DM/kg. The recoveries of crude protein

  15. Confronting species distribution model predictions with species functional traits. (United States)

    Wittmann, Marion E; Barnes, Matthew A; Jerde, Christopher L; Jones, Lisa A; Lodge, David M


    Species distribution models are valuable tools in studies of biogeography, ecology, and climate change and have been used to inform conservation and ecosystem management. However, species distribution models typically incorporate only climatic variables and species presence data. Model development or validation rarely considers functional components of species traits or other types of biological data. We implemented a species distribution model (Maxent) to predict global climate habitat suitability for Grass Carp (Ctenopharyngodon idella). We then tested the relationship between the degree of climate habitat suitability predicted by Maxent and the individual growth rates of both wild (N = 17) and stocked (N = 51) Grass Carp populations using correlation analysis. The Grass Carp Maxent model accurately reflected the global occurrence data (AUC = 0.904). Observations of Grass Carp growth rate covered six continents and ranged from 0.19 to 20.1 g day(-1). Species distribution model predictions were correlated (r = 0.5, 95% CI (0.03, 0.79)) with observed growth rates for wild Grass Carp populations but were not correlated (r = -0.26, 95% CI (-0.5, 0.012)) with stocked populations. Further, a review of the literature indicates that the few studies for other species that have previously assessed the relationship between the degree of predicted climate habitat suitability and species functional traits have also discovered significant relationships. Thus, species distribution models may provide inferences beyond just where a species may occur, providing a useful tool to understand the linkage between species distributions and underlying biological mechanisms.

  16. Germination sensitivities to water potential among co-existing C3 and C4 grasses of cool semi-arid prairie grasslands. (United States)

    Mollard, F P O; Naeth, M A


    An untested theory states that C4 grass seeds could germinate under lower water potentials (Ψ) than C3 grass seeds. We used hydrotime modelling to study seed water relations of C4 and C3 Canadian prairie grasses to address Ψ divergent sensitivities and germination strategies along a risk-spreading continuum of responses to limited water. C4 grasses were Bouteloua gracilis, Calamovilfa longifolia and Schizachyrium scoparium; C3 grasses were Bromus carinatus, Elymus trachycaulus, Festuca hallii and Koeleria macrantha. Hydrotime parameters were obtained after incubation of non-dormant seeds under different Ψ PEG 6000 solutions. A t-test between C3 and C4 grasses did not find statistical differences in population mean base Ψ (Ψb (50)). We found idiosyncratic responses of C4 grasses along the risk-spreading continuum. B. gracilis showed a risk-taker strategy of a species able to quickly germinate in a dry soil due to its low Ψb (50) and hydrotime (θH ). The high Ψb (50) of S. scoparium indicates it follows the risk-averse strategy so it can only germinate in wet soils. C. longifolia showed an intermediate strategy: the lowest Ψb (50) yet the highest θH . K. macrantha, a C3 grass which thrives in dry habitats, had the highest Ψb (50), suggesting a risk-averse strategy for a C3 species. Other C3 species showed intermediate germination patterns in response to Ψ relative to C4 species. Our results indicate that grasses display germination sensitivities to Ψ across the risk-spreading continuum of responses. Thus seed water relations may be poor predictors to explain differential recruitment and distribution of C3 and C4 grasses in the Canadian prairies. © 2014 German Botanical Society and The Royal Botanical Society of the Netherlands.

  17. Persistence of Overseeded Cool-Season Grasses in Bermudagrass Turf

    Directory of Open Access Journals (Sweden)

    Thomas Serensits


    Full Text Available Cool-season grass species are commonly overseeded into bermudagrass turf for winter color. When the overseeded grass persists beyond the spring; however, it becomes a weed. The ability of perennial ryegrass, Italian (annual ryegrass, intermediate ryegrass, and hybrid bluegrass to persist in bermudagrass one year after seeding was determined. Perennial ryegrass, intermediate ryegrass, and Italian ryegrass produced acceptable ground cover in the spring after fall seeding. Hybrid bluegrass did not establish well, resulting in unacceptable cover. Perennial ryegrass generally persisted the most one year after seeding, either because of summer survival of plants or because of new germination the following fall. Plant counts one year after seeding were greater in the higher seeding rate treatment compared to the lower seeding treatment rate of perennial ryegrass, suggesting new germination had occurred. Plant counts one year after seeding plots with intermediate ryegrass or Italian ryegrass were attributed primarily to latent germination and not summer survival. Applications of foramsulfuron generally did not prevent overseeded species stand one year after seeding, supporting the conclusion of new germination. Although quality is less with intermediate ryegrass compared to perennial ryegrass, it transitions out easier than perennial ryegrass, resulting in fewer surviving plants one year later.

  18. Review of the integrated process for the production of grass biomethane. (United States)

    Nizami, Abdul-Sattar; Korres, Nicholas E; Murphy, Jerry D


    Production of grass biomethane is an integrated process which involves numerous stages with numerous permutations. The grass grown can be of numerous species, and it can involve numerous cuts. The lignocellulosic content of grass increases with maturity of grass; the first cut offers more methane potential than the later cuts. Water-soluble carbohydrates (WSC) are higher (and as such methane potential is higher) for grass cut in the afternoon as opposed to that cut in the morning. The method of ensiling has a significant effect on the dry solids content of the grass silage. Pit or clamp silage in southern Germany and Austria has a solids content of about 40%; warm dry summers allow wilting of the grass before ensiling. In temperate oceanic climates like Ireland, pit silage has a solids content of about 21% while bale silage has a solids content of 32%. Biogas production is related to mass of volatile solids rather than mass of silage; typically one ton of volatile solid produces 300 m(3) of methane. The dry solids content of the silage has a significant impact on the biodigester configuration. Silage with a high solids content would lend itself to a two-stage process; a leach bed where volatile solids are converted to a leachate high in chemical oxygen demand (COD), followed by an upflow anaerobic sludge blanket where the COD can be converted efficiently to CH(4). Alternative configurations include wet continuous processes such as the ubiquitous continuously stirred tank reactor; this necessitates significant dilution of the feedstock to effect a solids content of 12%. Various pretreatment methods may be employed especially if the hydrolytic step is separated from the methanogenic step. Size reduction, thermal, and enzymatic methodologies are used. Good digester design is to seek to emulate the cow, thus rumen fluid offers great potential for hydrolysis.

  19. Herbaceous Legume Encroachment Reduces Grass Productivity and Density in Arid Rangelands.

    Directory of Open Access Journals (Sweden)

    Thomas C Wagner

    Full Text Available Worldwide savannas and arid grasslands are mainly used for livestock grazing, providing livelihood to over a billion people. While normally dominated by perennial C4 grasses, these rangelands are increasingly affected by the massive spread of native, mainly woody legumes. The consequences are often a repression of grass cover and productivity, leading to a reduced carrying capacity. While such encroachment by woody plants has been extensively researched, studies on similar processes involving herbaceous species are rare. We studied the impact of a sustained and massive spread of the native herbaceous legume Crotalaria podocarpa in Namibia's escarpment region on the locally dominant fodder grasses Stipagrostis ciliata and Stipagrostis uniplumis. We measured tussock densities, biomass production of individual tussocks and tussock dormancy state of Stipagrostis on ten 10 m x 10 m plots affected and ten similarly-sized plots unaffected by C. podocarpa over eight consecutive years and under different seasonal rainfalls and estimated the potential relative productivity of the land. We found the percentage of active Stipagrostis tussocks and the biomass production of individual tussocks to increase asymptotically with higher seasonal rainfall reaching a maximum around 300 mm while the land's relative productivity under average local rainfall conditions reached only 40% of its potential. Crotalaria podocarpa encroachment had no effect on the proportion of productive grass tussocks, but reduced he productivity of individual Stipagrostis tussocks by a third. This effect of C. podocarpa on grass productivity was immediate and direct and was not compensated for by above-average rainfall. Besides this immediate effect, over time, the density of grass tussocks declined by more than 50% in areas encroached by C. podocarpa further and lastingly reducing the lands carrying capacity. The effects of C. podocarpa on grass productivity hereby resemble those of woody

  20. Weather and plant age affect the levels of steroidal saponin and Pithomyces chartarum spores in Brachiaria grass (United States)

    Brachiaria species are cultivated worldwide in tropical and subtropical climates as the main forage source for ruminants. Numerous tropical and warm-season grasses cause hepatogenous photosensitization, among them several species of Brachiaria. Steroidal saponins present in these plants may be respo...

  1. Common garden comparisons of reproductive, forage and weed suppression potential of rangeland rehabilitation grasses of the Great Basin (United States)

    Common garden experiments are a means to remove environmental effects. Using 8 species of perennial rangeland grasses, we established a common garden (3 reps x28 plants = 84 plants/species). We found that ‘Hycrest’ crested wheatgrass (Agropyron cristatum) and bluebunch wheatgrass (Pseudoroegneria sp...

  2. New Claviceps species from warm-season grasses

    Czech Academy of Sciences Publication Activity Database

    Pažoutová, Sylvie; Odvody, G.; Frederickson, D.E.; Chudíčková, Milada; Olšovská, Jana; Kolařík, Miroslav


    Roč. 49, č. 1 (2011), s. 145-165 ISSN 1560-2745 R&D Projects: GA ČR GA206/97/0611 Institutional research plan: CEZ:AV0Z50200510 Keywords : Ascomycota * Taxonomy * Phylogeny Subject RIV: EE - Microbiology, Virology Impact factor: 4.769, year: 2011

  3. Plant Growth and Phosphorus Uptake of Three Riparian Grass Species (United States)

    Riparian buffers can significantly reduce sediment-bound phosphorus (P) entering surface water, but control of dissolved P inputs is more challenging. Because plant roots remove P from soil solution, it follows that plant uptake will reduce dissolved P losses. We evaluated P uptake of smooth bromegr...

  4. An African grassland responds similarly to long-term fertilization to the Park Grass experiment.

    Directory of Open Access Journals (Sweden)

    David Ward

    Full Text Available We compared the results of a long-term (65 years experiment in a South African grassland with the world's longest-running ecological experiment, the Park Grass study at Rothamsted, U.K. The climate is warm and humid in South Africa and cool and temperate in England. The African grassland has been fertilized with two forms of nitrogen applied at four levels, phosphorus and lime in a crossed design in 96 plots. In 1951, about 84% of plant cover consisted of Themeda triandra, Tristachya leucothrix and Setaria nigrirostris. Currently, the dominant species are Panicum maximum, Setaria sphacelata and Eragrostis curvula, making up 71% of total biomass. As in the Park Grass experiment, we found a significant (additive interaction effect on ANPP of nitrogen and phosphorus, and a (marginally significant negative correlation between ANPP and species richness. Unlike the Park Grass experiment, there was no correlation between ANPP and species richness when pH was included as a covariate. There was also a significant negative effect of nitrogen amount and nitrogen form and a positive effect of lime on species richness and species diversity. Soil pH had an important effect on species richness. Liming was insufficient to balance the negative effects on species richness of nitrogen fertilization. There was a significant effect of pH on biomass of three abundant species. There were also significant effects of light on the biomass of four species, with only Panicum maximum having a negative response to light. In all of the abundant species, adding total species richness and ANPP to the model increased the amount of variance explained. The biomass of Eragrostis curvula and P. maximum were negatively correlated with species richness while three other abundant species increased with species richness, suggesting that competition and facilitation were active. Consistent with the results from the Park Grass and other long-term fertilization experiments of grasslands

  5. Adaptation and detoxification mechanisms of Vetiver grass (Chrysopogon zizanioides) growing on gold mine tailings. (United States)

    Melato, F A; Mokgalaka, N S; McCrindle, R I


    Vetiver grass (Chrysopogon zizanioides) was investigated for its potential use in the rehabilitation of gold mine tailings, its ability to extract and accumulate toxic metals from the tailings and its metal tolerant strategies. Vetiver grass was grown on gold mine tailings soil, in a hothouse, and monitored for sixteen weeks. The mine tailings were highly acidic and had high electrical conductivity. Vetiver grass was able to grow and adapt well on gold mine tailings. The results showed that Vetiver grass accumulated large amounts of metals in the roots and restricted their translocation to the shoots. This was confirmed by the bioconcentration factor of Zn, Cu, and Ni of >1 and the translocation factor of <1 for all the metals. This study revealed the defense mechanisms employed by Vetiver grass against metal stress that include: chelation of toxic metals by phenolics, glutathione S-tranferase, and low molecular weight thiols; sequestration and accumulation of metals within the cell wall that was revealed by the scanning electron microscopy that showed closure of stomata and thickened cell wall and was confirmed by high content of cell wall bound phenolics. Metal induced reactive oxygen species are reduced or eliminated by catalase, superoxide dismutase and peroxidase dismutase.

  6. Immunochemical Analysis of Paxilline and Ergot Alkaloid Mycotoxins in Grass Seeds and Plants. (United States)

    Bauer, Julia I; Gross, Madeleine; Cramer, Benedikt; Humpf, Hans-Ulrich; Hamscher, Gerd; Usleber, Ewald


    Limited availability of toxin standards for lolitrem B and ergovaline impedes routine control of grasses for endophyte toxins. This study aimed at assessing the applicability of an enzyme immunoassay (EIA) for the indole-diterpene mycotoxin paxilline, in combination with a generic EIA for ergot alkaloids, as alternative parameters for screening purposes. Analysis of grass seeds and model pastures of four different grass species showed that both EIAs yielded highly positive results for paxilline and ergot alkaloids in perennial ryegrass seeds. Furthermore, evidence for natural occurrence of paxilline in grass in Germany was obtained. High performance liquid chromatography-tandem mass spectrometry analysis qualitatively confirmed the paxilline EIA results but showed that paxilline analogues 1'-O-acetylpaxilline and 13-desoxypaxilline were the predominant compounds in seeds and grass. In the absence of easily accessible reference standards for specific analysis of some major endophyte toxins, analysis of paxilline and ergot alkaloids by EIA may be suitable substitute parameters. The major advantage of this approach is its ease of use and speed, providing an analytical tool which could enhance routine screening for endophyte toxins in pasture.

  7. Current Models for Transcriptional Regulation of Secondary Cell Wall Biosynthesis in Grasses

    Directory of Open Access Journals (Sweden)

    Xiaolan Rao


    Full Text Available Secondary cell walls mediate many crucial biological processes in plants including mechanical support, water and nutrient transport and stress management. They also provide an abundant resource of renewable feed, fiber, and fuel. The grass family contains the most important food, forage, and biofuel crops. Understanding the regulatory mechanism of secondary wall formation in grasses is necessary for exploiting these plants for agriculture and industry. Previous research has established a detailed model of the secondary wall regulatory network in the dicot model species Arabidopsis thaliana. Grasses, branching off from the dicot ancestor 140–150 million years ago, display distinct cell wall morphology and composition, suggesting potential for a different secondary wall regulation program from that established for dicots. Recently, combined application of molecular, genetic and bioinformatics approaches have revealed more transcription factors involved in secondary cell wall biosynthesis in grasses. Compared with the dicots, grasses exhibit a relatively conserved but nevertheless divergent transcriptional regulatory program to activate their secondary cell wall development and to coordinate secondary wall biosynthesis with other physiological processes.

  8. Microsatellite genetic diversity and differentiation of native and introduced grass carp populations in three continents (United States)

    Chapman, Duane C.; Chen, Qin; Wang, Chenghui; Zhao, Jinlian; Lu, Guoqing; Zsigmond, Jeney; Li, Si-Fa


    Grass carp (Ctenopharyngodon idella), a freshwater species native to China, has been introduced to about 100 countries/regions and poses both biological and environmental challenges to the receiving ecosystems. In this study, we analyzed genetic variation in grass carp from three introduced river systems (Mississippi River Basin in US, Danube River in Hungary, and Tone River in Japan) as well as its native ranges (Yangtze, Pearl, and Amur Rivers) in China using 21 novel microsatellite loci. The allelic richness, observed heterozygosity, and within-population gene diversity were found to be lower in the introduced populations than in the native populations, presumably due to the small founder population size of the former. Significant genetic differentiation was found between all pairwise populations from different rivers. Both principal component analysis and Bayesian clustering analysis revealed obvious genetic distinction between the native and introduced populations. Interestingly, genetic bottlenecks were detected in the Hungarian and Japanese grass carp populations, but not in the North American population, suggesting that the Mississippi River Basin grass carp has experienced rapid population expansion with potential genetic diversification during the half-century since its introduction. Consequently, the combined forces of the founder effect, introduction history, and rapid population expansion help explaining the observed patterns of genetic diversity within and among both native and introduced populations of the grass carp.

  9. Forage mass and stocking rate of elephant grass pastures managed under agroecological and conventional systems

    Directory of Open Access Journals (Sweden)

    Clair Jorge Olivo


    Full Text Available The objective was to evaluate elephant grass (Pennisetum purpureum Schum. pastures, under the agroecological and conventional systems, as forage mass and stocking rate. In the agroecological system, the elephant grass was established in rows spaced by 3.0 m from each other. During the cool season ryegrass (Lolium multiflorum Lam. was established between these rows, which allowed the development of spontaneous growth species during the warm season. In the conventional system the elephant grass was established singularly in rows spaced 1.4 m from each other. Organic and chemical fertilizers were applied at 150 kg of N/ha/year with in the pastures under agroecological and conventional systems, respectively. Lactating Holstein cows which received 5.0 kg/day supplementary concentrate feed were used for evaluation. The experimental design was completely randomized, with two treatments (agroecological and conventional systems two replications (paddocks and independent evaluations (grazing cycles. The pastures were used during the whole year for the agroecological system and for 195 days in the conventional year. The average values of forage mass were 3.5 and 4.2 t/ha and the stocking rates were 2.08 and 3.23 AU/ha for the respective systems. The results suggest that the use of the elephant grass under the agroecological system allows for best distribution of forage and stocking rate to be more uniform throughout the year than the use of elephant grass in conventional system.

  10. Potential of grass seed production for new lawns

    Directory of Open Access Journals (Sweden)

    Josiane Vargas de Oliveira Maximino


    Full Text Available The Paspalum and Axonopus genera are among the main warm season grasses used for lawns. The seed propagation contributes to the decrease of the cost of establishment, besides maintaining the exact characteristics of the mother plant genotype, because they are apomictic species. The objective of this work was to evaluate the seed production potential of seventeen grass accesses of the species Paspalum notatum, P. lepton, P. lividum and Axonopus parodii. The experiment was conducted at Capão do Leão, Rio Grande do Sul State, Brazil, in a randomized block design, with four replications. The evaluated variables were: number of inflorescences per area, number of florets per inflorescence and seed production potential (SPP. In order to measure the seed production potential of the accesses, the equation proposed is: SPP = number of florets per inflorescence x number of inflorescences per m2 . There were year, access and interaction between years and accesses effect for the traits number of inflorescences per area and seed production potential. For the number of florets per inflorescence, there was no year effect. Potential production for the 2013/2014 harvest, ranged from 19,152.00 to 135,062.70 seeds m- ², with PN 09 of the P. notatum species standing out. In the 2014/2015 harvest, the seed production potential ranged from 9,973.75 to 81,536.75 seeds m- ², highlighting the access PN 11 of the species P. notatum. The accesses PN 11, PN 09, PN 10 and AP 01 were in the top third of the seed production potential ranking in the two harvests, and “grama-batatais” was in the lower third. There is genotype-environment interaction for all characteristics evaluated. However, there are accesses that show seed production potential consistently superior to the “grama-batatais” control, and have a greater potential for exploitation in the establishment of lawns by seeds.

  11. Diet Switching by Mammalian Herbivores in Response to Exotic Grass Invasion.

    Directory of Open Access Journals (Sweden)

    Carolina Bremm

    Full Text Available Invasion by exotic grasses is a severe threat to the integrity of grassland ecosystems all over the world. Because grasslands are typically grazed by livestock and wildlife, the invasion is a community process modulated by herbivory. We hypothesized that the invasion of native South American grasslands by Eragrostis plana Nees, an exotic tussock-forming grass from Africa, could be deterred by grazing if grazers switched dietary preferences and included the invasive grass as a large proportion of their diets. Bos taurus (heifers and Ovis aries (ewes grazed plots with varying degrees of invasion by E. plana in a replicated manipulative experiment. Animal positions and species grazed were observed every minute in 45-min grazing session. Proportion of bites and steps in and out of E. plana tussocks were measured and used to calculate several indices of selectivity. Both heifers and ewes exhibited increasing probability of grazing E. plana as the proportion of area covered by tussocks increased, but they behaved differently. In agreement with expectations based on the allometry of dietary preferences and morphology, ewes consumed a low proportion of E. plana, except in areas that had more than 90% E. plana cover. Heifers consumed proportionally more E. plana than ewes. Contrary to our hypothesis, herbivores did not exhibit dietary switching towards the invasive grass. Moreover, they exhibited avoidance of the invasive grass and preference for short-statured native species, both of which should tend to enhance invasion. Unless invasive plants are highly palatable to livestock, the effect of grazing to deter the invasion is limited, due to the inherent avoidance of the invasive grass by the main grazers in the ecosystem, particularly sheep.

  12. Dynamics of a grassland ecosystem: botanical equilibrium in the Park Grass Experiment

    Energy Technology Data Exchange (ETDEWEB)

    Silvertown, J


    The published results of the Park Grass Experiment (PGE), begun in 1856, provide up to 30 yr of annual data which may be used to determine whether the botanical composition of these grasslands was at equilibrium. Data covering a period exceeding 80 yr are available to test for relationships between hay yield (biomass), species diversity, species number and time. Species diversity and species number show negative relationships with plot biomass and with pH. These relationships were constant over time. The effects of biomass and pH on species number and species diversity were additive. Analysis of the flora of nine plots, each divided into grasses, legumes and a miscellaneous component showed that these components were at equilibrium. The effect of various endogenous factors on this botanical equilibrium was examined. No regular or irregular cycles of component biomass operating between years were detected and it is inferred that populations were regulated by processes operating within individual years. The biomasses of all three components were positively correlated within an unfertilized plot but the floristic components of plots receiving a fertilizer treatment showed few within-plot correlations. By contrast between-plot correlations of components were common for all plots with the exception of those receiving nitrogen fertilizer. The mechanisms of population regulation which maintained the park grass ecosystem at equilibrium are discussed and tests for these are proposed.

  13. Genetic resources of perennial forage grasses in Serbia: Current state, broadening and evaluation

    Directory of Open Access Journals (Sweden)

    Sokolović Dejan


    Full Text Available Due to historical background of vegetation development, geographical position, climate and relief, Serbia represents one of the 158 world biodiversity centres, based upon the number of plant species and territory size (biodiversity index 0.72. Large areas in Serbia are under natural grasslands and pastures, composed of forage grass species, and important as source of natural plant genetic diversity and germplasm for breeding. These eco-systems represent basic prerequisites for sustainable forage production, but very low potential of them is utilized and genetic resources are not protected. Family Poaceae is present in Serbia flora with 70 genera and among them from the aspect of forage production and quality, the most important are perennial Festuca, Lolium, Dactylis, Phleum, Bromus, Arrhenatherum, Poa and Agrostis species. Most of these grasses have been bred in Serbia and lot of cultivars were released. These cultivars contain autochthonous Serbian material and represent great and important resource of genetic variability. Therefore, collecting of new samples which are acclimatised to local eco-geographical conditions and including them in plant ex situ gene bank is of exceptional importance for further utilization in different plant breeding programmes as well as genetic resources protection. These autochthonous populations have natural variability and very often have satisfactory yielding performance in comparison with introduced cultivars, which referred them for direct phenotypic selection for cultivars release. Broadening of forage grasses genotypes collection is permanent objective of Serbian scientists. Collected accessions are being characterized and evaluated for important phenological, morphological and agronomical traits. In this paper genetic resources of forage grass species, their diversity and potentials, state of the grasses gene banks, as well as possibility for breeding of new cultivars has been analysed.

  14. Role of carbohydrate metabolism in grass tetany

    Energy Technology Data Exchange (ETDEWEB)

    Miller, J.K.; Madsen, F.C.; Lentz, D.E.; Hansard, S.L.


    Clinical hypomagnesemia is confined primarily to beef cattle in the United States but also occurs in dairy cattle in other countries, probably due to different management practices. During periods when grass tetany is likely, early vegetative temperate zone grasses are usually low in total readily available carbohydrates and magnesium but high in potassium and nitrogen. The tetany syndrome may include hypoglycemia and ketosis, suggesting an imbalance in intermediary energy metabolism. Many enzyme systems critical to cellular metabolism, including those which hydrolyze and transfer phosphate groups, are activated by Mg. Thus, by inference, Mg is required for normal glucose utilization, fat, protein, nucleic acid and coenzyme synthesis, muscle contraction, methyl group transfer, and sulfate, acetate, and formate activation. Numerous clinical and experimental studies suggest an intimate relationship between metabolism of Mg and that of carbohydrate, glucagon, and insulin. The objective is to review this literature and suggest ways in which these relationships might contribute to a chain of events leading to grass tetany.

  15. Biogas and Methane Yield from Rye Grass

    Directory of Open Access Journals (Sweden)

    Tomáš Vítěz


    Full Text Available Biogas production in the Czech Republic has expanded substantially, including marginal regions for maize cultivation. Therefore, there are increasingly sought materials that could partially replace maize silage, as a basic feedstock, while secure both biogas production and its quality.Two samples of rye grass (Lolium multiflorum var. westerwoldicum silage with different solids content 21% and 15% were measured for biogas and methane yield. Rye grass silage with solid content of 15% reached an average specific biogas yield 0.431 m3·kg−1 of organic dry matter and an average specific methane yield 0.249 m3·kg−1 of organic dry matter. Rye grass silage with solid content 21% reached an average specific biogas yield 0.654 m3·kg−1 of organic dry matter and an average specific methane yield 0.399 m3·kg−1 of organic dry matter.

  16. Rehabilitation experiment by phytoremediation using lawn grass

    International Nuclear Information System (INIS)


    Measures against environmental contamination by radioactive materials originated from the Fukushima Nuclear Accident (May, 2011), are being conducted in Fukushima and surrounding prefectures. Regarding to the measures, a phytoremediation experiment with several types of lawn grasses in a field scale have been carried out. Lawn grasses are generally characterized by shallow rhizosphere, high density and root mat formation. Decontamination effectiveness of radioactive cesium by plant uptake and by sod removing was investigated. As a result, the range of decontamination factors by plant uptake was below than 1% because of low transfer rate form soil to plant. On the other hand, maximum decontamination factor by sod removing reached about 100%. Decontamination activities with various methods will be implemented according to the national decontamination policy and related plans in each municipality. The phytoremediation method with lawn grass would be applicable in limited circumstances. (author)

  17. Relationship between the Al resistance of grasses and their adaptation to an infertile habitat. (United States)

    Poozesh, Vahid; Cruz, Pablo; Choler, Philippe; Bertoni, Georges


    Original data on Al resistance, relative growth rate and leaf traits of five European grasses as well as literature data on Al resistance, habitat preference and traits of grasses were considered to determine whether (a) Al resistance is correlated to a growth conservative strategy and (b) species occurrence could be useful to assess Al toxicity in meadows on acid soils. The Al resistance of 15 species was represented by the Al activity in nutrient solution that resulted in a 50 % decrease in root length, [Al(3+)](50), or, for published values, in root or plant biomass. The correlations between Al resistance and acidity or nitrogen indices and the correlation between Al resistance and selected traits (relative growth rate, leaf dry matter content, specific leaf area and leaf thickness) were calculated. Principal component analysis was used for the characterization of the relationships between Al resistance and measured traits. The [Al(3+)](50) values of the resistant species Molinia caerulea and Sieglingia decumbens were 13 and 26 microm [Al(3+)](50), respectively. The known Al resistance of 15 species that were mainly of the intermediate strategy competitor-stress tolerator-ruderal (C-S-R) type and of the S type was correlated with Ellenberg's nitrogen and acidity indices. For the whole set of species, the correlation between Al resistance and traits was not significant. The Al resistance of the C-S-R species was variable and independent of their traits. S-type species, adapted to acid soils and with traits of conservative strategy, displayed Al resistance. The large difference in Al resistance between grasses may help assess Al soil toxicity by using the abundance of grasses.

  18. Genetic sorting of subordinate species in grassland modulated by intraspecific variation in dominant species.

    Directory of Open Access Journals (Sweden)

    Danny J Gustafson

    Full Text Available Genetic variation in a single species can have predictable and heritable effects on associated communities and ecosystem processes, however little is known about how genetic variation of a dominant species affects plant community assembly. We characterized the genetic structure of a dominant grass (Sorghastrum nutans and two subordinate species (Chamaecrista fasciculata, Silphium integrifolium, during the third growing season in grassland communities established with genetically distinct (cultivated varieties or local ecotypes seed sources of the dominant grasses. There were genetic differences between subordinate species growing in the cultivar versus local ecotype communities, indicating that intraspecific genetic variation in the dominant grasses affected the genetic composition of subordinate species during community assembly. A positive association between genetic diversity of S. nutans, C. fasciculata, and S. integrifolium and species diversity established the role of an intraspecific biotic filter during community assembly. Our results show that intraspecific variation in dominant species can significantly modulate the genetic composition of subordinate species.

  19. Genome-Wide Characterization of Major Intrinsic Proteins in Four Grass Plants and Their Non-Aqua Transport Selectivity Profiles with Comparative Perspective.

    Directory of Open Access Journals (Sweden)

    Abul Kalam Azad

    Full Text Available Major intrinsic proteins (MIPs, commonly known as aquaporins, transport not only water in plants but also other substrates of physiological significance and heavy metals. In most of the higher plants, MIPs are divided into five subfamilies (PIPs, TIPs, NIPs, SIPs and XIPs. Herein, we identified 68, 42, 38 and 28 full-length MIPs, respectively in the genomes of four monocot grass plants, specifically Panicum virgatum, Setaria italica, Sorghum bicolor and Brachypodium distachyon. Phylogenetic analysis showed that the grass plants had only four MIP subfamilies including PIPs, TIPs, NIPs and SIPs without XIPs. Based on structural analysis of the homology models and comparing the primary selectivity-related motifs [two NPA regions, aromatic/arginine (ar/R selectivity filter and Froger's positions (FPs] of all plant MIPs that have been experimentally proven to transport non-aqua substrates, we predicted the transport profiles of all MIPs in the four grass plants and also in eight other plants. Groups of MIP subfamilies based on ar/R selectivity filter and FPs were linked to the non-aqua transport profiles. We further deciphered the substrate selectivity profiles of the MIPs in the four grass plants and compared them with their counterparts in rice, maize, soybean, poplar, cotton, Arabidopsis thaliana, Physcomitrella patens and Selaginella moellendorffii. In addition to two NPA regions, ar/R filter and FPs, certain residues, especially in loops B and C, contribute to the functional distinctiveness of MIP groups. Expression analysis of transcripts in different organs indicated that non-aqua transport was related to expression of MIPs since most of the unexpressed MIPs were not predicted to facilitate the transport of non-aqua molecules. Among all MIPs in every plant, TIP (BdTIP1;1, SiTIP1;2, SbTIP2;1 and PvTIP1;2 had the overall highest mean expression. Our study generates significant information for understanding the diversity, evolution, non

  20. Assessment of some macromineral concentration of a grass/ legume ...

    African Journals Online (AJOL)

    Assessment of some macromineral concentration of a grass/ legume sward in ... Bulletin of Animal Health and Production in Africa ... The study aimed to determine the concentration of some macromineral elements in the grass/legume pasture ...

  1. Modelling of excess noise attnuation by grass and forest | Onuu ...

    African Journals Online (AJOL)

    , guinea grass (panicum maximum) and forest which comprises iroko (milicia ezcelea) and white afara (terminalia superba) trees in the ratio of 2:1 approximately. Excess noise attenuation spectra have been plotted for the grass and forest for ...

  2. Photosynthetic light response of the C4 grasses Brachiaria brizantha and B. humidicola under shade

    Directory of Open Access Journals (Sweden)

    Dias-Filho Moacyr Bernardino


    Full Text Available Forage grasses in tropical pastures can be subjected to considerable diurnal and seasonal reductions in available light. To evaluate the physiological behavior of the tropical forage grasses Brachiaria brizantha cv. Marandu and B. humidicola to low light, the photosynthetic light response and chlorophyll contents of these species were compared for plants grown outdoors, on natural soil, in pots, in full sunlight and those shaded to 30 % of full sunlight, over a 30-day period. Both species showed the ability to adjust their photosynthetic behavior in response to shade. Photosynthetic capacity and light compensation point were lower for shade plants of both species, while apparent quantum yield was unaffected by the light regime. Dark respiration and chlorophyll a:b ratio were significantly reduced by shading only in B. humidicola. B. humidicola could be relatively more adapted to succeed, at least temporarily, in light-limited environments.

  3. Root proliferation in native perennial grasses of arid Patagonia, Argentina

    Institute of Scientific and Technical Information of China (English)

    Yanina A. TORRES; Mara M. MUJICA; Sandra S. BAIONI; Jos ENTO; Mara N. FIORETTI; Guillermo TUCAT; Carlos A. BUSSO; Oscar A. MONTENEGRO; Leticia ITHURRART; Hugo D. GIORGETTI; Gustavo RODRGUEZ; Diego BENTIVEGNA; Roberto E. BREVEDAN; Osvaldo A. FERNNDEZ


    Pappophorum vaginatum is the most abundant C4 perennial grass desirable to livestock in rangelands of northeastern Patagonia, Argentina. We hypothesized that (1) defoliation reduce net primary productivity, and root length density and weight in the native species, and (2) root net primary productivity, and root length density and weight, are greater in P. vaginatum than in the other, less desirable, native species (i.e., Aristida spegazzinii, A. subulata and Sporobolus cryptandrus). Plants of all species were either exposed or not to a severe defoliation twice a year during two growing seasons. Root proliferation was measured using the cylinder method. Cylindrical, iron structures, wrapped up using nylon mesh, were buried diagonally from the periphery to the center on individual plants. These structures, initially filled with soil without any organic residue, were dug up from the soil on 25 April 2008, after two successive defoliations in mid-spring 2007. During the second growing season (2008-2009), cylinders were destructively harvested on 4 April 2009, after one or two defoliations in mid-and/or late-spring, respectively. Roots grown into the cylinders were obtained after washing the soil manually. Defoliation during two successive years did reduce the study variables only after plants of all species were defoliated twice, which supported the first hypothesis. The greater root net primary productivity, root length den-sity and weight in P. vaginatum than in the other native species, in support of the second hypothesis, could help to explain its greater abundance in rangelands of Argentina.

  4. Dynamic development of starch granules and the regulation of starch biosynthesis in Brachypodium distachyon: comparison with common wheat and Aegilops peregrina. (United States)

    Chen, Guanxing; Zhu, Jiantang; Zhou, Jianwen; Subburaj, Saminathan; Zhang, Ming; Han, Caixia; Hao, Pengchao; Li, Xiaohui; Yan, Yueming


    Thorough understanding of seed starch biosynthesis and accumulation mechanisms is of great importance for agriculture and crop improvement strategies. We conducted the first comprehensive study of the dynamic development of starch granules and the regulation of starch biosynthesis in Brachypodium distachyon and compared the findings with those reported for common wheat (Chinese Spring, CS) and Aegilops peregrina. Only B-granules were identified in Brachypodium Bd21, and the shape variation and development of starch granules were similar in the B-granules of CS and Bd21. Phylogenetic analysis showed that most of the Bd21 starch synthesis-related genes were more similar to those in wheat than in rice. Early expression of key genes in Bd21 starch biosynthesis mediate starch synthesis in the pericarp; intermediate-stage expression increases the number and size of starch granules. In contrast, these enzymes in CS and Ae. peregrina were mostly expressed at intermediate stages, driving production of new B-granules and increasing the granule size, respectively. Immunogold labeling showed that granule-bound starch synthase (GBSSI; related to amylose synthesis) was mainly present in starch granules: at lower levels in the B-granules of Bd21 than in CS. Furthermore, GBSSI was phosphorylated at threonine 183 and tyrosine 185 in the starch synthase catalytic domain in CS and Ae. peregrina, but neither site was phosphorylated in Bd21, suggesting GBSSI phosphorylation could improve amylose biosynthesis. Bd21 contains only B-granules, and the expression of key genes in the three studied genera is consistent with the dynamic development of starch granules. GBSSI is present in greater amounts in the B-granules of CS than in Bd21; two phosphorylation sites (Thr183 and Tyr185) were found in Triticum and Aegilops; these sites were not phosphorylated in Bd21. GBSSI phosphorylation may reflect its importance in amylose synthesis.

  5. Classification of grass pollen through the quantitative analysis of surface ornamentation and texture. (United States)

    Mander, Luke; Li, Mao; Mio, Washington; Fowlkes, Charless C; Punyasena, Surangi W


    Taxonomic identification of pollen and spores uses inherently qualitative descriptions of morphology. Consequently, identifications are restricted to categories that can be reliably classified by multiple analysts, resulting in the coarse taxonomic resolution of the pollen and spore record. Grass pollen represents an archetypal example; it is not routinely identified below family level. To address this issue, we developed quantitative morphometric methods to characterize surface ornamentation and classify grass pollen grains. This produces a means of quantifying morphological features that are traditionally described qualitatively. We used scanning electron microscopy to image 240 specimens of pollen from 12 species within the grass family (Poaceae). We classified these species by developing algorithmic features that quantify the size and density of sculptural elements on the pollen surface, and measure the complexity of the ornamentation they form. These features yielded a classification accuracy of 77.5%. In comparison, a texture descriptor based on modelling the statistical distribution of brightness values in image patches yielded a classification accuracy of 85.8%, and seven human subjects achieved accuracies between 68.33 and 81.67%. The algorithmic features we developed directly relate to biologically meaningful features of grass pollen morphology, and could facilitate direct interpretation of unsupervised classification results from fossil material.

  6. Meiosis in elephant grass (Pennisetum purpureum, pearl millet (Pennisetum glaucum (Poaceae, Poales and their interspecific hybrids

    Directory of Open Access Journals (Sweden)

    Vânia Helena Techio


    Full Text Available The cultivated and sexually compatible species Pennisetum purpureum (elephant grass, 2n = 4x = 28 and Pennisetum glaucum (pearl millet, 2n = 2x = 14 can undergo hybridization which favors the amplification of their genetic background and the introgression of favorable alleles into breeding programs. The main problem with interspecific hybrids of these species is infertility due to triploidy (2n = 3x = 21. This study describes meiosis in elephant grass x pearl millet hybrids and their progenitors. Panicles were prepared according to the conventional protocol for meiotic studies and Alexander’s stain was used for assessing pollen viability. Pearl millet accessions presented regular meiosis with seven bivalents and high pollen viability. For elephant grass, 14 bivalents in diakinesis and metaphase I were observed. The BAG 63 elephant grass accession, derived from tissue culture, presented a high frequency of meiotic abnormalities. The three hybrid accessions presented a high frequency of abnormalities characterized by irregular chromosomal segregation which resulted in the formation of sterile pollen.

  7. Nitrogen washing from C3 and C4 cover grasses residues by rain

    Directory of Open Access Journals (Sweden)

    Ciro Antonio Rosolem


    Full Text Available Crop species with the C4 photosynthetic pathway are more efficient in assimilating N than C3 plants, which results in different N amounts prone to be washed from its straw by rain water. Such differences may affect N recycling in agricultural systems where these species are grown as cover crops. In this experiment, phytomass production and N leaching from the straw of grasses with different photosynthetic pathways were studied in response to N application. Pearl millet (Pennisetum glaucum and congo grass (Brachiaria ruziziensis with the C4 photosynthetic pathway, and black oat (Avena Strigosa and triticale (X Triticosecale, with the C3 photosynthetic pathway, were grown for 47 days. After determining dry matter yields and N and C contents, a 30 mm rainfall was simulated over 8 t ha-1 of dry matter of each plant residue and the leached amounts of ammonium and nitrate were determined. C4 grasses responded to higher fertilizer rates, whereas N contents in plant tissue were lower. The amount of N leached from C4 grass residues was lower, probably because the C/N ratio is higher and N is more tightly bound to organic compounds. When planning a crop rotation system it is important to take into account the difference in N release of different plant residues which may affect N nutrition of the subsequent crop.

  8. Notes on Alien Bromus Grasses in Taiwan

    Directory of Open Access Journals (Sweden)

    Ming-Jer Jung


    Full Text Available Bromus carinatus Hook. & Arn., Bromus hordeaceus L., Bromus pubescens Muhl. ex Willd. and Bromus secalinus L. were recently found at middle elevations of southern and central Taiwan, respectively. We present taxonomic treatments, distribution map, and line-drawings of these introduced alien brome grasses.

  9. Notes on the nomenclature of some grasses

    NARCIS (Netherlands)

    Henrard, J.Th.


    In a former article 1) many new combinations and critical observations were published on various grasses all over the world. New investigations in critical genera together with the study of the existing literature made it necessary to accept various other arrangements in this important family. The

  10. Grass Pollen Pollution from Biofuels Farming

    Czech Academy of Sciences Publication Activity Database

    Ratajová, A.; Tříska, Jan; Vrchotová, Naděžda; Kolář, L.; Kužel, S.


    Roč. 26, č. 4 (2013), s. 199-203 ISSN 2151-321X R&D Projects: GA MŠk(CZ) ED1.1.00/02.0073 Institutional support: RVO:67179843 Keywords : grass pollen pollution * biofuels farming * temperate climate * PK-fertilization * N-fertilization * phenolic Subject RIV: EH - Ecology, Behaviour Impact factor: 0.556, year: 2013

  11. Global grass (Poaceae) success underpinned by traits facilitating colonization, persistence and habitat transformation. (United States)

    Linder, H P; Lehmann, Caroline E R; Archibald, Sally; Osborne, Colin P; Richardson, David M


    Poaceae (the grasses) is arguably the most successful plant family, in terms of its global occurrence in (almost) all ecosystems with angiosperms, its ecological dominance in many ecosystems, and high species richness. We suggest that the success of grasses is best understood in context of their capacity to colonize, persist, and transform environments (the "Viking syndrome"). This results from combining effective long-distance dispersal, efficacious establishment biology, ecological flexibility, resilience to disturbance and the capacity to modify environments by changing the nature of fire and mammalian herbivory. We identify a diverse set of functional traits linked to dispersal, establishment and competitive abilities. Enhanced long-distance dispersal is determined by anemochory, epizoochory and endozoochory and is facilitated via the spikelet (and especially the awned lemma) which functions as the dispersal unit. Establishment success could be a consequence of the precocious embryo and large starch reserves, which may underpin the extremely short generation times in grasses. Post-establishment genetic bottlenecks may be mitigated by wind pollination and the widespread occurrence of polyploidy, in combination with gametic self-incompatibility. The ecological competitiveness of grasses is corroborated by their dominance across the range of environmental extremes tolerated by angiosperms, facilitated by both C 3 and C 4 photosynthesis, well-developed frost tolerance in several clades, and a sympodial growth form that enabled the evolution of both annual and long-lived life forms. Finally, absence of investment in wood (except in bamboos), and the presence of persistent buds at or below ground level, provides tolerance of repeated defoliation (whether by fire, frost, drought or herbivores). Biotic modification of environments via feedbacks with herbivory or fire reinforce grass dominance leading to open ecosystems. Grasses can be both palatable and productive

  12. Germination of Themeda triandra (Kangaroo grass) as affected by ...

    African Journals Online (AJOL)

    Low rainfall in range areas restricts germination, growth and development of majority of range grasses. However, germination and establishment potential of forage grasses vary and depends on environmental conditions. Themeda triandra is an excellent known grass to grow under different environmental conditions.

  13. Convex relationships in ecosystems containing mixtures of trees and grass

    CSIR Research Space (South Africa)

    Scholes, RJ


    Full Text Available The relationship between grass production and the quantity of trees in mixed tree-grass ecosystems (savannas) is convex for all or most of its range. In other words, the grass production declines more steeply per unit increase in tree quantity...

  14. Heterologous expression and transcript analysis of gibberellin biosynthetic genes of grasses reveals novel functionality in the GA3ox family. (United States)

    Pearce, Stephen; Huttly, Alison K; Prosser, Ian M; Li, Yi-dan; Vaughan, Simon P; Gallova, Barbora; Patil, Archana; Coghill, Jane A; Dubcovsky, Jorge; Hedden, Peter; Phillips, Andrew L


    The gibberellin (GA) pathway plays a central role in the regulation of plant development, with the 2-oxoglutarate-dependent dioxygenases (2-ODDs: GA20ox, GA3ox, GA2ox) that catalyse the later steps in the biosynthetic pathway of particularly importance in regulating bioactive GA levels. Although GA has important impacts on crop yield and quality, our understanding of the regulation of GA biosynthesis during wheat and barley development remains limited. In this study we identified or assembled genes encoding the GA 2-ODDs of wheat, barley and Brachypodium distachyon and characterised the wheat genes by heterologous expression and transcript analysis. The wheat, barley and Brachypodium genomes each contain orthologous copies of the GA20ox, GA3ox and GA2ox genes identified in rice, with the exception of OsGA3ox1 and OsGA2ox5 which are absent in these species. Some additional paralogs of 2-ODD genes were identified: notably, a novel gene in the wheat B genome related to GA3ox2 was shown to encode a GA 1-oxidase, named as TaGA1ox-B1. This enzyme is likely to be responsible for the abundant 1β-hydroxylated GAs present in developing wheat grains. We also identified a related gene in barley, located in a syntenic position to TaGA1ox-B1, that encodes a GA 3,18-dihydroxylase which similarly accounts for the accumulation of unusual GAs in barley grains. Transcript analysis showed that some paralogs of the different classes of 2-ODD were expressed mainly in a single tissue or at specific developmental stages. In particular, TaGA20ox3, TaGA1ox1, TaGA3ox3 and TaGA2ox7 were predominantly expressed in developing grain. More detailed analysis of grain-specific gene expression showed that while the transcripts of biosynthetic genes were most abundant in the endosperm, genes encoding inactivation and signalling components were more highly expressed in the seed coat and pericarp. The comprehensive expression and functional characterisation of the multigene families encoding the 2-ODD

  15. Effects of an invasive grass on the demography of the Caribbean cactus Harrisia portoricensis: Implications for cacti conservation (United States)

    Rojas-Sandoval, Julissa; Meléndez-Ackerman, Elvia


    The impact of exotic species around the world is among the primary threats to the conservation and management of rare and endangered species. In this work we asked whether or not the presence of the African grass Megathyrsus maximus on Mona Island was associated with negative impacts on the demography of the endangered Caribbean cactus Harrisia portoricensis. To address this question we performed field observations where we compared demographic data collected at un-manipulated areas invaded by Megathyrsus with un-manipulated areas non-invaded by this exotic grass. Additionally, demographic data were also collected in areas in which we removed the exotic grass biomass using two alternative treatments: complete and partial grass removal. Results demonstrated that the presence of Megathyrsus has negative effects on demographic parameters of Harrisia at various stages throughout its life cycle. In general, the survival, growth, and reproduction of Harrisia plants were depressed under the presence of Megathyrsus. Growth and survival of seedlings and juveniles of Harrisia were more impacted by the presence of Megathyrsus than adult performance and seedling recruitment only occurred in areas with grass absence. Our combined results suggest that modifications of the micro-environment by the presence of Megathyrsus may add an additional level of vulnerability to the persistence of Harrisia, and as such this factor must be considered when designing conservation strategies for this endangered species. This study highlights the need for a greater emphasis on understanding the interactions between invasive grass species and native cacti, and the importance of such information in designing conservation strategies for cacti species elsewhere.

  16. Estimating grass and grass silage degradation characteristics by in situ and in vitro gas production methods

    Directory of Open Access Journals (Sweden)

    Danijel Karolyi


    Full Text Available Fermentation characteristics of grass and grass silage at different maturities were studied using in situ and in vitro gas production methods. In situ data determined difference between grass and silage. Degradable fraction decreased as grass matured while the undegradable fraction increased. Rate of degradation (kd was slower for silage than fresh grass. Gas production method (GP data showed that fermentation of degradable fraction was different between stage of maturity in both grass and silage. Other data did not show any difference with the exception for the rate of GP of soluble and undegradable fraction. The in situ degradation characteristics were estimated from GP characteristics. The degradable and undegradable fractions could be estimated by multiple relationships. Using the three-phases model for gas production kd and fermentable organic matter could be estimated from the same parameters. The only in situ parameter that could not be estimated with GP parameters was the soluble fraction. The GP method and the three phases model provided to be an alternative to the in situ method for animal feed evaluations.

  17. DNA Methylation of T1R1 Gene in the Vegetarian Adaptation of Grass Carp Ctenopharyngodon idella. (United States)

    Cai, Wenjing; He, Shan; Liang, Xu-Fang; Yuan, Xiaochen


    Although previous studies have indicated importance of taste receptors in food habits formation in mammals, little is known about those in fish. Grass carp is an excellent model for studying vegetarian adaptation, as it shows food habit transition from carnivore to herbivore. In the present study, pseudogenization or frameshift mutations of the umami receptors that hypothesized related to dietary switch in vertebrates, were not found in grass carp, suggesting other mechanisms for vegetarian adaptation in grass carp. T1R1 and T1R3 strongly responded to L-Arg and L-Lys, differing from those of zebrafish and medaka, contributing to high species specificity in amino acid preferences and diet selection of grass carp. After food habit transition of grass carp, DNA methylation levels were higher in CPG1 and CPG3 islands of upstream control region of T1R1 gene. Luciferase activity assay of upstream regulatory region of T1R1 (-2500-0 bp) without CPG1 or CPG3 indicated that CPG1 and CPG3 might be involved in transcriptional regulation of T1R1 gene. Subsequently, high DNA methylation decreased expression of T1R1 in intestinal tract. It could be a new mechanism to explain, at least partially, the vegetarian adaptation of grass carp by regulation of expression of umami receptor via epigenetic modification.

  18. Cross-species amplification of 105 Lolium perenne SSR loci in 23 species within the Poaceae

    DEFF Research Database (Denmark)

    Jensen, Louise Bach; Holm, Preben Bach; Lübberstedt, Thomas


    Amplification of 105 Lolium perenne SSR markers was studied in 23 grass species representing seven tribes from three subfamilies of Poaceae. Twelve of the SSR markers are published for the first time. Between 2% and 96% of the SSR markers could be amplified within a given species. A subset of eight...... SSR markers was evaluated for polymorphism across nine of the 23 grass species. Four to seven of the markers were polymorphic within each species, with an average detection of 2.4 alleles per species....

  19. Functional immunoglobulin E cross-reactivity between Pas n 1 of Bahia grass pollen and other group 1 grass pollen allergens. (United States)

    Davies, J M; Dang, T D; Voskamp, A; Drew, A C; Biondo, M; Phung, M; Upham, J W; Rolland, J M; O'Hehir, R E


    Grass pollens are major triggers of allergic rhinitis and asthma, but the immunological relationships between pollen allergens of the subtropical Bahia grass, Paspalum notatum, and temperate grasses are unresolved. To assess serum IgE cross-reactivity between subtropical P. notatum and temperate Lolium perenne (Ryegrass) pollen allergens. Serum IgE reactivities of grass pollen-allergic patients with P. notatum, L. perenne and Cynodon dactylon (Bermuda grass) pollen extracts and their respective purified group 1 allergens, Pas n 1, Lol p 1 and Cyn d 1, were compared by immunoblotting, ELISA and basophil activation. In a cohort of 51 patients from a temperate region, a high frequency of IgE reactivity with each grass pollen was detected, but reactivity with L. perenne pollen was substantially greater than with P. notatum and C. dactylon pollen. Similarly, serum IgE reactivity with Lol p 1 was greater than with Pas n 1 or Cyn d 1. For seven of eight sera studied in detail, asymmetric serum IgE cross-reactivity was observed; L. perenne pollen inhibited IgE reactivity with P. notatum pollen but not the converse, and IgE reactivity with Pas n 1 was inhibited by Lol p 1 but IgE reactivity with Lol p 1 was not inhibited by Pas n 1 or Cyn d 1. Importantly, P. notatum pollen and Pas n 1 activated basophils in grass pollen-allergic patients from a temperate region, although stimulation was greater by pollen of L. perenne than P. notatum or C. dactylon, and by Lol p 1 than Pas n 1 or Cyn d 1. In contrast, a cohort of 47 patients from a subtropical region showed similar IgE reactivity with P. notatum and L. perenne pollen, and reciprocal cross-inhibition of IgE reactivity between L. perenne and P. notatum. Pollen allergens of the subtropical P. notatum, including Pas n 1, show clinically relevant IgE cross-reactivity with pollen allergens of L. perenne but also species-specific IgE reactivity. © 2011 Blackwell Publishing Ltd.


    Directory of Open Access Journals (Sweden)

    Valentino Straser


    Full Text Available The occasional appearance of circular shapes in meadows and farmland located on slopes usually affected by gravitational phenomena, offered an occasion for verifying the possible relation between the position of the circles in the grass, the gravitational movement of the slope affecting its mineral horizons and the variations of electric and static magnetic fields close to the circular shapes and in the surrounding area. The stress caused by the “creeping” movement in the uderlying ground turned out to be in direct relation with the variation in the electric and magnetic fields caused by piezoelectric and piezomagnetic minerals such as quartz. The onset of the electromagnetic process involves the conversion of electric energy on the surface into an area of spherical shape which is linked with a different growth of herbaceous species compared to the surrounding vegetation.

  1. Warm season grass establishment (in one year without the weeds)

    International Nuclear Information System (INIS)

    Downing, D.


    Native warm season grasses, big bluestem and indian, were established by the broadcast method on a relatively large area (130 acres) of reclaimed coal surface-mined land in Perry County, Illinois. Existing vegetation was controlled using two quarts of Round-Up and 12 ounces of Plateau per acre the first week of May. Five pounds of pure live seed of both species were applied by airflow using 100 pounds per acre of 0-46-0 and 100 pounds per acre of 0-0-60, primarily to carry the seed. The surface was cultipacked to insure good seed to soil contact. Planting was initiated and completed the last week of June. An estimated 95% to 100% ground cover was evident by mid to late August. By mid September, numerous big blue stem flower/seed stalks were noticeable

  2. Pollutant tracking for 3 Western North Atlantic sea grasses by remote sensing: Preliminary diminishing white light responses of Thalassia testudinum, Halodule wrightii, and Zostera marina

    International Nuclear Information System (INIS)

    Thorhaug, Anitra; Berlyn, Graeme P.; Poulos, Helen M.; Goodale, Uromi M.


    Highlights: • Sea grass accessory pigments are more important than Chl at medium to low light intensity. • Partial absorption changes in Thalassia and also in Halodule at low intensity visible light ranges. • NDVI and chlNDI do not detect these changes or low light responses of sea grasses. • Intertidal sea grasses are less stressed than the subtidal species at low and high light. • Chl b is an important photosynthetic pigment in tropical/subtropical species. - Abstract: Sea grasses are foundation species for estuarine ecosystems. The available light for sea grasses diminishes rapidly during pollutant spills, effluent releases, disturbances such as intense riverine input, and tidal changes. We studied how sea grasses’ remote-sensing signatures and light-capturing ability respond to short term light alterations. In vivo responses were measured over the entire visible-light spectra to diminishing white-light on whole-living-plants’ spectral reflectance, including 6 h of full oceanic-light fluences from 10% to 100%. We analyzed differences by various reflectance indices. We compared the sea grasses species responses of tropical vs. temperate and intertidals (Halodule wrightii, and Zostera marina) vs. subtidal (Thalassia testudinum). Reflectance diminished with decreasing light intensity that coincided with greater accessory pigment stimulation (anthocyanin, carotenoids, xanthins). Chlorophyll a and Chlorophyll b differed significantly among species (Thalassia vs. Halodule). Photosynthetic efficiency diminished at high light intensities. The NDVI index was inadequate to perceive these differences. Our results demonstrate the leaf-level utility of data to remote sensing for mapping sea grass and sea grass stress

  3. Nowcasting daily minimum air and grass temperature (United States)

    Savage, M. J.


    Site-specific and accurate prediction of daily minimum air and grass temperatures, made available online several hours before their occurrence, would be of significant benefit to several economic sectors and for planning human activities. Site-specific and reasonably accurate nowcasts of daily minimum temperature several hours before its occurrence, using measured sub-hourly temperatures hours earlier in the morning as model inputs, was investigated. Various temperature models were tested for their ability to accurately nowcast daily minimum temperatures 2 or 4 h before sunrise. Temperature datasets used for the model nowcasts included sub-hourly grass and grass-surface (infrared) temperatures from one location in South Africa and air temperature from four subtropical sites varying in altitude (USA and South Africa) and from one site in central sub-Saharan Africa. Nowcast models used employed either exponential or square root functions to describe the rate of nighttime temperature decrease but inverted so as to determine the minimum temperature. The models were also applied in near real-time using an open web-based system to display the nowcasts. Extrapolation algorithms for the site-specific nowcasts were also implemented in a datalogger in an innovative and mathematically consistent manner. Comparison of model 1 (exponential) nowcasts vs measured daily minima air temperatures yielded root mean square errors (RMSEs) <1 °C for the 2-h ahead nowcasts. Model 2 (also exponential), for which a constant model coefficient ( b = 2.2) was used, was usually slightly less accurate but still with RMSEs <1 °C. Use of model 3 (square root) yielded increased RMSEs for the 2-h ahead comparisons between nowcasted and measured daily minima air temperature, increasing to 1.4 °C for some sites. For all sites for all models, the comparisons for the 4-h ahead air temperature nowcasts generally yielded increased RMSEs, <2.1 °C. Comparisons for all model nowcasts of the daily grass

  4. Reducing tillage intensity affects the cumulative emergence dynamics of annual grass weeds in winter cereals

    DEFF Research Database (Denmark)

    Scherner, A; Melander, B; Jensen, P K


    Annual grass weeds such as Apera spica-venti and Vulpia myuros are promoted in non-inversion tillage systems and winter cereal-based crop rotations. Unsatisfactory weed control in these conditions is often associated with a poor understanding of the emergence pattern of these weed species. The aim...... with a higher total emergence seen under direct drilling, followed by pre-sowing tine cultivation and ploughing. The emergence patterns of all species were differently influenced by the tillage systems, suggesting that under direct drilling, in which these species occur simultaneously, management interventions...

  5. Natural lactic acid bacteria population of tropical grasses and their fermentation factor analysis of silage prepared with cellulase and inoculant. (United States)

    Khota, Waroon; Pholsen, Suradej; Higgs, David; Cai, Yimin


    Natural lactic acid bacteria (LAB) populations in tropical grasses and their fermentation characteristics on silage prepared with cellulase enzyme and LAB inoculants were studied. A commercial inoculant Lactobacillus plantarum Chikuso 1 (CH), a local selected strain Lactobacillus casei TH14 (TH14), and 2 cellulases, Acremonium cellulase (AC) and Maicelase (MC; Meiji Seika Pharma Co. Ltd., Tokyo, Japan), were used as additives to silage preparation with fresh and wilted (6 h) Guinea grass and Napier grass. Silage was prepared using a laboratory-scale fermentation system. Treatments were CH, TH14, AC at 0.01% fresh matter, AC 0.1%, MC 0.01%, MC 0.1%, CH+AC 0.01%, CH+AC 0.1%, CH+MC 0.01%, CH+MC 0.1%, TH14+AC 0.1%, TH14+AC 0.01%, TH14+MC 0.1%, and TH14+MC 0.01%. Microorganism counts of Guinea grass and Napier grass before ensiling were 10 2 LAB and 10 6 aerobic bacteria; these increased during wilting. Based on morphological and biochemical characteristics, and 16S rRNA gene sequence analysis, natural strains from both grasses were identified as L. plantarum, L. casei, Lactobacillus acidipiscis, Leuconostoc pseudomesenteroides, Leuconostoc garlicum, Weissella confusa, and Lactococcus lactis. Lactobacillus plantarum and L. casei are the dominant species and could grow at lower pH and produce more lactic acid than the other isolates. Crude protein and neutral detergent fiber were 5.8 and 83.7% of dry matter (DM) for Guinea grass, and 7.5 and 77.1% of DM for Napier grass. Guinea grass had a low level of water-soluble carbohydrates (0.39% of DM). Guinea grass silage treated with cellulase had a lower pH and higher lactic acid content than control and LAB treatments. The 0.1% AC and MC treatments had the best result for fermentation quality. All high water-soluble carbohydrate (2.38% DM) Napier grass silages showed good fermentation quality. Compared with control and LAB-inoculated silage, the cellulase-treated silages had significantly higher crude protein content and


    Directory of Open Access Journals (Sweden)

    Eka Budi Mursa fitri


    Full Text Available Grass jelly is one of the plants that has considerable potential as medicine and drinks. This study was conducted to determine how kinship plant species Grass jelly from three districts. The Exploration of Grass jelly plants conducted in Gianyar, Tabanan and Badung, Bali province. Making preparations in the Structures Laboratory of Plant Development (SPT Faculty Udayana University and the Center of Veterinary (BBVet. This research was carried out from September 2015-January 2016. This research method using the technique of embedding and fresh slices, FAA fixative (formaldehyde: glacial acetic acid: alcohol 70% = 1: 1: 9, 1% safranin staining in 70% alcohol. For the analysis of kinship qualitative and quantitative data were suspended leaf anatomical characters to create table Taxonomy Operation Unit (OTU. The results are used OTU table into mini-tab program version 14.The result showed that four species of grass jelly plants are Cyclea barbata, Stephania japonica, Stephania capitata and Cocculus orbiculatus. Leaf form is like shields and ellipse. Kinship four types of plant grass jelly from three districts are very much based on morphological and anatomical characters (level 15.64% similarity.

  7. The use of less common grass varieties as a factor of increasing forage lands productivity

    Directory of Open Access Journals (Sweden)

    В. Д. Бугайов


    Full Text Available Purpose. To assess introduced samples of drought-resistant species of perennial grasses, select a promising parent material and create on its base high-yielding varie­ ies with economic characters. Methods. Field experiment, laboratory testing. Results. The results of studies on introduction and breeding were given aimed to improve drought tolerance of non-traditional perennial grasses under the conditions of the Right-Bank Forest-Steppe zone of Ukraine. Based on the selected parent material, varieties were created by the use of hybridization and ecotype breeding methods and then entered into the State Register of plant varieties suitable for dissemination in Ukraine, among them: intermediate wheatgrass (Elytrigia intermedia (Host Nevski – ‘Hors’, crested wheatgrass (Agropyron cristatum (L. Gaertn. – ‘Petrivskyi’; meadow brome (Bromus riparia Rehm. – ‘Boian’; slender wheatgrass (Roegneria trachycaulon (Link Nevski – ‘Co­umb’. As compared with conventional, relatively drought-tolerant species of smooth brome (Bromopsis inermis (Leyss. Holub – ‘Mars’, increment of dry matter content of these species in the extreme drought conditions of 2011 was increased by 1,52–3,73 t/ha. Under more sufficient moistening conditions of 2012, slender wheatgrass ‘Columb’ was at the level of the сheck variety in terms of this indicator. Other varieties exceeded it by 1.44–3.22 t/ha. The data was given including seed productivity and sowing quality indicators, after-ripening duration and economic fitness of seeds. Conclusions. The use of the recommended varieties of drought-resistant species of perennial grasses as part of grass mixtures will increase significantly the productivity of grasslands and pastures in the current context of climate change.

  8. Lead-210 and polonium-210 in grass

    Energy Technology Data Exchange (ETDEWEB)

    Hill, C R


    It appears that an important contribution to the observed ..cap alpha..-activity of grass may be provided by a process of natural fall-out in which lead-210 resulting from decay of atmospheric radon, together with a fraction of the equilibrium amount of its descendant polonium-210 are deposited by rainfall directly on to foliage. Metabolic uptake of part of this activity by sheep is indicated by the presence in the kidney of polonium-210. 6 references, 1 figure, 2 tables.

  9. Phylogenetic analysis of the expansion of the MATH-BTB gene family in the grasses. (United States)

    Juranić, Martina; Dresselhaus, Thomas


    MATH-BTB proteins are known to act as substrate-specific adaptors of cullin3 (CUL3)-based ubiquitin E3 ligases to target protein for ubiquitination. In a previous study we reported the presence of 31 MATH-BTB genes in the maize genome and determined the regulatory role of the MATH-BTB protein MAB1 during meiosis to mitosis transition. In contrast to maize, there are only 6 homologous genes in the model plant Arabidopsis, while this family has largely expanded in grasses. Here, we report a phylogenetic analysis of the MATH-BTB gene family in 9 land plant species including various mosses, eudicots, and grasses. We extend a previous classification of the plant MATH-BTB family and additionally arrange the expanded group into 5 grass-specific clades. Synteny studies indicate that expansion occurred to a large extent due to local gene duplications. Expression studies of 3 closely related MATH-BTB genes in maize (MAB1-3) indicate highly specific expression pattern. In summary, this work provides a solid base for further studies comparing genetic and functional information of the MATH-BTB family especially in the grasses.

  10. Effects of processing phases on the quality of massai grass seeds

    Directory of Open Access Journals (Sweden)

    Lilian Faria de Melo

    Full Text Available ABSTRACT Massai grass is an important tropical forage grass. The harvested seeds upon being received by the company, are found to be contaminated with impurities which are removable by processing machines. This procedure is necessary to produce seeds of a quality level within standards established for commercialization and sowing purposes. The objective of this project was to evaluate the effects of processing phases on the physical and physiological quality of massai grass (Panicum maximum x P. infestum, cv. Massai seeds for commercialization purposes. Seeds were sampled before processing and after leaving the air and screen machine (upper and intermediary screens and bottom; first gravity table (drift, upper and intermediate spouts; treating machine; and second gravity table (upper, intermediate, and lower spouts. Seeds were evaluated as to water content, physical (purity and 1,000 seeds weight and physiological quality (germination, first count of germination, seedling vigor classification, accelerated aging, seedling emergence in the field, speed of emergence index, and primary root length, shoot length. Massai grass seeds had their physical and physiological qualities improved when they were processed by an air and screen machine and a gravity table. Seeds from the intermediate discharge spout of the first gravity table, after going through the air and screen machine, are those of with highest physiological potential. The seeds of this species do not need to be processed to fit the germination and purity standards when the national market is the goal.

  11. Molecular features of grass allergens and development of biotechnological approaches for allergy prevention. (United States)

    Devis, Deborah L; Davies, Janet M; Zhang, Dabing


    Allergic diseases are characterized by elevated allergen-specific IgE and excessive inflammatory cell responses. Among the reported plant allergens, grass pollen and grain allergens, derived from agriculturally important members of the Poaceae family such as rice, wheat and barley, are the most dominant and difficult to prevent. Although many allergen homologs have been predicted from species such as wheat and timothy grass, fundamental aspects such as the evolution and function of plant pollen allergens remain largely unclear. With the development of genetic engineering and genomics, more primary sequences, functions and structures of plant allergens have been uncovered, and molecular component-based allergen-specific immunotherapies are being developed. In this review, we aim to provide an update on (i) the distribution and importance of pollen and grain allergens of the Poaceae family, (ii) the origin and evolution, and functional aspects of plant pollen allergens, (iii) developments of allergen-specific immunotherapy for pollen allergy using biotechnology and (iv) development of less allergenic plants using gene engineering techniques. We also discuss future trends in revealing fundamental aspects of grass pollen allergens and possible biotechnological approaches to reduce the amount of pollen allergens in grasses. Copyright © 2017. Published by Elsevier Inc.

  12. Role of grass-legume communities in revegetation of a subalpine mine site in British Columbia

    Energy Technology Data Exchange (ETDEWEB)

    Yamanaka, K


    This study describes an investigation of the potential for pioneer grass-legume communities to stabilize and ameliorate geologically-fresh soil leading to the establishment of a self-sustaining, progressive plant succession on a surface-mined subalpine site. The study area is located 2000 m above sea level in the Canadian Rocky Mountains. Field studies revealed chronological trends in grass-legume communities at four sites revegetated during 1974-1978 including: species composition, legumes (Trifolium repens L., T. hybridum L. and Medicago sativa L.) performing increasingly poorly on the older sites; biomass changes, a shoot to root ratio (S/R) decreasing from 2.3 to 0.2 as the communities aged; and litter accumulation which continued even on the oldest site. Fertilizer (13-16-10) operationally applied at 150-391 kg/ha enhanced the growth of Dactylis gomerata L. and litter degradation, and acidified the soil. Nitrogen fertilization was also associated with two clear inverse relationships identified between D. glomerata and Festuca rubra L. biomass, and between soil pH and phosphorus levels. In greenhouse tests grasses were revealed to be more efficient soil nitrogen consumers than were legumes and nitrogen fixation decreased significantly (P < 0.01) and linearly with increasing grass seeding rates.

  13. Production cost of biomasses from eucalyptus and elefant grass for energy

    Directory of Open Access Journals (Sweden)

    Laurent Marie Roger Quéno


    Full Text Available This work established the unit energy cost generated from biomass of eucalyptus (Eucalyptus sp. and elephant grass (Pennisetum sp. and applied a sensitivity analysis to verify the influences of factors such as the silviculture of eucalyptus, production volume of each species, the cost of land and the interest rate. It was shown that the treatment of eucalyptus in very short rotation of 2 years with reform of stand every 6 years has a average cost of production higher than the traditional treatment of short rotation of 6 years with reform only at the age of 18. It was also observed that eucalyptus has a Production Cost on average of R$ 4,41 /Gj, lower than the elephant grass which is on average of R$ 5,44/Gj, which however has a higher annual capacity of dry matter production. The elephant grass has the possibility to compete with eucalyptus when a set of conditions is met: discount rate higher than or equal to 8%, High price of land, and elephant grass high volume production, greater than or equal to 35 tonnes of dry matter per hectare and year.

  14. Utilization of grasses for potential biofuel production and phytoremediation of heavy metal contaminated soils. (United States)

    Balsamo, Ronald A; Kelly, William J; Satrio, Justinus A; Ruiz-Felix, M Nydia; Fetterman, Marisa; Wynn, Rodd; Hagel, Kristen


    This research focuses on investigating the use of common biofuel grasses to assess their potential as agents of long-term remediation of contaminated soils using lead as a model heavy metal ion. We present evidence demonstrating that switch grass and Timothy grass may be potentially useful for long-term phytoremediation of heavy metal contaminated soils and describe novel techniques to track and remove contaminants from inception to useful product. Enzymatic digestion and thermochemical approaches are being used to convert this lignocellulosic feedstock into useful product (sugars, ethanol, biocrude oil+biochar). Preliminary studies on enzymatic hydrolysis and fast pyrolysis of the Switchgrass materials that were grown in heavy metal contaminated soil and non-contaminated soils show that the presence of lead in the Switchgrass material feedstock does not adversely affect the outcomes of the conversion processes. These results indicate that the modest levels of contaminant uptake allow these grass species to serve as phytoremediation agents as well as feedstocks for biofuel production in areas degraded by industrial pollution.

  15. Modulation of phytochrome signaling networks for improved biomass accumulation using a bioenergy crop model

    Energy Technology Data Exchange (ETDEWEB)

    Mockler, Todd C. [Donald Danforth Plant Science Center, Saint Louis, MO (United States)


    Plant growth and development, including stem elongation, flowering time, and shade-avoidance habits, are affected by wavelength composition (i.e., light quality) of the light environment. the molecular mechanisms underlying light perception and signaling pathways in plants have been best characterized in Arabidopsis thaliana where dozens of genes have been implicated in converging, complementary, and antagonistic pathways communicating light quality cues perceived by the phytochrome (red/far-red) cryptochrome (blue) and phototropin (blue) photorecptors. Light perception and signaling have been studied in grasses, including rice and sorghum but in much less detail than in Arabidopsis. During the course of the Mocker lab's DOE-funded wrok generating a gene expression atlas in Brachypodium distachyon we observed that Brachypodium plants grown in continuous monochromatic red light or continuous white light enriched in far-red light accumulated significantly more biomass and exhibited significantly greater seed yield than plants grown in monochromatic blue light or white light. This phenomenon was also observed in two other grasses, switchgrass and rice. We will systematically manipulate the expression of genes predicted to function in Brachypodium phytochrome signaling and assess the phenotypic consequences in transgenic Brachypodium plants in terms of morphology, stature, biomass accumulation, and cell wall composition. We will also interrogate direct interactions between candidate phytochrome signaling transcription factors and target promoters using a high-throughput yeast one-hybrid system. Brachypodium distachyon has emerged as a model grass species and is closely related to candidate feedstock crops for bioethanol production. Identification of genes capable of modifying growth characteristics of Brachypodium, when misexpressed, in particular increasing biomass accumulation, by modulating photoreceptor signaling will provide valuable candidates for

  16. The relative importance of different grass components in controlling runoff and erosion on a hillslope under simulated rainfall (United States)

    Li, Changjia; Pan, Chengzhong


    The effects of vegetation cover on overland flow and erosion processes on hillslopes vary with vegetation type and spatial distribution and the different vegetation components, including the above- and below-ground biomass. However, few attempts have been made to quantify how these factors affect erosion processes. Field experimental plots (5 m × 2 m) with a slope of approximately 25° were constructed and simulated rainfall (60 mm hr-1) (Rainfall) and simulated rainfall combined with upslope overland flow (20 L min-1) (Rainfall + Flow) were applied. Three grass species were planted, specifically Astragalus adsurgens (A. adsurgens), Medicago sativa (M. sativa) and Cosmos bipinnatus (C. bipinnatus). To isolate and quantify the relative contributions of the above-ground grass parts (stems, litter cover and leaves) and the roots to reducing surface runoff and erosion, each of the three grass species was subjected to three treatments: intact grass control (IG), no litter or leaves (only the grass stems and roots were reserved) (NLL), and only roots remaining (OR). The results showed that planting grass significantly reduced overland flow rate and velocity and sediment yield, and the mean reductions were 21.8%, 29.1% and 67.1%, respectively. M. sativa performed the best in controlling water and soil losses due to its thick canopy and dense, fine roots. Grasses reduced soil erosion mainly during the early stage of overland flow generation. The above-ground grass parts primarily contributed to reducing overland flow rate and velocity, with mean relative contributions of 64% and 86%, respectively. The roots played a predominant role in reducing soil erosion, with mean contribution of 84%. Due to the impact of upslope inflow, overland flow rate and velocity and sediment yield increased under the Rainfall + Flow conditions. The results suggest that grass species on downslope parts of semi-arid hillslopes performed better in reducing water and soil losses. This study is

  17. Accuracy and Consistency of Grass Pollen Identification by Human Analysts Using Electron Micrographs of Surface Ornamentation

    Directory of Open Access Journals (Sweden)

    Luke Mander


    Full Text Available Premise of the study: Humans frequently identify pollen grains at a taxonomic rank above species. Grass pollen is a classic case of this situation, which has led to the development of computational methods for identifying grass pollen species. This paper aims to provide context for these computational methods by quantifying the accuracy and consistency of human identification. Methods: We measured the ability of nine human analysts to identify 12 species of grass pollen using scanning electron microscopy images. These are the same images that were used in computational identifications. We have measured the coverage, accuracy, and consistency of each analyst, and investigated their ability to recognize duplicate images. Results: Coverage ranged from 87.5% to 100%. Mean identification accuracy ranged from 46.67% to 87.5%. The identification consistency of each analyst ranged from 32.5% to 87.5%, and each of the nine analysts produced considerably different identification schemes. The proportion of duplicate image pairs that were missed ranged from 6.25% to 58.33%. Discussion: The identification errors made by each analyst, which result in a decline in accuracy and consistency, are likely related to psychological factors such as the limited capacity of human memory, fatigue and boredom, recency effects, and positivity bias.

  18. Perennial pastures for marginal farming country in southern Queensland. 2. Potential new grass cultivar evaluation

    Directory of Open Access Journals (Sweden)

    Richard G. Silcock


    Full Text Available Trials in the Condamine-Balonne basin, Australia, compared 11 promising perennial pasture grass accessions (4 Bothriochloa, 2 Cenchrus, 2 Urochloa and 1 each of Digitaria, Eragrostis and Panicum species against the best similar commercial cultivars on the basis of ease of establishment from seed, persistence once established, forage yield and ease of seed production.  Accessions sown at a site were determined by prior experience with them on a range of soils.  High quality seed was relatively easy to produce for both Urochloa species and for Eragrostis curvula CPI 30374 but problematic for the Bothriochloa spp.  Once established, all accessions persisted for 3–5 years and most were well grazed, but adequate establishment was sometimes a problem with Panicum stapfianum and Bothriochloa ewartiana.  The dry matter yield ratings of the non-commercial lines were similar to those of the commercial equivalents of the same species.  While agronomically valuable, none of the promising new grasses was considered worthy of commercialization at this point because their strengths did not warrant the setting up of a seed-production business in competition with current commercial enterprises.  Long-standing cultivars such as Gayndah buffel and Nixon sabi grass continued to exhibit their superior pasture qualities.Keywords: Herbicide tolerance, persistence, forage yield, establishment ease, commercialization, seed production.DOI: 10.17138/TGFT(315-26

  19. Flora and fauna associated with prairie dog colonies and adjacent ungrazed mixed-grass prairie in western South Dakota (United States)

    William Agnew; Daniel W. Uresk; Richard M. Hansen


    Vegetation, small rodents, and birds were sampled during the growing seasons of 2 years on prairie dog (Cynomys ludovicianus) colonies and adjacent mixed-grass prairie in western South Dakota. Prairie dog grazing decreased mulch cover, maximum height of vegetation, plant species richness, and tended to decrease live plant canopy cover compared to...

  20. Evaluating poverty grass (Danthonia spicata L.) for use in tees, fairways, or rough areas in golf courses in the midwest (United States)

    Nadia E. Navarrete-Tindall; Brad Fresenburg; J.W. Van Sambeek


    Poverty grass (Danthonia spicata L.), a native, cool-season perennial bunchgrass with wide distribution in the United States, is being evaluated for its suitability for use on golf courses. The goal is to identify practices to improve seed germination and successfully establish field plots as monocultures or with other native species to mimic natural...

  1. Strong genetic differentiation in the invasive annual grass Bromus tectorum across the Mojave-Great Basin ecological transition zone (United States)

    Susan E. Meyer; Elizabeth A. Leger; Desiree R. Eldon; Craig E. Coleman


    Bromus tectorum, an inbreeding annual grass, is a dominant invader in sagebrush steppe habitat in North America. It is also common in warm and salt deserts, displaying a larger environmental tolerance than most native species. We tested the hypothesis that a suite of habitat-specific B. tectorum lineages dominates warm desert habitats. We sampled 30 B....

  2. Effect of an Invasive Grass on Ambient Rates of Decomposition and Microbial Community Structure: A Search for Causality (United States)

    In sutu decomposition of above and below ground plant biomass of the native grass species Andropogon glmoeratus (Walt.) B.S.P and exotic Imperata cylindrica (L.) Beauv. (cogongrass) was investigated using litter bags over the course of a 12 month period. The above and below ground biomass of the inv...

  3. Ploidy determination of buffel grass accessions in the USDA National Plant Germplasm System collection by flow cytometry (United States)

    Buffelgrass [Pennisetum ciliare (L.) Link syn. Cenchrus ciliaris L.] is an important forage and range grass in many of the semi-arid tropical and subtropical regions of the world. The species reproduces primarily by apomixis but it is highly diverse because a wide array of different apomictic ecoty...

  4. Presence of Trifolium repens promotes complementarity of water use and N facilitation in diverse grass mixtures

    Directory of Open Access Journals (Sweden)

    Pauline eHernandez


    Full Text Available Legume species promote productivity and increase the digestibility of herbage in grasslands. Considerable experimental data also indicate that communities with legumes produce more above-ground biomass than is expected from monocultures. While it has been attributed to N facilitation, evidence to identify the mechanisms involved is still lacking and the role of complementarity in soil water acquisition by vertical root differentiation remains unclear. We used a 20-month mesocosm experiment to investigate the effects of species richness (single species, two- and five-species mixtures and functional diversity (presence of the legume Trifolium repens on a set of traits related to light, N and water use and measured at community level. We found a positive effect of Trifolium presence and abundance on biomass production and complementarity effects in the two-species mixtures from the second year. In addition the community traits related to water and N acquisition and use (leaf area, N, water-use efficiency and deep root growth were higher in the presence of Trifolium. With a multiple regression approach, we showed that the traits related to water acquisition and use were with N the main determinants of biomass production and complementarity effects in diverse mixtures. At shallow soil layers, lower root mass of Trifolium and higher soil moisture should increase soil water availability for the associated grass species. Conversely at deep soil layer, higher root growth and lower soil moisture mirror soil resource use increase of mixtures. Altogether, these results highlight N facilitation but almost soil vertical differentiation and thus complementarity for water acquisition and use in mixtures with Trifolium. Contrary to grass-Trifolium mixtures, no significant over-yielding was measured for grass mixtures even those having complementary traits (short and shallow vs tall and deep. Thus, vertical complementarity for soil resources uptake in mixtures

  5. Presence of Trifolium repens Promotes Complementarity of Water Use and N Facilitation in Diverse Grass Mixtures. (United States)

    Hernandez, Pauline; Picon-Cochard, Catherine


    Legume species promote productivity and increase the digestibility of herbage in grasslands. Considerable experimental data also indicate that communities with legumes produce more above-ground biomass than is expected from monocultures. While it has been attributed to N facilitation, evidence to identify the mechanisms involved is still lacking and the role of complementarity in soil water acquisition by vertical root differentiation remains unclear. We used a 20-months mesocosm experiment to investigate the effects of species richness (single species, two- and five-species mixtures) and functional diversity (presence of the legume Trifolium repens) on a set of traits related to light, N and water use and measured at community level. We found a positive effect of Trifolium presence and abundance on biomass production and complementarity effects in the two-species mixtures from the second year. In addition the community traits related to water and N acquisition and use (leaf area, N, water-use efficiency, and deep root growth) were higher in the presence of Trifolium. With a multiple regression approach, we showed that the traits related to water acquisition and use were with N the main determinants of biomass production and complementarity effects in diverse mixtures. At shallow soil layers, lower root mass of Trifolium and higher soil moisture should increase soil water availability for the associated grass species. Conversely at deep soil layer, higher root growth and lower soil moisture mirror soil resource use increase of mixtures. Altogether, these results highlight N facilitation but almost soil vertical differentiation and thus complementarity for water acquisition and use in mixtures with Trifolium. Contrary to grass-Trifolium mixtures, no significant over-yielding was measured for grass mixtures even those having complementary traits (short and shallow vs. tall and deep). Thus, vertical complementarity for soil resources uptake in mixtures was not only

  6. The study of desiccation-tolerance in drying leaves of the desiccation-tolerant grass Sporobolus elongatus and the desiccation-sensitive grass Sporobolus pyramidalis. (United States)

    Ghasempour, Hamid Reza; Kianian, Jahanbakheshe


    Hydrated leaves of the resurrection grass Sporobolus elongatus are not desiccation tolerant (DT), but moderate to severe drought stress can induce their DT with the leaves remain attach to drying intact plants. In vivo protein synthesis was studied with SDS-page of extracts of leaves of intact drying plants of S. elongatus (a desiccation-Tolerant grass (DT)) and S. pyramidalis (a desiccation-sensitive species (DS)). Free proline increased in drying leaves. Soluble sugar contents also increased with drying but were less than fully hydrated leaves at 8% RWC. Total protein also showed an increase with an exception at 8% RWC which showed a decrease. SDS-page of extracts of drying leaves of both DT and DS plants were studied as relative water contents (RWC) decreased. In first phase, DT species at 58% RWC (80-51% RWC range), two proteins increased in contents. In the second phase, at 8% (35-4% RWC range) two new bands increased and two bands decreased. In leaves of DS species some bands decreased as drying progressed. Also, as drying advanced free proline increased in DT species. Total protein increased as drying increased but at 8% RWC decreased. All data of results are consistent with current views about studied factors and their roles during drying and induction of desiccation tolerance in DT plants.

  7. Patterns of species discovery in the Western Ghats, a megadiversity ...

    Indian Academy of Sciences (India)


    Species discovery patterns have been under study since the past ... frogs, tiger beetles, grasses, asters, ferns and orchids – in the Western Ghats, a megadiversity centre in India. Our .... This analysis is an alternative to logistic regression; it.

  8. The importance of cross-reactivity in grass pollen allergy

    Directory of Open Access Journals (Sweden)

    Aleksić Ivana


    Full Text Available According to the data obtained from in vivo and in vitro testing in Serbia, a significant number of patients have allergic symptoms caused by grass pollen. We examined the protein composition of grass pollens (Dactylis glomerata, Lolium perenne and Phleum pratense and cross-reactivity in patients allergic to grass pollen from our region. The grass pollen allergen extract was characterized by SDS-PAGE, while cross-reactivity of single grass pollens was revealed by immunoblot analysis. A high degree of cross-reactivity was demonstrated for all three single pollens in the sera of allergic patients compared to the grass pollen extract mixture. Confirmation of the existence of cross-reactivity between different antigenic sources facilitates the use of monovalent vaccines, which are easier to standardize and at the same time prevent further sensitization of patients and reduces adverse reactions. [Projekat Ministarstva nauke Republike Srbije, br. 172049 i br. 172024

  9. Effect of sulfur levels on four tropical grasses in cerrado soils of mato grosso do sul, Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Carlos Casagrande, J.; Correa De Souza, O.


    A greenhouse experiment was conducted to evaluate responses of four tropical grasses, Melinis minutiflora cv. Cabelo de Negro Hyparrhenia rufa, Brachiaria decumbens australian type and Setaria anceps cv. kazungula to five levels of sulfur (0, 15, 30, 45 and 60 kg/ha) in two cerrado Oxisols and one Entisol. Cuttings were done at 50, 95 and 150 days after plant exposure. Besides dry matter production, visible symptoms of sulfur deficiency were observed. Greater responses were associated with sulfur rates up to 30 kg/ha. Molasses grass and brachiaria were the most responsive species.

  10. Accelerated development in Johnsongrass seedlings (Sorghum halepense) suppresses the growth of native grasses through size-asymmetric competition. (United States)

    Schwinning, Susanne; Meckel, Heather; Reichmann, Lara G; Polley, H Wayne; Fay, Philip A


    Invasive plant species often dominate native species in competition, augmenting other potential advantages such as release from natural enemies. Resource pre-emption may be a particularly important mechanism for establishing dominance over competitors of the same functional type. We hypothesized that competitive success of an exotic grass against native grasses is mediated by establishing an early size advantage. We tested this prediction among four perennial C4 warm-season grasses: the exotic weed Johnsongrass (Sorghum halepense), big bluestem (Andropogon gerardii), little bluestem (Schizachyrium scoparius) and switchgrass (Panicum virgatum). We predicted that a) the competitive effect of Johnsongrass on target species would be proportional to their initial biomass difference, b) competitive effect and response would be negatively correlated and c) soil fertility would have little effect on competitive relationships. In a greenhouse, plants of the four species were grown from seed either alone or with one Johnsongrass neighbor at two fertilizer levels and periodically harvested. The first two hypotheses were supported: The seedling biomass of single plants at first harvest (50 days after seeding) ranked the same way as the competitive effect of Johnsongrass on target species: Johnsongrass critical mechanism by which exotic invasive species displace functionally similar native species and alter the functional dynamics of native communities.

  11. Marandu palisade grass intercropped with densely spaced teak in silvopastoral system

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo Avelino Cabral


    Full Text Available This study was conducted to evaluate two systems of production: integration between teak and forage (silvopastoral system and forage only (monoculture. The forage species used was Marandu palisade grass (Urochloa brizantha cv. Marandu. In January 2009, part of the pasture was desiccated and the teak (Tectona grandis was implemented in a 3 × 4 m spacing arrangement, and at every five rows, a space between rows of 6 m was established, providing a population of 750 trees per hectare. Alongside the development of the trees, the Marandu palisade grass pasture was reestablished. In February 2015, the animals were removed from the experimental area and, in March, the pasture degradation, the density and the mass of tillers was assessed. The following variables were evaluated: sward height; forage mass, percentage of leaf blade, stem+sheath and senescent material; leaf blade:stem+sheath ratio; and live:dead material ratio. The experimental design was completely randomized, with 12 replicates. Treatments consisted of two systems (silvopastoral and monoculture. The total forage accumulation was higher in the monoculture system. The sward height and the percentage of stem+sheath were higher in the integrated system, while the percentage of leaf blade and the leaf blade:stem+sheath ratio were higher in the system exclusively with forage. In conclusion, Marandu palisade grass tolerates shading in a high density spacing silvopastoral system, but the degradation process is more intense compared to grass in monoculture, and the use of Marandu palisade grass in silvopastoral systems changes the forage mass and the structure of the produced forage.

  12. Determining the regional potential for a grass biomethane industry

    International Nuclear Information System (INIS)

    Smyth, Beatrice M.; Smyth, Henry; Murphy, Jerry D.


    Research highlights: → We identified assessment criteria for determining the regional potential for grass biomethane. → Grass biomethane is distributed via the natural gas grid. → The criteria include: land use; grass yields; gas grid coverage; availability of co-substrates. → The county with the highest potential can fuel 50% of cars or supply 130% of domestic gas consumption. - Abstract: Grass biogas/biomethane has been put forward as a renewable energy solution and it has been shown to perform well in terms of energy balance, greenhouse gas emissions and policy constraints. Biofuel and energy crop solutions are country-specific and grass biomethane has strong potential in countries with temperate climates and a high proportion of grassland, such as Ireland. For a grass biomethane industry to develop in a country, suitable regions (i.e. those with the highest potential) must be identified. In this paper, factors specifically related to the assessment of the potential of a grass biogas/biomethane industry are identified and analysed. The potential for grass biogas and grass biomethane is determined on a county-by-county basis using multi-criteria decision analysis. Values are assigned to each county and ratings and weightings applied to determine the overall county potential. The potential for grass biomethane with co-digestion of slaughter waste (belly grass) is also determined. The county with the highest potential (Limerick) is analysed in detail and is shown to have ready potential for production of gaseous biofuel to meet either 50% of the vehicle fleet or 130% of the domestic natural gas demand, through 25 facilities at a scale of ca. 30 kt yr -1 of feedstock. The assessment factors developed in this paper can be used in other resource studies into grass biomethane or other energy crops.

  13. Towards reconstructing herbaceous biome dynamics and associated precipitation in Africa: insights from the classification of grass morphological traits (United States)

    Pasturel, Marine; Alexandre, Anne; Novello, Alice; Moctar Dieye, Amadou; Wele, Abdoulaye; Paradis, Laure; Hely, Christelle


    Inter-tropical herbaceous ecosystems occupy a 1/5th of terrestrial surface, a half of the African continent, and are expected to extend in the next decades. Dynamic of these ecosystems is simulated with poor accuracy by Dynamic Global Vegetation Models (DGVMs). One of the bias results from the fact that the diversity of the grass layer dominating these herbaceous ecosystems is poorly taken into account. Mean annual precipitation and the length of the dry season are the main constrains of the dynamics of these ecosystems. Conversely, changes in vegetation affect the water cycle. Inaccuracy in herbaceous ecosystem simulation thus impacts simulations of the water cycle (including precipitation) and vice versa. In order to increase our knowledge of the relationships between grass morphological traits, taxonomy, biomes and climatic niches in Western and South Africa, a 3-step methodology was followed: i) values of culm height, leaf length and width of dominant grass species from Senegal were gathered from flora and clustered using the Partition Around Medoids (PAM) method; ii) trait group ability to sign climatic domains and biomes was assessed using Kruskal-Wallis tests; iii) genericity and robustness of the trait groups were evaluated through their application to Chadian and South African botanical datasets. Results show that 8 grass trait groups are present either in Senegal, Chad or South Africa. These 8 trait groups are distributed along mean annual precipitation and dry season length gradients. The combination of three of them allow to discriminate mean annual precipitation domains (1000 mm) and herbaceous biomes (steppes, savannas, South African grasslands and Nama-Karoo). With these results in hand, grass Plant Functional Types (PFTs) of the DGMV LPJ-GUESS will be re-parameterized and particular attention will be given to the herbaceous biomass assigned to each grass trait group. Simultaneously, relationships between grass trait groups and phytolith vegetation

  14. Investigation of Desso GrassMaster® as application in hydraulic engineering

    NARCIS (Netherlands)

    Steeg, van der P.; Paulissen, M.P.C.P.; Roex, E.; Mommer, L.


    Dessa GrassMaster® is a reinforced grass system which is applied successfully on sports fields and enables to use a sports field more intensively than a normal grass field. In this report the possibility of an application of Dessa GrassMaster®in hydraulic conditions, with a focus on grass dikes, is


    Directory of Open Access Journals (Sweden)

    V. N. Bubenchikova


    Full Text Available The article present results of the study for a anatomic structure of Campanula rotundifolia grass from Campanulaceae family. Despite its dispersion and application in folk medicine, there are no data about its anatomic structure, therefore to estimate the indices of authenticity and quality of raw materials it is necessary to develop microdiagnostical features in the first place, which could help introducing of thisplant in a medical practice. The purpose of this work is to study anatomical structureof Campanula rotundifolia grass to determine its diagnostic features. Methods. Thestudy for anatomic structure was carried out in accordance with the requirements of State Pharmacopoeia, edition XIII. Micromed laboratory microscope with digital adjutage was used to create microphotoes, Photoshop CC was used for their processing. Result. We have established that stalk epidermis is prosenchymal, slightly winding with straight of splayed end cells. After study for the epidermis cells we established that upper epidermis cells had straight walls and are slightly winding. The cells of lower epidermishave more winding walls with prolong wrinkled cuticule. Presence of simple one-cell, thin wall, rough papillose hair on leaf and stalk epidermis. Cells of epidermis in fauces of corolla are prosenchymal, with winding walls, straight or winding walls in a cup. Papillary excrescences can be found along the cup edges. Stomatal apparatus is anomocytic. Conclusion. As the result of the study we have carried out the research for Campanula rotundifolia grass anatomic structure, and determined microdiagnostic features for determination of raw materials authenticity, which included presence of simple, one-cell, thin-walled, rough papillose hair on both epidermises of a leaf, along the veins, leaf edge, and stalk epidermis, as well as the presence of epidermis cells with papillary excrescences along the edges of leaves and cups. Intercellular canals are situatedalong the

  16. Post-harvest treatments in smooth-stalked meadow grass (Poa pratensis L.) - effect on carbohydrates and tiller development

    DEFF Research Database (Denmark)

    Boelt, Birte


    Temperate grass species require a period of short days/low temperature to respond to flower induction stimuli. The same environmental conditions stimulate the increase in carbohydrate concentration in aboveground biomass and the accumulation of reserve carbohydrates in the basal plant parts....... The present investigation was initiated to investigate the effect of post-harvest treatments on dry matter production in autumn, carbohydrate content, the number of reproductive tillers and seed yield in a turf-type cultivar ‘Conni' of smooth-stalked meadow grass. The results show that post-harvest treatments...... harvest and all residues removed. The results from plant samples in autumn indicate that decreasing aboveground biomass production leads to a higher carbohydrate concentration which may stimulate the reproductive development in smooth-stalked meadow grass....

  17. Changes in nutritive value and herbage yield during extended growth intervals in grass-legume mixtures

    DEFF Research Database (Denmark)

    Elgersma, Anjo; Søegaard, Karen


    . Perennial ryegrass was sown with each of four legumes: red clover, white clover, lucerne and birdsfoot trefoil, and white clover was sown with hybrid ryegrass, meadow fescue and timothy. Effects of species composition on herbage yield, contents of N, neutral detergent fibre (NDF), acid detergent fibre (ADF...... in quality parameters differed among species and functional groups, i.e., grasses and legumes. Results are discussed in the context of quantifying the impact of delaying the harvest date of grass–legume mixtures and relationships between productivity and components of feed quality....

  18. Upgrated fuel from reed canary grass

    Energy Technology Data Exchange (ETDEWEB)

    Oravainen, H. [VTT Energy, Jyvaeskylae (Finland)


    Results described in this presentation are from a large EU-project - Development of a new crop production system based on delayed harvesting and system for its combined processing to chemical pulp and biofuel powder. This is a project to develop the use of Reed Canary Grass (Phalaris Arundinaceae) both for pulp industry and energy production. The main contractor of the project is Swedish University of Agricultural Sciences (coordinator), task coordinators are United Milling Systems A/S from Denmark, and Jaakko Poeyry Oy and VTT Energy from Finland In addition, there are partners from several countries participating in the project

  19. An integral projection model with YY-males and application to evaluating grass carp control (United States)

    Erickson, Richard A.; Eager, Eric A.; Brey, Marybeth; Hansen, Michael J.; Kocovsky, Patrick


    Invasive fish species disrupt ecosystems and cause economic damage. Several methods have been discussed to control populations of invasive fish including the release of YY-males. YY-males are fish that have 2 male chromosomes compared to a XY-male. When YY-males mate, they only produce male (XY) offspring. This decreases the female proportion of the population and can, in theory, eradicate local populations by biasing the sex-ratio. YY-males have been used as a population control tool for brook trout in montane streams and lakes in Idaho, USA. The YY-male control method has been discussed for grass carp in Lake Erie, North America. We developed and presented an integral projection model for grass carp to model the use of YY-males as a control method for populations in this lake. Using only the YY-male control method, we found that high levels of YY-males would need to be release annually to control the species. Specifically, these levels were the same order of magnitude as the baseline adult population (e.g., 1000 YY-males needed to be released annual for 20 years to control a baseline adult population of 2500 grass carp). These levels may not be reasonable or obtainable for fisheries managers given the impacts of YY-males on aquatic vegetation and other constraints of natural resource management.

  20. Potential of grasses and rhizosphere bacteria for bioremediation of diesel-contaminated soils

    Directory of Open Access Journals (Sweden)

    Melissa Paola Mezzari


    Full Text Available The techniques available for the remediation of environmental accidents involving petroleum hydrocarbons are generally high-cost solutions. A cheaper, practical and ecologically relevant alternative is the association of plants with microorganisms that contribute to the degradation and removal of hydrocarbons from the soil. The growth of three tropical grass species (Brachiaria brizantha, Brachiaria decumbens and Paspalum notatum and the survival of root-associated bacterial communities was evaluated at different diesel oil concentrations. Seeds of three grass species were germinated in greenhouse and at different doses of diesel (0, 2.5, 5 and 10 g kg-1 soil. Plants were grown for 10 weeks with periodic assessment of germination, growth (fresh and dry weight, height, and number of bacteria in the soil (pots with or without plants. Growth and biomass of B. decumbens and P. notatum declined significantly when planted in diesel-oil contaminated soils. The presence of diesel fuel did not affect the growth of B. brizantha, which was highly tolerant to this pollutant. Bacterial growth was significant (p < 0.05 and the increase was directly proportional to the diesel dose. Bacteria growth in diesel-contaminated soils was stimulated up to 5-fold by the presence of grasses, demonstrating the positive interactions between rhizosphere and hydrocarbon-degrading bacteria in the remediation of diesel-contaminated soils.

  1. Diversification of C(4) grasses (Poaceae) does not coincide with their ecological dominance. (United States)

    Bouchenak-Khelladi, Yanis; Slingsby, Jasper A; Verboom, G Anthony; Bond, William J


    The radiation of a lineage and its rise to ecological dominance are distinct phenomena and driven by different processes. For example, paleoecological data has been used to show that the Cretaceous angiosperm radiation did not coincide with their rise to dominance. Using a phylogenetic approach, we here explored the evolution of C4 grasses and evaluated whether the diversification of this group and its rise to ecological dominance in the late Miocene were decoupled. We assembled a matrix including 675 grass species of the PACMAD clade and 2784 characters (ITS and ndhF) to run a molecular dating analysis using three fossils as reference calibrations. We coded species as C3 vs. C4 and reconstructed ancestral states under maximum likelihood. We used the program BiSSE to test whether rates of diversification are correlated with photosynthetic pathway and whether the radiation of C4 lineages preceded or coincided with their rise to ecological dominance from ∼10 Ma. C4 grass lineages first originated around 35 Ma at the time of the Eocene-Oligocene transition. Accelerated diversification of C4 lineages did not coincide with their rise to ecological dominance. C4-dominated grasslands have expanded only since the Late Miocene and Pliocene. The initial diversification of their biotic elements can be tracked back as far as the Eocene-Oligocene transition. We suggest that shifts in taxonomic diversification and ecological dominance were stimulated by different factors, as in the case of the early angiosperms in the Cretaceous.

  2. Forage production in mixed grazing systems of elephant grass with arrowleaf clover or forage peanut

    Directory of Open Access Journals (Sweden)

    Daiane Cristine Seibt

    Full Text Available ABSTRACT Most dairy production systems are pasture-based, usually consisting of sole grass species. This system facilitates pasture management, but results in high production costs, mainly because of nitrogen fertilizers. An alternative to making forage systems more sustainable is to introduce legumes into the pasture. Mixed pastures allow better forage distribution over time and reduce fertilization costs. Thus, the objective of this study was to evaluate, throughout the year, three forage systems (FS: FS1 (control - elephant grass (EG, ryegrass (RG, and spontaneous species (SS; FS2 - EG + RG + SS + arrowleaf clover; and FS3 - EG + RG + SS + forage peanut. Elephant grass was planted in rows spaced 4 m apart. Ryegrass was sown between the EG lines, in the winter. Arrowleaf clover was sown according to the respective treatments and forage peanut was preserved. Evaluation was carried out using Holstein cows. The experiment was arranged in a completely randomized design, with three treatments (FS, and three repetitions (paddocks with repeated measurements (grazing cycles. Forage mass achieved 3.46, 3.80, and 3.91 t ha-1 for the treatments FS1, FS2 and FS3, respectively. The forage systems intercropped with legumes produced the best results.

  3. Seeding method influences warm-season grass abundance and distribution but not local diversity in grassland restoration (United States)

    Yurkonis, Kathryn A.; Wilsey, Brian J.; Moloney, Kirk A.; Drobney, Pauline; Larson, Diane L.


    Ecological theory predicts that the arrangement of seedlings in newly restored communities may influence future species diversity and composition. We test the prediction that smaller distances between neighboring seeds in drill seeded grassland plantings would result in lower species diversity, greater weed abundance, and larger conspecific patch sizes than otherwise similar broadcast seeded plantings. A diverse grassland seed mix was either drill seeded, which places seeds in equally spaced rows, or broadcast seeded, which spreads seeds across the ground surface, into 24 plots in each of three sites in 2005. In summer 2007, we measured species abundance in a 1 m2 quadrat in each plot and mapped common species within the quadrat by recording the most abundant species in each of 64 cells. Quadrat-scale diversity and weed abundance were similar between drilled and broadcast plots, suggesting that processes that limited establishment and controlled invasion were not affected by such fine-scale seed distribution. However, native warm-season (C4) grasses were more abundant and occurred in less compact patches in drilled plots. This difference in C4 grass abundance and distribution may result from increased germination or vegetative propagation of C4 grasses in drilled plots. Our findings suggest that local plant density may control fine-scale heterogeneity and species composition in restored grasslands, processes that need to be further investigated to determine whether seed distributions can be manipulated to increase diversity in restored grasslands.

  4. Grass-legume mixtures sustain strong yield advantage over monocultures under cool maritime growing conditions over a period of 5 years. (United States)

    Helgadóttir, Áslaug; Suter, Matthias; Gylfadóttir, Thórey Ó; Kristjánsdóttir, Thórdís A; Lüscher, Andreas


    Grassland-based livestock systems in cool maritime regions are commonly dominated by grass monocultures receiving relatively high levels of fertilizer. The current study investigated whether grass-legume mixtures can improve the productivity, resource efficiency and robustness of yield persistence of cultivated grassland under extreme growing conditions over a period of 5 years. Monocultures and mixtures of two grasses (Phleum pratense and Festuca pratensis) and two legumes (Trifolium pratense and Trifolium repens), one of which was fast establishing and the other temporally persistent, were sown in a field trial. Relative abundance of the four species in the mixtures was systematically varied at sowing. The plots were maintained under three N levels (20, 70 and 220 kg N ha-1 year-1) and harvested twice a year for five consecutive years. Yields of individual species and interactions between all species present were modelled to estimate the species diversity effects. Significant positive diversity effects in all individual years and averaged across the 5 years were observed. Across years, the four-species equi-proportional mixture was 71 % (N20: 20 kg N ha-1 year-1) and 51 % (N70: 70 kg N ha-1 year-1) more productive than the average of monocultures, and the highest yielding mixture was 36 % (N20) and 39 % (N70) more productive than the highest yielding monoculture. Importantly, diversity effects were also evident at low relative abundances of either species group, grasses or legumes in the mixture. Mixtures suppressed weeds significantly better than monocultures consistently during the course of the experiment at all N levels. The results show that even in the less productive agricultural systems in the cool maritime regions grass-legume mixtures can contribute substantially and persistently to a more sustainable agriculture. Positive grass-legume interactions suggest that symbiotic N2 fixation is maintained even under these marginal conditions, provided that

  5. Herbicide spring treatments for the control of brome grasses (Bromus spp. in winter cereals

    Directory of Open Access Journals (Sweden)

    Gehring, Klaus


    Full Text Available The efficacy of different ALS-inhibiting herbicides for the control of brome species (Bromus spp. was tested in three field trials in the year 2010 – 2012 in the region of North-West-Bavaria Franken. As a result of the trials the standard herbicide Attribut (Propoxycarbazone was confirmed for the control of brome. In case of infestation with brome and black grass the herbicide Broadway (Pyroxsulam offers a certain control of both problematic grass weeds. This illustrates the high dependency of sufficient brome control in winter cereals on the effectiveness of specific ALS-Inhibitor herbicides. Because of the high risk of herbicide resistance to ACCaseand ALS-inhibiting herbicides in brome, integrated weed management is essential for the sustainable control of brome in winter cereals, respectively winter wheat.

  6. cDNA cloning and immunological characterization of the rye grass allergen Lol p I. (United States)

    Perez, M; Ishioka, G Y; Walker, L E; Chesnut, R W


    The complete amino acid sequence of two "isoallergenic" forms of Lol p I, the major rye grass (Lolium perenne) pollen allergen, was deduced from cDNA sequence analysis. cDNA clones isolated from a Lolium perenne pollen library contained an open reading frame coding for a 240-amino acid protein. Comparison of the nucleotide and deduced amino acid sequence of two of these clones revealed four changes at the amino acid level and numerous nucleotide differences. Both clones contained one possible asparagine-linked glycosylation site. Northern blot analysis shows one RNA species of 1.2 kilobases. Based on the complete amino acid sequence of Lol p I, overlapping peptides covering the entire molecule were synthesized. Utilizing these peptides we have identified a determinant within the Lol p I molecule that is recognized by human leukocyte antigen class II-restricted T cells obtained from persons allergic to rye grass pollen.

  7. The Genetics of Biofuel Traits in Panicum Grasses: Developing a Model System with Diploid Panicum Hallii

    Energy Technology Data Exchange (ETDEWEB)

    Juenger, Thomas [Univ. of Texas, Austin, TX (United States). Dept. of Integrative Biology; Wolfrum, Ed [National Renewable Energy Lab. (NREL), Golden, CO (United States)


    Our DOE funded project focused on characterizing natural variation in C4 perennial grasses including switchgrass (Panicum virgatum) and Hall’s panicgrass (Panicum hallii). The main theme of our project was to better understand traits linked with plant performance and that impact the utility of plant biomass as a biofuel feedstock. In addition, our project developed tools and resources for studying genetic variation in Panicum hallii. Our project successfully screened both Panicum virgatum and Panicum hallii diverse natural collections for a host of phenotypes, developed genetic mapping populations for both species, completed genetic mapping for biofuel related traits, and helped in the development of genomic resources of Panicum hallii. Together, these studies have improved our understanding of the role of genetic and environmental factors in impacting plant performance. This information, along with new tools, will help foster the improvement of perennial grasses for feedstock applications.

  8. Acetogenic and Sulfate-Reducing Bacteria Inhabiting the Rhizoplane and Deep Cortex Cells of the Sea Grass Halodule wrightii† (United States)

    Küsel, Kirsten; Pinkart, Holly C.; Drake, Harold L.; Devereux, Richard


    Recent declines in sea grass distribution underscore the importance of understanding microbial community structure-function relationships in sea grass rhizospheres that might affect the viability of these plants. Phospholipid fatty acid analyses showed that sulfate-reducing bacteria and clostridia were enriched in sediments colonized by the sea grasses Halodule wrightii and Thalassia testudinum compared to an adjacent unvegetated sediment. Most-probable-number analyses found that in contrast to butyrate-producing clostridia, acetogens and acetate-utilizing sulfate reducers were enriched by an order of magnitude in rhizosphere sediments. Although sea grass roots are oxygenated in the daytime, colorimetric root incubation studies demonstrated that acetogenic O-demethylation and sulfidogenic iron precipitation activities were tightly associated with washed, sediment-free H. wrightii roots. This suggests that the associated anaerobes are able to tolerate exposure to oxygen. To localize and quantify the anaerobic microbial colonization, root thin sections were hybridized with newly developed 33P-labeled probes that targeted (i) low-G+C-content gram-positive bacteria, (ii) cluster I species of clostridia, (iii) species of Acetobacterium, and (iv) species of Desulfovibrio. Microautoradiography revealed intercellular colonization of the roots by Acetobacterium and Desulfovibrio species. Acetogenic bacteria occurred mostly in the rhizoplane and outermost cortex cell layers, and high numbers of sulfate reducers were detected on all epidermal cells and inward, colonizing some 60% of the deepest cortex cells. Approximately 30% of epidermal cells were colonized by bacteria that hybridized with an archaeal probe, strongly suggesting the presence of methanogens. Obligate anaerobes within the roots might contribute to the vitality of sea grasses and other aquatic plants and to the biogeochemistry of the surrounding sediment. PMID:10543830

  9. From pasture grass to cattle milk

    International Nuclear Information System (INIS)

    Miyamoto, Susumu


    Iodine-131 is one of the important fission products since it is selectively accumulated in the thyroid gland of man. The transfer of this isotope from contaminated grass to cows' milk is therefore of particular importance since milk is a major constituent of the diet especially for infants. The purpose of this paper is to discuss the transfer rate of this isotope from grass to milk of lactuating cows and its distribution in milk. It is said that the orally administered iodide is rapidly absorbed through the rumen wall and excreted mainly to urine. The absorbed iodine is accumulated highly in the thyroid gland and the considerable amount is secreted to milk. Garner et al. showed that about 5% of a dose of 131 I was found in the milk within 7 days. The extremes were 1.43 to 16.4%. Present author obtained that 18 - 30% of the dosed 131 I was secreted into milk within 7 days, indicating somewhat higher transfer rate than that of Garner et al. It was reported that more than 90% of 131 I was found in milk serum in the ionic form. The countermeasures for diminishing 131 I in milk were also presented. (author)

  10. Elephant grass clones for silage production

    Directory of Open Access Journals (Sweden)

    Rerisson José Cipriano dos Santos


    Full Text Available Ensiling warm-season grasses often requires wilting due to their high moisture content, and the presence of low-soluble sugars in these grasses usually demands the use of additives during the ensiling process. This study evaluated the bromatological composition of the fodder and silage from five Pennisetum sp. clones (IPA HV 241, IPA/UFRPE Taiwan A-146 2.114, IPA/UFRPE Taiwan A-146 2.37, Elephant B, and Mott. The contents of 20 Polyvinyl chloride (PVC silos, which were opened after 90 days of storage, were used for the bromatological analysis and the evaluation of the pH, nitrogen, ammonia, buffer capacity, soluble carbohydrates, and fermentation coefficients. The effluent losses, gases and dry matter recovery were also calculated. Although differences were observed among the clones (p < 0.05 for the concentrations of dry matter, insoluble nitrogen in acid detergents, insoluble nitrogen in neutral detergents, soluble carbohydrates, fermentation coefficients, and in vitro digestibility in the forage before ensiling, no differences were observed for most of these variables after ensiling. All of the clones were efficient in the fermentation process. The IPA/UFRPE TAIWAN A-146 2.37 clone, however, presented a higher dry matter concentration and the best fermentation coefficient, resulting in a better silage quality, compared to the other clones.

  11. Using expansive grasses for monitoring heavy metal pollution in the vicinity of roads. (United States)

    Vachová, Pavla; Vach, Marek; Najnarová, Eva


    We propose a method for monitoring heavy metal deposition in the vicinity of roads using the leaf surfaces of two expansive grass species which are greatly abundant. A principle of the proposed procedure is to minimize the number of operations in collecting and preparing samples for analysis. The monitored elements are extracted from the leaf surfaces using dilute nitric acid directly in the sample-collection bottle. The ensuing steps, then, are only to filter the extraction solution and the elemental analysis itself. The verification results indicate that the selected grasses Calamagrostis epigejos and Arrhenatherum elatius are well suited to the proposed procedure. Selected heavy metals (Zn, Cu, Pb, Ni, Cr, and Cd) in concentrations appropriate for direct determination using methods of elemental analysis can be extracted from the surface of leaves of these species collected in the vicinity of roads with medium traffic loads. Comparing the two species showed that each had a different relationship between the amounts of deposited heavy metals and distance from the road. This disparity can be explained by specific morphological properties of the two species' leaf surfaces. Due to the abundant occurrence of the two species and the method's general simplicity and ready availability, we regard the proposed approach to constitute a broadly usable and repeatable one for producing reproducible results. Copyright © 2017 Elsevier Ltd. All rights reserved.

  12. Are biodiversity indices of spontaneous grass covers in olive orchards good indicators of soil degradation? (United States)

    Taguas, E. V.; Arroyo, C.; Lora, A.; Guzmán, G.; Vanderlinden, K.; Gómez, J. A.


    Spontaneous grass covers are an inexpensive soil erosion control measure in olive orchards. Olive farmers allow grass to grow on sloping terrain to comply with the basic environmental standards derived from the Common Agricultural Policy (CAP). However, to date there are very few studies assessing the environmental quality and extent of such covers. In this study, we described and compared the biodiversity indicators associated to herbaceous vegetation in two contrasting olive orchards in order to evaluate its relevance and quality. In addition, biodiversity patterns and their relationships with environmental factors such as soil type and properties, precipitation, topography and soil management were analyzed. Different grass cover biodiversity indices were evaluated in two olive orchard catchments under conventional tillage and no tillage with grass cover, during 3 hydrological years (2011-2013). Seasonal samples of vegetal material and pictures in a permanent grid (4 samples ha-1) were taken to characterize the temporal variations of the number of species, frequency, diversity and transformed Shannon's and Pielou's indices. Sorensen's index obtained in the two olive orchard catchments showed notable differences in composition, probably linked with the different site conditions. The catchment with the best site conditions (deeper soil and higher precipitation), with average annual soil losses over 10 t ha-1 and a more intense management, presented the highest biodiversity indices. In absolute terms, the diversity indices were reasonably high in both catchments, despite the fact that agricultural activity usually severely limits the landscape and the variety of species. Finally, a significantly higher content of organic matter in the first 10 cm of soil was found in the catchment with the worst site conditions, average annual soil losses of 2 t ha-1 and the least intense management. Therefore, the biodiversity indicators associated to weeds were not found to be

  13. Syntenic Relationships between the U and M Genomes of Aegilops, Wheat and the Model Species Brachypodium and Rice as Revealed by COS Markers

    Czech Academy of Sciences Publication Activity Database

    Molnár, I.; Šimková, Hana; Leverington-Waite, M.; Goram, R.; Cseh, A.; Vrána, Jan; Farkas, A.; Doležel, Jaroslav; Molnár-Láng, M.; Griffiths, S.


    Roč. 8, č. 8 (2013) E-ISSN 1932-6203 R&D Projects: GA ČR GBP501/12/G090 Grant - others:GA MŠk(CZ) ED0007/01/01 Program:ED Institutional research plan: CEZ:AV0Z50380511 Keywords : CHROMOSOME ADDITION LINES * IN-SITU HYBRIDIZATION * TRITICUM-AESTIVUM Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.534, year: 2013

  14. Perennial Grass Bioenergy Cropping on Wet Marginal Land

    NARCIS (Netherlands)

    Das, Srabani; Teuffer, Karin; Stoof, Cathelijne R.; Walter, Michael F.; Walter, M.T.; Steenhuis, Tammo S.; Richards, Brian K.


    The control of soil moisture, vegetation type, and prior land use on soil health parameters of perennial grass cropping systems on marginal lands is not well known. A fallow wetness-prone marginal site in New York (USA) was converted to perennial grass bioenergy feedstock production. Quadruplicate

  15. No positive feedback between fire and a nonnative perennial grass (United States)

    Erika L. Geiger; Guy R. McPherson


    Semi-desert grasslands flank the “Sky Island” mountains in southern Arizona and Northern Mexico. Many of these grasslands are dominated by nonnative grasses, which potentially alter native biotic communities. One specific concern is the potential for a predicted feedback between nonnative grasses and fire. In a large-scale experiment in southern Arizona we investigated...

  16. Analysis of Fusarium causing dermal toxicosis in marram grass planters

    NARCIS (Netherlands)

    Snijders, CHA; Samson, RA; Hoekstra, ES; Ouellet, T; Miller, JD; deRooijvanderGoes, PCEM; Baar, AJM; Dubois, AEJ; Kauffman, HF


    In the European coastal dunes, marram grass (Ammophila arenaria) is planted in order to control sand erosion. In the years 1986 to 1991, workers on the Wadden islands in the Netherlands planting marram grass showed lesions of skin and mucous membranes, suggesting a toxic reaction. Fusarium culmorum

  17. Conceptual model for reinforced grass on inner dike slopes

    NARCIS (Netherlands)

    Verhagen, H.J.; ComCoast


    A desk study has been carried out in order to develop a conceptual model for the erosion of inner dike slopes with reinforced grass cover. Based on the results the following can be concluded: The presence of a geosynthetic in a grass slope can be taken into account in the EPM method by increasing

  18. Grass defoliation affecting survival and growth of seedlings of ...

    African Journals Online (AJOL)

    Two experiments were conducted, one in the field and the other in the greenhouse, to investigate the effects of the intensity and frequency of grass defoliation on the survival and growth of Acacia karroo seedlings. In the greenhouse, seedlings growing with heavily clipped grasses had higher biomass production than those ...

  19. Defoliation effects of perennial grasses – continuing confusion | DL ...

    African Journals Online (AJOL)

    Although an adequate knowledge of growth patterns and defoliation effects in perennial grasses is a prerequisite for the rational use of veld and pastures for animal production, our knowledge of this subject is far from adequate. The results of various physiological and clipping studies on tropical and sub-tropical grasses are ...


    Directory of Open Access Journals (Sweden)

    F. Kusmiyati


    Full Text Available The high concentration of sodium chloride (NaCl in saline soils has negative effects on the growth ofmost plants. The experiment was designed to evaluate macro nutrient uptake (Nitrogen, Phosphorus andPotassium of forage grasses at different NaCl concentrations in growth media. The experiment wasconducted in a greenhouse at Forage Crops Laboratory of Animal Agriculture Faculty, Diponegoro University.Split plot design was used to arrange the experiment. The main plot was forage grasses (Elephant grass(Pennisetum purpureum and King grass (Pennisetum hybrida. The sub plot was NaCl concentrationin growth media (0, 150, and 300 mM. The nitrogen (N, phosphorus (P and potassium (K uptake in shootand root of plant were measured. The result indicated increasing NaCl concentration in growth mediasignificantly decreased the N, P and K uptake in root and shoot of the elephant grass and king grass. Thepercentage reduction percentage of N, P and K uptake at 150 mM and 300 mM were high in elephant grassand king grass. It can be concluded that based on nitrogen, phosphorus and potassium uptake, elephantgrass and king grass are not tolerant to strong and very strong saline soil.

  1. EBIPM | Finding the Tools to Manage Invasive Annual Grasses (United States)

    management decisions for a given landscape based on ecological principles. Take a look at our video " Grass Management How much could prevention save you? Guidelines to Implement EBIPM Weed Prevention Areas Grass Facts/ID The EBIPM Model Crooked River Weed Management Area Guide Tools for Educators EBIPM High

  2. Lessons learned in managing alfalfa-grass mixtures (United States)

    Grass-alfalfa mixtures have a number of benefits that make them attractive to producers. However, they can be problematic to establish and maintain. Research programs have made progress in understanding the benefits and challenges of alfalfa-grass mixtures. Mixtures may have greater winter survival ...

  3. Agricultural field reclamation utilizing native grass crop production (United States)

    J. Cure


    Developing a method of agricultural field reclamation to native grasses in the Lower San Pedro Watershed could prove to be a valuable tool for educational and practical purposes. Agricultural field reclamation utilizing native grass crop production will address water table depletion, soil degradation and the economic viability of the communities within the watershed....

  4. Analysis of Some Heavy Metals in Grass ( Paspalum Orbiculare ...

    African Journals Online (AJOL)

    The increased deposition of trace metals from vehicle exhausts on plants has raised concerns about the risks of the quality of food consumed by humans since the heavy metals emitted through the exhaust by vehicles can enter food chain through deposition on grass grazed by animals. Grass (Paspalum Orbiculare) and ...

  5. Invasive grasses change landscape structure and fire behavior in Hawaii (United States)

    Lisa M. Ellsworth; Creighton M. Litton; Alexander P. Dale; Tomoaki Miura


    How does potential fire behavior differ in grass-invaded non-native forests vs open grasslands? How has land cover changed from 1950–2011 along two grassland/forest ecotones in Hawaii with repeated fires? A study on non-native forest with invasive grass understory and invasive grassland (Megathyrsus maximus) ecosystems on Oahu, Hawaii, USA was...

  6. Native Grass Community Management Plan for the Oak Ridge Reservation

    Energy Technology Data Exchange (ETDEWEB)

    Ryon, Michael G [ORNL; Parr, Patricia Dreyer [ORNL; Cohen, Kari [ORNL


    Land managers at the Department of Energy's Oak Ridge National Laboratory in East Tennessee are restoring native warm-season grasses and wildflowers to various sites across the Oak Ridge Reservation (ORR). Some of the numerous benefits to planting native grasses and forbs include improved habitat quality for wildlife, improved aesthetic values, lower long-term maintenance costs, and compliance with Executive Order 13112 (Clinton 1999). Challenges to restoring native plants on the ORR include the need to gain experience in establishing and maintaining these communities and the potentially greater up-front costs of getting native grasses established. The goals of the native grass program are generally outlined on a fiscal-year basis. An overview of some of the issues associated with the successful and cost-effective establishment and maintenance of native grass and wildflower stands on the ORR is presented in this report.

  7. Quantification in mass units of group 1 grass allergens by a monoclonal antibody-based sandwich ELISA. (United States)

    Arilla, M C; Ibarrola, I; Eraso, E; Aguirre, M; Martínez, A; Asturias, J A


    Grass pollen extracts currently used for allergy diagnosis and immunotherapy are a complex mixture of proteins of which only a few have allergenic activity. Lol p 1 is one of the most important allergens in grass pollen extracts. To develop a two-site enzyme-linked immunosorbent assay for the quantification of Lol p 1 and other group 1 allergens from grass species, and to assess its suitability for quantifying this group of allergens. Balb/c mice immunized with recombinant Lol p 1 were used for the production of monoclonal antibodies. Screening of hybridomas was performed by direct ELISA, and selected monoclonal antibodies were immobilized on ELISA plates and incubated with samples containing group 1 allergens. Bound allergens were detected by a combination of biotinylated Lol p 1-specific monoclonal antibody and peroxidase-streptavidin conjugate. The assay is based on three Lol p 1-specific monoclonal antibodies with different epitope specificities. The optimized ELISA measured Lol p 1 concentrations ranging from 125 to 1000 ng/mL and could quantify group 1 allergen from grass species belonging to the Pooidea subfamily. The assay does not depend on anti-sera production or availability of human sera and thus reactives can be produced in unlimited amounts. This sensitive and specific Lol p 1 assay will be helpful both for quantifying the group 1 allergen content of Pooideae pollen extracts intended for clinical use and for studying cross-reactivities among pollen extracts.

  8. Rumen escape protein in grass and grass silage deterimened with a nylon bag and an enzymatic technique

    NARCIS (Netherlands)

    Cone, J.W.; Gelder, van A.H.; Mathijssen-Kamman, A.A.; Hindle, V.A.


    Rumen escape protein (REP) was determined for six grasses and 16 grass silages using a nylon bag technique and an in vitro technique using a proteolytic enzyme preparation of Streptomyces griseus. In vitro, the samples were incubated for 0, 1, 6 and 24 h. The highest correlation observed between

  9. EroGRASS : Failure of grass cover layers at seaward and shoreward dike slopes. design, construction and performance

    NARCIS (Netherlands)

    Verhagen, H.J.; Verheij, H.J.; Cao, T.M.; Dassanayake, D.; Roelvink, D.; Piontkowitz, T.


    A large number of the dikes in the North Sea and Baltic Sea regions are covered with grass that is exposed to hydraulic loading from waves and currents during storm surges. During previous storm surges the grass cover layers often showed large strength and remained undamaged. A clear physical

  10. Established native perennial grasses out-compete an invasive annual grass regardless of soil water and nutrient availability (United States)

    Christopher M. McGlone; Carolyn Hull Sieg; Thomas E. Kolb; Ty Nietupsky


    Competition and resource availability influence invasions into native perennial grasslands by nonnative annual grasses such as Bromus tectorum. In two greenhouse experiments we examined the influence of competition, water availability, and elevated nitrogen (N) and phosphorus (P) availability on growth and reproduction of the invasive annual grass B. tectorum and two...

  11. Systematic studies of Australian stipoid grasses (Austrostipa based on micro-morphological and molecular characteristics

    Directory of Open Access Journals (Sweden)



    Full Text Available Bustam BM (2010 Systematic studies of Australian stipoid grasses (Austrostipa based on micro-morphological and molecular characteristics. Biodiversitas 11: 9-14. This research is one of many studies on stipoid grasses organized by the International Stipeae Working Group (ISWG. This research tested the subgeneric classification of Austrostipa proposed by Jacobs and Everett (1996 and tested how informative the micro morphological characters used. Data were collected from herbarium specimens of 36 species (33 species of Austrostipa, two species of Hesperostipa and one species of Anemanthele at Royal Botanic Gardens, Sydney. Twenty eight micro morphological characters were used. The data were collected from both adaxial and abaxial surfaces of leaves, and from the lemma epidermis using a scanning electron microscope (SEM. ISWG provided the molecular data. Parsimony analysis and a distance method (Unweighteic Pair Group with Arithmatic Mean: UPGMA were used to analyze mico morphological and molecular data separately. Only UPGMA analysis was used to analyze the combined data. The results support the monophyly of Austrostipa. However, there is a little support for the subgeneric classification of Austrostipa proposed by Jacobs and Everett (1996, other than for the consistent recognition of Falcatae. The characters for comparisons between genera are too homoplasious at this level and do not contain enough information for analyses at subgeneric level, a problem apparently shared with the DNA sequences.

  12. Vegetative hyphal fusion and subsequent nuclear behavior in Epichloë grass endophytes. (United States)

    Shoji, Jun-Ya; Charlton, Nikki D; Yi, Mihwa; Young, Carolyn A; Craven, Kelly D


    Epichloë species (including the former genus Neotyphodium) are fungal symbionts of many agronomically important forage grasses, and provide their grass hosts with protection from a wide range of biotic and abiotic stresses. Epichloë species include many interspecific hybrids with allodiploid-like genomes, which may provide the potential for combined traits or recombination to generate new traits. Though circumstantial evidence suggests that such interspecific hybrids might have arisen from nuclear fusion events following vegetative hyphal fusion between different Epichloë strains, this hypothesis has not been addressed empirically. Here, we investigated vegetative hyphal fusion and subsequent nuclear behavior in Epichloë species. A majority of Epichloë strains, especially those having a sexual stage, underwent self vegetative hyphal fusion. Vegetative fusion also occurred between two hyphae from different Epichloë strains. Though Epichloë spp. are uninucleate fungi, hyphal fusion resulted in two nuclei stably sharing the same cytoplasm, which might ultimately lead to nuclear fusion. In addition, protoplast fusion experiments gave rise to uninucleate putative hybrids, which apparently had two markers, one from each parent within the same nucleus. These results are consistent with the notion that interspecific hybrids arise from vegetative hyphal fusion. However, we also discuss additional factors, such as post-hybridization selection, that may be important to explain the recognized prevalence of hybrids in Epichloë species.

  13. Perrenial Grasses for Sustainable European Protein Production

    DEFF Research Database (Denmark)

    Jørgensen, Uffe; Lærke, Poul Erik


    reduction goals for agriculture. Denmark has an especially vulnerable aquatic environment due to sandy soils, a long coast line, and high precipitation. Thus, fulfilling the WFD means some areas must halve their nitrate leaching, and radical changes are required to reduce losses while maintaining profitable...... crop production. National scenarios show that up to ten million tonnes of additional biomass can be sourced in Denmark without reducing food production or increasing the area under cultivation if a biorefinery industry is established. In one of the scenarios optimized for additional environmental...... in the “environment” scenario. This scenario was achieved by converting approx. 9 % of agricultural land from annual crops into perennial grass. New experimental results support the anticipated increase in total biomass yield and reduction in nitrate leaching, when converting land currently used for grain crop...

  14. Accelerated development in Johnsongrass seedlings (Sorghum halepense suppresses the growth of native grasses through size-asymmetric competition.

    Directory of Open Access Journals (Sweden)

    Susanne Schwinning

    Full Text Available Invasive plant species often dominate native species in competition, augmenting other potential advantages such as release from natural enemies. Resource pre-emption may be a particularly important mechanism for establishing dominance over competitors of the same functional type. We hypothesized that competitive success of an exotic grass against native grasses is mediated by establishing an early size advantage. We tested this prediction among four perennial C4 warm-season grasses: the exotic weed Johnsongrass (Sorghum halepense, big bluestem (Andropogon gerardii, little bluestem (Schizachyrium scoparius and switchgrass (Panicum virgatum. We predicted that a the competitive effect of Johnsongrass on target species would be proportional to their initial biomass difference, b competitive effect and response would be negatively correlated and c soil fertility would have little effect on competitive relationships. In a greenhouse, plants of the four species were grown from seed either alone or with one Johnsongrass neighbor at two fertilizer levels and periodically harvested. The first two hypotheses were supported: The seedling biomass of single plants at first harvest (50 days after seeding ranked the same way as the competitive effect of Johnsongrass on target species: Johnsongrass < big bluestem < little bluestem/switchgrass, while Johnsongrass responded more strongly to competition from Johnsongrass than from native species. At final harvest, native plants growing with Johnsongrass attained between 2-5% of their single-plant non-root biomass, while Johnsongrass growing with native species attained 89% of single-plant non-root biomass. Fertilization enhanced Johnsongrass' competitive effects on native species, but added little to the already severe competitive suppression. Accelerated early growth of Johnsongrass seedlings relative to native seedlings appeared to enable subsequent resource pre-emption. Size-asymmetric competition and resource

  15. Autopolyploids in fodder grass breeding: induction and field performance

    Energy Technology Data Exchange (ETDEWEB)

    Dabkevičienė, G.; Kemešytė, V.; Statkevičiūtė, G.; Lemežienė, N.; Brazauskas, G.


    Doubling of chromosome set directly affects plant performance through increase of organ size, higher feeding value and increased resistance to adverse environmental factors. Therefore efficient methods of polyploid induction are needed in order to develop new varieties of naturally diploid fodder grass species. The efficiency of antimitotic agents as colchicine, amiprophos-methyl, trifluralin and oryzalin was compared in a series of tetraploid induction experiments in Lolium multiflorum, L. perenne and Festuca pratensis, while newly developed tetraploid plants were compared to standard tetraploid varieties in the field trials. Colchicine treatment proved to be the most efficient method for in vitro cultured embryos in comparison with the other agents. Induced tetraploids of F. pratensis produced higher dry matter and seed yield and could be used for the development of new varieties. Induced tetraploid plants of Lolium spp. were equal to the standard varieties in field trials, therefore they could be used as parental genotypes in crosses. Induced tetraploids of F. pratensis produced higher dry matter and seed yield and could be used for development of new variety.

  16. Application of wood chips for soil mulching in the cultivation of ornamental grasses

    Directory of Open Access Journals (Sweden)

    Henschke Monika


    Full Text Available A mulch is a layer of material applied to the surface of the soil. Mulching plays an important role in the maintenance of green spaces. Organic materials are still sought for the preparation of mulches. Recently interest in wood chips has grown. The aim of the study was to determine the effect of mulching with pine and birch chips on the contents of phenolic compounds in the soil, as well as on the growth and flowering of ornamental grasses – Bouteloua gracilis (Kunth. Lag. ex Griffiths, Panicum virgatum L. and Pennisetum alopecuroides L. The content of phenolic compounds in the soil steadily increased from spring to autumn. Mulching led to a substantial increase in the level of phenolic compounds. In the first year of cultivation more phenolic compounds were released by chips of pine than birch, while in the second year this difference did not occur. Mulching had a negative impact on the growth and flowering of ornamental grasses, especially in the first year of cultivation. Ornamental grass sensitivity to the substances released from mulches decreased with the age of the plants and was dependent on the species – Bouteloua gracilis was found to be particularly sensitive.

  17. Setaria viridis and Setaria italica, model genetic systems for the Panicoid grasses. (United States)

    Li, Pinghua; Brutnell, Thomas P


    Setaria italica and its wild ancestor Setaria viridis are diploid C(4) grasses with small genomes of ∼515 Mb. Both species have attributes that make them attractive as model systems. Setaria italica is a grain crop widely grown in Northern China and India that is closely related to the major food and feed crops maize and sorghum. A large collection of S. italica accessions are available and thus opportunities exist for association mapping and allele mining for novel variants that will have direct application in agriculture. Setaria viridis is the weedy relative of S. italica with many attributes suitable for genetic analyses including a small stature, rapid life cycle, and prolific seed production. Setaria sp. are morphologically similar to most of the Panicoideae grasses, including major biofuel feedstocks, switchgrass (Panicum virgatum) and Miscanthus (Miscanthus giganteus). They are broadly distributed geographically and occupy diverse ecological niches. The cross-compatibility of S. italica and S. viridis also suggests that gene flow is likely between wild and domesticated accessions. In addition to serving as excellent models for C(4) photosynthesis, these grasses provide novel opportunities to study abiotic stress tolerance and as models for bioenergy feedstocks.

  18. Uptake of C14-atrazine by prairie grasses in a phytoremediation setting. (United States)

    Khrunyk, Yuliya; Schiewer, Silke; Carstens, Keri L; Hu, Dingfei; Coats, Joel R


    Agrochemicals significantly contribute to environmental pollution. In the USA, atrazine is a widely used pesticide and commonly found in rivers, water systems, and rural wells. Phytoremediation can be a cost-effective means of removing pesticides from soil. The objective of this project was to investigate the ability of prairie grasses to remove atrazine. 14 C-labeled atrazine was added to sterilized sand and water/nutrient cultures, and the analysis was performed after 21 days. Switchgrass and big bluestem were promising species for phytoremediation, taking up about 40% of the applied [ 14 C] in liquid hydroponic cultures, and between 20% and 33% in sand cultures. Yellow Indiangrass showed low resistance to atrazine toxicity and low uptake of [ 14 C] atrazine in liquid hydroponic cultures. Atrazine degradation increased progressively from sand to roots and leaves. Most atrazine taken up by prairie grasses from sand culture was degraded to metabolites, which accounted for 60-80% of [ 14 C] detected in leaves. Deisopropylatrazine (DIA) was the main metabolite detected in sand and roots, whereas in leaves further metabolism took place, forming increased amounts of didealkylatrazine (DDA) and an unidentified metabolite. In conclusion, prairie grasses achieved high atrazine removal and degradation, showing a high potential for phytoremediation.

  19. Homogenous stands of a wetland grass harbour diverse consortia of arbuscular mycorrhizal fungi. (United States)

    Wirsel, Stefan G R


    A molecular approach was applied to investigate the colonisation of arbuscular mycorrhizal fungi (AMF) on the wetland grass Phragmites australis. A PCR assay targeting the traditional families of the Glomeromycota yielded products that were used to construct libraries of 18S rDNA. Five hundred and forty six clones were typed by restriction analysis and 76 representatives were sequenced. The majority corresponded to a wide range of taxa within Glomus group A, a few belonged to the "Diversisporaceae" and none to the genera Scutellospora or Acaulospora. Among these sequences, some were very similar to those reported earlier, e.g. Glomus mosseae and G. fasciculatum, other pointed to various new taxa. Although this wetland habitat harboured just one single plant species, phylogenetic analysis exhibited 21 AMF phylotypes, which is in the same range as reported for other natural ecosystems composed of more diverse host communities. Diversity indices supported the perception that the AMF mycoflora associated with this natural grass "monoculture" is not depauperate as it had been described for grasses of crop monocultures. Soil conditions determined the mycorrhizal state of the host, since AMF were not detected at the lakeward front of the reed belt, which is permanently waterlogged.

  20. Performances of legume-grass mixtures under different cutting managements in mediterranean environments

    Directory of Open Access Journals (Sweden)

    Pasquale Martiniello


    Full Text Available Annual forage crops have great importance for sustaining animal production in southern Italy. Knowledge of the performance of legume-grass associations under management similar to systems encountered in farm practice is essential for their effective exploitation of the available environmental resources. The purpose of this investigation was to estimate the effects of five cutting managements on the productivity and botanical composition of ten annual fodder crop mixtures in two Mediterranean environments. Ten ternary combinations of one grass (Avena sativa L., oat and Lolium multiflorum Lam., Italian ryegrass, one clover (Trifolium alexandrinum L., berseem; Trifolium incarnatum L., crimson and Trifolium squarrosum L., squarrosum or burr medic (Medicago polymorpha L. and common vetch (Vicia sativa L. were compared in a field trial (split-plot design, 3 replicates in two locations (Cagliari and Foggia, Italy during the 2000-2001 growing season. The cutting treatments included a winter grazing simulation (G, a cutting only regime at early (EF or late flowering (F of legumes and a combination of treatments (GEF and GF. Plant density (no. m-2 prior to cutting, dry matter yield (g m-2 and botanical composition (% were evaluated. Considerable differences were observed in the harvestable dry matter yields of mixtures among cutting treatments in both localities, with treatment F showing the higher values (787.1 and 415.7 g m-2 for Cagliari and Foggia, respectively. The forage species were able to compete and establish good growth during their initial phase in both localities. However, the botanical composition between the two sites differed considerably after the winter period. Particularly, at Foggia, grass dominance was a permanent feature of all treatments, and all the mixtures contained about 84% of grass. Italian ryegrass was the most representative species under all treatments in both sites. Mixtures with Italian ryegrass, crimson or berseem

  1. Grass carp in the Great Lakes region: establishment potential, expert perceptions, and re-evaluation of experimental evidence of ecological impact (United States)

    Wittmann, Marion E.; Jerde, Christopher L.; Howeth, Jennifer G.; Maher, Sean P.; Deines, Andrew M.; Jenkins, Jill A.; Whitledge, Gregory W.; Burbank, Sarah B.; Chadderton, William L.; Mahon, Andrew R.; Tyson, Jeffrey T.; Gantz, Crysta A.; Keller, Reuben P.; Drake, John M.; Lodge, David M.


    Intentional introductions of nonindigenous fishes are increasing globally. While benefits of these introductions are easily quantified, assessments to understand the negative impacts to ecosystems are often difficult, incomplete, or absent. Grass carp (Ctenopharyngodon idella) was originally introduced to the United States as a biocontrol agent, and recent observations of wild, diploid individuals in the Great Lakes basin have spurred interest in re-evaluating its ecological risk. Here, we evaluate the ecological impact of grass carp using expert opinion and a suite of the most up-to-date analytical tools and data (ploidy assessment, eDNA surveillance, species distribution models (SDMs), and meta-analysis). The perceived ecological impact of grass carp by fisheries experts was variable, ranging from unknown to very high. Wild-caught triploid and diploid individuals occurred in multiple Great Lakes waterways, and eDNA surveillance suggests that grass carp are abundant in a major tributary of Lake Michigan. SDMs predicted suitable grass carp climate occurs in all Great Lakes. Meta-analysis showed that grass carp introductions impact both water quality and biota. Novel findings based on updated ecological impact assessment tools indicate that iterative risk assessment of introduced fishes may be warranted.

  2. Feasibility of Invasive Grass Detection in a Desertscrub Community Using Hyperspectral Field Measurements and Landsat TM Imagery

    Directory of Open Access Journals (Sweden)

    Stuart E. Marsh


    Full Text Available Invasive species’ phenologies often contrast with those of native species, representing opportunities for detection of invasive species with multi-temporal remote sensing. Detection is especially critical for ecosystem-transforming species that facilitate changes in disturbance regimes. The African C4 grass, Pennisetum ciliare, is transforming ecosystems on three continents and a number of neotropical islands by introducing a grass-fire cycle. However, previous attempts at discriminating P. ciliare in North America using multi-spectral imagery have been unsuccessful. In this paper, we integrate field measurements of hyperspectral plant species signatures and canopy cover with multi-temporal spectral analysis to identify opportunities for detection using moderate-resolution multi-spectral imagery. By applying these results to Landsat TM imagery, we show that multi-spectral discrimination of P. ciliare in heterogeneous mixed desert scrub is feasible, but only at high abundance levels that may have limited value to land managers seeking to control invasion. Much higher discriminability is possible with hyperspectral shortwave infrared imagery because of differences in non-photosynthetic vegetation in uninvaded and invaded landscapes during dormant seasons but these spectra are unavailable in multispectral sensors. Therefore, we recommend hyperspectral imagery for distinguishing invasive grass-dominated landscapes from uninvaded desert scrub.

  3. Environmental performance assessment of Napier grass for bioenergy production

    DEFF Research Database (Denmark)

    Nimmanterdwong, Prathana; Chalermsinsuwan, Benjapon; Østergård, Hanne


    equivalence. This idea provides the quantitative indicators involving the resource use and the percent renewability of the systems. For the proposed biorefinery model, Napier grass (Pennisetum purpureum) grown in Thailand was used as lignocellulosic feedstock. An emergy assessment was performed in two parts...... cultivation and biorefinery stages. For Napier grass cultivation, most of the emergy support came from local resources in term of evapotranspiration of Napier grass (33%) and the diesel consumption during the cultivation process (21%). The emergy sustainability indicator of the cultivation was 0...

  4. Biohydrogenation of Fatty Acids Is Dependent on Plant Species and Feeding Regimen of Dairy Cows

    DEFF Research Database (Denmark)

    Petersen, Majbritt Bonefeld; Jensen, Søren Krogh


    and LA between single plant species and feeding regimens. Rumen fluid was collected from cows fed either total mixed ration (TMR), species-rich silage (HERB), or grass silage (GRASS). Five single species (alfalfa, birdsfoot trefoil, chicory, English plantain, and salad burnet) and a grass–clover mixture...... (white clover and ryegrass) were incubated in three replicas up to 30 h and subsequently analyzed for fatty acid content. Michaelis–Menten kinetics was applied for quantifying the BH rate. BH proceeded at the lowest rate in alfalfa and salad burnet (P ... was lower in HERB and GRASS compared to TMR (P

  5. Aquatic Nuisance Species Locator (United States)

    Data in this map has been collected by the United States Geological Survey's Nonindigenous Aquatic Species program located in Gainesville, Florida ( This dataset may have some inaccuracies and is only current to June 15, 2012. The species identified in this dataset are not inclusive of all aquatic nuisance species, but rather a subset identified to be at risk for transport by recreational activities such as boating and angling. Additionally, the locations where organisims have been identified are also not inclusive and should be treated as a guide. Organisms are limited to the following: American bullfrog, Asian clam, Asian shore crab, Asian tunicate, Australian spotted jellyfish, Chinese mitten crab, New Zealand mudsnail, Colonial sea squirt, Alewife, Bighead carp, Black carp, Flathead catfish, Grass carp, Green crab, Lionfish, Northern snakehead, Quagga mussel, Round Goby, Ruffe, Rusty crayfish, Sea lamprey, Silver carp, Spiny water flea, Veined rapa whelk, Zebra mussel

  6. Testing efficacy of distance and tree-based methods for DNA barcoding of grasses (Poaceae tribe Poeae) in Australia. (United States)

    Birch, Joanne L; Walsh, Neville G; Cantrill, David J; Holmes, Gareth D; Murphy, Daniel J


    In Australia, Poaceae tribe Poeae are represented by 19 genera and 99 species, including economically and environmentally important native and introduced pasture grasses [e.g. Poa (Tussock-grasses) and Lolium (Ryegrasses)]. We used this tribe, which are well characterised in regards to morphological diversity and evolutionary relationships, to test the efficacy of DNA barcoding methods. A reference library was generated that included 93.9% of species in Australia (408 individuals, [Formula: see text] = 3.7 individuals per species). Molecular data were generated for official plant barcoding markers (rbcL, matK) and the nuclear ribosomal internal transcribed spacer (ITS) region. We investigated accuracy of specimen identifications using distance- (nearest neighbour, best-close match, and threshold identification) and tree-based (maximum likelihood, Bayesian inference) methods and applied species discovery methods (automatic barcode gap discovery, Poisson tree processes) based on molecular data to assess congruence with recognised species. Across all methods, success rate for specimen identification of genera was high (87.5-99.5%) and of species was low (25.6-44.6%). Distance- and tree-based methods were equally ineffective in providing accurate identifications for specimens to species rank (26.1-44.6% and 25.6-31.3%, respectively). The ITS marker achieved the highest success rate for specimen identification at both generic and species ranks across the majority of methods. For distance-based analyses the best-close match method provided the greatest accuracy for identification of individuals with a high percentage of "correct" (97.6%) and a low percentage of "incorrect" (0.3%) generic identifications, based on the ITS marker. For tribe Poeae, and likely for other grass lineages, sequence data in the standard DNA barcode markers are not variable enough for accurate identification of specimens to species rank. For recently diverged grass species similar challenges are

  7. Grass-Shrub Associations over a Precipitation Gradient and Their Implications for Restoration in the Great Basin, USA.

    Directory of Open Access Journals (Sweden)

    Maike F Holthuijzen

    Full Text Available As environmental stress increases positive (facilitative plant interactions often predominate. Plant-plant associations (or lack thereof can indicate whether certain plant species favor particular types of microsites (e.g., shrub canopies or plant-free interspaces and can provide valuable insights into whether "nurse plants" will contribute to seeding or planting success during ecological restoration. It can be difficult, however, to anticipate how relationships between nurse plants and plants used for restoration may change over large-ranging, regional stress gradients. We investigated associations between the shrub, Wyoming big sagebrush (Artemisia tridentata ssp. wyomingensis, and three common native grasses (Poa secunda, Elymus elymoides, and Pseudoroegneria spicata, representing short-, medium-, and deep-rooted growth forms, respectively, across an annual rainfall gradient (220-350 mm in the Great Basin, USA. We hypothesized that positive shrub-grass relationships would become more frequent at lower rainfall levels, as indicated by greater cover of grasses in shrub canopies than vegetation-free interspaces. We sampled aerial cover, density, height, basal width, grazing status, and reproductive status of perennial grasses in canopies and interspaces of 25-33 sagebrush individuals at 32 sites along a rainfall gradient. We found that aerial cover of the shallow rooted grass, P. secunda, was higher in sagebrush canopy than interspace microsites at lower levels of rainfall. Cover and density of the medium-rooted grass, E. elymoides were higher in sagebrush canopies than interspaces at all but the highest rainfall levels. Neither annual rainfall nor sagebrush canopy microsite significantly affected P. spicata cover. E. elymoides and P. spicata plants were taller, narrower, and less likely to be grazed in shrub canopy microsites than interspaces. Our results suggest that exploring sagebrush canopy microsites for restoration of native perennial

  8. Competition for phosphorus: differential uptake from dual-isotope-labeled soil interspaces between shrub and grass

    International Nuclear Information System (INIS)

    Caldwell, M.M.; Eissenstat, D.M.; Richards, J.H.; Allen, M.F.


    Two species of Agropyron grass differed strikingly in their capacity to compete for phosphate in soil interspaces shared with a common competitor, the sagebrush Artemisia tridentata. Of the total phosphorus-32 and -33 absorbed by Artemisia, 86% was from the interspace shared with Agropyron spicatum and only 14% from that shared with Agropyron desertorum. Actively absorbing mycorrhizal roots of Agropyron and Artemisia were present in both interspaces, where competition for the labeled phosphate occurred. The results have important implications about the way in which plants compete for resources below ground in both natural plant communities and agricultural intercropping systems

  9. Spreaders, igniters, and burning shrubs: plant flammability explains novel fire dynamics in grass-invaded deserts. (United States)

    Fuentes-Ramirez, Andres; Veldman, Joseph W; Holzapfel, Claus; Moloney, Kirk A


    Novel fire regimes are an important cause and consequence of global environmental change that involve interactions among biotic, climatic, and human components of ecosystems. Plant flammability is key to these interactions, yet few studies directly measure flammability or consider how multiple species with different flammabilities interact to produce novel fire regimes. Deserts of the southwestern United States are an ideal system for exploring how novel fire regimes can emerge when fire-promoting species invade ecosystems comprised of species that did not evolve with fire. In these deserts, exotic annual grasses provide fuel continuity across landscapes that did not historically burn. These fires often ignite a keystone desert shrub, the fire-intolerant creosote bush, Larrea tridentata (DC.) Coville. Ignition of Larrea is likely catalyzed by fuels produced by native plants that grow beneath the shrubs. We hypothesize that invasive and native species exhibit distinct flammability characteristics that in combination determine spatial patterns of fire spread and intensity. We measured flammability metrics of Larrea, two invasive grasses, Schismus arabicus and Bromus madritensis, and two native plants, the sub-shrub Ambrosia dumosa and the annual herb Amsinckia menziesii. Results of laboratory experiments show that the grasses carry fire quickly (1.32 cm/s), but burn for short duration (0.5 min) at low temperatures. In contrast, native plants spread fire slowly (0.12 cm/s), but burn up to eight times longer (4 min) and produced hotter fires. Additional experiments on the ignition requirements of Larrea suggest that native plants burn with sufficient temperature and duration to ignite dead Larrea branches (time to ignition, 2 min; temperature at ignition 692°C). Once burning, these dead branches ignite living branches in the upper portions of the shrub. Our study provides support for a conceptual model in which exotic grasses are "spreaders" of fire and native

  10. Integrated production of warm season grasses and agroforestry for biomass production

    Energy Technology Data Exchange (ETDEWEB)

    Samson, R.; Omielan, J. [Resource Efficient Agricultural Production-Canada, Ste, Anne de Bellevue, Quebec (Canada); Girouard, P.; Henning, J. [McGill Univ., Ste. Anne de Bellevue, Quebec (Canada)


    Increased research on C{sub 3} and C{sub 4} perennial biomass crops is generating a significant amount of information on the potential of these crops to produce large quantities of low cost biomass. In many parts of North America it appears that both C{sub 3} and C{sub 4} species are limited by water availability particularly on marginal soils. In much of North America, rainfall is exceeded by evaporation. High transpiration rates by fast growing trees and rainfall interception by the canopy appear to indicate that this can further exacerbate the problem of water availability. C{sub 4} perennial grasses appear to have distinct advantages over C{sub 3} species planted in monoculture systems particularly on marginal soils. C{sub 4} grasses historically predominated over much of the land that is now available for biomass production because of their adaptation to low humidity environments and periods of low soil moisture. The planting of short rotation forestry (SRF) species in an energy agroforestry system is proposed as an alternative production strategy which could potentially alleviate many of the problems associated with SRF monocultures. Energy agroforestry would be complementary to both production of conventional farm crops and C{sub 4} perennial biomass crops because of beneficial microclimatic effects.

  11. Multiple photosynthetic transitions, polyploidy, and lateral gene transfer in the grass subtribe Neurachninae. (United States)

    Christin, Pascal-Antoine; Wallace, Mark J; Clayton, Harmony; Edwards, Erika J; Furbank, Robert T; Hattersley, Paul W; Sage, Rowan F; Macfarlane, Terry D; Ludwig, Martha


    The Neurachninae is the only grass lineage known to contain C(3), C(4), and C(3)-C(4) intermediate species, and as such has been suggested as a model system for studies of photosynthetic pathway evolution in the Poaceae; however, a lack of a robust phylogenetic framework has hindered this possibility. In this study, plastid and nuclear markers were used to reconstruct evolutionary relationships among Neurachninae species. In addition, photosynthetic types were determined with carbon isotope ratios, and genome sizes with flow cytometry. A high frequency of autopolyploidy was found in the Neurachninae, including in Neurachne munroi F.Muell. and Paraneurachne muelleri S.T.Blake, which independently evolved C(4) photosynthesis. Phylogenetic analyses also showed that following their separate C(4) origins, these two taxa exchanged a gene encoding the C(4) form of phosphoenolpyruvate carboxylase. The C(3)-C(4) intermediate Neurachne minor S.T.Blake is phylogenetically distinct from the two C(4) lineages, indicating that intermediacy in this species evolved separately from transitional stages preceding C(4) origins. The Neurachninae shows a substantial capacity to evolve new photosynthetic pathways repeatedly. Enablers of these transitions might include anatomical pre-conditions in the C(3) ancestor, and frequent autopolyploidization. Transfer of key C(4) genetic elements between independently evolved C(4) taxa may have also facilitated a rapid adaptation of photosynthesis in these grasses that had to survive in the harsh climate appearing during the late Pliocene in Australia.

  12. Energy evaluation of fresh grass in the diets of lactating dairy cows

    NARCIS (Netherlands)

    Bruinenberg, M.H.; Zom, R.L.G.; Valk, H.


    The discrepancy between the estimated feeding value of fresh grass and the output per kg grass in terms of milk and maintenance was studied by evaluating 12 experiments with grass-fed dairy cows. The percentage grass in the diets varied between 40 and 90. Intake and milk production were recorded

  13. Transgenesis and genomics in molecular breeding of pasture grasses and legumes for forage quality and other traits

    International Nuclear Information System (INIS)

    Spangenberg, G.


    Significant advances in the establishment of the methodologies required for the molecular breeding of temperate forage grasses (Lolium and Festuca species) and legumes (Trifolium and Medicago species) are reviewed. Examples of current products and approaches for the application of these methodologies to forage grass and legume improvement are outlined. The plethora of new technologies and tools now available for high-throughput gene discovery and genome-wide expression analysis have opened up opportunities for innovative applications in the identification, functional characterization and use of genes of value in forage production systems and beyond. Selected examples of current work in pasture plant genomics, xenogenomics, symbiogenomics and micro-array-based molecular phenotyping are discussed. (author)

  14. Management of Florida Scrub for Threatened and Endangered Species (United States)


    for Florida scrub: 1. The exotic species, cogon grass ( Imperata cylindrica), may become common in degraded scrubs. This is an aggressive, invasive...34Cogongrass, Imperata cylindrica (L.) Beauv.: A good grass gone bad!" Botany Circular No. 28, Florida Dept. Agric. & Consumer Services, Division of Plant...Industry, Gainesville, FL. Colvin, D.L., Gaffney, J., and Shilling, D. G. 1994. "Cogongrass ( Imperata cylindrica (L.) Beauv.) Biology, ecology and

  15. Effect of machinery wheel load on grass yield

    DEFF Research Database (Denmark)

    Green, Ole; Jørgensen, Rasmus Nyholm; Kristensen, Kristian


    Effect of machinery wheel load on grass   Ole Green1, Rasmus N. Jørgensen2, Kristian Kristensen3, René Gislum3, Dionysis Bochtis1, & Claus G. Sørensen1   1University of Aarhus, Dept. of Agricultural Engineering 2University of Southern Denmark, Inst. of Chemical Eng., Biotechnology and Environmental...... 3University of Aarhus, Dept. of Genetics and Biotechnology   Corresponding author: Ole Green Address & e-mail: Research Centre Foulum, Blichers Allé 20, 8830 Tjele.     Abstract   Different traffic intensities have been shown to have a negative influence on the yield of grass...... and clover. A full scale grass-clover field trial was established to estimate the effect on clover-grass yields as a function of different wheel loads and tire pressures. The trial comprised 16 different traffic intensities with 35 replicates and 1 traffic free treatment with 245 replicates, totalling 17...

  16. The design and development of GRASS file reservation system

    International Nuclear Information System (INIS)

    Huang Qiulan; Zhu Suijiang; Cheng Yaodong; Chen Gang


    GFRS (GRASS File Reservation System) is designed to improve the file access performance of GRASS (Grid-enabled Advanced Storage System) which is a Hierarchical Storage Management (HSM) system developed at Computing Center, Institute of High Energy Physics. GRASS can provide massive storage management and data migration, but the data migration policy is simply based factors such as pool water level, the intervals for migration and so on, so it is short of precise control over files. As for that, we design GFRS to implement user-based file reservation which is to reserve and keep the required files on disks for High Energy physicists. CFRS can improve file access speed for users by avoiding migrating frequently accessed files to tapes. In this paper we first give a brief introduction of GRASS system and then detailed architecture and implementation of GFRS. Experiments results from GFRS have shown good performance and a simple analysis is made based on it. (authors)

  17. Designing a New Raster Sub-System for GRASS-7

    Directory of Open Access Journals (Sweden)

    Martin Hruby


    Full Text Available The paper deals with a design of a new raster sub-system intended for modern GIS systems open for client and server operation, database connection and strong application interface (API. Motivation for such a design comes from the current state of API working in GRASS 6. If found attractive, the here presented design and its implementation (referred as RG7 may be integrated to the future new generation of the GRASS Geographical Information System version 7-8. The paper describes in details the concept of raster tiling, computer storage of rasters and basic raster access procedures. Finally, the paper gives a simple benchmarking experiment of random read access to raster files imported from the Spearfish dataset. The experiment compares the early implementation of RG7 with the current implementation of rasters in GRASS 6. As the result, the experiment shows the RG7 to be significantly faster than GRASS in random read access to large raster files.

  18. Grass survey of the Itremo Massif records endemic central highland ...

    African Journals Online (AJOL)

    Grasses are members of the plant family Poaceae, and are primar- ily known for their ... Madagascar Conservation & Development is the journal of. Indian Ocean .... cording to the classification by Kellogg (2015). With 64 ..... Flowering plants.

  19. The linear accumulation of atmospheric mercury by vegetable and grass leaves: Potential biomonitors for atmospheric mercury pollution. (United States)

    Niu, Zhenchuan; Zhang, Xiaoshan; Wang, Sen; Ci, Zhijia; Kong, Xiangrui; Wang, Zhangwei


    One question in the use of plants as biomonitors for atmospheric mercury (Hg) is to confirm the linear relationships of Hg concentrations between air and leaves. To explore the origin of Hg in the vegetable and grass leaves, open top chambers (OTCs) experiment was conducted to study the relationships of Hg concentrations between air and leaves of lettuce (Lactuca sativa L.), radish (Raphanus sativus L.), alfalfa (Medicago sativa L.) and ryegrass (Lolium perenne L.). The influence of Hg in soil on Hg accumulation in leaves was studied simultaneously by soil Hg-enriched experiment. Hg concentrations in grass and vegetable leaves and roots were measured in both experiments. Results from OTCs experiment showed that Hg concentrations in leaves of the four species were significantly positively correlated with those in air during the growth time (p  0.05). Thus, Hg in grass leaves is mainly originated from the atmosphere, and grass leaves are more suitable as potential biomonitors for atmospheric Hg pollution. The effect detection limits (EDLs) for the leaves of alfalfa and ryegrass were 15.1 and 22.2 ng g(-1), respectively, and the biological detection limit (BDL) for alfalfa and ryegrass was 3.4 ng m(-3).





    ABSTRACT This study aimed to characterize buffel grass accessions of the Cenchrus Germplasm Active Bank (CGAB) from Embrapa Semi-Arid in a morphoagronomic way, checking the descriptors variability and efficiency in accessions on two consecutive cuts. Twenty-five accessions and five buffel grass cultivars were used in randomized complete block design with three replications. Evaluations were conducted after two consecutive cuts, each evaluation performed 90 days after each cut. Characterizatio...

  1. Buffel grass morphoagronomic characterization from cenchrus germplasm active bank.


    BRUNO, L. R. G. P.; ANTONIO, R. P.; ASSIS, J. G. de A.; MOREIRA, J. N.; LIRA, I. C. de S. A.


    his study aimed to characterize buffel grass accessions of the Cenchrus Germplasm Active Bank (CGAB) from Embrapa Semi - Arid in a morphoagronomic way, checking the descriptors variability and efficiency in accessions on two consecutive cuts. Twenty - five accessions and five buffel grass cultivars were used in randomized complete block design with three replications. Evaluations were conducted after two consecutive cuts, each evaluation performed 90 days after each ...

  2. Postharvest residues from grass seed crops for bioenergy


    Simić, Aleksandar; Čolić, Vladislava; Vučković, Savo; Dželetović, Željko; Bijelić, Zorica; Mandić, Violeta


    During grass seed production, a large amount of low forage quality biomass has been produced. Tall growing perennial grasses such as tall fescue (Festuca arundinacea L.) and Italian ryegrass (Lolium multiflorum Lam.) can be used as an alternative source for bioenergy production as they can be grown in less cultivated areas, their residues in seed production could be valuable energy source and can be potentially used as a dual purpose crop (bioenergy and forage). In this research, potentials o...

  3. The Potential of Cellulosic Ethanol Production from Grasses in Thailand

    Directory of Open Access Journals (Sweden)

    Jinaporn Wongwatanapaiboon


    Full Text Available The grasses in Thailand were analyzed for the potentiality as the alternative energy crops for cellulosic ethanol production by biological process. The average percentage composition of cellulose, hemicellulose, and lignin in the samples of 18 types of grasses from various provinces was determined as 31.85–38.51, 31.13–42.61, and 3.10–5.64, respectively. The samples were initially pretreated with alkaline peroxide followed by enzymatic hydrolysis to investigate the enzymatic saccharification. The total reducing sugars in most grasses ranging from 500–600 mg/g grasses (70–80% yield were obtained. Subsequently, 11 types of grasses were selected as feedstocks for the ethanol production by simultaneous saccharification and cofermentation (SSCF. The enzymes, cellulase and xylanase, were utilized for hydrolysis and the yeasts, Saccharomyces cerevisiae and Pichia stipitis, were applied for cofermentation at 35°C for 7 days. From the results, the highest yield of ethanol, 1.14 g/L or 0.14 g/g substrate equivalent to 32.72% of the theoretical values was obtained from Sri Lanka ecotype vetiver grass. When the yields of dry matter were included in the calculations, Sri Lanka ecotype vetiver grass gave the yield of ethanol at 1,091.84 L/ha/year, whereas the leaves of dwarf napier grass showed the maximum yield of 2,720.55 L/ha/year (0.98 g/L or 0.12 g/g substrate equivalent to 30.60% of the theoretical values.

  4. Grass buffers for playas in agricultural landscapes: An annotated bibliography (United States)

    Melcher, Cynthia P.; Skagen, Susan K.


    This bibliography and associated literature synthesis (Melcher and Skagen, 2005) was developed for the Playa Lakes Joint Venture (PLJV). The PLJV sought compilation and annotation of the literature on grass buffers for protecting playas from runoff containing sediments, nutrients, pesticides, and other contaminants. In addition, PLJV sought information regarding the extent to which buffers may attenuate the precipitation runoff needed to fill playas, and avian use of buffers. We emphasize grass buffers, but we also provide information on other buffer types.

  5. Turbulent transfer characteristics of radioiodine effluents from air to grass

    Energy Technology Data Exchange (ETDEWEB)

    Markee, E. H. [ARFRO, Environmental Science Services Administration, Idaho Falls, Idaho (United States)


    A total of 20 controlled field releases of radioiodine have been performed at the National Reactor Testing Station in Idaho as a portion of a program to study the transmission of gaseous radioiodine through the air-vegetation-cow-milk-human chain. Most of the releases were conducted over typical pasture grasses during different wind and stability conditions. Radioiodine adherence to grass and carbon plates was measured during most of the tests. Vertical air concentration profiles and turbulence parameters were measured to determine flux characteristics. Analysis of the data reveals the complex interdisciplinary nature of transfer of radioiodine from air to a natural surface. The data are in reasonable agreement with the deposition models of Sheppard and Chamberlain when corrections for the physical and biological receptiveness of the grass and grass density are made. The average ratios of momentum to mass flux were found to be 0.9 in stable conditions and 1.4 in unstable conditions. These ratios demonstrate the effect on mass flux in the lowest 4m by a surface that acts as a partial sink for gaseous effluents. This series of releases indicates the need for further research on the biological receptiveness of grass and turbulent transfer within a grass canopy. (author)

  6. Estimating grass-clover ratio variations caused by traffic intensities using image analysis

    DEFF Research Database (Denmark)

    Jørgensen, Rasmus Nyholm; Sørensen, Claus Grøn; Green, Ole

    Grass and especially clover have a negative yield response as a function of  traffic intensity.  Conventional grass-clover production for silage have high traffic intensity due to fertilizing with slurry, cutting the grass, rolling the grass into swaths, and collecting and chopping the grass...... to fulfill the aim [1]

  7. Symbiosis in the Context of an Invasive, Non-Native Grass: Fungal Biodiversity and Student Engagement (United States)

    Lehr, Gavin

    Grasslands in the western United States face severe environmental threats including those brought about by climate change, such as changes in precipitation regimes and altered fire cycles; land-use conversion and development; and the introduction, establishment, and spread of non-native species. Lehmann's lovegrass (Eragrostis lehmanniana) was introduced to the southwestern United States in the early 1900s. Since its introduction, it has become the dominant grass in the mid-elevation grasslands of southern Arizona, including the Santa Rita Experimental Range (SRER), where it has displaced native grasses including Arizona cottontop, three awns, and gramas. Like all plants in terrestrial ecosystems, this grass harbors fungal symbionts that can be important for its establishment and persistence. This thesis focuses on fungal symbionts of Lehmann's lovegrass and has two components. First, the diversity and distributions of endophytes in Lehmann's lovegrass are evaluated in the context of biotic and abiotic factors in the SRER. Culturing from roots and shoots of Lehmann's lovegrass at points beneath and outside the canopy of native mesquites, which are encroaching on grasslands over time, provides insight into how a single plant species can exhibit local variation in the composition of its symbionts. Second, the thesis is used as the basis for engagement of students in science, technology, engineering, and mathematics (STEM) through the development and implementation of classroom- and field activities centered on endophytes, which help high school students address core learning aims while also gaining real research experience. Engaging students in important questions relevant to their local environment can catalyze interest in science and help students cross the threshold into research. The contributions of such approaches with respect to learning not only fulfills key next-generation science standards and common core objectives, but provides students with a meaningful

  8. Stem rust (Puccinia graminis ssp. graminicola Urban its hosts and harmfulness in grasses grown for seed

    Directory of Open Access Journals (Sweden)

    Maria Prończuk


    Full Text Available Stem rust development on four species of grasses was studied in field experiments conducted at Radzików in 1997-2001. Population of Puccinia graminis ssp. graminicola from different hosts was characterised and their harmfulness for grass grown for seed was estimated. The materials for study were ecotypes and strains of Lolium perenne, Festuca rubra, Poa pratensis and Deschampsia caespitosa collected in breeding nursery and cultivars and strains of L.perenne, F.rubra, P.pratensis cultivated for seed. It was found that the changes in environmental conditions during last years influenced earlier occurrence of stem rust on grasses in Poland. All examined species were the host of P.graminis ssp. graminicola, however the period of infection of particular hosts were different. L.perenne and D.caespitosa were infected in early summer but F.rubra and P.pratensis in late summer or in the autumn. Morphological analysis of spores of P.graminis ssp. graminicola have shoved significant differences between populations obtained from L.perenne and D.caespitosa. Some differences were found between populations from F.rubra and P.pratensis also, but they need more study. Every year occurrence of stem rust on L.perenne and D.caespitosa and its relation with spring temperature in Radzików indicated that populations of patogen could overwinter in local turf. Incidental appearance of stem rust on F.rubra and P.pratensis in centre of Poland allowed to suppose that spores of these forms might be transfer by wind from other regions. The investigation revealed that stem rust can be dangerous for L.perenne grown for seed when infection occurs at flowering time. It has been established that infection of F.rubra and P.pratensis in autumn should not be disregarded. Damages of leaves by P.graminis ssp. graminicola substantially limited plant heading in the next year.

  9. Post-treatment efficacy of discontinuous treatment with 300IR 5-grass pollen sublingual tablet in adults with grass pollen-induced allergic rhinoconjunctivitis

    DEFF Research Database (Denmark)

    Didier, A; Malling, H-J; Worm, Marcel


    Sustained efficacy over three pollen seasons of pre- and co-seasonal treatment with 300IR 5-grass pollen sublingual tablet has been demonstrated in adults with moderate-severe grass pollen-associated allergic rhinoconjunctivitis.......Sustained efficacy over three pollen seasons of pre- and co-seasonal treatment with 300IR 5-grass pollen sublingual tablet has been demonstrated in adults with moderate-severe grass pollen-associated allergic rhinoconjunctivitis....

  10. Preliminary Results of Clover and Grass Coverage and Total Dry Matter Estimation in Clover-Grass Crops Using Image Analysis

    Directory of Open Access Journals (Sweden)

    Anders K. Mortensen


    Full Text Available The clover-grass ratio is an important factor in composing feed ratios for livestock. Cameras in the field allow the user to estimate the clover-grass ratio using image analysis; however, current methods assume the total dry matter is known. This paper presents the preliminary results of an image analysis method for non-destructively estimating the total dry matter of clover-grass. The presented method includes three steps: (1 classification of image illumination using a histogram of the difference in excess green and excess red; (2 segmentation of clover and grass using edge detection and morphology; and (3 estimation of total dry matter using grass coverage derived from the segmentation and climate parameters. The method was developed and evaluated on images captured in a clover-grass plot experiment during the spring growing season. The preliminary results are promising and show a high correlation between the image-based total dry matter estimate and the harvested dry matter ( R 2 = 0.93 with an RMSE of 210 kg ha − 1 .

  11. Upgraded fuel from reed canary grass

    Energy Technology Data Exchange (ETDEWEB)

    Heiskanen, V P


    The feasibility of RCG for commercial utilization depends primarily on its applicability for pulp production and its use in energy production will be based on the residue that will be available after extracting the pulp fraction of the RCG. Roughly 20 ..30% of the material will be available for energy production purposes. However, the percentage may be higher/lower depending on the quality standards of the pulp fiber material. The harvesting period has a significant effect on the fuel characteristics of RCG. For instance the contents of N, S, Cl, K are clearly lower if the RCG is harvested in the spring (delayed) instead of summer/autumn. These elements affect significantly overall emission formation and ash behaviour and its melting temperature. The combustion related research in this project has been focused on the spring-harvested RCG. The project aims to evaluate the feasibility of delayed harvested RCG for energy production. In order to reach this goal, the following combustion methods will be tested and studied: combustion of pelletized RCG; gasification; combustion of pulverized RCG. In addition, pelletizing, reactivity and NO conversion of pulverized RCG will be studied. The research described here is a part of `Reed Canary Grass` project (in AIR programme). The contractors of the project are Swedish University of Agricultural Sciences (coordinator), United Milling Systems from Denmark, Jaakko Poeyry Oy and VTT Energy. In addition, there are partners from several countries participating in the project. The project has been divided in five tasks, VTT Energy being responsible for combustion related task `Upgraded fuel` that includes the research topics discussed in this paper

  12. Upgraded fuel from reed canary grass

    Energy Technology Data Exchange (ETDEWEB)

    Heiskanen, V.P.


    The feasibility of RCG for commercial utilization depends primarily on its applicability for pulp production and its use in energy production will be based on the residue that will be available after extracting the pulp fraction of the RCG. Roughly 20 ..30% of the material will be available for energy production purposes. However, the percentage may be higher/lower depending on the quality standards of the pulp fiber material. The harvesting period has a significant effect on the fuel characteristics of RCG. For instance the contents of N, S, Cl, K are clearly lower if the RCG is harvested in the spring (delayed) instead of summer/autumn. These elements affect significantly overall emission formation and ash behaviour and its melting temperature. The combustion related research in this project has been focused on the spring-harvested RCG. The project aims to evaluate the feasibility of delayed harvested RCG for energy production. In order to reach this goal, the following combustion methods will be tested and studied: combustion of pelletized RCG; gasification; combustion of pulverized RCG. In addition, pelletizing, reactivity and NO conversion of pulverized RCG will be studied. The research described here is a part of `Reed Canary Grass` project (in AIR programme). The contractors of the project are Swedish University of Agricultural Sciences (coordinator), United Milling Systems from Denmark, Jaakko Poeyry Oy and VTT Energy. In addition, there are partners from several countries participating in the project. The project has been divided in five tasks, VTT Energy being responsible for combustion related task `Upgraded fuel` that includes the research topics discussed in this paper

  13. GRASS GIS: The first Open Source Temporal GIS (United States)

    Gebbert, Sören; Leppelt, Thomas


    GRASS GIS is a full featured, general purpose Open Source geographic information system (GIS) with raster, 3D raster and vector processing support[1]. Recently, time was introduced as a new dimension that transformed GRASS GIS into the first Open Source temporal GIS with comprehensive spatio-temporal analysis, processing and visualization capabilities[2]. New spatio-temporal data types were introduced in GRASS GIS version 7, to manage raster, 3D raster and vector time series. These new data types are called space time datasets. They are designed to efficiently handle hundreds of thousands of time stamped raster, 3D raster and vector map layers of any size. Time stamps can be defined as time intervals or time instances in Gregorian calendar time or relative time. Space time datasets are simplifying the processing and analysis of large time series in GRASS GIS, since these new data types are used as input and output parameter in temporal modules. The handling of space time datasets is therefore equal to the handling of raster, 3D raster and vector map layers in GRASS GIS. A new dedicated Python library, the GRASS GIS Temporal Framework, was designed to implement the spatio-temporal data types and their management. The framework provides the functionality to efficiently handle hundreds of thousands of time stamped map layers and their spatio-temporal topological relations. The framework supports reasoning based on the temporal granularity of space time datasets as well as their temporal topology. It was designed in conjunction with the PyGRASS [3] library to support parallel processing of large datasets, that has a long tradition in GRASS GIS [4,5]. We will present a subset of more than 40 temporal modules that were implemented based on the GRASS GIS Temporal Framework, PyGRASS and the GRASS GIS Python scripting library. These mod