42 CFR 86.19 - Human subjects; animal welfare.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Human subjects; animal welfare. 86.19 Section 86.19... Occupational Safety and Health Training Grants § 86.19 Human subjects; animal welfare. No grant award may be... concerning animal welfare. 2 The Department Grants Administration Manual is available for inspection at the...

78 FR 64512 - Center for Scientific Review; Notice of Closed Meetings

Science.gov (United States)

2013-10-29

... Biology. Date: November 19, 2013. Time: 8:00 a.m. to 5:00 p.m. Agenda: To review and evaluate grant... Research in Diabetes, Obesity and Endocrine Disorders. Date: November 19, 2013. Time: 8:00 a.m. to 8:00 p.m... Scientific Review Special Emphasis Panel; Molecular Neuroscience. Date: November 19, 2013. Time: 1:00 p.m. to...

75 FR 32420 - Student Assistance General Provisions, Federal Supplemental Educational Opportunity Grant...

Science.gov (United States)

2010-06-08

... Grant, National Science and Mathematics Access To Retain Talent Grant, and Teacher Education Assistance... first column, after the signature block insert the following graphics. BILLING CODE 1301-00-D [[Page...] BILLING CODE 1301-00-C ...

Hydrophilic luminescent silicon nanoparticles in steric colloidal solutions: Their size, agglomeration, and toxicity

Czech Academy of Sciences Publication Activity Database

Herynková, Kateřina; Šimáková, Petra; Cibulka, Ondřej; Fučíková, Anna; Kalbáčová, M.H.

2017-01-01

Roč. 14, č. 12 (2017), s. 1-4, č. článku 1700195. ISSN 1862-6351 Grant - others:AV ČR(CZ) DAAD-16-18 Program:Bilaterální spolupráce Institutional support: RVO:68378271 Keywords : silicon nanoparticles * agglomeration * toxicity Subject RIV: BO - Biophysics OBOR OECD: Biophysics

Zoogeography of fish parasites of the pearlside (Maurolicus muelleri), with genetic evidence of Anisakis simplex (s.s.) from the Mid-Atlantic Ridge

Czech Academy of Sciences Publication Activity Database

Klimpel, S.; Kellermanns, E.; Palm, H. W.; Moravec, František

2007-01-01

Roč. 152, č. 3 (2007), s. 725-732 ISSN 0025-3162 Grant - others:German Research Council(DE) DFG KL 2087/1, PA 664/4-1; German Academic Exchange Service(DE) DAAD Klimpel D/05/51605 Institutional research plan: CEZ:AV0Z60220518 Keywords : Anisakis * Maurolicus * Atlantic Ocean Subject RIV: EG - Zoology Impact factor: 2.215, year: 2007

Hydrophilic luminescent silicon nanoparticles in steric colloidal solutions: their size, agglomeration and toxicity

Czech Academy of Sciences Publication Activity Database

Herynková, Kateřina; Šimáková, Petra; Cibulka, Ondřej; Fučíková, Anna; Kalbáčová, M.H.

2017-01-01

Roč. 14, č. 12 (2017), s. 1-4, č. článku 1700195. ISSN 1862-6351 Grant - others:AV ČR(CZ) DAAD-16-18 Program:Bilaterální spolupráce Institutional support: RVO:68378271 Keywords : silicon nanocrystals * colloidal solutions * steric stabilization * cytotoxicity Subject RIV: BO - Biophysics OBOR OECD: Biophysics

Structural, magneto-optical properties and cation distribution of SrBi{sub x}La{sub x}Y{sub x}Fe{sub 12−3x}O{sub 19} (0.0 ≤ x ≤ 0.33) hexaferrites

Energy Technology Data Exchange (ETDEWEB)

Auwal, I.A. [Department of Chemistry, Fatih University, 34500 B. Çekmece, İstanbul (Turkey); Güngüneş, H. [Department of Physics, Hitit University, 19030 Çevre Yolu Bulvarı, Çorum (Turkey); Güner, S. [Department of Physics, Fatih University, 34500 B. Çekmece, İstanbul (Turkey); Shirsath, Sagar E. [Spin Device Technology Center, Faculty of Engineering, Shinshu University, 380-8553 Nagano (Japan); Sertkol, M. [Department of Physics Engineering, Istanbul Technical University, 34469 Maslak (Turkey); Baykal, A., E-mail: hbaykal@fatih.edu.tr [Department of Chemistry, Fatih University, 34500 B. Çekmece, İstanbul (Turkey)

2016-08-15

Highlights: • SrBi{sub x}La{sub x}Y{sub x}Fe{sub 12−3x}O{sub 19} (0.0 ≤ x ≤ 0.33) hexaferrites have been prepared by sol-gel autocombustion. • XRD patterns show that SrBi{sub x}La{sub x}Y{sub x}Fe{sub 12−3x}O{sub 19} (0.0 ≤ x ≤ 0.33) hexaferrites exhibit hexagonal structure. • The intrinsic coercivity (H{sub ci}) above 15000 Oe reveals that all samples are magnetically hard materials. - Abstract: SrBi{sub x}La{sub x}Y{sub x}Fe{sub 12−3x}O{sub 19} (0.0 ≤ x ≤ 0.33) hexaferrites were produced via sol-gel auto combustion. XRD patterns show that all the samples are single-phase M-type strontium hexaferrite (SrM). The magnetic hysteresis (σ-H) loops revealed the ferromagnetic nature of nanoparticles (NPs). The coercive field decreases from 4740 Oe to 2720 Oe with increasing ion content. In particular, SrBi{sub x}La{sub x}Y{sub x}Fe{sub 12−3x}O{sub 19} NPs with x = 0.0, 0.1, 0.2 have suitable magnetic characteristics (σ{sub s} = 62.03–64.72 emu/g and H{sub c} = 3105–4740 Oe) for magnetic recording. The intrinsic coercivity (H{sub ci}) above 15000 Oe reveals that all samples are magnetically hard materials. Tauc plots were used to specify the direct optical energy band gap (E{sub g}) of NPs. The E{sub g} values are between 1.76 eV and 1.85 eV. {sup 57}Fe Mössbauer spectroscopy data, the variation in line width, isomer shift, quadrupole splitting, relative area and hyperfine magnetic field values on Bi{sup 3+} La{sup 3+} and Y{sup 3+} substitutions have been determined.

Agglomeration of luminescent porous silicon nanoparticles in colloidal solutions

Czech Academy of Sciences Publication Activity Database

Herynková, Kateřina; Šlechta, Miroslav; Šimáková, Petra; Fučíková, Anna; Cibulka, Ondřej

2016-01-01

Roč. 11, Aug (2016), s. 1-5, č. článku 367. ISSN 1556-276X Grant - others:AV ČR(CZ) DAAD-16-18 Program:Bilaterální spolupráce Institutional support: RVO:68378271 Keywords : nanocrystalline silicon * porous silicon * nanoparticles * colloids * agglomeration Subject RIV: BO - Biophysics Impact factor: 2.833, year: 2016

Identifying Causal Gateways and Mediators in Complex Spatio-Temporal Systems

Czech Academy of Sciences Publication Activity Database

Runge, J.; Petoukhov, V.; Donges, J.F.; Hlinka, Jaroslav; Jajcay, Nikola; Vejmelka, Martin; Hartman, David; Marwan, N.; Paluš, Milan; Kurths, J.

2015-01-01

Roč. 6, 7 October (2015), Article 8502 ISSN 2041-1723 R&D Projects: GA ČR(CZ) GA14-02634S; GA ČR GA13-23940S; GA MZd(CZ) NV15-29835A Grant - others:GA MŠk(CZ) LL1201; AV ČR + DAAD(CZ-DE) DAAD-15-30 Program:Bilaterální spolupráce Institutional support: RVO:67985807 Keywords : causality * climate * complex systems * dimension reduction * atmospheric dynamics * networks * dynamical systems Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 11.329, year: 2015

Magneto-optical properties BaBi{sub x}La{sub x}Fe{sub 12−2x}O{sub 19} (0.0≤x≤0.5) hexaferrites

Energy Technology Data Exchange (ETDEWEB)

Auwal, I.A. [Department of Chemistry, Fatih University, 34500 B.Çekmece, İstanbul (Turkey); Baykal, A., E-mail: hbaykal@fatih.edu.tr [Department of Chemistry, Fatih University, 34500 B.Çekmece, İstanbul (Turkey); Güner, S. [Department of Physics, Fatih University, 34500 B.Çekmece, İstanbul (Turkey); Sertkol, M. [Department of Physics Engineering, Istanbul Technical University, 34469 Maslak, Istanbul (Turkey); Sözeri, H. [TUBITAK-UME, National Metrology Institute, P.O. Box 54, 41470 Gebze, Kocaeli (Turkey)

2016-07-01

BaBi{sub x}La{sub x}Fe{sub (12−2x)}O{sub 19} (0.0≤x≤0.5) hexaferrites were synthesized by solid state synthesis route and the effects of Bi, La substitutions on structural, magnetic and optical properties were investigated. X-ray powder diffraction, Scanning electron microscopy, Vibrating sample magnetometer, and Percent diffuse reflectance spectroscopy were used to study the physical properties. Room temperature specific magnetization (M–H) curves revealed the ferromagnetic nature of all products. The increasing Bi, La compositions increased the magnetic properties at different magnitudes with respect to undoped BaFe{sub 12}O{sub 19} sample. The maximum values of remnant specific magnetization (M{sub r}=30.3 emu/g), extrapolated specific saturation magnetization (M{sub s}=62.12 emu/g), and magneton number (n{sub B}=16.27) were recorded from BaBi{sub 0.2}La{sub 0.2}Fe{sub 11.4}O{sub 19} hexaferrite. The average crystallite size varies in a range of (37.35–51.36) nm. The coercive field (H{sub c}) of undoped hexaferrites is 1180 Oe and increased to maximum 2320 Oe belonging to BaBi{sub 0.4}La{sub 0.4}Fe{sub 11.2}O{sub 19}. Magnetic anisotropy was confirmed as uniaxial and calculated effective anisotropy constants (K{sub eff}) are between 4.27×10{sup 5} Ergs/g and 5.05×10{sup 5} Ergs/g. The high magnitudes of magnetocrystalline anisotropy (H{sub a}) above than 16,200 Oe revealed that all samples are magnetically hard materials. The Tauc plots were drawn to extrapolate the direct optical energy band gap (E{sub g}) of hexaferrites. The E{sub g} values decreased from 1.76 eV to 1.47 eV with increasing Bi, La compositions. - Highlights: • BaBi{sub x}La{sub x}Fe{sub (12−2x)}O{sub 19} (0.0≤x≤0.5) hexaferrites were synthesized by solid state synthesis route. • The E{sub g} values decreased from 1.76 eV to 1.47 eV with increasing Bi, La compositions. • BaBi{sub xx}La{sub xx}Fe{sub 12-2x}O{sub 19} hexaferrites good candidate for potential applications

Data of evolutionary structure change: 1A00A-2ZLWD [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1A00A-2ZLWD 1A00 2ZLW A D -VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPT...R VQLSGEEKAAVLALWDKVN--EEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEL...x>0 2ZLW D 2ZLWD

Fuchs-Kliewer phonons of H-covered and clean GaN(1 1 bar 00)

Science.gov (United States)

Rink, M.; Himmerlich, M.; Krischok, S.; Kröger, J.

2018-01-01

Inelastic electron scattering is used to study surface phonon polaritons on H-covered and clean GaN(1 1 bar 00) surfaces. The Fuchs-Kliewer phonon of GaN(1 1 bar 00) -H gives rise to characteristic signatures of its single and multiple excitation in specular electron energy loss spectra. The loss intensities for multi-phonon scattering processes decrease according to a Poisson distribution. Vibrational spectra of this surface are invariant on the time scale of days reflecting its chemical passivation by the H layer. In contrast, vibrational spectra of pristine GaN(1 1 bar 00) are subject to a pronounced temporal evolution where spectroscopic weight is gradually shifted towards the multiple excitation of the Fuchs-Kliewer phonon. As a consequence, the monotonous decrease of the cross section for multiple quantum excitation as observed for the H-covered surface is not applicable. This remarkable effect is particularly strong in spectra acquired at low primary energies of incident electrons, which hints at processes occurring in the very surface region. Scenarios that may contribute to these observations are discussed.

Data of evolutionary structure change: 1A00C-2ZLWD [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1A00C-2ZLWD 1A00 2ZLW C D -VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPT...SKYR VQLSGEEKAAVLALWDKVN--EEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEG---VHHLDNLKGTF...D> 0 2ZLW D 2ZLWD

Comparison of silicon nanocrystals prepared by two fundamentally different methods

Czech Academy of Sciences Publication Activity Database

Cibulka, Ondřej; Vorkotter, C.; Purkrt, Adam; Holovský, Jakub; Benedikt, J.; Herynková, Kateřina

2016-01-01

Roč. 11, Oct (2016), s. 1-7, č. článku 445. ISSN 1556-276X Grant - others:AV ČR(CZ) DAAD-16-18 Program:Bilaterální spolupráce Institutional support: RVO:68378271 Keywords : silicon nanocrystals * electrochemical etching * low-pressure plasma * photoluminescence * size distribution * surface passivation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.833, year: 2016

19 CFR 19.1 - Classes of customs warehouses.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Classes of customs warehouses. 19.1 Section 19.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS WAREHOUSES, CONTAINER STATIONS AND CONTROL OF MERCHANDISE THEREIN § 19.1 Classes of...

Hepatoprotective effect of MMP-19 deficiency in a mouse model of chronic liver fibrosis

Czech Academy of Sciences Publication Activity Database

Jiroušková, Markéta; Žbodáková, Olga; Gregor, Martin; Chalupský, Karel; Sarnová, Lenka; Hajduch, M.; Ehrmann, J.; Jirkovska, M.; Sedláček, Radislav

2012-01-01

Roč. 7, č. 10 (2012), e46271 E-ISSN 1932-6203 R&D Projects: GA AV ČR IAA500520812; GA ČR GAP303/10/2044 Grant - others:MŠMT(CZ) CZ.1.05/1.1.00/02.0109; MŠMT(CZ) CZ.1.05/2.1.00/01.0030 Institutional support: RVO:68378050 Keywords : matrix metalloproteinase * liver * fibrosis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.730, year: 2012

28 CFR 90.19 - State office.

Science.gov (United States)

2010-07-01

... 28 Judicial Administration 2 2010-07-01 2010-07-01 false State office. 90.19 Section 90.19...¢ Training ⢠Officers ⢠Prosecutors) Violence Against Women Formula Grant Program § 90.19 State office. (a... office for the purposes of: (1) Certifying qualifications for funding under this subpart B; (2...

Highly tunable SrTiO.sub.3./sub./DyScO.sub.3./sub. heterostructures for applications in the terahertz range

Czech Academy of Sciences Publication Activity Database

Kužel, Petr; Kadlec, Filip; Petzelt, Jan; Schubert, J.; Panaitov, G.

2007-01-01

Roč. 91, č. 23 (2007), 232911/1-232911/3 ISSN 0003-6951 R&D Projects: GA MŠk LC512; GA ČR(CZ) GA202/06/0286 Grant - others:DAAD-ASCR(XE) D20-CZ4/06-07 Institutional research plan: CEZ:AV0Z10100520 Keywords : ferroelectric * terahertz * strontium titanate * thin film * soft mode Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.596, year: 2007

Nucleoporin NUP153 guards genome integrity by promoting nuclear import of 53BP1

Czech Academy of Sciences Publication Activity Database

Moudrý, Pavel; Lukas, C.; Macůrek, Libor; Neumann, B.; Heriche, J.K.; Pepperkok, R.; Ellenberg, J.; Hodný, Zdeněk; Lukas, J.; Bartek, Jiří

2012-01-01

Roč. 19, č. 5 (2012), s. 798-807 ISSN 1350-9047 R&D Projects: GA ČR GA301/08/0353; GA ČR GAP301/10/1525; GA ČR GPP305/10/P420 Grant - others:7.RP EU(XE) CZ.1.05/2.1.00/01.0030 Institutional research plan: CEZ:AV0Z50520514 Keywords : DNA damage response * NUP153 * 53BP1 nuclear import Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 8.371, year: 2012

VizieR Online Data Catalog: W1J00 and W2J00 Transit Circle Catalogs (Rafferty+, 2016)

Science.gov (United States)

Rafferty, T. J.; Holdenried, E. R.; Urban, S. E.

2016-06-01

The W1J00, named because it was the first (of two) Washington transit circle catalog to be referred to the Equinox of J2000.0, is the result of observations made with the Six-inch Transit Circle in Washington, D.C., between September 1977 and July 1982. The observing program was structured to be absolute, in the sense that the positions were not explicitly relying on any previous observations. The absolute positions were defined with respect to an internally consistent frame that was unique to the particular instrument. Following the reductions, comparisons with stars from the Hipparcos Catalogue (European Space Agency 1997) revealed unaccounted for systematic differences on the level of 100-200mas. It was decided, therefore, to include data on both the absolute positions reduced in way common to many past Washington transit circle catalogs, as well as the positions differentially adjusted to the system of the Hipparcos Catalog. The W1J00 contains mean positions of 7267 stars and 4383 observations of solar system objects. The majority of the stars fall into two categories; those from the Fifth Fundamental Catalog (FK5; Fricke et al 1988), and those from the Catalog Of 3539 Zodiacal Stars For The Equinox 1950.0 (Robertson 1940). The solar system objects include the Sun, Mercury, Venus, Mars, Jupiter, Saturn, Uranus, Neptune, eight minor planets (Eunomia, Flora, Hebe, Iris, Juno, Metis, Pallas, and Vesta), and the dwarf planet Ceres. Characteristics of the W1J00 catalog: Category Range Average ------------------------------------------------------------- Magnitudes -1.6 to 10.4 7.18 RA standard errors of the mean 15 to 460 mas 98 mas Dec standard errors of the mean 10 to 400 mas 107 mas RA Number of observations / star 3 to 187 10 Dec Number of observations / star 2 to 179 10 Declination coverage -39 to +90 degrees ------------------------------------------------------------- Details of the W1J00 can be found in Rafferty, Holdenried, and Urban (2016, Publ. USNO, 2nd

47 CFR Appendix A to Part 400 - Minimum Grant Awards Available to Qualifying States

Science.gov (United States)

2010-10-01

... ADMINISTRATION, DEPARTMENT OF COMMERCE, AND NATIONAL HIGHWAY TRAFFIC SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION E-911 GRANT PROGRAM Pt. 400, App. A Appendix A to Part 400—Minimum Grant Awards Available to Qualifying States State name Minimum E-911grant award Alabama $686,230.25 Alaska 500,000.00 American Samoa...

Generation of a quasi-monoergetic proton beam from laser-irradiated submicron droplets

Czech Academy of Sciences Publication Activity Database

Ter-Avetisyan, Sargis; Ramakrishna, B.; Prasad, R.; Borghesi, M.; Nickles, P. V.; Steinke, S.; Schnürer, M.; Popov, K.I.; Ramunno, L.; Zmitrenko, N.V.; Bychenkov, V.Yu.

2012-01-01

Roč. 19, č. 7 (2012), "073112-1"-"073112-8" ISSN 1070-664X R&D Projects: GA MŠk ED1.1.00/02.0061 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061 Institutional support: RVO:68378271 Keywords : spray * protons * lasers Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.376, year: 2012 http://pop.aip.org/resource/1/phpaen/v19/i7/p073112_s1?isAuthorized=no

Structural and luminescence properties of silicon nanocrystals in colloidal solutions for bio applications

Czech Academy of Sciences Publication Activity Database

Herynková, Kateřina; Vorkotter, C.; Šimáková, Petra; Benedikt, J.; Cibulka, Ondřej

2016-01-01

Roč. 213, č. 11 (2016), s. 2873-2878 ISSN 1862-6300. [Spring Conference of the European-Materials-Research-Society (E-MRS). Lille, 02.05.2016-06.05.2016] Grant - others:AV ČR(CZ) DAAD-16-18 Program:Bilaterální spolupráce Institutional support: RVO:68378271 Keywords : silicon nanoparticles * porous silicon * colloidal solutions * surface modification * low- pressure microwave plasma synthesis Subject RIV: BO - Biophysics Impact factor: 1.775, year: 2016

Passivation effect of water vapour on thin film polycrystalline Si solar cells

Czech Academy of Sciences Publication Activity Database

Pikna, Peter; Müller, Martin; Becker, C.; Fejfar, Antonín

2016-01-01

Roč. 213, č. 7 (2016), s. 1969-1975 ISSN 1862-6300 R&D Projects: GA MŠk LM2015087; GA ČR GA13-12386S Grant - others:AV ČR(CZ) DAAD-16-27 Program:Bilaterální spolupráce Institutional support: RVO:68378271 Keywords : passivation, * plasma hydrogenation * silicon * solar cells * thin films * water vapour Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.775, year: 2016

19 CFR 145.36 - Articles for institutions.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Articles for institutions. 145.36 Section 145.36... TREASURY (CONTINUED) MAIL IMPORTATIONS Special Classes of Merchandise § 145.36 Articles for institutions. Books and other articles classifiable under subheading 4903.00.00, 4904.00.00, 4905.91.00, 4905.99.00...

Astigmatism induced by conventional spherical ablation after PRK and LASIK in myopia with astigmatism < 1.00 D.

Science.gov (United States)

Christiansen, Steven M; Mifflin, Mark D; Edmonds, Jason N; Simpson, Rachel G; Moshirfar, Majid

2012-01-01

The purpose of this study was to evaluate surgically-induced astigmatism after spherical ablation in photorefractive keratectomy (PRK) and laser-assisted in situ keratomileusis (LASIK) for myopia with astigmatism PRK or LASIK for the correction of myopia with minimal astigmatism of PRK, average cylinder increased from 0.39 ± 0.25 (0.00-0.75) preoperatively to 0.55 ± 0.48 (0.00-1.75) postoperatively (P = 0.014), compared with an increase in LASIK eyes from 0.40 ± 0.27 (0.00-0.75) preoperatively to 0.52 ± 0.45 (0.00-2.00) postoperatively (P = 0.041). PRK eyes experienced an absolute value change in cylinder of 0.41 ± 0.32 (0.00-1.50) and LASIK eyes experienced a change of 0.41 ± 0.31 (0.00-1.50, P = 0.955). Mean surgically-induced astigmatism was 0.59 ± 0.35 (0.00-1.70) in PRK eyes, with an increase in surgically-induced astigmatism of 0.44 D for each additional 1.00 D of preoperative cylinder; in LASIK eyes, mean surgically-induced astigmatism was 0.55 ± 0.32 (0.00-1.80, P = 0.482), with an increase in surgically-induced astigmatism of 0.29 D for each 1.00 D of preoperative cylinder. Spherical ablation can induce substantial astigmatism even in eyes with less than one diopter of preoperative astigmatism in both PRK and LASIK. No significant difference in the magnitude of surgically-induced astigmatism was found between eyes treated with PRK and LASIK, although surgically-induced astigmatism was found to increase with greater levels of preoperative astigmatism in both PRK and LASIK.

77 FR 19738 - Notice of Availability of Calendar Year 2013 Competitive Grant Funds

Science.gov (United States)

2012-04-02

... , or visit the grants competition Web site at www.grants.lsc.gov . SUPPLEMENTARY INFORMATION: The..., CA-19, CA-26, CA-29, CA- 30. Colorado CO-6, MCO, NCO-1. Delaware MDE. Florida FL-5, FL-13, FL-14,FL...

A-quasiconvexity at the boundary and weak lower semicontinuity of integral functionals

Czech Academy of Sciences Publication Activity Database

Krämer, J.; Krömer, S.; Kružík, Martin; Pathó, G.

2017-01-01

Roč. 10, č. 1 (2017), s. 49-67 ISSN 1864-8258 R&D Projects: GA ČR GAP201/10/0357 Grant - others:GA ČR(CZ) GAP107/12/0121; GA AV ČR(CZ) CZ01-DE03/2013-2014/DAAD-56269992 Institutional support: RVO:67985556 Keywords : concentrations * oscillations * A-quasiconvexity Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 1.182, year: 2016 Http://library.utia.cas.cz/separaty/2017/MTR/kruzik-0470210.pdf

Astigmatism induced by conventional spherical ablation after PRK and LASIK in myopia with astigmatism < 1.00 D

Directory of Open Access Journals (Sweden)

Christiansen SM

2012-12-01

Full Text Available Steven M Christiansen,1 Mark D Mifflin,1 Jason N Edmonds,1 Rachel G Simpson,2 Majid Moshirfar11John A Moran Eye Center, University of Utah, Salt Lake City, UT, 2The University of Arizona College of Medicine, Phoenix, AZ, USABackground: The purpose of this study was to evaluate surgically-induced astigmatism after spherical ablation in photorefractive keratectomy (PRK and laser-assisted in situ keratomileusis (LASIK for myopia with astigmatism < 1.00 D.Methods: The charts of patients undergoing spherical PRK or LASIK for the correction of myopia with minimal astigmatism of <1.00 D from 2002 to 2012 at the John A Moran Eye Center in Salt Lake City, UT, were retrospectively reviewed. Astigmatism was measured by manifest refraction. The final astigmatic refractive outcome at 6 months postoperatively was compared with the initial refraction by Alpins vector analysis.Results: For PRK, average cylinder increased from 0.39 ± 0.25 (0.00–0.75 preoperatively to 0.55 ± 0.48 (0.00–1.75 postoperatively (P = 0.014, compared with an increase in LASIK eyes from 0.40 ± 0.27 (0.00–0.75 preoperatively to 0.52 ± 0.45 (0.00–2.00 postoperatively (P = 0.041. PRK eyes experienced an absolute value change in cylinder of 0.41 ± 0.32 (0.00–1.50 and LASIK eyes experienced a change of 0.41 ± 0.31 (0.00–1.50, P = 0.955. Mean surgically-induced astigmatism was 0.59 ± 0.35 (0.00–1.70 in PRK eyes, with an increase in surgically-induced astigmatism of 0.44 D for each additional 1.00 D of preoperative cylinder; in LASIK eyes, mean surgically-induced astigmatism was 0.55 ± 0.32 (0.00–1.80, P = 0.482, with an increase in surgically-induced astigmatism of 0.29 D for each 1.00 D of preoperative cylinder.Conclusion: Spherical ablation can induce substantial astigmatism even in eyes with less than one diopter of preoperative astigmatism in both PRK and LASIK. No significant difference in the magnitude of surgically-induced astigmatism was found between eyes

Sensitivity of Quantitative Signal Detection in Regards to Pharmacological Neuroenhancement

Directory of Open Access Journals (Sweden)

Maximilian Gahr

2017-01-01

Full Text Available Pharmacological neuroenhancement (PNE is a form of abuse and has not yet been addressed by methods of pharmacovigilance. In the present study, we tested if quantitative signal detection may be sensitive in regards to PNE. We evaluated the risk of drug abuse and dependence (DAAD related to substances that are known to be used for PNE and divided this group into agents with (methylphenidate and without a known abuse potential outside the field of PNE (atomoxetine, modafinil, acetylcholine esterase inhibitors, and memantine. Reporting odds ratios (RORs were calculated using a case/non-case approach based on global and country-specific drug safety data from the Uppsala Monitoring Centre (UMC. Both control substances (diazepam and lorazepam and methylphenidate were statistically associated with DAAD in all datasets (except methylphenidate in Italy. Modafinil was associated with DAAD in the total dataset (ROR, 2.7 (95% confidence interval (CI, 2.2–3.3, Germany (ROR, 4.6 (95% CI, 1.8–11.5, and the USA (ROR, 2.0 (95% CI, 1.6–2.5. Atomoxetine was associated with DAAD in the total dataset (ROR, 1.3 (95% CI, 1.2–1.5 and in the UK (ROR, 3.3 (95% CI, 1.8–6.1. Apart from memantine, which was associated with DAAD in Germany (ROR, 1.8 (95% CI, 1.0–3.2, no other antidementia drug was associated with DAAD. Quantitative signal detection is suitable to detect agents with a risk for DAAD. Its sensitivity regarding PNE is limited, although atomoxetine and modafinil, which do not have a known abuse potential outside PNE, and no antidementia drugs, whose use in PNE is presumably low, were associated with DAAD in our analysis.

ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available Ca19AnnotatedDec2004aaSeq orf19.2029; Contig19-10139; 79190..80278; RFC5*; DNA replicationn factor C | lead...ing strand elongation mismatch repair ... (ATPase); >1a5t0 2 329 7 339 1e-22 ... gb|EAL00

Structure and energetics of the anisole-Ar-n (n=1, 2, 3) complexes: high-resolution resonant two-photon and threshold ionization experiments, and quantum chemical calculations

Czech Academy of Sciences Publication Activity Database

Mazzoni, F.; Becucci, M.; Řezáč, Jan; Nachtigallová, Dana; Michels, F.; Hobza, Pavel; Müller-Dethlefs, K.

2015-01-01

Roč. 17, č. 19 (2015), s. 12530-12537 ISSN 1463-9076 R&D Projects: GA ČR GBP208/12/G016 Grant - others:GA MŠk(CZ) ED2.1.00/03.0058 Program:ED Institutional support: RVO:61388963 Keywords : intermolecular interactions * noncovalent interactions * van der Waals Subject RIV: CF - Physical ; The oretical Chemistry Impact factor: 4.449, year: 2015

19 CFR 4.70 - Public Health Service requirements.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Public Health Service requirements. 4.70 Section 4... THE TREASURY VESSELS IN FOREIGN AND DOMESTIC TRADES Foreign Clearances § 4.70 Public Health Service... Public Health Service. [T.D. 00-4, 65 FR 2874, Jan. 19, 2000] ...

Risk factors and long-term outcomes of parvovirus B19 infection in kidney transplant patients.

Science.gov (United States)

Baek, Chung Hee; Kim, Hyosang; Yang, Won Seok; Han, Duck Jong; Park, Su-Kil

2017-10-01

Parvovirus B19 is a small, non-enveloped, single-stranded DNA virus with a special affinity for the erythroid progenitor cells of the bone marrow. The first case of parvovirus B19 infection in a kidney transplant recipient (KTR) was reported in 1986. Data on the risk factors and specific clinical characteristics of parvovirus B19 infection remain insufficient. We screened 602 KTRs for parvovirus B19 infection using parvovirus B19 polymerase chain reaction (PCR) from January 1990 to April 2016, and the clinical characteristics of patients with positive results were compared to those of age- and gender-matched patients with negative PCR results. A total of 39 KTRs tested positive for parvovirus B19, and they were compared to 78 age- and gender-matched patients among 563 KTRs who had negative PCR results. In all, 89.7% of positive cases were reported within the first year after kidney transplantation. In multivariate analyses, deceased-donor kidney transplantation (odds ratio [OR] 9.067, 95% confidence interval [CI] 1.668-49.275, P = .011), use of tacrolimus (OR 3.607, 95% CI 1.024-12.706, P = .046), PCR test within 1 year of kidney transplantation (OR 12.456, 95% CI 2.674-58.036, P = .001), and hemoglobin levels (OR 0.559, 95% CI 0.351-0.889, P = .014) showed significant correlations with parvovirus B19 infection. Graft survival did not differ between the two groups during the follow-up period of 111.68 ± 54.54 months (P = .685 by log-rank test). The identification of factors related to positive parvovirus B19 PCR results may promote the early detection of parvovirus B19 infection. Further studies are needed to elucidate the characteristics of parvovirus B19 infection in kidney transplantation. © 2017 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

Verification of the 2.00 WAPPA-B [Waste Package Performance Assessment-B version] code

International Nuclear Information System (INIS)

Tylock, B.; Jansen, G.; Raines, G.E.

1987-07-01

The old version of the Waste Package Performance Assessment (WAPPA) code has been modified into a new code version, 2.00 WAPPA-B. The input files and the results for two benchmarks at repository conditions are fully documented in the appendixes of the EA reference report. The 2.00 WAPPA-B version of the code is suitable for computation of barrier failure due to uniform corrosion; however, an improved sub-version, 2.01 WAPPA-B, is recommended for general use due to minor errors found in 2.00 WAPPA-B during its verification procedures. The input files and input echoes have been modified to include behavior of both radionuclides and elements, but the 2.00 WAPPA-B version of the WAPPA code is not recommended for computation of radionuclide releases. The 2.00 WAPPA-B version computes only mass balances and the initial presence of radionuclides that can be released. Future code development in the 3.00 WAPPA-C version will include radionuclide release computations. 19 refs., 10 figs., 1 tab

The Optimum Feeding Frequency in Growing Korean Rockfish ( Rearing at the Temperature of 15°C and 19°C

Directory of Open Access Journals (Sweden)

Rahman Md Mizanur

2014-09-01

Full Text Available Two feeding trials were conducted to determine the optimum feeding frequency in growing Korean rockfish, (Sebastes schlegeli reared at the temperatures of 15°C and 19°C. Fish averaging 92.2±0.7 g (mean±standard deviation [SD] at 15.0±0.5°C and 100.2±0.4 g (mean±SD at 19.0±0.5°C water temperature were randomly distributed into each of 15 indoor tanks containing 250-L sea water from a semi-recirculation system. A total of five feeding frequency groups were set up in three replicates as follows: one meal in a day at 08:00 hour, two meals a day at 08:00 and 17:00 hours, three meals a day at 08:00, 14:00, and 20:00 hours, four meals a day at 08:00, 12:00, 16:00, and 20:00 hours, and one meal every 2 days at 08:00 hour. Fish were fed at the rate of 1.2% body weight (BW/d at 15°C and 1.5% BW/d at 19°C. At the end of 8 wks of feeding trial weight gain and specific growth rate were significantly higher at the fish fed groups of one meal a day and two meals a day at 15°C and fish fed groups of 1 meal every 2 days at 19°C were significantly lower than those of all other fish fed groups. Glutamic oxaloacetic transaminase and glutamic pyruvic transaminase of fish fed group at 1 meal every 2 days was significantly higher than those of all other fish fed groups in both experiments. Weight gain, specific growth rate and condition factor were gradually decreased as the feeding frequency increased. The results indicate that growing Korean rockfish 92 and 100 g perform better at 15°C than 19°C water temperature. As we expected, current results have indicated that a feeding frequency of 1 meal a day is optimal for the improvement of weight gain in growing Korean rockfish grown from 92 g to 133 g at 15°C and 100 g to 132 g at 19°C water temperature.

Change in a butterfly community on a gradually overgrowing site

Czech Academy of Sciences Publication Activity Database

Kočíková, Lenka; Čanády, A.; Panigaj, L.

2014-01-01

Roč. 45, č. 5 (2014), s. 391-398 ISSN 1067-4136 Grant - others:Slovak Scientific Grant Agency VEGA(SK) 1/0434/03; Slovak Scientific Grant Agency VEGA(SK) 1/0477/10; Slovak Scientific Grant Agency VEGA(SK) 1/1025/12; Internal Research Grants(SK) I-10-001-00-F-VVGS; Internal Research Grants(SK) VVGS-PF-2012-19 Institutional support: RVO:60077344 Keywords : butterflies * monitoring * water pan traps Subject RIV: EH - Ecology, Behaviour Impact factor: 0.390, year: 2014 http://link.springer.com/article/10.1134%2FS1067413614050087

NCBI nr-aa BLAST: CBRC-MMUS-19-0100 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-19-0100 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 0.0 90% ...

Communication from the Restaurants 1 and 2

CERN Multimedia

2006-01-01

Please note that due to the renovation work taking place in Restaurant 1, the 'free-flow' area will be moved to a temporary position at the far end of the restaurant from Thursday 30th November. A marquee will be erected in front of the restaurant to provide an additional seating area during this time. Please also note that Restaurant 1 will be closed from Friday 1st December at 15:00 until the morning of 3rd December. Restaurant 2 will remain open during this period with the following opening times: Friday 1st December: hot meals available from 18:00 - 19:30, closing time 20:00; Saturday 2nd December: Opening time 8:00, hot meals available 12:00 - 14:00 and 18:00 - 19:30, closing time 20:00; Sunday 3rd December: Opening time 9:00, hot meals available 12:00 - 14:00 and 18:00 - 19:30, closing time 20:00. For further details please see http://cern.ch/resto2/DSR/Welcome.html

Communication from the Restaurants 1 and 2

CERN Multimedia

2006-01-01

Please note that due to the renovation work taking place in Restaurant 1, the 'free-flow' area will be moved to a temporary location at the far end of the restaurant from Thursday 30th November. A marquee will be erected in front of the restaurant to provide an additional seating area during this time. Please also note that Restaurant 1 will be closed from Friday 1st December at 15:00 until the morning of 3rd December. Restaurant 2 will remain open during this period with the following opening times: Friday 1st December: hot meals available from 18:00 - 19:30, closing time 20:00. Saturday 2nd December: Opening time 8:00, hot meals available 12:00 - 14:00 and 18:00 - 19:30, closing time 20:00. Sunday 3rd December: Opening time 9:00, hot meals available 12:00 - 14:00 and 18:00 - 19:30, closing time 20:00. For further details please see http://cern.ch/resto2/DSR/Welcome.html

Aplikasi Magnet Berpengikat (Bonded NdFeB untuk S-band Circulator pada Rentang Frekuensi 2,00-4,00 GHz

Directory of Open Access Journals (Sweden)

Tony Kristiantoro

2016-06-01

Full Text Available Circulator merupakan perangkat elektronik yang memiliki fungsi penting pada suatu sistem pemancar dan penerima gelombang frekuensi radio (RF, di mana magnet permanen dapat berfungsi sebagai pengarah gelombang (waveguide. Penelitian ini bertujuan untuk menggantikan magnet permanen barium ferit (BaFe12O19 yang umumnya digunakan pada circulator dengan magnet permanen berpengikat (bonded neodymium besi boron (NdFeB. Bahan baku yang digunakan adalah serbuk NdFeB crashed ribbon dengan menggunakan metode pengepresan green-compact yang divariasikan pada tekanan 25, 50, 75, dan 100 kg.cm-2 dan dilanjutkan proses pemanasan pada temperatur 200 C selama 60 menit. Karakterisasi sifat magnet dilakukan dengan Permagraph, diperoleh nilai intrinsik optimum dari sampel 100 kg.cm-2 , induksi remanen (Br = 5,37 kG, koersifitas (HcJ = 4,74 kOe, produk energi maksimum (BHmax = 2,39 MGOe, dan densitas (ρ = 4,89 gr.cm-3 . Hasil pengukuran kuat medan permukaan (B dengan Gauss-meter menunjukkan nilai 800 G. Magnet dengan karakteristik optimum diterapkan pada circulator kemudian dikarakterisasi dengan Vector Network Analyzer dan menghasilkan voltage standing wave ratio (VSWR = 1,354, isolasi = -17,165 dB dan kerugian penyisipan = -0,200 dB pada titik kerja 3,00 GHz, sehingga magnet berpengikat (bonded NdFeB ini dapat diterapkan pada S-band circulator yang bekerja pada rentang frekuensi 2,00-4,00 GHz.

Unigene BLAST: CBRC-GGAL-19-0006 [SEVENS

Lifescience Database Archive (English)

Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(25,1080) /gb=NM_205409 /gi=45382276 /ug=Gga.786 /len=1507 0.0 100% ... ...CBRC-GGAL-19-0006 gnl|UG|Gga#S19184022 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli

Circadian variations in the clinical presentation of headaches among migraineurs: A study using a smartphone headache diary.

Science.gov (United States)

Park, Jeong-Wook; Cho, Soo-Jin; Park, Sang-Gue; Chu, Min Kyung

2018-04-01

Migraines occur within certain time frames. Nevertheless, information regarding circadian variation in the clinical presentation of migraine is limited. We investigated circadian variations in the clinical presentation of migraine using a smartphone headache diary (SHD). We enrolled adult participants with the diagnosis of migraine according to the third beta edition of the International Classification of Headache Disorders. Participants were asked to log in to the SHD every day for 90 days to record the occurrence of headaches. We compared the occurrence and clinical presentation of headaches during four 6-hour quadrants per day (00:00-05:59, 06:00-11:59, 12:00-17:59, and 18:00-23:59). Migraine-type headache was defined as a headache attack that fulfilled all criteria of migraine, except for the criterion regarding typical headache duration. Eighty-two participants kept a dairy for at least 50% of the study period and recorded 1491 headache attacks. Among the 1491 headache attacks, 474 (31.8%) were classified as migraine-type headaches and 1017 (68.2%) were classified as non-migraine-type headaches. All headaches, migraine-type headaches and non-migraine-type headaches occurred most frequently between 06:00 and 11:59, and least frequently between 18:00 and 23:59, and between 00:00 and 05:59. Migrainous headache characteristics, such as unilateral pain, pulsating quality, severe headache intensity, aggravation by movement, nausea, photophobia, and phonophobia presented most frequently between 06:00 and 11:59, and least frequently between 18:00 and 23:59, and 00:00 and 05:59 among 1491 all headache attacks. Headache clinical presentation as well as headache occurrence exhibited circadian periodicity among migraineurs. SHD: smartphone headache diary; ICHD-3 beta: the third edition beta version of the International Classification of Headache Disorders.

Nuclear reactors situation in Japan after the major earthquake of March 11, 2011. March 19, 2011, 6:00 AM status; Situation des reacteurs nucleaires au Japon suite au seisme majeur survenu le 11 mars 2011. Point de situation du 19 mars 2011 a 06 heures

Energy Technology Data Exchange (ETDEWEB)

NONE

2011-07-01

This situation note is established according to the information gained on March 19, 2011, at 6:00 AM, by the crisis centre of the French institute of radiation protection and nuclear safety (IRSN). The situation of all 6 reactors of the Fukushima I site (Dai-ichi) and of their spent fuel pools, as well as the situation of the reactors No. 1, 2, 3 and 4 of the Fukushima II site (Daini), and of the Onagawa and Tokai power plants is briefly presented with the progress of the accident management actions. (J.S.)

Laser pulse duration dependence of blister formation on back-radiated Ti thin films for BB-LIFT

Czech Academy of Sciences Publication Activity Database

Goodfriend, N. T.; Starinskiy, S.V.; Nerushev, O. A.; Bulgakova, Nadezhda M.; Bulgakov, A.V.; Campbell, E.E.B.

2016-01-01

Roč. 122, č. 3 (2016), s. 1-9, č. článku 154. ISSN 0947-8396 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk LO1602 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027 Institutional support: RVO:68378271 Keywords : mass-spectrometry * nanoparticles * ablation Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.455, year: 2016

45 CFR 63.19 - Budget revisions and minor deviations.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Budget revisions and minor deviations. 63.19 Section 63.19 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION GRANT PROGRAMS... Budget revisions and minor deviations. Pursuant to § 74.102(d) of this title, paragraphs (b)(3) and (b)(4...

Mapping the Binding Site of a Cross-Reactive Plasmodium falciparum PfEMP1 Monoclonal Antibody Inhibitory of ICAM-1 Binding

Czech Academy of Sciences Publication Activity Database

Lennartz, F.; Bengtsson, A.; Olsen, R. W.; Joergensen, L.; Brown, A.; Remy, L.; Man, Petr; Forest, E.; Barfod, L. K.; Adams, Y.; Higgins, M. K.; Jensen, A. T. R.

2015-01-01

Roč. 195, č. 7 (2015), s. 3273-3283 ISSN 0022-1767 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109 Grant - others:OPPC(XE) CZ.2.16/3.1.00/24023 Institutional support: RVO:61388971 Keywords : INTERCELLULAR-ADHESION MOLECULE-1 * SMALL-ANGLE SCATTERING * ERYTHROCYTE-MEMBRANE PROTEIN-1 Subject RIV: CE - Biochemistry Impact factor: 4.985, year: 2015

Hybrid Carbon-Glass Fiber/Toughened Epoxy Thick Composite Joints Subject to Drop-Weight and Ballistic Impacts

National Research Council Canada - National Science Library

Liaw, Benjamin; Delale, Feridun

2007-01-01

... No. DAAD19-02-R-0010 to conduct research on hybrid carbon-S2 glass fiber/toughened epoxy thick-section, hybrid interwoven composite joints subject to drop-weight and ballistic impacts. Dr. Basavaraju B. Raju of U.S...

Deregulated electricity markets with thermal losses and production bounds: models and optimality conditions

Czech Academy of Sciences Publication Activity Database

Aussel, D.; Červinka, Michal; Marechal, M.

2016-01-01

Roč. 50, č. 1 (2016), s. 19-38 ISSN 0399-0559 R&D Projects: GA ČR GAP402/12/1309; GA ČR GA201/09/1957 Institutional support: RVO:67985556 Keywords : Deregulated electricity market * production bounds * mathematical program with complementarity constraints * M-stationarity * calmness Subject RIV: BA - General Mathematics Impact factor: 0.550, year: 2016

Traffic: Special arrangements for the Official Ceremony on 19th October - REMINDER

CERN Document Server

Relations with the Host States Service

2004-01-01

Disruption: Route de Meyrin: probably closed to traffic by the police between 2.00 p.m. and 3.00 p.m. and between 5.00 p.m. and 7.00 p.m. for the arrival and departure of VIPs. Saint-Genis-Pouilly roundabout: access difficult between 2.00 p.m. and 2.30 p.m., when the new entrance to the Meyrin site will be inaugurated. Reception of building 33 : closed from 13h00 to 19h00 ; Car parks prohibited from 16 to 19 October inclusive (Open Day and Official Ceremony): the car parks located between the two lines on the drawing below (guests will register in a tent set up opposite Building 156), a marked out area of the external car park in front of Building 33; the appropriate road signs will be erected. Recommendations for 19 October Do not use Gates A and B from 12.30 p.m. to 3.00 p.m. and from 4.30 p.m. to 7.00 p.m. During these times, please use: Gate C (Satigny): exceptionally open in both directions between 12.30 p.m. and 7.30 p.m. Tunnel linking the Meyrin and Prévessin...

RESTAURANT No. 1

CERN Multimedia

2002-01-01

Customers are kindly requested to note the modified opening times of restaurant no. 1 from Monday, February 4 to Sunday, March 3, 2002 : from Monday to Friday 07h00 - 23h00 Saturday / Sunday 08h00 - 21h00 Hot meals will be served between 11h30 and 14h00, then from 18h00 to 19h30. Restaurant Supervisory Committee, tel. 77551

Tracing the Magnetic Field of IRDC G028.23-00.19 Using NIR Polarimetry

Energy Technology Data Exchange (ETDEWEB)

Hoq, Sadia; Clemens, D. P.; Cashman, Lauren R. [Institute for Astrophysical Research, 725 Commonwealth Ave, Boston University, Boston, MA 02215 (United States); Guzmán, Andrés E., E-mail: shoq@bu.edu, E-mail: clemens@bu.edu, E-mail: lcashman@bu.edu, E-mail: aguzman@das.uchile.cl [Departamento de Astronomía, Universidad de Chile, Camino el Observatorio 1515, Las Condes, Santiago (Chile)

2017-02-20

The importance of the magnetic ( B ) field in the formation of infrared dark clouds (IRDCs) and massive stars is an ongoing topic of investigation. We studied the plane-of-sky B field for one IRDC, G028.23-00.19, to understand the interaction between the field and the cloud. We used near-IR background starlight polarimetry to probe the B field and performed several observational tests to assess the field importance. The polarimetric data, taken with the Mimir instrument, consisted of H -band and K -band observations, totaling 17,160 stellar measurements. We traced the plane-of-sky B -field morphology with respect to the sky-projected cloud elongation. We also found the relationship between the estimated B -field strength and gas volume density, and we computed estimates of the normalized mass-to-magnetic flux ratio. The B -field orientation with respect to the cloud did not show a preferred alignment, but it did exhibit a large-scale pattern. The plane-of-sky B -field strengths ranged from 10 to 165 μ G, and the B -field strength dependence on density followed a power law with an index consistent with 2/3. The mass-to-magnetic flux ratio also increased as a function of density. The relative orientations and relationship between the B field and density imply that the B field was not dynamically important in the formation of the IRDC. The increase in mass-to-flux ratio as a function of density, though, indicates a dynamically important B field. Therefore, it is unclear whether the B field influenced the formation of G28.23. However, it is likely that the presence of the IRDC changed the local B -field morphology.

Surface modification of ZnAl{sub 1.9}Eu{sub 0.05}O{sub 4} aiming to obtaining ZnAl{sub 1.9}Eu{sub 0.05}O{sub 4}/SiO{sub 2} hybrid for use as a biosensor; Modificacao da superficie do ZnAl{sub 1.9}Eu{sub 0.05}O{sub 4} visando a obtencao do hibrido ZnAl{sub 1.9}Eu{sub 0.05}O{sub 4}/SiO{sub 2} para aplicacao como biossensor

Energy Technology Data Exchange (ETDEWEB)

Araujo, P.M.A.G.; Santos, P.T.A.; Costa, A.C.F.M., E-mail: pascally.guerra@gmail.com, E-mail: polyanaquimica@yahoo.com.br, E-mail: ana.costa@ufcg.edu.br [Universidade Federal de Campina Grande (UFCG), PB (Brazil); Junior, S.A.; Viana, R. S., E-mail: salvesjr@ufpe.br, E-mail: rodrigosilva.viana@yahoo.com.br [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil)

2017-01-15

This study aimed to investigate the influence of surface modification of ZnAl{sub 1.9}Eu{sub 0.05}O{sub 4} nanoparticles for obtaining hybrid ZnAl{sub 1.9}Eu{sub 0.05}O{sub 4}/SiO{sub 2} for application as a biosensor. Initially ZnAl{sub 1.9}Eu{sub 0.05}O{sub 4} nanoparticles were synthesized by combustion reaction and, subsequently, their surfaces were modified with silane agent. The samples were characterized by X-ray diffraction, scanning electron microscopy (SEM), Fourier transform infrared (FTIR) spectroscopy, and excitation and emission spectroscopy. The results showed formation of ZnAl{sub 2}O{sub 4} as the major phase. By SEM, hard agglomerates, irregularly shaped in the form of plaques, with the presence of few irregular and variables pores were observed. The surface modification was confirmed by FTIR through the silanol and siloxane groups. The excitation and emission spectra revealed the presence of a broadband of ZnAl{sub 2} O{sub 4} matrix, and fine and intense transitions from europium ion arising from doping of non-stoichiometric ZnAl{sub 2}O{sub 4} with the europium. From the results of emission and excitation, it was observed that the luminescence of ZnAl{sub 1.9}Eu{sub 0.05}O{sub 4}/SiO{sub 2} hybrid presented a small decrease in relation to the ZnAl{sub 1.9}Eu0.0{sub 5}O{sub 4} nanoparticles. This decrease was almost insignificant in relation to the benefits of silanization caused by the introduction of functional groups that promote combination of hybrid ZnAl{sub 1.9}Eu{sub 0.05}O{sub 4}/SiO{sub 2} with biomolecules, being this promising for application as a biosensor used in the biomedical field for the diagnosis and treatment of diseases. (author)

Gene : CBRC-PMAR-01-0559 [SEVENS

Lifescience Database Archive (English)

Full Text Available 9 /gi=114310048 /ug=Pma.7703 /len=689 1e-04 33% MSTSLLDFCMCWCGLSPLACLLHVFLCPNLHLPVCFTCLYGLSPLVCLLHVSLWPISTCL...PASRVSMAYLHLPACFTCLYGLSPLACLLHVFLWPISTCLPASRVSMAYLHLPACFTCLYGLISTCLPASRVSMAYLHLPACFTCLYGLSPLVCLLHVSLWPISTC...LPASRVSMSYLHLSACFTCLYGLISTCLPASRVSMGYLHLPACFTCLYCLIFTCLPASRVSMACLHLSACLPHLSV ...

Identification of a mutation in ADD1/SREBP-1 in the spontaneously hypertensive rat

Czech Academy of Sciences Publication Activity Database

Pravenec, Michal; Jansa, Petr; Kostka, Vlastimil; Zídek, Václav; Křen, Vladimír; Forejt, Jiří; Kurtz, T. W.

2001-01-01

Roč. 12, č. 4 (2001), s. 295-298 ISSN 0938-8990 R&D Projects: GA ČR(CZ) GA305/00/1646; GA MŠk(CZ) LN00A079; GA ČR(CZ) GV204/98/K015 Grant - others:HHMI(US) 55000331 Institutional research plan: CEZ:AV0Z5011922 Keywords : mutations in genes * ADD1/SREBP-1c * spontaneously hypertensive rat Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.318, year: 2001

Arts@CERN | ACCELERATE Austria | 19 May | IdeaSquare

CERN Multimedia

2016-01-01

​Arts@CERN welcomes you to a talk by architects Sandra Manninger and Matias Del Campo, at IdeaSquare (Point 1) on May 19 at 6:00 p.m.   Sensible Bodies - architecture, data, and desire. Sandra and Matias are the winning architects for ACCELERATE Austria. Focusing on the notion of geometry, they are at CERN during the month of May, as artists in residence. Their research highlights how to go beyond beautiful data to discover something that could be defined voluptuous data. This coagulation of numbers, algorithms, procedures and programs uses the forces of thriving nature and, passing through the calculation of a multi-core processor, knits them with human desire. Read more. ACCELERATE Austria is supported by The Department of Arts of the Federal Chancellery of Austria. Thursday, May 19 at 6:00 p.m. at IdeaSquare.  See event on Indico. 

34 CFR 461.1 - What is the Adult Education State-administered Basic Grant Program?

Science.gov (United States)

2010-07-01

... 34 Education 3 2010-07-01 2010-07-01 false What is the Adult Education State-administered Basic...-ADMINISTERED BASIC GRANT PROGRAM General § 461.1 What is the Adult Education State-administered Basic Grant Program? The Adult Education State-administered basic Grant Program (the program) is a cooperative effort...

17 CFR 19.00 - General provisions.

Science.gov (United States)

2010-04-01

... and derivation of such conversion factors. (Approved by the Office of Management and Budget under... to the following: (1) Excluding products or byproducts of the cash commodity hedged. If the regular... cash positions for bona fide hedging (as defined in § 1.3(z) of this chapter), the same shall be...

76 FR 62455 - Announcement of Updated Funding Availability for H-1B Technical Skills Training Grants

Science.gov (United States)

2011-10-07

... 10-13] Announcement of Updated Funding Availability for H-1B Technical Skills Training Grants AGENCY... the availability of $240 million for the H-1B Technical Skills Training Grants to be awarded through a... additional applicants to apply for the H-1B Technical Skills Training Grants competition that will close on...

Properties of surface plasmon polaritons on lossy materials: lifetimes, periods and excitation conditions

Czech Academy of Sciences Publication Activity Database

Derrien, Thibault; Krüger, J.; Bonse, J.

2016-01-01

Roč. 18, č. 11 (2016), 1-9, č. článku 115007. ISSN 2040-8978 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk LO1602 EU Projects: European Commission(XE) 657424 - QuantumLaP Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027 Institutional support: RVO:68378271 Keywords : electromagnetic-waves * optical-properties * dispersion * metals * media * Al * metamaterials * enhancement * generation * constants Subject RIV: BH - Optics , Masers, Lasers Impact factor: 1.741, year: 2016

31 CFR 19.705 - What does the suspending official consider in issuing a suspension?

Science.gov (United States)

2010-07-01

... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false What does the suspending official consider in issuing a suspension? 19.705 Section 19.705 Money and Finance: Treasury Office of the Secretary... may examine the basic documents, including grants, cooperative agreements, loan authorizations...

19 CFR 10.46 - Articles for the United States.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles for the United States. 10.46 Section 10... THE TREASURY ARTICLES CONDITIONALLY FREE, SUBJECT TO A REDUCED RATE, ETC. General Provisions Articles for Institutions § 10.46 Articles for the United States. Pursuant to subheadings 9808.00.10 and 9808...

Dual ferroic properties of hexagonal ferrite ceramics BaFe_1_2O_1_9 and SrFe_1_2O_1_9

International Nuclear Information System (INIS)

Kostishyn, V.G.; Panina, L.V.; Timofeev, A.V.; Kozhitov, L.V.; Kovalev, A.N.; Zyuzin, A.K.

2016-01-01

Dual ferroic properties of a strong magnetism and large ferroelectricity have been observed in barium BaFe_1_2O_1_9 and strontium SrFe_1_2O_1_9 hexaferrite ceramics. The samples were fabricated by a modified ceramic technique from highly purified raw materials with addition of boron oxide allowing the control of grain size and enhancement of bulk resistivity. Whereas the samples of PbFe_1_2O_1_9 fabricated by the same technological method did not have sufficient electric resistivity to support an electric field and did not exhibit the ferroelectric properties. The structure of the samples examined by X-ray diffraction is consistent with a single hexagonal phase. The grains are randomly oriented with the average grain size of 300–400 nm coated with boron oxide. The magnetic properties are characterised by standard ferrimagnetic behavior with the Neel temperature of about 450 °C. Large spontaneous polarization was observed with the maximal values of 45–50 μC/cm"2 under an applied electric field of 100–300 kV/m. A strong coupling between magnetic and electric ordering was confirmed by measuring the magnetoelectric (ME) parameter and magnetodielectric ratio. These ME characteristics are more advanced than those for well-known room temperature multiferroic BiFeO_3. Furthermore, by applying an electric field, the manipulation of magnetization in the range of up to 9% was observed, which is even greater than in some substituted hexaferrites with a non-collinear magnetic structure. The obtained results on electrical polarization are similar to the values reported for the corresponding hexaferrites sintered by polymer precursor technique. This suggests a promising potential of M-type hexaferrite ceramics in devices utilizing magnetoelectric coupling. - Highlights: • Ba(Sr)Fe_1_2O_1_9-hexaferrites show large room-temperature multiferroic properties. • Small addition of B_2O_3 increases the hexaferrite resistivity by 4 orders of magnitude. • Large spontaneous

Chemo-enzymatic synthesis of poly-N-acetyllactosamine (poly-LacNAc) structures and their characterization for CGL2-galectin-mediated binding of ECM glycoproteins to biomaterial surfaces

Czech Academy of Sciences Publication Activity Database

Sauerzapfe, B.; Křenek, Karel; Schmiedel, J.; Wakarchuk, W.W.; Pelantová, Helena; Křen, Vladimír; Elling, L.

2009-01-01

Roč. 26, č. 2 (2009), s. 141-159 ISSN 0282-0080 R&D Projects: GA AV ČR IAA400200503; GA MŠk(CZ) LC06010 Grant - others:CZ(CZ) DAAD-AV ČR projekt PPP-D7-CZ 26/04-05D/03/44448 Institutional research plan: CEZ:AV0Z50200510 Keywords : chemo-enzymatic sysnthesis * galectin binding * biomaterials Subject RIV: EE - Microbiology, Virology Impact factor: 2.500, year: 2009

Incommensurateness in nanotwinning models of modulated martensites

Czech Academy of Sciences Publication Activity Database

Benešová, B.; Frost, Miroslav; Kampschulte, M.; Melcher, C.; Sedlák, Petr; Seiner, Hanuš

2015-01-01

Roč. 92, č. 18 (2015), s. 180101-180101 ISSN 1098-0121 R&D Projects: GA ČR GA14-15264S; GA ČR(CZ) GP14-28306P Grant - others:AV ČR(CZ) DAAD/14/11 Institutional support: RVO:61388998 Keywords : nanotwinning * incommensurateness * intermartensitic transitions Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.736, year: 2014 http://journals.aps.org/prb/abstract/10.1103/PhysRevB.92.180101

The effect of Ni-doping on the magnetic order in the cubic GdIn(Cu{sub 1-x}Ni{sub x})4 (0.00 < x < 1.00) compounds

Energy Technology Data Exchange (ETDEWEB)

Mendonca, Edielma Costa; Silva, Leonardo Souza; Mercena, Samuel Gomes; Peixoto, Erilaine Barreto; Meneses, Cristiano Teles de, E-mail: edielmacm@gmail.com [Universidade Federal de Sergipe (UFS), Aracaju, SE (Brazil); Duque, Jose Gerivaldo; Jesus, Camilo Bruno Ramos; Pagliuso, Pascoal G. [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Instituto de Fisica Gleb Wataghin

2016-07-01

Full text: In this work, we report on X-ray, magnetization, heat capacity and electron spin resonance measurements in GdIn(Ni{sub x}Cu{sub 1-x}){sub 4} (0.00 < x < 1.00) samples synthesized via flux method. The analysis of X-ray powder diffraction data carried out at room temperature reveal that all samples belong to cubic space group (Cl5b-type structure) with lattice parameters ranging 7.087 < a < 7.233 Å. Interestingly, the T-dependence of magnetic susceptibility and the MvsH loops indicate an gradual transition from antiferromagnetic to ferromagnetic as function the Ni-doping. Specific heat for samples with concentrations x = 0 (Cu-rich) and x = 0.70 and 0.90 (Ni-rich) confirm the order temperatures observed in MvsT data. Finally, electron spin resonance taken in 10 < T < 60 K for two intermediate concentrations x = 0.5 and 0.65 shows a single resonance of Dysonian with a nearly temperature g-independent and a linear thermal broadening of the linewidth following a Korringa-like behavior. In both cases, we observe an increasing of the residual linewidth as compared with GdInCu{sub 4}. We suggest that this can be linked with the chemical disorder produced by the Ni-doping. (author)

Stem cell markers (cytokeratin 17 and cytokeratin 19 in scarring and nonscarring alopecia

Directory of Open Access Journals (Sweden)

Dalia El Sakka

2016-01-01

Full Text Available Background: Alopecia is one of the most important hair follicle (HF disorders, which is divided into scarring (cicatricial and nonscarring (noncicatricial types. Objective: The aim of this study is to investigate the expression of stem cell (SC markers such as cytokeratin (CK 17 and CK19 in scarring and nonscarring alopecia. Materials and Methods: Thirty patients with scalp alopecia (15 with scarring alopecia and 15 without together with ten healthy volunteers were included in this study. Biopsies were taken from all participants and stained for CK17 and CK19 using immunohistochemistry. Results: There was a statistically significant difference between the nonscarring group and the control group with regard to CK17 expression in the outer layers of the HFs (P = 0.00 and CK19 staining of the inner layers of the HFs (P = 0.008. There was a statistically significant difference between the scarring and the control groups regarding CK17 expression in the outer (P = 0.00 and the inner layers (P = 0.00 of the HFs and CK19 expression in the inner layers of the HFs (P = 0.00. CK17 expression in the outer layers (P = 0.02 and the inner layers of the HFs (P = 0.00 together with CK19 expression in the inner layers of the HFs (P = 0.00 showed statistically significant differences between scarring and nonscarring alopecia groups. Conclusions: The presence of SC markers (CK17 and CK19 in the HFs was affected in both scarring and nonscarring alopecia, but the defect in scarring alopecia is more evident than that of nonscarring alopecia. The persistence of SC markers in some types of scarring alopecia could give a hope for the recovery of these lesions. Further studies are recommended to clarify the benefit from using HF SCs in the treatment of alopecia.

Stem Cell Markers (Cytokeratin 17 and Cytokeratin 19) in Scarring and Nonscarring Alopecia

Science.gov (United States)

El Sakka, Dalia; Gaber, Mohamed Abdel Wahed; Abdou, Asmaa Gaber; Wahed, Moshira Abdel; Saleh, Ahmed Abdel-Wahab; Shehata, Walla

2016-01-01

Background: Alopecia is one of the most important hair follicle (HF) disorders, which is divided into scarring (cicatricial) and nonscarring (noncicatricial) types. Objective: The aim of this study is to investigate the expression of stem cell (SC) markers such as cytokeratin (CK) 17 and CK19 in scarring and nonscarring alopecia. Materials and Methods: Thirty patients with scalp alopecia (15 with scarring alopecia and 15 without) together with ten healthy volunteers were included in this study. Biopsies were taken from all participants and stained for CK17 and CK19 using immunohistochemistry. Results: There was a statistically significant difference between the nonscarring group and the control group with regard to CK17 expression in the outer layers of the HFs (P = 0.00) and CK19 staining of the inner layers of the HFs (P = 0.008). There was a statistically significant difference between the scarring and the control groups regarding CK17 expression in the outer (P = 0.00) and the inner layers (P = 0.00) of the HFs and CK19 expression in the inner layers of the HFs (P = 0.00). CK17 expression in the outer layers (P = 0.02) and the inner layers of the HFs (P = 0.00) together with CK19 expression in the inner layers of the HFs (P = 0.00) showed statistically significant differences between scarring and nonscarring alopecia groups. Conclusions: The presence of SC markers (CK17 and CK19) in the HFs was affected in both scarring and nonscarring alopecia, but the defect in scarring alopecia is more evident than that of nonscarring alopecia. The persistence of SC markers in some types of scarring alopecia could give a hope for the recovery of these lesions. Further studies are recommended to clarify the benefit from using HF SCs in the treatment of alopecia. PMID:27761086

MicroRNA-19b associates with Ago2 in the amygdala following chronic stress and regulates the adrenergic receptor beta 1.

Science.gov (United States)

Volk, Naama; Paul, Evan D; Haramati, Sharon; Eitan, Chen; Fields, Brandon K K; Zwang, Raaya; Gil, Shosh; Lowry, Christopher A; Chen, Alon

2014-11-05

Activation of the stress response in the presence of diverse challenges requires numerous adaptive molecular and cellular changes. To identify specific microRNA molecules that are altered following chronic stress, mice were subjected to the chronic social defeat procedure. The amygdala from these mice was collected and a screen for microRNAs that were recruited to the RNA-induced silencing complex and differentially expressed between the stressed and unstressed mice was conducted. One of the microRNAs that were significantly altered was microRNA-19b (miR-19b). Bioinformatics analysis revealed the adrenergic receptor β-1 (Adrb1) as a potential target for this microRNA with multiple conserved seed sites. Consistent with its putative regulation by miR-19b, Adrb1 levels were reduced in the basolateral amygdala (BLA) following chronic stress. In vitro studies using luciferase assays showed a direct effect of miR-19b on Adrb1 levels, which were not evident when miR-19b seed sequences at the Adrb1 transcript were mutated. To assess the role of miR-19b in memory stabilization, previously attributed to BLA-Adrb1, we constructed lentiviruses designed to overexpress or knockdown miR-19b. Interestingly, adult mice injected bilaterally with miR-19b into the BLA showed lower freezing time relative to control in the cue fear conditioning test, and deregulation of noradrenergic circuits, consistent with downregulation of Adrb1 levels. Knockdown of endogenous BLA-miR-19b levels resulted in opposite behavioral and noradrenergic profile with higher freezing time and increase 3-methoxy-4-hydroxyphenylglycol/noradrenaline ratio. These findings suggest a key role for miR-19b in modulating behavioral responses to chronic stress and Adrb1 as an important target of miR-19b in stress-linked brain regions. Copyright © 2014 the authors 0270-6474/14/3415070-13$15.00/0.

Unsichtbar. Meditation zum Lukasevangelium 19,1-10

DEFF Research Database (Denmark)

Nielsen, Kirsten Busch

2008-01-01

En meditation over Lukasevangeliet 19,1-10 (Zakæus) med temaet usynlighed som omdrejningspunkt. Udgivelsesdato: 2007......En meditation over Lukasevangeliet 19,1-10 (Zakæus) med temaet usynlighed som omdrejningspunkt. Udgivelsesdato: 2007...

Molecular Rods Combining o-Carborane and Bicyclo[1.1.1]pentane Cages: An Insertion of the Triple Bond Located Next to a Highly Strained Cage

Czech Academy of Sciences Publication Activity Database

Kaleta, Jiří; Janoušek, Zbyněk; Nečas, M.; Mazal, C.

2015-01-01

Roč. 34, č. 5 (2015), s. 967-972 ISSN 0276-7333 Grant - others:GA MŠk(CZ) ED1.1.00/02.0068 Program:ED Institutional support: RVO:61388963 Keywords : dehydrogenative alkyne-insertion * dicobalt octacarbonyl * polyborane reactions Subject RIV: CC - Organic Chemistry Impact factor: 4.186, year: 2015

Structural properties and superconductivity of SrFe2As2-xPx (0.0 ≤ x ≤ 1.0) and CaFe2As2-yPy (0.0 ≤ y ≤ 0.3)

International Nuclear Information System (INIS)

Shi, H L; Yang, H X; Tian, H F; Lu, J B; Wang, Z W; Qin, Y B; Song, Y J; Li, J Q

2010-01-01

The SrFe 2 As 2-x P x (0.0 ≤ x ≤ 1.0) and CaFe 2 As 2-y P y (0.0 ≤ y ≤ 0.3) materials were prepared by a solid-state reaction method. X-ray diffraction measurements indicate that the single-phase samples can be successfully obtained for SrFe 2 As 2-x P x (0.0 ≤ x ≤ 0.8) and CaFe 2 As 2-y P y (0.0 ≤ y ≤ 0.3). Visible contraction of the lattice parameters is determined due to the relatively smaller radius of P ions in comparison with that of As. The spin-density-wave (SDW) instability associated with the tetragonal to orthorhombic phase transition is suppressed noticeably in both systems following the increase in P content. The highest superconducting transitions are observed at about 27 K in SrFe 2 As 1.3 P 0.7 and at about 13 K in CaFe 2 As 1.925 P 0.075 , respectively. Structural analysis suggests that lattice contraction could notably affect the superconductivity in these materials.

The effect of lactate unit number in compounds with azo group in the molecular core

Czech Academy of Sciences Publication Activity Database

Novotná, Vladimíra; Hamplová, Věra; Kašpar, Miroslav; Podoliak, Natalia; Bubnov, Alexej; Glogarová, Milada; Nonnenmacher, D.; Giesselmann, F.

2011-01-01

Roč. 38, č. 5 (2011), s. 649-655 ISSN 0267-8292 R&D Projects: GA AV ČR IAA100100911; GA AV ČR(CZ) GA202/09/0047; GA ČR(CZ) GAP204/11/0723 Grant - others:RFASI(RU) 02.740.11.5166; Společný projekt AV ČR-DAAD SNR(CZ) D4-CZ5/2010-2011; GA UK(CZ) SVV-2011-263303 Institutional research plan: CEZ:AV0Z10100520 Keywords : liquid crystals * ferroelectricity * chirality * azo group * antiferroelectricity Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.858, year: 2011 http://dx.doi.org/10.1080/02678292.2011.565426

Thin disk amplifier-based 40 mJ, 1 kHz, picosecond laser at 515 nm

Czech Academy of Sciences Publication Activity Database

Novák, Jakub; Green, Jonathan T.; Metzger, T.; Mazanec, Tomáš; Himmel, Bedřich; Horáček, Martin; Hubka, Zbyněk; Boge, Robert; Antipenkov, Roman; Batysta, František; Naylon, Jack A.; Bakule, Pavel; Rus, Bedřich

2016-01-01

Roč. 24, č. 6 (2016), s. 5728-5733 ISSN 1094-4087 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE.2.3.20.0091 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; OP VK 1 Laser Sys(XE) CZ.1.07/2.3.00/20.0091 Institutional support: RVO:68378271 Keywords : laser amplifiers * laser s * pulsed * laser s * diode -pumped * laser s * frequency doubled * ultrafast laser s Subject RIV: BH - Optics, Masers, Laser s Impact factor: 3.307, year: 2016

RESTAURANT No. 1 (building 501 - Meyrin site)

CERN Multimedia

2005-01-01

Opening times in January - February 2005 Customers are kindly requested to note the modified opening times of restaurant no. 1 and the adjoining newspaper stand from Monday 3 January to Sunday 27 February 2005: Kiosque from Monday to Friday 07:30 - 17:00 Restaurant from Monday to Friday 07:00 - 23:00 Saturday / Sunday 08:00 - 21:00 Hot meals will be served between 11:30 and 14:00, then from 18:00 to 19:30.

RESTAURANT No. 1 (building 501 - Meyrin site)

CERN Multimedia

2004-01-01

Opening times in January - February 2005 Customers are kindly requested to note the modified opening times of restaurant no. 1 and the adjoining newspaper stand from Monday 3 January to Sunday 27 February 2005: Kiosque from Monday to Friday 07:30 - 17:00 Restaurant from Monday to Friday 07:00 - 23:00 Saturday / Sunday 08:00 - 21:00 Hot meals will be served between 11:30 and 14:00, then from 18:00 to 19:30.

>RESTAURANT Nr 1 (building 501 - Meyrin site)

CERN Multimedia

2004-01-01

Customers are kindly requested to note the modified opening times of restaurant nr. 1 and the adjoining newspaper stand from Monday, January 5 to Sunday February 29, 2004: - Kiosque from Monday to Friday 07:30 - 17:00 hrs - Restaurant from Monday to Friday Saturday / Sunday 07:00 - 23:00 hrs08:00 - 21:00 hrs Hot meals will be served between 11:30 and 14:00 hrs, then from 18:00 to 19:30 hrs. Restaurant Supervisory Committee

37 CFR 1.19 - Document supply fees.

Science.gov (United States)

2010-07-01

... unless the original document is in color, a color copy is requested and the fee for a color copy is paid... portion of a patent application publication or patent, including a design patent, statutory invention....g., facsimile, electronic mail)—$3.00 (2) Printed copy of a plant patent in color: $15.00. (3) Color...

Prevention of heterotopic bone formation with early post operative irradiation in high risk patients undergoing total hip arthroplasty: comparison of 10.00 Gy vs 20.00 Gy schedules

International Nuclear Information System (INIS)

Anthony, P.; Keys, H.; Evarts, C.M.; Rubin, P.; Lush, C.

1987-01-01

Prior studies have demonstrated the effectiveness of postoperative radiation therapy (RT) to the hip area following total hip replacement (THR) surgery in preventing the development of heterotopic bone formation in patients considered to be at high risk for development of this complication. Previously, patients received 20.00 Gy in 10 fractions (fx) over 2 weeks, beginning as soon postop as medically feasible (usually post-op day 2). In an effort to reduce hospital stay and risk of secondary malignancy, a prospective treatment program was initiated April 1982 using a reduced dose of 10.00 Gy in 5 fx over 5-7 days. As of February 1984, 46 consecutive hips determined to be at high risk were treated with this reduced dose. Prior studies have demonstrated that heterotopic bone is always radiographically evident by 8 weeks. Of the 46 hips, 41 had been evaluated with the minimum required 8 week follow-up X ray. Twenty-five of these hips, 61%, had a mean long term follow-up of 12 months. It historical control group, consisting of 54 consecutive high risk post-THR's, was shown to have a 68.5% incidence of heterotopic bone. The 20.00 Gy group, when RT was started by post-op day 5, demonstrated a 3.2% incidence, compared to 4.9% in the 10.00 Gy group. Complication rates were also comparable in the two RT groups, 19.4% and 7.3% respectively; 10.00 Gy is apparently as effective as 20.00 Gy in preventing heterotopic bone formation in high risk post-THR patients

Phytosterols from Dombeya torrida (J. F. Gmel.) S.N. NDWIGAH1 ...

African Journals Online (AJOL)

NDWIGA

2006-08-03

ol, β- sitosterol, stigmasterol and taraxerol. This is the first report of the isolation of these compounds from D. torrida. ACKNOWLEDGEMENTS. The authors are grateful to Deutsch. Academischer Auslader-Dienst (DAAD) for.

49 CFR 1242.30 - Dismantling retired road property and depreciation (accounts XX-17-39, XX-18-39, XX-19-39, 62-17...

Science.gov (United States)

2010-10-01

... 49 Transportation 9 2010-10-01 2010-10-01 false Dismantling retired road property and depreciation (accounts XX-17-39, XX-18-39, XX-19-39, 62-17-00, 62-18-00, and 62-19-00). 1242.30 Section 1242.30....30 Dismantling retired road property and depreciation (accounts XX-17-39, XX-18-39, XX-19-39, 62-17...

Intrinsically disordered proteins drive enamel formation via an evolutionarily conserved self-assembly motif

Czech Academy of Sciences Publication Activity Database

Wald, Tomáš; Špoutil, František; Osičková, Adriana; Procházková, Michaela; Benada, Oldřich; Kašpárek, Petr; Bumba, Ladislav; Klein, O. D.; Sedláček, Radislav; Šebo, Peter; Procházka, Jan; Osička, Radim

2017-01-01

Roč. 114, č. 9 (2017), s. 1641-1650 ISSN 0027-8424 R&D Projects: GA MŠk(CZ) LM2015064; GA MŠk(CZ) LQ1604; GA MŠk(CZ) LM2011032; GA MŠk(CZ) LM2015040; GA MŠk(CZ) LO1509; GA MŠk(CZ) ED1.1.00/02.0109; GA MŠk ED2.1.00/19.0395 Grant - others:Ministerstvo pro místní rozvoj(CZ) CZ2.16/3.1.00/24023 Institutional support: RVO:61388971 ; RVO:68378050 Keywords : ameloblastin * amelogenin * biomineralization Subject RIV: EE - Microbiology, Virology; EB - Genetics ; Molecular Biology (UMG-J) OBOR OECD: Microbiology; Microbiology (UMG-J) Impact factor: 9.661, year: 2016

Halogen bond tunability II: the varying roles of electrostatic and dispersion contributions to attraction in halogen bonds

Czech Academy of Sciences Publication Activity Database

Riley, Kevin Eugene; Murray, J. S.; Fanfrlík, Jindřich; Řezáč, Jan; Solá, R. J.; Concha, M. C.; Ramos, F. M.; Politzer, P.

2013-01-01

Roč. 19, č. 11 (2013), s. 4651-4659 ISSN 1610-2940 R&D Projects: GA ČR GBP208/12/G016 Grant - others:Operational Program Research and Development for Innovations(XE) CZ.1.05/2.1.00/03.0058 Institutional support: RVO:61388963 Keywords : dispersion * electrostatics * halogen bonding * noncovalent interactions Subject RIV: CE - Biochemistry Impact factor: 1.867, year: 2013

Isolation and characterization of cyp19a1a and cyp19a1b promoters in the protogynous hermaphrodite orange-spotted grouper (Epinephelus coioides).

Science.gov (United States)

Zhang, Weimin; Lu, Huijie; Jiang, Haiyan; Li, Mu; Zhang, Shen; Liu, Qiongyou; Zhang, Lihong

2012-02-01

Aromatase (CYP19A1) catalyzes the conversion of androgens to estrogens. In teleosts, duplicated copies of cyp19a1 genes, namely cyp19a1a and cyp19a1b, were identified, however, the transcriptional regulation of these two genes remains poorly understood. In the present study, the 5'-flanking regions of the orange-spotted grouper cyp19a1a (gcyp19a1a) and cyp19a1b (gcyp19a1b) genes were isolated and characterized. The proximal promoter regions of both genes were relatively conserved when compared to those of the other teleosts. Notably, a conserved FOXO transcriptional factor binding site was firstly reported in the proximal promoter of gcyp19a1a, and deletion of the region (-112 to -60) containing this site significantly decreased the promoter activities. The deletion of the region (-246 to -112) containing the two conserved FTZ-F1 sites also dramatically decreased the transcriptional activities of gcyp19a1a promoter, and both two FTZ-F1 sites were shown to be stimulatory cis-acting elements. A FTZ-F1 homologue isolated from ricefield eel (eFTZ-F1) up-regulated gcyp19a1a promoter activities possibly via the FTZ-F1 sites, however, a previously identified orange-spotted grouper FTZ-F1 homologue (gFTZ-F1) did not activate the transcription of gcyp19a1a promoter unexpectedly. As to gcyp19a1b promoter, all the deletion constructs did not show good promoter activities in either TM4 or U251-MG cells. Estradiol (100nM) up-regulated gcyp19a1b promoter activities by about 13- and 36-fold in TM4 and U251-MG cells, respectively, via the conserved ERE motif, but did not stimulate gcyp19a1a promoter activities. These results are helpful to further elucidate the regulatory mechanisms of cyp19a1a and cyp19a1b expression in the orange-spotted grouper as well as other teleosts. Copyright © 2011 Elsevier Inc. All rights reserved.

RESTAURANT Nr 1 (building 501 - Meyrin site)

CERN Multimedia

2003-01-01

OPENING TIMES in JANUARY-FEBRUARY 2004 Customers are kindly requested to note the modified opening times of restaurant nr. 1 and the adjoining newspaper stand from Monday, January 5 to Sunday February 29, 2004: Kiosquefrom Monday to Friday07:30 - 17:00 hrs Restaurant from Monday to FridaySaturday / Sunday 07:00 - 23:00 hrs08:00 - 21:00 hrs Hot meals will be served between 11:30 and 14:00 hrs, then from 18:00 to 19:30 hrs. Restaurant Supervisory Committee

NCBI nr-aa BLAST: CBRC-MMUS-19-0098 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-19-0098 ref|NP_036871.2| adrenergic receptor, alpha 2a [Rattus norvegicus...] sp|P22909|ADA2A_RAT Alpha-2A adrenergic receptor (Alpha-2A adrenoceptor) (Alpha-2A adrenoreceptor) (Alpha-...2AAR) (CA2-47) (Alpha-2D adrenergic receptor) gb|AAC24959.1| alpha2D adrenergic receptor [Rattus norvegicus] NP_036871.2 0.0 97% ...

Subcellular localization of Arabidopsis pathogenesis-related 1 (PR1) protein

Czech Academy of Sciences Publication Activity Database

Pečenková, Tamara; Pleskot, Roman; Žárský, V.

2017-01-01

Roč. 18, č. 4 (2017), č. článku 825. E-ISSN 1422-0067 R&D Projects: GA ČR(CZ) GA15-14886S Grant - others:OPPK(XE) CZ.2.16/3.1.00/21519 Institutional support: RVO:61389030 Keywords : cape * mvb * pi(3)p * pr1 * Secretion * Trafficking Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Cell biology Impact factor: 3.226, year: 2016

Traffic - Special arrangements for the official ceremony on 19th October

CERN Multimedia

Relations with the Host States Service

2004-01-01

The official ceremony marking CERN's fiftieth anniversary will take place on 19th October 2004 in the presence of Member State delegations and observers. Many VIPs are to attend the ceremony, which will be held in the Globe of Science and Innovation and in the adjacent marquee. The arrival and departure of the official delegations and guests will cause some disruption to traffic on and around the Meyrin site: The Route de Meyrin will probably be closed to traffic by the police between 2.00 p.m. and 3.00 p.m. and between 5.00 p.m. and 7.00 p.m. for the arrival and departure of VIPs. Access to the Saint-Genis-Pouilly roundabout will be difficult between 2.00 p.m. and 2.30 p.m., when the new entrance to the Meyrin site will be inaugurated. Use of the following car parks will be prohibited from 16th to 19th October inclusive (Open day and official ceremony; the appropriate road signs will be erected): the car parks located between the two lines on the drawing below (guests will register in a tent set up oppo...

46 CFR 78.19-1 - Use of auto pilot.

Science.gov (United States)

2010-10-01

... 46 Shipping 3 2010-10-01 2010-10-01 false Use of auto pilot. 78.19-1 Section 78.19-1 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PASSENGER VESSELS OPERATIONS Auto Pilot § 78.19-1 Use of auto pilot. Except as provided in 33 CFR 164.15, when the automatic pilot is used in— (a...

19 CFR 10.57 - Certified seed potatoes, and seed corn or maize.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Certified seed potatoes, and seed corn or maize... Provisions Potatoes, Corn, Or Maize § 10.57 Certified seed potatoes, and seed corn or maize. Claim for classification as seed potatoes under subheading 0701.10.00, as seed corn (maize) under subheading 1005.10...

Weak Lower Semicontinuity of Integral Functionals and Applications

Czech Academy of Sciences Publication Activity Database

Benešová, B.; Kružík, Martin

2017-01-01

Roč. 59, č. 4 (2017), s. 703-766 ISSN 0036-1445 R&D Projects: GA ČR GA14-15264S; GA ČR(CZ) GF16-34894L Grant - others:GA AV ČR(CZ) DAAD-16-14 Program:Bilaterální spolupráce Institutional support: RVO:67985556 Keywords : calculus of variations * weak lower semi-continuity Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 4.897, year: 2016 http://library.utia.cas.cz/separaty/2017/MTR/kruzik-0481321.pdf

19 CFR 122.1 - General definitions.

Science.gov (United States)

2010-04-01

... such government, or passengers traveling on official business of such government; or (3) Carrying... 19 Customs Duties 1 2010-04-01 2010-04-01 false General definitions. 122.1 Section 122.1 Customs... AIR COMMERCE REGULATIONS General Definitions and Provisions § 122.1 General definitions. The following...

TRIGA Mark II nuclear reactor facility. Final report, 1 July 1980--30 June 1995

Energy Technology Data Exchange (ETDEWEB)

Ryan, B.C.

1997-05-01

This report is a final culmination of activities funded through the Department of Energy`s (DOE) University Reactor Sharing Program, Grant DE-FG02-80ER10273, during the period 1 July 1980 through 30 June 1995. Progress reports have been periodically issued to the DOE, namely the Reactor Facility Annual Reports C00-2082/2219-7 through C00-2082/10723-21, which are contained as an appendix to this report. Due to the extent of time covered by this grant, summary tables are presented. Table 1 lists the fiscal year financial obligations of the grant. As listed in the original grant proposals, the DOE grant financed 70% of project costs, namely the total amount spent of these projects minus materials costs and technical support. Thus the bulk of funds was spent directly on reactor operations. With the exception of a few years, spending was in excess of the grant amount. As shown in Tables 2 and 3, the Reactor Sharing grant funded a immense number of research projects in nuclear engineering, geology, animal science, chemistry, anthropology, veterinary medicine, and many other fields. A list of these users is provided. Out of the average 3000 visitors per year, some groups participated in classes involving the reactor such as Boy Scout Merit Badge classes, teacher`s workshops, and summer internships. A large number of these projects met the requirements for the Reactor Sharing grant, but were funded by the University instead.

TRIGA Mark II nuclear reactor facility. Final report, 1 July 1980--30 June 1995

International Nuclear Information System (INIS)

Ryan, B.C.

1997-05-01

This report is a final culmination of activities funded through the Department of Energy's (DOE) University Reactor Sharing Program, Grant DE-FG02-80ER10273, during the period 1 July 1980 through 30 June 1995. Progress reports have been periodically issued to the DOE, namely the Reactor Facility Annual Reports C00-2082/2219-7 through C00-2082/10723-21, which are contained as an appendix to this report. Due to the extent of time covered by this grant, summary tables are presented. Table 1 lists the fiscal year financial obligations of the grant. As listed in the original grant proposals, the DOE grant financed 70% of project costs, namely the total amount spent of these projects minus materials costs and technical support. Thus the bulk of funds was spent directly on reactor operations. With the exception of a few years, spending was in excess of the grant amount. As shown in Tables 2 and 3, the Reactor Sharing grant funded a immense number of research projects in nuclear engineering, geology, animal science, chemistry, anthropology, veterinary medicine, and many other fields. A list of these users is provided. Out of the average 3000 visitors per year, some groups participated in classes involving the reactor such as Boy Scout Merit Badge classes, teacher's workshops, and summer internships. A large number of these projects met the requirements for the Reactor Sharing grant, but were funded by the University instead

IDH mutant and 1p/19q co-deleted oligodendrogliomas: tumor grade stratification using diffusion-, susceptibility-, and perfusion-weighted MRI

Energy Technology Data Exchange (ETDEWEB)

Lin, Yu; Xing, Zhen; She, Dejun; Yang, Xiefeng; Zheng, Yingyan; Xiao, Zebin; Cao, Dairong [First Affiliated Hospital of Fujian Medical University, Department of Radiology, Fuzhou, Fujian (China); Wang, Xingfu [First Affiliated Hospital of Fujian Medical University, Department of Pathology, Fuzhou (China)

2017-06-15

Currently, isocitrate dehydrogenase (IDH) mutation and 1p/19q co-deletion are proven diagnostic biomarkers for both grade II and III oligodendrogliomas (ODs). Non-invasive diffusion-weighted imaging (DWI), susceptibility-weighted imaging (SWI), and dynamic susceptibility contrast perfusion-weighted imaging (DSC-PWI) are widely used to provide physiological information (cellularity, hemorrhage, calcifications, and angiogenesis) of neoplastic histology and tumor grade. However, it is unclear whether DWI, SWI, and DSC-PWI are able to stratify grades of IDH-mutant and 1p/19q co-deleted ODs. We retrospectively reviewed the conventional MRI (cMRI), DWI, SWI, and DSC-PWI obtained on 33 patients with IDH-mutated and 1p/19q co-deleted ODs. Features of cMRI, normalized ADC (nADC), intratumoral susceptibility signals (ITSSs), normalized maxim CBV (nCBV), and normalized maximum CBF (nCBF) were compared between low-grade ODs (LGOs) and high-grade ODs (HGOs). Receiver operating characteristic curve and logistic regression were applied to determine diagnostic performances. HGOs tended to present with prominent edema and enhancement. nADC, ITSSs, nCBV, and nCBF were significantly different between groups (all P < 0.05). The combination of SWI and DSC-PWI for grading resulted in sensitivity and specificity of 100.00 and 93.33%, respectively. IDH-mutant and 1p/19q co-deleted ODs can be stratified by grades using cMRI and advanced magnetic resonance imaging techniques including DWI, SWI, and DSC-PWI. Combined ITSSs with nCBV appear to be a promising option for grading molecularly defined ODs in clinical practice. (orig.)

The mass of the black hole in 1A 0620-00, revisiting the ellipsoidal light curve modelling

Science.gov (United States)

van Grunsven, Theo F. J.; Jonker, Peter G.; Verbunt, Frank W. M.; Robinson, Edward L.

2017-12-01

The mass distribution of stellar-mass black holes can provide important clues to supernova modelling, but observationally it is still ill constrained. Therefore, it is of importance to make black hole mass measurements as accurate as possible. The X-ray transient 1A 0620-00 is well studied, with a published black hole mass of 6.61 ± 0.25 M⊙, based on an orbital inclination i of 51.0° ± 0.9°. This was obtained by Cantrell et al. (2010) as an average of independent fits to V-, I- and H-band light curves. In this work, we perform an independent check on the value of i by re-analysing existing YALO/SMARTS V-, I- and H-band photometry, using different modelling software and fitting strategy. Performing a fit to the three light curves simultaneously, we obtain a value for i of 54.1° ± 1.1°, resulting in a black hole mass of 5.86 ± 0.24 M⊙. Applying the same model to the light curves individually, we obtain 58.2° ± 1.9°, 53.6° ± 1.6° and 50.5° ± 2.2° for V-, I- and H-band, respectively, where the differences in best-fitting i are caused by the contribution of the residual accretion disc light in the three different bands. We conclude that the mass determination of this black hole may still be subject to systematic effects exceeding the statistical uncertainty. Obtaining more accurate masses would be greatly helped by continuous phase-resolved spectroscopic observations simultaneous with photometry.

Mycobacterium tuberculosis Phosphoenolpyruvate Carboxykinase Is Regulated by Redox Mechanisms and Interaction with Thioredoxin

Czech Academy of Sciences Publication Activity Database

Machová, Iva; Snášel, Jan; Zimmermann, M.; Laubitz, D.; Plocinski, P.; Oehlmann, W.; Singh, M.; Dostál, Jiří; Sauer, U.; Pichová, Iva

2014-01-01

Roč. 289, č. 19 (2014), s. 13066-13078 ISSN 0021-9258 EU Projects: European Commission(XE) 241587 - SYSTEMTB Grant - others:OPPK(CZ) CZ.2.16/3.1.00/24016 Institutional support: RVO:61388963 Keywords : enzyme kinetics * hypoxia * metabolism * Mycobacterium tuberculosis * oxidation-reduction * thioredoxin * Phosphoenolpyruvate carboxykinase Subject RIV: CE - Biochemistry Impact factor: 4.573, year: 2014

Substrate binding activates the designed triple mutant of the colicin E7 metallonuclease

Czech Academy of Sciences Publication Activity Database

Németh, E.; Körtvélyesi, T.; Kožíšek, Milan; Thulstrup, P. W.; Christensen, H. E. M.; Asaka, M. N.; Nagata, K.; Gyurcsik, B.

2014-01-01

Roč. 19, č. 8 (2014), s. 1295-1303 ISSN 0949-8257 Grant - others:OPPC(XE) CZ.2.16/3.1.00/24016; Seventh Framework Programme of the European Union(XE) FP7-312284 Institutional support: RVO:61388963 Keywords : binding affinity * calorimetry * zinc nuclease * substrate induced folding * protein engineering Subject RIV: CE - Biochemistry Impact factor: 2.538, year: 2014

37 CFR 1.9 - Definitions.

Science.gov (United States)

2010-07-01

... Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES General Provisions General Information and Correspondence § 1.9... Secretary of Commerce for Intellectual Property and Director of the United States Patent and Trademark...

mu ABC: a systematic microsecond molecular dynamics study of tetranucleotide sequence effects in B-DNA

Czech Academy of Sciences Publication Activity Database

Pasi, M.; Maddocks, J. H.; Beveridge, D.; Bishop, T. C.; Case, D. A.; Cheatham III, T. E.; Dans, P. D.; Jayaram, B.; Lankaš, Filip; Laughton, C.; Mitchell, J.; Osman, R.; Orozco, M.; Pérez, A.; Petkevičiute, D.; Špačková, Naďa; Šponer, Jiří; Zakrzewska, K.; Lavery, R.

2014-01-01

Roč. 42, č. 19 (2014), s. 12272-12283 ISSN 0305-1048 R&D Projects: GA ČR(CZ) GA14-21893S; GA ČR(CZ) GAP208/11/1822 Grant - others:GA MŠk(CZ) ED1.1.00/02.0068 Program:ED Institutional support: RVO:61388963 ; RVO:68081707 Keywords : base pair * recognition * conformations Subject RIV: BO - Biophysics Impact factor: 9.112, year: 2014

V1.42In1.83Mo15Se19

Directory of Open Access Journals (Sweden)

Michel Potel

2010-10-01

Full Text Available The structure of the title compound, vanadium indium pentadecamolybdenum nonadecaselenide, V1.42In1.83Mo15Se19, is isotypic with In2.9Mo15Se19 [Grüttner et al. (1979. Acta Cryst. B35, 285–292]. It is characterized by two cluster units Mo6Sei8Sea6 and Mo9Sei11Sea6 (where i represents inner and a apical atoms that are present in a 1:1 ratio. The cluster units are centered at Wyckoff positions 2b and 2c and have point-group symmetry overline{3} and overline{6}, respectively. The clusters are interconnected through additional Mo—Se bonds. In the title compound, the V3+ cations replace the trivalent indium atoms present in In2.9Mo15Se19, and a deficiency is observed on the monovalent indium site. One Mo, one Se and the V atom are situated on mirror planes, and two other Se atoms and the In atom are situated on threefold rotation axes.

Modelling the Preferential Solvation of Ferulic Acid in {2-Propanol (1 + Water (2} Mixtures at 298.15 K

Directory of Open Access Journals (Sweden)

Abolghasem Jouyban 1,2, Fleming Martínez 3 *

2017-12-01

Full Text Available Background: Recently Haq et al. reported the equilibrium solubility in {2-propanol (1 + water (2} mixtures at several temperatures with some numerical correlation analysis. Nevertheless, no attempt was made to evaluate the preferential solvation of this compound by the solvents. Methods: Preferential solvation of ferulic acid in the saturated mixtures at 298.15 K was analyzed based on the inverse Kirkwood-Buff integrals as described in the literature. Results: Ferulic acid is preferentially solvated by water in water-rich mixtures (0.00 < x1 < 0.19 but preferentially solvated by 2-propanol in mixtures with composition 0.19 < x1 < 1.00. Conclusion: These results could be interpreted as a consequence of hydrophobic hydration around the non-polar groups of the solute in the former case (0.00 < x1 < 0.19. Moreover, in the last case (0.19 < x1 < 1.00, the observed trend could be a consequence of the acid behavior of ferulic acid in front to 2-propanol molecules because this cosolvent is more basic than water as described by the respective solvatochromic parameters.

Differential Expression and Processing of Matrix Metalloproteinase 19 Marks Progression of Gastrointestinal Diseases

Czech Academy of Sciences Publication Activity Database

Červinková, Monika; Horák, P.; Kanchev, Ivan; Matej, R.; Fanta, J.; Sequens, R.; Kašpárek, Petr; Sarnová, Lenka; Turečková, Jolana; Sedláček, Radislav

2014-01-01

Roč. 60, č. 3 (2014), s. 113-122 ISSN 0015-5500 R&D Projects: GA ČR GAP302/11/2048; GA ČR GAP303/10/2044; GA MŠk(CZ) ED1.1.00/02.0109; GA MŠk EE.2.3.20.0102 Institutional support: RVO:68378050 Keywords : matrix metalloproteinase 19 * macrophages * colon cancer Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.000, year: 2014

Information regarding restaurants 1 and 2

CERN Document Server

2007-01-01

Please note that Restaurant 1 will be closed during the Easter weekend from Friday 6th April until Monday 9th April inclusive. Restaurant 2 will remain open during this period. See http://resto2.web.cern.ch/resto2/Events/easter2007.html for more information. Restaurant 1 will also be closed for technical reasons during the weekend of 5th-6th May. Restaurant 2 will be open on Saturday 5th May from 8.00-20.00 and on Sunday 6th May from 9.00-20.00. Hot meals will be served on both days from 12.00-14.00 and from 18.00-19.30. See http://resto2.web.cern.ch/resto2/Events/5-6May2007.html for more information. Thank you for your understanding.

Near-Infrared Spectroscopy of the Cool Brown Dwarf, SDSS 1624+00

Science.gov (United States)

Nakajima, Tadashi; Tsuji, Takashi; Maihara, Toshinori; Iwamuro, Fumihide; Motohara, Ken-taro; Taguchi, Tomoyuki; Hata, Ryuji; Tamura, Motohide; Yamashita, Takuya

2000-02-01

Using the Subaru Telescope, we have obtained multiple near-infrared spectra of the cool brown dwarf, SDSS 1624+00 (J162414.37+002915.8), in search of spectral variability in an 80 minute time span. We have found the suspected variability of water vapor absorption throughout the observations, which requires a confirmation with a longer time baseline. After coadding the spectra, we have obtained a high-quality spectrum covering from 1.05 to 1.8 mu m. There are three kinds of spectral indicators, the water vapor bands, methane band and K I lines at 1.243 and 1.252 mu m, which can be used to study the temperature and the presence of dust. We compare the spectra of SDSS 1624+00 and Gliese 229B, while paying special attention to these indicators. The shallower water vapor absorption of SDSS 1624+00 indicates that it is warmer and/or dustier. The shallower methane absorption suggests that SDSS 1624+00 is warmer. We interpret the deeper K I lines in SDSS 1624+00 as being the result of its higher temperature. With the help of model spectra, we conclude that SDSS 1624+00 is warmer and dustier than Gliese 229B. For the first time in a cool brown dwarf, a finite flux is seen at the bottom of the water vapor band between 1.34 and 1.42 mu m, which means that the 1.4 mu m band of water can be completely observed from the ground.

77 FR 38879 - Self-Regulatory Organizations; NYSE Arca, Inc.; Order Granting Approval of Proposed Rule Change...

Science.gov (United States)

2012-06-29

... marketable non-displayed interest, the Market Maker would be required to re-enter a quotation for purposes of...-Regulatory Organizations; NYSE Arca, Inc.; Order Granting Approval of Proposed Rule Change Adding New... Securities Exchange Act of 1934 (``Act'') \\1\\ and Rule 19b-4 thereunder,\\2\\ a proposed rule change to add new...

Assessing the Accuracy and Performance of Implicit Solvent Models for Drug Molecules: Conformational Ensemble Approaches

Czech Academy of Sciences Publication Activity Database

Kolář, Michal; Fanfrlík, Jindřich; Lepšík, Martin; Forti, F.; Luque, F. J.; Hobza, Pavel

2013-01-01

Roč. 117, č. 19 (2013), s. 5950-5962 ISSN 1520-6106 R&D Projects: GA ČR GBP208/12/G016 Grant - others:Operational Program Research and Development for Innovations(XE) CZ 1.05/2.1.00/03/0058 Institutional support: RVO:61388963 Keywords : continuum solvation models * free-energy perturbation * partition-coefficients * HIV1-protease Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.377, year: 2013

Altitude-Wind-Tunnel Investigation of the 19B-2, 19B-8 and 19XB-1 Jet- Propulsion Engines. 4; Analysis of Compressor Performance

Science.gov (United States)

Dietz, Robert O.; Kuenzig, John K.

1947-01-01

Investigations were conducted in the Cleveland altitude wind tunnel to determine the performance and operational characteristics of the 19B-2, 19B-8, and 19XS-1 turbojet engines. One objective was to determine the effect of altitude, flight Mach number, and tail-pipe-nozzle area on the performance characteristics of the six-stage and ten-stage axial-flow compressors of the 19B-8 and 19XB-1 engines, respectively, The data were obtained over a range of simulated altitudes and flight Mach numbers. At each simulated flight condition the engine was run over its full operable range of speeds. Performance characteristics of the 19B-8 and 19XB-1 compressors for the range of operation obtainable in the turboJet-engine installation are presented. Compressor characteristics are presented as functions of air flow corrected to sea-level conditions, compressor Mach number, and compressor load coefficient. For the range of compressor operation investigated, changes in Reynolds number had no measurable effect on the relations among compressor Mach number, corrected air flow, compressor load coefficient, compressor pressure ratio, and compressor efficiency. The operating lines for the 19B-8 compressor lay on the low-air-flow side of the region of maximum compressor efficiency; the 19B-8 compressor operated at higher average pressure coefficients per stage and produced a lower over-all pressure ratio than did the 19XB-1 compressor.

The making of S{u00E1mi ethnography : contested authorities and negotiated representations / Kristin Kuutma

Index Scriptorium Estoniae

Kuutma, Kristin, 1959-

2008-01-01

Vaadeldakse saami autori Johan Turi raamatut Muitalus s{u00E1miid birra (1910) ja selle tõlget taani keelede Emilie Demant Hatti poolt ning uuritakse, millist autoritaarsust ja kultuurilist poeetikat see peegeldab ja millist sotsiaalset ja kultuurilist kriitikat ta edasi arendab

76 FR 4299 - National Sea Grant Advisory Board; Meeting

Science.gov (United States)

2011-01-25

..., education and extension, science and technology programs, and other matters as described in the agenda found on the National Sea Grant College Program Web site at http://www.seagrant.noaa.gov/leadership... can be found at http://www.seagrant.noaa.gov/leadership/advisory_board.html . Dated: January 19, 2011...

Experimental study and calculations of nitric oxide absorption in the γ(0,0) and γ(1,0) bands for strong temperature conditions

International Nuclear Information System (INIS)

Trad, H.; Higelin, P.; Djebaieli-Chaumeix, N.; Mounaim-Rousselle, C.

2005-01-01

Absorption spectra of nitric oxide in the γ(0,0) and γ(1,0) bands have been measured for hard temperature conditions up to 1700 K in order to validate a model for the simulation of these two bands. The good agreement between experiments and calculations (relative errors of 2-5% for the γ(0,0) band and 10-15% for the γ(1,0) band) consolidates the two important assumptions concerning the intermediate Hund's case between (a) and (b) for the X 2 Π state of the γ(0,0) and γ(1,0) absorption bands and the use of collisional broadening parameters of γ(0,0) to simulate the γ(1,0) band. Using this simulation, a study of the Beer-Lambert law behavior at high temperature has been carried out. With the instrument resolution used for these experiments, it was shown that a correction of the Beer-Lambert law is necessary. To apply this technique for the measurements of NO concentrations inside the combustion chamber of an optical SI engine, a new formulation of the Beer-Lambert law has been introduced, since the modified form proposed in the literature is no longer applicable in the total column range of interest

Human Parvovirus B19 NS1 Protein Aggravates Liver Injury in NZB/W F1 Mice

Science.gov (United States)

Tsai, Chun-Chou; Chiu, Chun-Ching; Hsu, Jeng-Dong; Hsu, Huai-Sheng; Tzang, Bor-Show; Hsu, Tsai-Ching

2013-01-01

Human parvovirus B19 (B19) has been associated with a variety of diseases. However, the influence of B19 viral proteins on hepatic injury in SLE is still obscure. To elucidate the effects of B19 viral proteins on livers in SLE, recombinant B19 NS1, VP1u or VP2 proteins were injected subcutaneously into NZB/W F1 mice, respectively. Significant expressions of inducible nitric oxide synthase (iNOS) and cyclooxygenase-2 (COX-2) were detected in NZB/W F1 mice receiving B19 NS1 as compared to those mice receiving PBS. Markedly hepatocyte disarray and lymphocyte infiltration were observed in livers from NZB/WF 1 mice receiving B19 NS1 as compared to those mice receiving PBS. Additionally, significant increases of Tumor Necrosis Factor –α (TNF-α), TNF-α receptor, IκB kinase –α (IKK-α), nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor (IκB) and nuclear factor-kappa B (NF-κB) were detected in livers from NZB/W F1 mice receiving B19 NS1 as compared to those mice receiving PBS. Accordingly, significant increases of matrix metalloproteinase-9 (MMP9) and U-plasminogen activator (uPA) were also detected in livers from NZB/W F1 mice receiving B19 NS1 as compared to those mice receiving PBS. Contrarily, no significant variation on livers from NZB/W F1 mice receiving B19 VP1u or VP2 was observed as compared to those mice receiving PBS. These findings firstly demonstrated the aggravated effects of B19 NS1 but not VP1u or VP2 protein on hepatic injury and provide a clue in understanding the role of B19 NS1 on hepatic injury in SLE. PMID:23555760

Polymorphisms in the cytochrome P450 genes CYP1A2, CYP1B1, CYP3A4, CYP3A5, CYP11A1, CYP17A1, CYP19A1 and colorectal cancer risk

Directory of Open Access Journals (Sweden)

Withey Laura

2007-07-01

Full Text Available Abstract Background Cytochrome P450 (CYP enzymes have the potential to affect colorectal cancer (CRC risk by determining the genotoxic impact of exogenous carcinogens and levels of sex hormones. Methods To investigate if common variants of CYP1A2, CYP1B1, CYP3A4, CYP3A5, CYP11A1, CYP17A1 and CYP19A1 influence CRC risk we genotyped 2,575 CRC cases and 2,707 controls for 20 single nucleotide polymorphisms (SNPs that have not previously been shown to have functional consequence within these genes. Results There was a suggestion of increased risk, albeit insignificant after correction for multiple testing, of CRC for individuals homozygous for CYP1B1 rs162558 and heterozygous for CYP1A2 rs2069522 (odds ratio [OR] = 1.36, 95% confidence interval [CI]: 1.03–1.80 and OR = 1.34, 95% CI: 1.00–1.79 respectively. Conclusion This study provides some support for polymorphic variation in CYP1A2 and CYP1B1 playing a role in CRC susceptibility.

Recombinant Expression, In Vitro Refolding and Characterizing Disulfide Bonds of a Mouse Inhibitory C-Type Lectin-Like Receptor Nkrp1b

Czech Academy of Sciences Publication Activity Database

Hernychová, Lucie; Mrázek, Hynek; Ivanova, Ljubina; Kukačka, Zdeněk; Chmelík, Josef; Novák, Petr

2015-01-01

Roč. 64, č. 2015 (2015), s. 85-93 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) EE2.3.30.0003; GA MŠk(CZ) ED1.1.00/02.0109; GA MŠk LO1509 Grant - others:OPPC(XE) CZ.2.16/3.1.00/24023 Institutional support: RVO:61388971 Keywords : NK cell * C-type lectin-like receptor (CTLR) * Nkrp1 Subject RIV: CE - Biochemistry Impact factor: 1.643, year: 2015

Benchmark quantum-chemical calculations on a complete set of rotameric families of the DNA sugar-phosphate backbone and their comparison with modern density functional theory

Czech Academy of Sciences Publication Activity Database

Mládek, Arnošt; Krepl, Miroslav; Svozil, Daniel; Čech, P.; Otyepka, M.; Banáš, P.; Zgarbová, M.; Jurečka, P.; Šponer, Jiří

2013-01-01

Roč. 15, č. 19 (2013), s. 7295-7310 ISSN 1463-9076 R&D Projects: GA ČR(CZ) GAP208/11/1822 Grant - others:GA MŠk(CZ) ED1.1.00/02.0068 Program:ED Institutional research plan: CEZ:AV0Z50040702 Institutional support: RVO:68081707 Keywords : GAUSSIAN-BASIS SETS * GENERALIZED GRADIENT APPROXIMATION * CORRELATED MOLECULAR CALCULATIONS Subject RIV: BO - Biophysics Impact factor: 4.198, year: 2013

Complete genome sequence of Francisella tularensis subspecies holarctica FTNF002-00.

Directory of Open Access Journals (Sweden)

Ravi D Barabote

Full Text Available Francisella tularensis subspecies holarctica FTNF002-00 strain was originally obtained from the first known clinical case of bacteremic F. tularensis pneumonia in Southern Europe isolated from an immunocompetent individual. The FTNF002-00 complete genome contains the RD(23 deletion and represents a type strain for a clonal population from the first epidemic tularemia outbreak in Spain between 1997-1998. Here, we present the complete sequence analysis of the FTNF002-00 genome. The complete genome sequence of FTNF002-00 revealed several large as well as small genomic differences with respect to two other published complete genome sequences of F. tularensis subsp. holarctica strains, LVS and OSU18. The FTNF002-00 genome shares >99.9% sequence similarity with LVS and OSU18, and is also approximately 5 MB smaller by comparison. The overall organization of the FTNF002-00 genome is remarkably identical to those of LVS and OSU18, except for a single 3.9 kb inversion in FTNF002-00. Twelve regions of difference ranging from 0.1-1.5 kb and forty-two small insertions and deletions were identified in a comparative analysis of FTNF002-00, LVS, and OSU18 genomes. Two small deletions appear to inactivate two genes in FTNF002-00 causing them to become pseudogenes; the intact genes encode a protein of unknown function and a drug:H(+ antiporter. In addition, we identified ninety-nine proteins in FTNF002-00 containing amino acid mutations compared to LVS and OSU18. Several non-conserved amino acid replacements were identified, one of which occurs in the virulence-associated intracellular growth locus subunit D protein. Many of these changes in FTNF002-00 are likely the consequence of direct selection that increases the fitness of this subsp. holarctica clone within its endemic population. Our complete genome sequence analyses lay the foundation for experimental testing of these possibilities.

VP1, the major capsid protein of the mouse polyomavirus, binds microtubules, promotes their acetylation and blocks the host cell cycle

Czech Academy of Sciences Publication Activity Database

Horníková, L.; Fraiberk, M.; Man, Petr; Janovec, V.; Forstová, J.

2017-01-01

Roč. 284, č. 2 (2017), s. 301-323 E-ISSN 1742-4658 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109; GA MŠk(CZ) LO1509 Grant - others:Ministerstvo pro místní rozvoj(CZ) CZ.2.16./3.1.00/24023 Institutional support: RVO:61388971 Keywords : cell cycle arrest * chaperone Hsp90 * microtubules Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology

Formation of the food vacuole in Plasmodium falciparum: a potential role for the 19 kDa fragment of merozoite surface protein 1 (MSP1(19.

Directory of Open Access Journals (Sweden)

Anton R Dluzewski

2008-08-01

Full Text Available Plasmodium falciparum Merozoite Surface Protein 1 (MSP1 is synthesized during schizogony as a 195-kDa precursor that is processed into four fragments on the parasite surface. Following a second proteolytic cleavage during merozoite invasion of the red blood cell, most of the protein is shed from the surface except for the C-terminal 19-kDa fragment (MSP1(19, which is still attached to the merozoite via its GPI-anchor. We have examined the fate of MSP1(19 during the parasite's subsequent intracellular development using immunochemical analysis of metabolically labeled MSP1(19, fluorescence imaging, and immuno-electronmicroscopy. Our data show that MSP1(19 remains intact and persists to the end of the intracellular cycle. This protein is the first marker for the biogenesis of the food vacuole; it is rapidly endocytosed into small vacuoles in the ring stage, which coalesce to form the single food vacuole containing hemozoin, and persists into the discarded residual body. The food vacuole is marked by the presence of both MSP1(19 and the chloroquine resistance transporter (CRT as components of the vacuolar membrane. Newly synthesized MSP1 is excluded from the vacuole. This behavior indicates that MSP1(19 does not simply follow a classical lysosome-like clearance pathway, instead, it may play a significant role in the biogenesis and function of the food vacuole throughout the intra-erythrocytic phase.

The 10:00-11:00 pm urine cortisol/creatinine ratio. An alternative to late-night salivary cortisol for the diagnosis of Cushing's syndrome.

Science.gov (United States)

Bruno, Oscar D; Rossi, María A; Juárez-Allen, Lea; Serra, Héctor A; Albiero, María C

2015-01-01

The aim of this study was to investigate interchangeability of two tests to diagnose Cushing's syndrome. We compared 10:00-11:00 PM urinary free cortisol/creatinine ratio (UFC/Cr) with late night 11:00 PM salivary cortisol (LNSC) in normal and obese controls vs. patients with Cushing's syndrome. Mean UFC/Cr did not differ between 69 normal and 62 obese controls (9.9 ± 7.9 vs. 9.7 ± 9.3) whereas 116 Cushing's patients had significantly higher values (277.0 ± 318.0; z: -11.1 and -10.2, respectively; p Cushing's patients (24.8 ± 23.3; z: -7.22 and -6.96, respectively, p Cushing's syndrome.

19 CFR 173.5 - Review of entry covering household or personal effects.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Review of entry covering household or personal effects. 173.5 Section 173.5 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... authority to grant. Where the port director has no authority to grant the waiver, the application shall be...

Grants Solutions -

Data.gov (United States)

Department of Transportation — The Grants Center of Excellence The Grants Center of Excellence (COE) delivers end-to-end grants management products and support to over 17 Federal partner agencies....

26 CFR 1.501(c)(19)-1 - War veterans organizations.

Science.gov (United States)

2010-04-01

...) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Exempt Organizations § 1.501(c)(19)-1 War veterans... members of the United States Armed Forces, (iii) Cadets (including only students in college or university... provision described in § 1.501(c)(3)-1(b)(4). (2) The corpus or income cannot be diverted or used other than...

Spectroscopy of the {sup 29}Si(p,{gamma}) reaction for E{sub p}=1.00{endash}1.75 MeV

Energy Technology Data Exchange (ETDEWEB)

Vavrina, G.A.; Bybee, C.R.; Mitchell, G.E.; Moore, E.F.; Shriner, J.D. [North Carolina State University, Raleigh, North Carolina 27695 (United States); Bilpuch, E.G.; Wallace, P.M.; Westerfeldt, C.R. [Duke University, Durham, North Carolina 27708 (United States); Shriner, J.F. , Jr. [Tennessee Technological University, Cookeville, Tennessee 38505 (United States)

1997-03-01

The {sup 29}Si(p,{gamma}) reaction has been studied in the range E{sub p}=1.00{endash}1.75 MeV. Three previously unknown states in {sup 30}P were identified, and one state previously assigned to {sup 30}P was identified as a state in {sup 14}N. Gamma-ray strengths were determined for the three new levels, and branching ratios were measured for 17 resonances. Revised J{sup {pi}};T assignments were made for nine of these states. {copyright} {ital 1997} {ital The American Physical Society}

Caffeine-hydrazones as anticancer agents with pronounced selectivity toward T-lymphoblastic leukaemia cells

Czech Academy of Sciences Publication Activity Database

Kaplánek, R.; Jakubek, M.; Rak, J.; Kejik, Z.; Havlík, M.; Dolenský, B.; Frydrych, I.; Hajduch, M.; Kolář, M.; Bogdanová, K.; Králová, Jarmila; Dzubak, P.; Král, V.

2015-01-01

Roč. 60, Jun (2015), s. 19-29 ISSN 0045-2068 Grant - others:GA MŠk(CZ) EE2.3.30.0060; GA MŠk CZ.1.07/2.3.00/30.0041; GA MŠk(CZ) LO1304 Program:EE; LD Institutional support: RVO:68378050 Keywords : Anticancer agents * Cancer treatment * Caffeine -hydrazones * Leukaemia * Selectivity Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.252, year: 2015

RESTAURANT AND CAFETERIA SERVICES ARRANGEMENTS FOR 1 MAY 2002

CERN Document Server

Restaurant Supervisory Committee

2002-01-01

1. Restaurants As Wednesday 1 May is an official CERN holiday, restaurants no. 2 (DSR: bldg. 504 - Meyrin) and no. 3 (Avenance: bldg. 866 - Prévessin) will be closed as from Tuesda 30 April at 18h00. They will reopen on Thursday 2 May at 6h30 (rest. no. 2) and at 7h00 (rest. no. 3). On 1 May, a limited service will be provided by restaurant no. 1 (COOP: bldg. 501 - Meyrin) from 8h00 to 21h00 with hot meals served from 11h30 to 14h00 and from 18h00 to 19h30. 2. Decentralised services No decentralised services (satellite cafétérias etc.) will operate. 3. Newspaper stand The newspaper kiosque in building 501 will be closed. Restaurant Supervisory Committee, tel. 77551

Electrical conductivity of Sr{sub 2−x}VMoO{sub 6−y} (x = 0.0, 0.1, 0.2) double perovskites

Energy Technology Data Exchange (ETDEWEB)

Childs, Nicholas B.; Smith, Richard; Key, Camas [Department of Physics, EPS 264, Montana State University, Bozeman, Montana 59717 (United States); Weisenstein, Adam; Sofie, Stephen [Department of Mechanical Engineering, Roberts 220, Montana State University, Bozeman, Montana 59717 (United States)

2013-06-28

Electrical conductivity of Sr{sub 2-x}VMoO{sub 6-y} (x = 0.0, 0.1, 0.2) double perovskites has been investigated in a reducing atmosphere at temperatures up to 800 °C. This material has a key application in solid oxide fuel cell anodes as a mixed ion and electron conductor. A solid state synthesis technique was used to fabricate materials and crystal structure was verified through x-ray diffraction. Subsequent to conventional sintering in a reducing environment, elemental valence states were indentified through x-ray photoemission spectroscopy on the double perovskite material before and after annealing in a hydrogen environment. Samples exhibited metallic like conduction with electrical conductivities of 1250 S/cm (Sr{sub 2}VMoO{sub 6-y′}), 2530 S/cm (Sr{sub 1.8}VMoO{sub 6-y″}), and 3610 S/cm (Sr{sub 1.9}VMoO{sub 6-y‴}) at 800 °C in 5% H{sub 2}/95% N{sub 2}, with a substantial increase in conductivity upon cooling to room temperature. Room temperature electrical conductivity values for Sr{sub 1.9}VMoO{sub 6-y‴} make it a candidate as the highest electrically conductive oxide known. Highly insulating secondary surface phases, Sr{sub 3}V{sub 2}O{sub 8}, and SrMoO{sub 4}, begin to reduce at 400 °C in a hydrogen environment, as confirmed by X-ray photoemission and thermal gravimetric analysis. This reduction, from V{sup 5+} and Mo{sup 6+} to lower valence states, leads to a large increase in sample electrical conductivity.

Spin canting and magnetic transition in NixZn1-xFe2O4 (x=0.0, 0.5 and 1.0) nanoparticles

Science.gov (United States)

Rani, Stuti; Raghav, Dharmendra Singh; Yadav, Prashant; Varma, G. D.

2018-04-01

Nanoparticles of NixZn1-xFe2O4(x=0.0, 0.5 and 1.0) have been synthesized via co-precipitation method and studied thestructural and magnetic properties. Rietveld refinement of X ray diffraction data of as synthesized samples revealthat the samples have mixed spinel structure with space group Fd-3m. The lattice parameter of the samples decreases as doping concentration of Ni ions increases. Magnetic measurements show paramagnetic to ferrimagnetic transition at room temperature on Ni doping in ZnFe2O4 nanoparticles. The magnetic measurements also show spin canting in samples possibly due to their nanocrystalline nature. The spin canting angles have been calculated with the help of Yafet-Kittel (Y-K) model. Furthermore, the Law of approach (LA) fitting of M-H curves indicates that the samples are highly anisotropicin nature. The Arrot plots of as synthesized samples also indicate the paramagnetic to ferrimagnetic transition. The correlation between the structural and observed magnetic properties of NixZn1-xFe2O4(x=0.0, 0.5 and 1.0) nanocrystals will be described and discussed in this paper.

19 CFR 210.1 - Applicability of part.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 3 2010-04-01 2010-04-01 false Applicability of part. 210.1 Section 210.1 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF UNFAIR PRACTICES IN IMPORT TRADE..., and 1337) and sections 2 and 1342(d)(1)(B) of the Omnibus Trade and Competitiveness Act of 1988, Pub...

SKIP and BIR-1/Survivin have potential to integrate proteome status with gene expression

Czech Academy of Sciences Publication Activity Database

Kostrouchová, V.; Kostrouch, Z.; Kostrouch, D.; Kostrouchová, M.; Yilma, P.; Chughtai, Ahmed A.; Novotný, Jan P.; Novák, Petr

2014-01-01

Roč. 110, č. 4 (2014), s. 93-106 ISSN 1874-3919 R&D Projects: GA MŠk(CZ) cz.1.07/2.3.00/20.0055; GA MŠk ED1.1.00/02.0109; GA MŠk(CZ) EE2.3.30.0003; GA MŠk ED0012/01/01 Grant - others:Masaryk University, Brno(CZ) MUNI/A/1012/2009; Universita Karlova(CZ) UNCE 204022; Universita Karlova(GB) UNCE204011; Univesita Karlova(CZ) PRVOUK-P24/LF/1/3 Institutional support: RVO:61388971 Keywords : Survivin * proteomics * gene expression Subject RIV: EE - Microbiology, Virology Impact factor: 3.888, year: 2014

Federal health services grants, 1985.

Science.gov (United States)

Zwick, D I

1986-01-01

Federal health services grants amounted to about $1.8 billion in fiscal year 1985. The total amount was about $100 million less, about 6 percent, than in 1980. Reductions in the health planning program accounted for most of the decline in absolute dollars. The four formula grants to State agencies amounted to about $1.0 billion in 1985, about 60 percent of the total. The largest formula grants were for maternal and child health services and for alcohol, drug abuse, and mental health services. Project grants to selected State and local agencies amounted to about $.8 billion. There was 12 such grants in 1985 (compared with 34 in 1980). The largest, for community health services, equaled almost half the total. In real, inflation-adjusted dollars, the decline in Federal funds for these programs exceeded a third during the 5-year period. The overall dollar total in real terms in 1985 approximated the 1970 level. The ratio of formula grants to project grants in 1985 was similar to that in 1965. Studies of the impact of changes in Federal grants have found that while the development of health programs has been seriously constrained in most cases, their nature has not been substantially altered. In some cases broader program approaches and allocations have been favored. Established modes of operations and administration have generally been strengthened. Some efficiencies but few savings in administration have been identified. Replacement of reduced Federal funding by the States has been modest but has increased over time, especially for direct service activities. These changes reflect the important influence of professionalism in the health fields and the varying strengths of political interest and influence among program supporters. The long-term impact on program innovation is not yet clear.

25 CFR 23.21 - Noncompetitive tribal government grants.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Noncompetitive tribal government grants. 23.21 Section 23... ACT Grants to Indian Tribes for Title II Indian Child and Family Service Programs § 23.21 Noncompetitive tribal government grants. (a) Grant application information and technical assistance. Information...

Documentation for Grants Equal to Tax model: Volume 1, Technical description

International Nuclear Information System (INIS)

1986-01-01

A computerized model, the Grants Equal to Tax (GETT) model, was developed to assist in evaluating the amount of federal grant monies that would go to state and local jurisdictions under the provisions outlined in the Nuclear Waste Policy Act of 1982. The GETT model is capable of forecasting the amount of tax liability associated with all property owned and all activities undertaken by the US Department of Energy (DOE) in site characterization and repository development. The GETT program is a user-friendly, menu-driven model developed using dBASE III/trademark/, a relational data base management system. The data base for GETT consists primarily of eight separate dBASE III/trademark/ files corresponding to each of the eight taxes levied by state and local jurisdictions on business property and activity. Additional smaller files help to control model inputs and reporting options. Volume 1 of the GETT model documentation is a technical description of the program and its capabilities providing (1) descriptions of the data management system and its procedures; (2) formulas for calculating taxes (illustrated with flow charts); (3) descriptions of tax data base variables for the Deaf Smith County, Texas, Richton Dome, Mississippi, and Davis Canyon, Utah, salt sites; and (4) data inputs for the GETT model. 10 refs., 18 figs., 3 tabs

Progress of sperm Izumo1 relocation during spontaneous acrosome reaction

Czech Academy of Sciences Publication Activity Database

Šebková, N.; Děd, Lukáš; Veselá, K.; Dvořáková-Hortová, K.

2014-01-01

Roč. 147, č. 2 (2014), s. 231-240 ISSN 1470-1626 R&D Projects: GA ČR(CZ) GAP503/12/1834; GA MŠk ED1.1.00/02.0109 Grant - others:GA ČR(CZ) GAP506/12/1046 Institutional research plan: CEZ:AV0Z50520701 Keywords : Acrosome reaction * Capacitation * Izumo 1 Subject RIV: EC - Immunology Impact factor: 3.174, year: 2014

Exacerbating effects of human parvovirus B19 NS1 on liver fibrosis in NZB/W F1 mice.

Directory of Open Access Journals (Sweden)

Tsai-Ching Hsu

Full Text Available Systemic lupus erythematosus (SLE is an autoimmune disorder with unknown etiology that impacts various organs including liver. Recently, human parvovirus B19 (B19 is recognized to exacerbate SLE. However, the effects of B19 on liver in SLE are still unclear. Herein we aimed to investigate the effects of B19 on liver in NZB/W F1 mice by injecting subcutaneously with PBS, recombinant B19 NS1, VP1u or VP2, respectively. Our experimental results revealed that B19 NS1 protein significantly enhanced the TGF-β/Smad fibrotic signaling by increasing the expressions of TGF-β, Smad2/3, phosphorylated Smad2/3, Smad4 and Sp1. The consequent fibrosis-related proteins, PAI-1 and α-SMA, were also significantly induced in livers of NZB/W F1 mice receiving B19 NS1 protein. Accordingly, markedly increased collagen deposition was also observed in livers of NZB/W F1 mice receiving B19 NS1 protein. However, no significant difference was observed in livers of NZB/W F1 mice receiving B19 VP1u or VP2 as compared to the controls. These findings indicate that B19 NS1 plays a crucial role in exacerbating liver fibrosis in NZB/W F1 mice through enhancing the TGF-â/Smad fibrotic signaling.

Exacerbating Effects of Human Parvovirus B19 NS1 on Liver Fibrosis in NZB/W F1 Mice

Science.gov (United States)

Hsu, Tsai-Ching; Tsai, Chun-Chou; Chiu, Chun-Ching; Hsu, Jeng-Dong; Tzang, Bor-Show

2013-01-01

Systemic lupus erythematosus (SLE) is an autoimmune disorder with unknown etiology that impacts various organs including liver. Recently, human parvovirus B19 (B19) is recognized to exacerbate SLE. However, the effects of B19 on liver in SLE are still unclear. Herein we aimed to investigate the effects of B19 on liver in NZB/W F1 mice by injecting subcutaneously with PBS, recombinant B19 NS1, VP1u or VP2, respectively. Our experimental results revealed that B19 NS1 protein significantly enhanced the TGF-β/Smad fibrotic signaling by increasing the expressions of TGF-β, Smad2/3, phosphorylated Smad2/3, Smad4 and Sp1. The consequent fibrosis-related proteins, PAI-1 and α-SMA, were also significantly induced in livers of NZB/W F1 mice receiving B19 NS1 protein. Accordingly, markedly increased collagen deposition was also observed in livers of NZB/W F1 mice receiving B19 NS1 protein. However, no significant difference was observed in livers of NZB/W F1 mice receiving B19 VP1u or VP2 as compared to the controls. These findings indicate that B19 NS1 plays a crucial role in exacerbating liver fibrosis in NZB/W F1 mice through enhancing the TGF-â/Smad fibrotic signaling. PMID:23840852

Electrically-controlled permeation of vapors through carbon nanotube network-based membranes

Czech Academy of Sciences Publication Activity Database

Slobodian, P.; Říha, Pavel; Olejník, R.

2018-01-01

Roč. 17, č. 2 (2018), s. 332-337 ISSN 1536-125X R&D Projects: GA MŠk ED2.1.00/19.0409 Grant - others:Ministerstvo školství, mládeže a tělovýchovy (MŠMT)(CZ) LO1504 Institutional research plan: CEZ:AV0Z20600510 Keywords : carbon nanotubes * electrically controlled membranes * permeation of chemical vapors Impact factor: 2.485, year: 2016

Sun Grant Initiative Regional Biomass Feedstock Partnership Competitive Grants Program

Energy Technology Data Exchange (ETDEWEB)

Owens, Vance [South Dakota State Univ., Brookings, SD (United States). North Central Regional Sun Grant Center

2016-12-30

The Sun Grant Initiative partnered with the US Department of Energy (DOE) in 2008 to create the Regional Biomass Feedstock Partnership Competitive Grants Program. The overall goal of this project was to utilize congressionally directed funds to leverage the North Central Regional Sun Grant’s Competitive Grant program at South Dakota State University (SDSU) to address key issues and research gaps related to development of the bioeconomy. Specific objectives of this program were to: 1. Identify research projects through a Regional Competitive Grants program that were relevant to the sustainable production, harvest, transport, delivery, and processing/conversion of cost-competitive, domestically grown biomass. 2. Build local expertise and capacity at the North Central Regional Sun Grant Center at SDSU through an internal selection of key bioenergy research projects. To achieve these, three nationwide Request for Applications (RFA) were developed: one each in 2008, 2009, and 2010. Internal, capacity building projects at SDSU were also selected during each one of these RFAs. In 2013 and 2015, two additional Proof of Concept RFAs were developed for internal SDSU projects. Priority areas for each RFA were 1) Biomass feedstock logistics including biomass harvesting, handling, transportation, storage, and densification; 2) Sustainable biomass feedstock production systems including biomass crop development, production, and life-cycle analysis; 3) Biomass production systems that optimize biomass feedstock yield and economic return across a diverse landscape while minimizing negative effects on the environment and food/feed production; and 4) Promotion of knowledge-based economic development in science and technology and to advance commercialization of inventions that meet the mission of the Sun Grant Initiative. A total of 33 projects were selected for funding through this program. Final reports for each of these diverse projects are included in this summary report

Synchronous gastric and sebaceous cancers, a rare manifestation of MLH1-related Muir-Torre syndrome

Czech Academy of Sciences Publication Activity Database

Švec, Jiří; Schwarzová, L.; Janošíková, B.; Štekrová, J.; Mandys, V.; Kment, M.; Vodička, Pavel

2014-01-01

Roč. 7, č. 8 (2014), s. 5196-5202 ISSN 1936-2625 Grant - others:GA MŠk(CZ) Prvouk-P27/LF1/1; Univerzita Karlova(CZ) CZ.2.16/3.1.00/24024 Institutional support: RVO:68378041 Keywords : germline mutation * gastric cancer * MLH1 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.891, year: 2014

Federal Administrative Court, judgement of December 19, 1985 (nuclear power station Sued Block 1, Wyhl)

International Nuclear Information System (INIS)

Anon.

1986-01-01

In case the licensing authority grants a conceptual preliminary licence in connection with a partial licence or a site preliminary licence, this fact has to be expressed in the ruling part of the licence because of the implied approval of the concept (sec. 19 para. 3 no. 2 rules of procedure in Atomic Energy Law). With each partial licence there has to be connected a preliminary favourable general statement applying to the whole installation. For the judicial examination of partial licences within the framework of a third party appeal against the issue of a licence the factual and legal position at the time of issue is generally authoritative. (HP) [de

25 CFR 23.51 - Grant carry-over authority.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Grant carry-over authority. 23.51 Section 23.51 Indians... Uniform Grant Administration Provisions and Requirements § 23.51 Grant carry-over authority. Unless... two years beyond the initial grant funding period and must be utilized only for the intent, purpose...

Komparasi Aplikasi Perangkat Lunak Sistem Klasifikasi Ddc: Athenaeum Light 8.5., Dfw Version 1.00, We

OpenAIRE

Wijaya Hardiyati

2016-01-01

Librarian has many alternative to classify DDC (Dewey Decimal Classification) number. Not only use printed DDC, but now DDC software to help identify DDC number is available. On of them is Athenaeum Light 8.5., DFW (Dewey For Windows) Version 1.00, WebDewey 2.0, e-DDC (electronic-Dewey Decimal Classification) Edition 22. In this paper, it will roll out about how to use that software with it excess and deficiency.

Integrated Knowledge Translation and Grant Development: Addressing the Research Practice Gap through Stakeholder-informed Research.

Science.gov (United States)

Henderson, Joanna; Brownlie, Elizabeth; Rosenkranz, Susan; Chaim, Gloria; Beitchman, Joseph

2013-11-01

We describe our stakeholder engagement process for grant application development that occurred as part of our integrated knowledge translation plan and make recommendations for researchers. In phase 1, a stakeholder consultation group was developed. In phase 2, surveys regarding knowledge gathering, research agenda, and research collaboration preferences were sent to 333 cross-sectoral youth-serving organizations in Ontario, including family and consumer organizations. In phase 1, 28 stakeholders from six sectors participated in the consultation group and provided input on multiple aspects of the proposal. Through this process, 19 stakeholders adopted formal roles within the project. In phase 2, 206 surveys were received (response rate = 62%). Survey responses supported the grant focus (concurrent youth mental health and substance use problems). Respondents also prioritized project goals and provided specific feedback on research and knowledge translation. Finally, although some stakeholders chose greater involvement, most survey respondents indicated a preference for a moderate level of participation in research rather than full team membership. Despite short timelines and feasibility challenges, stakeholders can be meaningfully engaged in and contribute to the grant proposal development process. Consideration is needed for the practical challenges that stakeholder organizations face in supporting and participating in research.

Determination of Absolute Configuration and Conformation of a Cyclic Dipeptide by NMR and Chiral Spectroscopic Methods

Czech Academy of Sciences Publication Activity Database

Li, X.; Hopmann, K. H.; Hudecová, Jana; Isaksson, J.; Novotná, J.; Stensen, W.; Andrushchenko, Valery; Urbanová, M.; Svendsen, J. S.; Bouř, Petr; Ruud, K.

2013-01-01

Roč. 117, č. 8 (2013), s. 1721-1736 ISSN 1089-5639 R&D Projects: GA MŠk(CZ) LH11033; GA ČR GAP208/10/0559; GA ČR GAP208/11/0105 Grant - others:Rada Programu interní podpory projektů mezinárodní spolupráce AV ČR(CZ) M200550902 Institutional support: RVO:61388963 Keywords : density-functional theory * Raman optical activity * vibrational circular dichroism * residual dipolar couplings * crystal structure Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.775, year: 2013

Structural characterization of P1 '-diversified urea-based inhibitors of glutamate carboxypeptidase II

Czech Academy of Sciences Publication Activity Database

Pavlíček, Jiří; Ptáček, Jakub; Černý, Jiří; Byun, Y.; Škultétyová, Ĺubica; Pomper, M.G.; Lubkowski, J.; Bařinka, Cyril

2014-01-01

Roč. 24, č. 10 (2014), s. 2340-2345 ISSN 0960-894X R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109 Grant - others:EMBO(DE) 1978 Institutional support: RVO:86652036 Keywords : GCPII * Prostate -specific membrane antigen * PSMA Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 2.420, year: 2014

THE EVOLUTION OF THE STAR FORMATION RATE OF GALAXIES AT 0.0 ≤ z ≤ 1.2

International Nuclear Information System (INIS)

Rujopakarn, Wiphu; Eisenstein, Daniel J.; Rieke, George H.; Rieke, Marcia J.; Papovich, Casey; Cool, Richard J.; Moustakas, John; Jannuzi, Buell T.; Dey, Arjun; Kochanek, Christopher S.; Eisenhardt, Peter; Murray, Steve S.; Brown, Michael J. I.; Le Floc'h, Emeric

2010-01-01

We present the 24 μm rest-frame luminosity function (LF) of star-forming galaxies in the redshift range 0.0 ≤ z ≤ 0.6 constructed from 4047 spectroscopic redshifts from the AGN and Galaxy Evolution Survey of 24 μm selected sources in the Booetes field of the NOAO Deep Wide-Field Survey. This sample provides the best available combination of large area (9 deg 2 ), depth, and statistically complete spectroscopic observations, allowing us to probe the evolution of the 24 μm LF of galaxies at low and intermediate redshifts while minimizing the effects of cosmic variance. In order to use the observed 24 μm luminosity as a tracer for star formation, active galactic nuclei (AGNs) that could contribute significantly at 24 μm are identified and excluded from our star-forming galaxy sample based on their mid-IR spectral energy distributions or the detection of X-ray emission. Optical emission line diagnostics are considered for AGN identification, but we find that 24 μm emission from optically selected AGNs is usually from star-forming activity and therefore should not be excluded. The evolution of the 24 μm LF of star-forming galaxies for redshifts of z ≤ 0.65 is consistent with a pure luminosity evolution where the characteristic 24 μm luminosity evolves as (1 + z) 3.8±0.3 . We extend our evolutionary study to encompass 0.0 ≤ z ≤ 1.2 by combining our data with that of the Far-Infrared Deep Extragalactic Legacy Survey. Over this entire redshift range, the evolution of the characteristic 24 μm luminosity is described by a slightly shallower power law of (1 + z) 3.4±0.2 . We find a local star formation rate density of (1.09 ± 0.21) x 10 -2 M sun yr -1 Mpc -3 , and that it evolves as (1 + z) 3.5±0.2 over 0.0 ≤ z ≤ 1.2. These estimates are in good agreement with the rates using optical and UV fluxes corrected for the effects of intrinsic extinction in the observed sources. This agreement confirms that star formation at z ∼< 1.2 is robustly traced by

Evolution of Matrix-Twin Interfaces of (1 0 -1 2) Twin in Magnesium

Czech Academy of Sciences Publication Activity Database

Ostapovets, Andriy; Serra, A.

2015-01-01

Roč. 128, č. 4 (2015), s. 661-663 ISSN 0587-4246. [ISPMA13 - International Symposium on Physics of Materials /13./. Praha, 31.08.2014-04.09.2014] R&D Projects: GA MŠk(CZ) EE2.3.30.0063; GA MŠk(CZ) ED1.1.00/02.0068 Grant - others:Spanish Secretariat of Research, Development and Innovation (ES) FIS2012-39433-C02-02 Institutional support: RVO:68081723 Keywords : twinning * magnesium * computer simuations Subject RIV: JG - Metallurgy Impact factor: 0.525, year: 2015

You Can Get Grants!

Science.gov (United States)

Novelli, Joan

1994-01-01

Presents strategies to help elementary teachers win grants for the classroom. The article includes information on grant sources, where to find out more about grants, and how to write winning grants. Examples of successful grant projects are provided, and announcement of a $500 Instructor grant competition is included. (SM)

Taxation in France: Public meeting on Wednesday 19 March 2014

CERN Multimedia

2014-01-01

A public meeting will take place on Wednesday 19 March from 1.00 p.m. to 3.00 p.m. in the Main Auditorium (500/1-001).   At this meeting, Mr Jean-Louis Brandolin and Mr Gérard Polizzi, Head and Deputy Head respectively of the private citizens and companies income tax office at the Public Finance Centre in Bellegarde, will advise members of the CERN personnel domiciled in France on tax-related matters. The agenda will include questions of principle that appear to be on the minds of many members of the personnel, such as the definition of tax domicile, the content of the income-tax declaration form (reference to CERN income and declaration of other income from a French or non-French source), the declaration of bank accounts outside France and the obligation (under certain conditions) to pay the CSG-CRDS withholding. This meeting will only address questions of principle and we expressly invite you not to ask questions on personal matters. For all questions on personal matters, such as ...

Effects of GF-015535-00, a novel α1 GABA A receptor ligand, on the sleep-wake cycle in mice, with reference to zolpidem.

Science.gov (United States)

Anaclet, Christelle; Zhang, Mei; Zhao, Chunmei; Buda, Colette; Seugnet, Laurent; Lin, Jian-Sheng

2012-01-01

Novel, safe, and efficient hypnotic compounds capable of enhancing physiological sleep are still in great demand in the therapy of insomnia. This study compares the sleep-wake effects of a new α1 GABA(A) receptor subunit ligand, GF-015535-00, with those of zolpidem, the widely utilized hypnotic compound. Nine C57Bl6/J male mice were chronically implanted with electrodes for EEG and sleep-wake monitoring. Each mouse received 3 doses of GF-015535-00 and zolpidem. Time spent in sleep-wake states and cortical EEG power spectra were analyzed. Both zolpidem and GF-015535-00 prominently enhanced slow wave sleep and paradoxical sleep in the mouse. However, as compared with zolpidem, GF-015535-00 showed several important differences: (1) a comparable sleep-enhancing effect was obtained with a 10 fold smaller dose; (2) the induced sleep was less fragmented; (3) the risk of subsequent wake rebound was less prominent; and (4) the cortical EEG power ratio between slow wave sleep and wake was similar to that of natural sleep and thus compatible with physiological sleep. The characteristics of the sleep-wake effects of GF-015535-00 in mice could be potentially beneficial for its use as a therapeutic compound in the treatment of insomnia. Further investigations are required to assess whether the same characteristics are conserved in other animal models and humans.

Expression and purification of soluble and stable ectodomain of natural killer cell receptor LLT1 through high-density transfection of suspension adapted HEK293S GnTI(-) cells

Czech Academy of Sciences Publication Activity Database

Bláha, J.; Pachl, Petr; Novák, Petr; Vaněk, O.

2015-01-01

Roč. 109, May (2015), s. 7-13 ISSN 1046-5928 R&D Projects: GA MŠk(CZ) EE2.3.30.0003; GA MŠk(CZ) ED1.1.00/02.0109 Grant - others:OPPK(CZ) CZ.2.16/3.1.00/24023 Institutional support: RVO:61388963 ; RVO:61388971 Keywords : LLT1 * HEK293S GnTI(-) * C-type lectin-like * NK cell * glycosylation * transfection Subject RIV: CE - Biochemistry Impact factor: 1.407, year: 2015

19 CFR 191.1 - Authority of the Commissioner of Customs.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Authority of the Commissioner of Customs. 191.1 Section 191.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... Customs. Pursuant to Treasury Department Order No. 165, Revised (T.D. 53654, 19 FR 7241), as amended, the...

Double-tuned radiofrequency coil for (19)F and (1)H imaging.

Science.gov (United States)

Otake, Yosuke; Soutome, Yoshihisa; Hirata, Koji; Ochi, Hisaaki; Bito, Yoshitaka

2014-01-01

We developed a double-tuned radiofrequency (RF) coil using a novel circuit method to double tune for fluorine-19 (19F) and 1H magnetic resonance imaging, whose frequencies are very close to each other. The RF coil consists of 3 parallel-connected series inductor capacitor circuits. A computer simulation for our double-tuned RF coil with a phantom demonstrated that the coil has tuned resonant frequency and high sensitivity for both 19F and 1H. Drug distribution was visualized at 7 tesla using this RF coil and a rat administered perfluoro 15-crown-5-ether emulsion. The double-tune RF coil we developed may be a powerful tool for 19F and 1H imaging.

Autocrine VEGF-VEGFR2-Neuropilin-1 signaling promotes glioma stem-like cell viability and tumor growth

Czech Academy of Sciences Publication Activity Database

Hamerlik, P.; Lathia, J.D.; Rasmussen, R.; Wu, Q.; Bartkova, J.; Lee, M.; Moudrý, Pavel; Bartek, J. Jr.; Fischer, W.; Lukas, J.; Rich, J.N.; Bartek, Jiří

2012-01-01

Roč. 209, č. 3 (2012), s. 507-520 ISSN 0022-1007 Grant - others:Danish Council for Independent Research /Medical Sciences(DK) ID4765/11-105457; MZd(CZ) NT11065; MŠMT(CZ) CZ.1.07/2.3.00/20.0019; MŠMT(CZ) CZ.1.05/2.1.00/01.0030; NIH(US) NS054276; NIH(US) CA129958; NIH(US) CA116659; NRSA(US) CA142159 Program:NT Institutional research plan: CEZ:AV0Z50520514 Institutional support: RVO:68378050 Keywords : VEGFR2 * cancer * GBM Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 13.214, year: 2012

Efficient diode-pumped Tm:KYW 1.9-μm microchip laser with 1 W cw output power.

Science.gov (United States)

Gaponenko, Maxim; Kuleshov, Nikolay; Südmeyer, Thomas

2014-05-19

We report on a diode-pumped Tm:KYW microchip laser generating 1 W continuous-wave output power. The laser operates at a wavelength of 1.94 μm in the fundamental TEM(00) mode with 71% slope efficiency relative to the absorbed pump radiation and 59% slope efficiency relative to the incident pump radiation. The optical-to-optical laser efficiency is 43%.

Efficient diode-pumped Tm:KYW 1.9-μm microchip laser with 1 W cw output power

OpenAIRE

Gaponenko, M. S.; Kuleshov, N. V.; Südmeyer, T.

2014-01-01

We report on a diode-pumped Tm:KYW microchip laser generating 1 W continuous-wave output power. The laser operates at a wavelength of 1.94 μm in the fundamental TEM00 mode with 71% slope efficiency relative to the absorbed pump radiation and 59% slope efficiency relative to the incident pump radiation. The optical-to-optical laser efficiency is 43%.

Interaction of the Bragg gap with polaritonic gap in opal photonic crystals

Science.gov (United States)

Nayer, Eradat; Sivachenko, Andrey Yu; Li, Sergey; Raikh, Mikhail E.; Valy Vardeny, Z.

2001-03-01

Photonic crystals (PC) are a class of artificial structures with a periodic dielectric function. PCs can be a laboratory for testing fundamental processes involving interactions of radiation with matter in novel conditions. We have studied the optical properties of opal PCs that are infiltrated with highly polarizable media such as j-aggregates of cyanine dyes. Opals are self- assembled structures of silica (SiO_2) spheres. We report our studies on clarifying the relationship between a polaritonic gap and a photonic stop band (Bragg gap) when they resonantly coexist in the same structure. Infiltration of opal with polarizable molecules combines the polaritonic and Bragg diffractive effects. Both effects exist independently when the Bragg (at ω=ω_B) and polaritonic (at ω=ω_T) resonances are well separated in frequency. A completely different situation occurs when ωT =ω_B. Such a condition was achieved in opals that were infiltrated with J-aggregates of cyanine dyes that have large Rabi frequency. Our measurements show some dramatic changes in the shape of the reflectivity plateaus, which are due to the interplay between the photonic band gap and the polaritonic gap. The experimental results on reflectivity and its dependence on the light propagation angle and concentration of the cyanie dyes are in agreement with the theoretical calculations. (The work was supported in part by Army Research office DAAD19-00-1-0406.)

Effect of Ba and Ti doping on magnetic properties of multiferroic Pb(Fe.sub.1/2./sub.Nb.sub.1/2./sub.)O.sub.3./sub..

Czech Academy of Sciences Publication Activity Database

Laguta, Valentyn; Glinchuk, M. D.; Maryško, Miroslav; Kuzian, R. O.; Prosandeev, S. A.; Raevskaya, S. I.; Smotrakov, V. G.; Eremkin, V. V.; Raevski, I. P.

2013-01-01

Roč. 87, č. 6 (2013), "064403-1"-"064403-8" ISSN 1098-0121 R&D Projects: GA MŠk(CZ) LM2011029; GA ČR GA13-11473S Grant - others:SAFMAT(XE) CZ.2.16/3.1.00/22132 Institutional support: RVO:68378271 Keywords : multiferroic * spin glass * superantiferromagnetism * percolation theory * EPR Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.664, year: 2013

Comparative study on optical performance and visual outcomes between two diffractive multifocal lenses: AMO Tecnis ® ZMB00 and AcrySof ® IQ ReSTOR ® Multifocal IOL SN6AD1

Directory of Open Access Journals (Sweden)

Mario Augusto Pereira Dias Chaves

2016-06-01

Full Text Available ABSTRACT Purpose: To compare the optical performance and visual outcomes between two diffractive multifocal lenses: AMO Tecnis® ZMB00 and AcrySof® ReSTOR® SN6AD1. Methods: This prospective, non-randomized comparative study included the assessment of 74 eyes in 37 patients referred for cataract surgery and candidates for multifocal intraocular lens implants. Exclusion criteria included existence of any other eye disease, previous eye surgery, high axial myopia, preoperative corneal astigmatism of >1.00 cylindrical diopter (D, and intraoperative or postoperative complications. Ophthalmological evaluation included the measurement of uncorrected distance visual acuity (UDVA, corrected distance visual acuity (CDVA, distance-corrected near visual acuity (DCNVA, and distance-corrected intermediate visual acuity (DCIVA, with analysis of contrast sensitivity (CS, wavefront, and visual defocus curve. Results: Postoperative UDVA was 0.09 and 0.08 logMAR in the SN6AD1 and ZMB00 groups, respectively (p=0.868; postoperative CDVA was 0.04 and 0.02 logMAR in the SN6AD1 and ZMB00 groups, respectively (p=0.68; DCIVA was 0.17 and 0.54 logMAR in the SN6AD1 and ZMB00 groups, respectively (p=0.000; and DCNVA was 0.04 and 0.09 logMAR in the SN6AD1 and ZMB00 groups, respectively (p=0.001. In both cases, there was an improvement in the spherical equivalent and UDVA (p<0.05. Under photopic conditions, the SN6AD1 group had better CS at low frequencies without glare (p=0.04; however, the ZMB00 group achieved better sensitivity at high frequencies with glare (p=0.003. The SN6AD1 and ZMB00 lenses exhibited similar behavior for intermediate vision, according to the defocus curve; however, the ZMB00 group showed a shorter reading distance than the SN6AD1 group. There were no significant differences regarding aberrometry between the two groups. Conclusion: Both lenses promoted better quality of vision for both long and short distances and exhibited a similar behavior for

Developmental changes in uncoupling protein 1 and F(1)-ATPase subunit levels in the golden hamster brown adipose tissue mitochondria as determined by electron microscopy in situ immunocytochemistry

Czech Academy of Sciences Publication Activity Database

Bednár, Jan; Soukup, Tomáš

2003-01-01

Roč. 22, - (2003), s. 477-486 ISSN 0231-5882 R&D Projects: GA ČR GA304/00/1653 Grant - others:NATO Research project(XX) 979876 Institutional research plan: CEZ:AV0Z5011922 Keywords : immunoelectron microscopy * uncoupling protein 1 * mitochondrial ATP synthase Subject RIV: ED - Physiology Impact factor: 0.794, year: 2003

On stability and reflection-transmission analysis of the bipenalty method in contact-impact problems: A one-dimensional, homogeneous case study

Czech Academy of Sciences Publication Activity Database

Kopačka, Ján; Tkachuk, A.; Gabriel, Dušan; Kolman, Radek; Bischoff, M.; Plešek, Jiří

2018-01-01

Roč. 113, č. 10 (2018), s. 1607-1629 ISSN 0029-5981 R&D Projects: GA MŠk(CZ) EF15_003/0000493; GA ČR(CZ) GA17-22615S; GA ČR GA17-12925S; GA ČR(CZ) GA16-03823S Grant - others:AV ČR(CZ) DAAD-16-12 Program:Bilaterální spolupráce Institutional support: RVO:61388998 Keywords : bipenalty method * explicit time integration * finite element method * penalty method * reflection-transmission analysis * stability analysis Subject RIV: JC - Computer Hardware ; Software OBOR OECD: Applied mechanics Impact factor: 2.162, year: 2016 http://onlinelibrary.wiley.com/doi/10.1002/nme.5712/full

B-spline based finite element method in one-dimensional discontinuous elastic wave propagation

Czech Academy of Sciences Publication Activity Database

Kolman, Radek; Okrouhlík, Miloslav; Berezovski, A.; Gabriel, Dušan; Kopačka, Ján; Plešek, Jiří

2017-01-01

Roč. 46, June (2017), s. 382-395 ISSN 0307-904X R&D Projects: GA ČR(CZ) GAP101/12/2315; GA MŠk(CZ) EF15_003/0000493 Grant - others:AV ČR(CZ) DAAD-16-12; AV ČR(CZ) ETA-15-03 Program:Bilaterální spolupráce; Bilaterální spolupráce Institutional support: RVO:61388998 Keywords : discontinuous elastic wave propagation * B-spline finite element method * isogeometric analysis * implicit and explicit time integration * dispersion * spurious oscillations Subject RIV: BI - Acoustics OBOR OECD: Acoustics Impact factor: 2.350, year: 2016 http://www.sciencedirect.com/science/article/pii/S0307904X17300835

Genetic isolation of a blood pressure quantitative trait locus on chromosome 2 in the spontaneously hypertensive rat

Czech Academy of Sciences Publication Activity Database

Pravenec, Michal; Zídek, Václav; Musilová, Alena; Vorlíček, Jaroslav; Křen, Vladimír; St. Lezin, E.; Kurtz, T. W.

2001-01-01

Roč. 19, č. 6 (2001), s. 1061-1064 ISSN 0263-6352 R&D Projects: GA ČR(CZ) GA305/00/1646; GA MŠk(CZ) LN00A079; GA ČR(CZ) GV204/98/K015 Grant - others:HHMI(US) 55000331 Institutional research plan: CEZ:AV0Z5011922 Keywords : spontaneously hypertensive rat * chromosome 2 * congenic Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.210, year: 2001

RESTAURANT and CAFETERIA SERVICES: ARRANGEMENTS for MAY 1st, 2003

CERN Document Server

2003-01-01

1. Restaurants As Thursday, May 1st, is an official CERN holiday, restaurants no. 2 (DSR : Bldg. 504 - Meyrin) and no. 3 (Avenance : Bldg. 866 - Prévessin) will be closed as from Wednesday, April 30 at 18h00. They will reopen on Friday, May 2nd at 6h30 (rest. no. 2) and at 7h00 (rest. no. 3). On May 1st, a limited service will be provided by restaurant no. 1 (COOP : Bldg. 501 - Meyrin) from 8h00 to 21h00 with hot meals served from 11h30 to 14h00 and from 18h00 to 19h30. 2. Newspaper stand The newspaper kiosque run by restaurant no. 1 in building 501 will be closed. 3. Decentralised services No decentralised services (satellite cafétérias etc.) will operate on May 1st, but will resume their normal activites on Friday, May 2nd, except for those dependent on restaurant no. 3 (Prévessin site) which will not reopen until Monday, May 5, 2003.

RESTAURANT AND CAFETERIA SERVICES ARRANGEMENTS FOR MAY 1ST, 2001

CERN Multimedia

Restaurant Supervisory Committee

2001-01-01

1. Restaurants As Tuesday, May 1st, is an official CERN holiday, restaurants no 2 (DSR : Bldg. 504 - Meyrin) and no 3 (Avenance : Bldg. 866 - Prévessin) will be closed as from Monday, April 30 at 18h00. They will reopen on Wednesday, May 2nd at 6h30 (rest. no 2) and at 7h00 (rest. no 3). On May 1st, a limited service will be provided by restaurant no. 1 (COOP : Bldg. 501 - Meyrin) from 8h00 to 21h00 with hot meals served from 11h30 to 14h00 and from 18h00 to 19h30. 2. Satellite cafétérias All satellite cafétérias will be closed on May 1st. They will all operate normally on Monday, April 30, except for buildings 17 (Meyrin), 865 and 892 (Prévessin) which will be closed. 3. Newspaper stand The newspaper kiosque in building 501 will be closed on May 1st.

19 CFR 19.47 - Security.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Security. 19.47 Section 19.47 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS WAREHOUSES, CONTAINER STATIONS AND CONTROL OF MERCHANDISE THEREIN Container Stations § 19.47 Security. The...

25 CFR 23.22 - Purpose of tribal government grants.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Purpose of tribal government grants. 23.22 Section 23.22... Grants to Indian Tribes for Title II Indian Child and Family Service Programs § 23.22 Purpose of tribal government grants. (a) Grants awarded under this subpart are for the establishment and operation of tribally...

Optical identification of A0620-00

International Nuclear Information System (INIS)

Wolfson, R.; Boley, F.

1976-01-01

Identification of the optical counterpart to the transient x-ray source A0620-00 was made on August 16, 1975, using image tube photography at the McGraw-Hill Observatory on Kitt Peak, Arizona. Spectra taken subsequent to the identification showed no stellar absorption or emission features. Photometric data gave a V magnitude of 11.2 +- 0.1. This is about 8 magnitudes brighter than the object appears on the Palomar Sky Survey

Altered Na+-K+ pump activity and plasma lipids in salt-hypertensive Dahl rats: relationship to Atp1a1 gene

Czech Academy of Sciences Publication Activity Database

Zicha, Josef; Negrin, C. D.; Dobešová, Zdenka; Carr, F.; Vokurková, Martina; McBride, M.; Kuneš, Jaroslav; Dominiczak, A. F.

2001-01-01

Roč. 6, č. 2 (2001), s. 99-104 ISSN 1094-8341 R&D Projects: GA ČR GA305/00/1638; GA MŠk LN00A069 Grant - others:British Heart Foundation Program(GB) RG/97009 Institutional research plan: CEZ:AV0Z5011922 Keywords : F2 hybrids * erythrocyte ion transport * erythrocyte sodium content Subject RIV: ED - Physiology Impact factor: 3.352, year: 2001

Cell Cycle Dependent Expression of Plk1 in Synchronized Porcine Fetal Fibroblasts

Czech Academy of Sciences Publication Activity Database

Anger, Martin; Kues, W. A.; Klíma, Jiří; Mielenz, M.; Kubelka, Michal; Motlík, Jan; Ešner, M.; Dvořák, P.; Carnwath, J. W.; Niemann, H.

2003-01-01

Roč. 65, č. 3 (2003), s. 245-253 ISSN 1040-452X R&D Projects: GA MŠk LN00A065 Grant - others:FIRCA(XX) R03-TW-05530-01 Institutional research plan: CEZ:AV0Z5045916 Keywords : Plk1 * serum deprivation * cell cycle Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.543, year: 2003

A telomerase-independent component of telomere loss in chromatin assembly factor 1 mutants of Arabidopsis thaliana

Czech Academy of Sciences Publication Activity Database

Jaške, K.; Mokroš, P.; Mozgová, I.; Fojtová, Miloslava; Fajkus, Jiří

2013-01-01

Roč. 122, č. 4 (2013), s. 285-293 ISSN 0009-5915 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0068 Grant - others:GA ČR(CZ) GAP501/11/0289 Institutional support: RVO:68081707 Keywords : FACTOR-I * GENOME INSTABILITY * MOLECULAR ANALYSIS Subject RIV: BO - Biophysics Impact factor: 3.260, year: 2013

42 CFR 86.12 - Application for a grant.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Application for a grant. 86.12 Section 86.12 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OCCUPATIONAL SAFETY AND HEALTH RESEARCH AND RELATED ACTIVITIES GRANTS FOR EDUCATION PROGRAMS IN OCCUPATIONAL SAFETY AND HEALTH Occupational Safety and Health Training Grants §...

On the preparation of precursors and carriers of nanoparticles by water jet technology

Czech Academy of Sciences Publication Activity Database

Sitek, Libor; Foldyna, Josef; Martinec, Petr; Klich, Jiří; Mašláň, M.

2012-01-01

Roč. 19, č. 3 (2012), s. 465-474 ISSN 1330-3651 R&D Projects: GA MŠk ED2.1.00/03.0082; GA MPO FR-TI3/733 Grant - others:GA ČR(CZ) GA205/08/0869; GA MŠk(CZ) 1M6198959201 Institutional support: RVO:68145535 Keywords : carriers of nano particles * particle disintegration * precursors of nano particles * water jet Subject RIV: JQ - Machines ; Tools Impact factor: 0.601, year: 2012 http://hrcak.srce.hr/index.php?show=clanak&id_clanak_jezik=129050

Effect of pre-strain and KMnO4 oxidation of carbon nanotubes embedded in polyurethane on strain dependent electrical resistance of the composite

Czech Academy of Sciences Publication Activity Database

Slobodian, P.; Říha, Pavel; Olejník, R.; Matyáš, J.

2018-01-01

Roč. 38, č. 2 (2018), s. 163-170 ISSN 0260-2288 R&D Projects: GA MŠk ED2.1.00/19.0409 Grant - others:Ministerstvo školství, mládeže a tělovýchovy (MŠMT)(CZ) LO1504 Institutional research plan: CEZ:AV0Z20600510 Keywords : nanotechnology * sensor s * polymer sensor s * carbon nanotubes * polyurethane composite * transverse cracking Subject RIV: BK - Fluid Dynamics OBOR OECD: Nano-processes (applications on nano-scale) Impact factor: 1.277, year: 2016

Nigerian Journal of Physiological Sciences - Vol 19, No 1 (2004)

African Journals Online (AJOL)

Noise-Induced Hearing Impairment As An Occupational Risk Factor Among Nigerian Traders · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. ADA Ighoroje, C Marchie, ED Nwobodo, 14-19. http://dx.doi.org/10.4314/njps.v19i1.32630 ...

Multiferroic properties of microwave sintered PbFe{sub 12−x}O{sub 19−δ}

Energy Technology Data Exchange (ETDEWEB)

Prathap, S. [Ceramic Composite Laboratory, Centre for Crystal Growth, SAS, VIT University, Vellore 632014, Tamil Nadu (India); Madhuri, W., E-mail: madhuriw12@gmail.com [Ceramic Composite Laboratory, Centre for Crystal Growth, SAS, VIT University, Vellore 632014, Tamil Nadu (India); IFW, Leibniz Institute for Solid State and Materials Research, Technische Universität Dresden, 01069 Dresden (Germany)

2017-05-15

The effect of iron deficiency on the structural, electrical, ferroelectric and magnetic properties of nano PbFe{sub 12-x}O{sub 19-δ} (where x=0.0, 0.25, 0.50, 0.75, 1.0) hexaferrites prepared by sol-gel auto combustion and processed by microwaves are investigated. X-ray analysis confirms single phase magneto-plumbite phase formation. The surface morphology is studied from Field Emission Scanning Electron Microscope. Further, optical properties are investigated using Fourier Transform Infrared spectra and UV–visible spectra. AC electrical conductivity is estimated as a function of temperature and frequency in the range of room temperature (RT) to 500 °C and 100 Hz to 5MHz. AC electrical conduction analysis shows that conduction is mainly due to small polaron hopping mechanism. The variation of polarization with applied electric field exhibits hysteresis loop confirming the ferroelectric nature. The initial permeability studies with varying temperature reveals that the Curie transition temperature for the present series is around 400 °C. Variation of initial permeability with frequency ranging from 100 to 5 MHz shows a constant value (except for x=0.0) opening avenues for high frequency applications. - Highlights: • The nanoPbFe{sub 12-x}O{sub 19-δ} (x=0.0, -1.0) are prepared by sol-gel auto combustion and microwave heated. • The grain size is found to be varying between 40 nm and 80nm and crystallite size 11–45 nm. • The optical band gaps are found to be varying between 1.52 and 1.89 eV. • The highest saturation polarization (P{sub s}) of all the PMF is found to be ≈75 μC/cm{sup 2}.

Effect of cold water and inverse lighting on growth performance of broiler chickens under extreme heat stress.

Science.gov (United States)

Park, Sang-oh; Park, Byung-sung; Hwangbo, Jong

2015-07-01

The present study was carried out to investigate the effect of provision of extreme heat stress diet (EHD), inverse lighting, cold water on growth performance of broiler chickens exposed to extreme heat stress. The chickens were divided into four treatment groups, (T1, T2, T3, T4) as given below: Ti (EHD 1, 10:00-19:00 dark, 19:00-10:00 light, cool water 9 degrees C); T2 (EHD 2, 10:00-19:00 dark, 19:00-10:00 light, cool water 9 degrees C); T3 (EHD 1, 09:00-18:00 dark, 18:00-09:00 light, cool water 141C); T4 (EHD 2, 09:00-18:00 dark, 18:00-09:00 light, cool water 14 degrees C. EHD 1 contained soybean oil, molasses, methionine and lysine; EHD 2 contained the same ingredients as EHD 1 with addition of vitamin C. Groups T1 and T2 were given cooler water than the othertwo groups, and displayed higher body weight increase and diet intake as compared to T3 and T4 (pstress diet, inverse lighting (10:00-19:00 dark, 19:00-10:00 light) with cold water at 9 degrees C under extreme heat stress could enhance growth performance of broiler chickens.

40 CFR 86.129-00 - Road load power, test weight, and inertia weight class determination.

Science.gov (United States)

2010-07-01

... inertia weight class determination. 86.129-00 Section 86.129-00 Protection of Environment ENVIRONMENTAL... power, test weight, and inertia weight class determination. Applicability. Section 86.129-94 (a) applies... testing using paragraphs (e)(1) and (e)(2) of this section. (f)(1) Required test dynamometer inertia...

42 CFR 137.25 - Are planning and negotiation grants available?

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Are planning and negotiation grants available? 137... for Participation in Self-Governance Planning Phase § 137.25 Are planning and negotiation grants... planning and negotiation grants available, an explanation of the application process for such grants, and...

The clinical application of determination of plasma IL-6, TNF-α and cortisol (at 8:00 and 20:00) levels for assessment of severity of the disease in patients with acute brain injury

International Nuclear Information System (INIS)

Zhao Ruoyu; Bao Yimin; Yang Yongqing

2009-01-01

Objective: To investigate the clinical usefulness of determination of plasma IL-6, TNF-α and cortisol (at 8:00 and 24:00) levels in patients with acute brain injury. Methods: Plasma IL-6, TNF-α and cortisol (at 8:00 and 24:00) levels were determined with RIA in 112 patients with acute brain injury and 58 controls. The 112 patients were of 3 groups: (1) mild, Glascow score 13-15, n=46 (2) moderate, score 9-12, n=31 (3) severe, score 3-8, n=35. Results: The plasma IL-6, TNF -α and cortisol (at 8:00 and 24:00) levels were significantly higher in the patients with brain injury than those in the controls (P all 0.05). Conclusion: Plasma IL-6, TNF-α and cortisol levels could reflect the severity of the disease in patients with acute brain injury and determination of which would be clinically useful. (authors)

Ubiquitin-activating enzyme UBA1 is required for cellular response to DNA damage

Czech Academy of Sciences Publication Activity Database

Moudrý, Pavel; Lukas, C.; Macůrek, Libor; Hanzlíková, Hana; Hodný, Zdeněk; Lukas, J.; Bartek, Jiří

2012-01-01

Roč. 11, č. 8 (2012), s. 1573-1582 ISSN 1538-4101 R&D Projects: GA ČR GA301/08/0353; GA ČR GAP301/10/1525 Grant - others:7.RP EU(XE) CZ.1.05/2.1.00/01.0030 Institutional research plan: CEZ:AV0Z50520514 Keywords : 53BP1 * DNA damage response * UBA1 * UBA6 * ubiquitylation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.243, year: 2012

30 CFR 886.12 - What can I use grant funds for?

Science.gov (United States)

2010-07-01

...; Tribal share funds as in § 872.19 of this chapter; historic coal funds as in § 872.23 of this chapter; minimum program make up funds as in § 872.28 of this chapter; prior balance replacement funds as in § 872... rights associated with the land, for up to 90 percent of the costs. (e) You may use grant funds only for...

The Acoustic Correlates of Breathy Voice: a Study of Source-Vowel INTERACTION{00}{00}{00}{00}{00}{00}{00} {00}{00}{00}{00}{00}{00}{00}{00}{00}{00}{00}{00}{00}{00} {00}{00}{00}{00}{00}{00}{00}{00}{00}{00}{00}{00}{00}{00} {00}{00}{00}{00}{00}{00}{00}{00}{00}{00}{00}{00}{00}{00}.

Science.gov (United States)

Lin, Yeong-Fen Emily

This thesis is the result of an investigation of the source-vowel interaction from the point of view of perception. Major objectives include the identification of the acoustic correlates of breathy voice and the disclosure of the interdependent relationship between the perception of vowel identity and breathiness. Two experiments were conducted to achieve these objectives. In the first experiment, voice samples from one control group and seven patient groups were compared. The control group consisted of five female and five male adults. The ten normals were recruited to perform a sustained vowel phonation task with constant pitch and loudness. The voice samples of seventy patients were retrieved from a hospital data base, with vowels extracted from sentences repeated by patients at their habitual pitch and loudness. The seven patient groups were divided, based on a unique combination of patients' measures on mean flow rate and glottal resistance. Eighteen acoustic variables were treated with a three-way (Gender x Group x Vowel) ANOVA. Parameters showing a significant female-male difference as well as group differences, especially those between the presumed breathy group and the other groups, were identified as relevant to the distinction of breathy voice. As a result, F1-F3 amplitude difference and slope were found to be most effective in distinguishing breathy voice. Other acoustic correlates of breathy voice included F1 bandwidth, RMS-H1 amplitude difference, and F1-F2 amplitude difference and slope. In the second experiment, a formant synthesizer was used to generate vowel stimuli with varying spectral tilt and F1 bandwidth. Thirteen native American English speakers made dissimilarity judgements on paired stimuli in terms of vowel identity and breathiness. Listeners' perceptual vowel spaces were found to be affected by changes in the acoustic correlates of breathy voice. The threshold of detecting a change of vocal quality in the breathiness domain was also

Geometric Effects of La1+xMg2-xNi9 (x=0.0～1.0) Ternary Alloys on Their Hydrogen Storage Capacities

Institute of Scientific and Technical Information of China (English)

Zhiqing YUAN; Guanglie LU; Bin LIAO; Yongquan LEI

2005-01-01

Structural analysis was made using X-ray diffraction (XRD) Rietveld refinement on a series of La1+xMg2-xNi9(x=0.0～1.0) ternary alloys. Results showed that each of La1+xMg2-xNi9 alloys was a PuNi3-type structure stacked by LaNi5 and (La, Mg) Ni2 blocks. Electrochemical tests revealed that discharge abilities of these La-Mg-Ni ternary alloys mainly depended on their atomic distances between (La, Mg) and Ni, which could be modified by varying the atomic ratios of La/Mg.

The role of parvovirus B19 in the pathogenesis of autoimmunity and autoimmune disease.

Science.gov (United States)

Kerr, Jonathan R

2016-04-01

Human parvovirus B19 is a single-stranded DNA virus which preferentially targets the erythroblasts in the bone marrow. B19 infection commonly causes erythema infectiosum, arthralgia, fetal death, transient aplastic crisis in patients with shortened red cell survival, and persistent infection in people who are immunocompromised. Less common clinical manifestations include atypical skin rashes, neurological syndromes, cardiac syndromes, and various cytopenias. B19 infection has also been associated with development of a variety of different autoimmune diseases, including rheumatological, neurological, neuromuscular, cardiovascular, haematological, nephrological and metabolic. Production of a variety of autoantibodies has been demonstrated to occur during B19 infection and these have been shown to be key to the pathogenesis of the particular disease process in a significant number of cases, for example, production of rheumatoid factor in cases of B19-associated rheumatoid arthritis and production of anti-glutamic acid decarboxylase (GAD) in patients with B19-associated type 1 diabetes mellitus. B19 infection has also been associated with the development of multiple autoimmune diseases in 12 individuals. Documented mechanisms in B19-associated autoimmunity include molecular mimicry (IgG antibody to B19 proteins has been shown to cross react with a variety of recognised human autoantigens, including collagen II, keratin, angiotensin II type 1 receptor, myelin basic protein, cardiolipin, and platelet membrane glycoprotein IIb/IIIa), B19-induced apoptosis with presentation of self-antigens to T lymphocytes, and the phospholipase activity of the B19 unique VP1 protein. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/

Clinical delineation of the PACS1-related syndrome--Report on 19 patients

NARCIS (Netherlands)

Schuurs-Hoeijmakers, J.H.M.; Landsverk, M.L.; Foulds, N.; Kukolich, M.K.; Gavrilova, R.H.; Greville-Heygate, S.; Hanson-Kahn, A.; Bernstein, J.A.; Glass, J.; Chitayat, D.; Burrow, T.A.; Husami, A.; Collins, K.; Wusik, K.; Aa, N. van der; Kooy, F.; Brown, K.T.; Gadzicki, D.; Kini, U.; Alvarez, S.; Fernandez-Jaen, A.; McGehee, F.; Selby, K.; Tarailo-Graovac, M.; Allen, M.; Karnebeek, C.D. van; Stavropoulos, D.J.; Marshall, C.R.; Merico, D.; Gregor, A.; Zweier, C.; Hopkin, R.J.; Chu, Y.W.; Chung, B.H.; Vries, B. de; Devriendt, K.; Hurles, M.E.; Brunner, H.G.

2016-01-01

We report on 19 individuals with a recurrent de novo c.607C>T mutation in PACS1. This specific mutation gives rise to a recognizable intellectual disability syndrome. There is a distinctive facial appearance (19/19), characterized by full and arched eyebrows, hypertelorism with downslanting

Inhibitor of DNA binding 1 (Id1) induces differentiation and proliferation of mouse embryonic carcinoma P19CL6 cells

International Nuclear Information System (INIS)

Meng, Qingzhen; Jia, Zhuqing; Wang, Weiping; Li, Binhong; Ma, Kangtao; Zhou, Chunyan

2011-01-01

Highlights: → Id1 was upregulated during the cardiac differentiation process of P19CL6 cells. → Id1 upregulated expression of cardiac specific genes Gata4, α-MHC and ISL1. → Id1 promoted proliferation of P19CL6 cells. → Overexpression of Id1 increased activity of TOP flash. → Wnt3a or LiCl treatment promoted Id1 expression in P19CL6 cells. -- Abstract: The inhibitor of DNA binding (Id) family of genes encodes negative regulators of basic helix-loop-helix transcription factors and has been implicated in such diverse cellular processes as differentiation, proliferation, apoptosis and migration. Id knockout mouse embryos display multiple cardiac defects but the specific role of Id1 in cardiac differentiation is unclear. In the present study, we investigated the function of Id1 in DMSO-induced P19CL6 cells, a widely-accepted cell model of cardiac differentiation. We found that Id1 was upregulated during the cardiac differentiation of P19CL6 cells. The expression of cardiac specific marker genes, Gata4, α-MHC and ISL1, was upregulated in P19CL6 cells stably transfected with Id1 (P19CL6-Id1) during cardiac differentiation. The overexpression of Id1 reduced the number of cells in G1 phase and increased the cell population in G2, M and S phases, while knockdown of Id1 increased the number of cells in G1 phase from 48.6 ± 2.51% to 62.2 ± 1.52% at day 0 of cardiac induction, and from 52.5 ± 3.41% to 63.7 ± 1.02% at day 3 after cardiac induction, indicating that Id1 promoted proliferation of P19CL6 cells. Luciferase assays showed that the activity of TOP flash was higher in P19CL6-Id1 cells than wildtype P19CL6 cells, while Id1 expression was also upregulated in P19CL6 cells treated with Wnt3a or LiCl. This indicates that there may be positive feedback between Id1 and Wnt signaling which plays an important role in cardiac differentiation.

Comparison of the pharmacological and biological properties of HPMA copolymer-pirarubicin conjugates: A single-chain copolymer conjugate and its biodegradable tandem-diblock copolymer conjugate

Czech Academy of Sciences Publication Activity Database

Etrych, Tomáš; Tsukigawa, K.; Nakamura, H.; Chytil, Petr; Fang, J.; Ulbrich, Karel; Otagiri, M.; Maeda, H.

2017-01-01

Roč. 106, 30 August (2017), s. 10-19 ISSN 0928-0987 R&D Projects: GA ČR(CZ) GA15-02986S; GA MŠk(CZ) LQ1604; GA MŠk(CZ) ED1.1.00/02.0109 Grant - others:AV ČR,Japan Society for the Promotion of Science(CZ) JSPS-16-05 Program:Bilaterální spolupráce Institutional support: RVO:61389013 Keywords : pirarubicin * PHPMA conjugate * tandem-diblock PHPMA conjugate Subject RIV: FR - Pharmacology ; Medidal Chemistry OBOR OECD: Pharmacology and pharmacy Impact factor: 3.756, year: 2016

WatAA: Atlas of Protein Hydration. Exploring synergies between data mining and ab initio calculations

Czech Academy of Sciences Publication Activity Database

Černý, Jiří; Schneider, Bohdan; Biedermannová, Lada

2017-01-01

Roč. 19, č. 26 (2017), s. 17094-17102 ISSN 1463-9076 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109; GA MŠk(CZ) LM2015047; GA ČR GPP205/12/P729 Grant - others:GA MŠk(CZ) LM2010005 Institutional support: RVO:86652036 Keywords : EMPIRICAL DISPERSION TERM * WATER-MOLECULES * CRYSTAL-STRUCTURES Subject RIV: EI - Biotechnology ; Bionics OBOR OECD: Computer sciences, information science, bioinformathics (hardware development to be 2.2, social aspect to be 5.8) Impact factor: 4.123, year: 2016

19 CFR 10.31 - Entry; bond.

Science.gov (United States)

2010-04-01

... 9813.00.20, HTSUS, motion-picture advertising films entered under subheading 9813.00.25, HTSUS, and... section 520(c)(1), Tariff Act of 1930, as amended, and was brought to the attention of the Customs Service...

Study of 19F and 19Ne mirror nuclei

International Nuclear Information System (INIS)

Lebrun, Claude.

1976-01-01

The electromagnetic properties of the mirror nuclei 19 F and 19 Ne were studied using the 18 O(d,nγ) 19 F, 17 O( 3 He,nγ) 19 Ne and 19 F(p,nγ) 19 Ne reactions. Lifetimes of 8 levels in 19 F and 11 levels in 19 Ne have been measured using the Doppler shift attenuation method. Weak and strong components of M 1 , E 1 and E 2 transition strengths are compared with shell model predictions. M 1 and E 2 transition strengths of conjugated nuclei (A=18 to A=34) are compiled and compared with wide configuration space shell models [fr

19 CFR 173.1 - Authority to review for error.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 2 2010-04-01 2010-04-01 false Authority to review for error. 173.1 Section 173.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) ADMINISTRATIVE REVIEW IN GENERAL § 173.1 Authority to review for error. Port directors...

19 CFR 19.34 - Customs supervision.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Customs supervision. 19.34 Section 19.34 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS WAREHOUSES, CONTAINER STATIONS AND CONTROL OF MERCHANDISE THEREIN Space Bonded for the Storage of Wheat § 19.34 Customs supervision. Port...

Fibroblast growth factor 15/19 (FGF15/19) protects from diet-induced hepatic steatosis: development of an FGF19-based chimeric molecule to promote fatty liver regeneration.

Science.gov (United States)

Alvarez-Sola, Gloria; Uriarte, Iker; Latasa, M Ujue; Fernandez-Barrena, Maite G; Urtasun, Raquel; Elizalde, Maria; Barcena-Varela, Marina; Jiménez, Maddalen; Chang, Haisul C; Barbero, Roberto; Catalán, Victoria; Rodríguez, Amaia; Frühbeck, Gema; Gallego-Escuredo, José M; Gavaldà-Navarro, Aleix; Villarroya, Francesc; Rodriguez-Ortigosa, Carlos M; Corrales, Fernando J; Prieto, Jesus; Berraondo, Pedro; Berasain, Carmen; Avila, Matias A

2017-10-01

Fibroblast growth factor 15/19 (FGF15/19), an enterokine that regulates synthesis of hepatic bile acids (BA), has been proposed to influence fat metabolism. Without FGF15/19, mouse liver regeneration after partial hepatectomy (PH) is severely impaired. We studied the role of FGF15/19 in response to a high fat diet (HFD) and its regulation by saturated fatty acids. We developed a fusion molecule encompassing FGF19 and apolipoprotein A-I, termed Fibapo, and evaluated its pharmacological properties in fatty liver regeneration. Fgf15 -/- mice were fed a HFD. Liver fat and the expression of fat metabolism and endoplasmic reticulum (ER) stress-related genes were measured. Influence of palmitic acid (PA) on FGF15/19 expression was determined in mice and in human liver cell lines. In vivo half-life and biological activity of Fibapo and FGF19 were compared. Hepatoprotective and proregenerative activities of Fibapo were evaluated in obese db/db mice undergoing PH. Hepatosteatosis and ER stress were exacerbated in HFD-fed Fgf15 -/- mice. Hepatic expression of Pparγ2 was elevated in Fgf15 -/- mice, being reversed by FGF19 treatment. PA induced FGF15/19 expression in mouse ileum and human liver cells, and FGF19 protected from PA-mediated ER stress and cytotoxicity. Fibapo reduced liver BA and lipid accumulation, inhibited ER stress and showed enhanced half-life. Fibapo provided increased db/db mice survival and improved regeneration upon PH. FGF15/19 is essential for hepatic metabolic adaptation to dietary fat being a physiological regulator of Pparγ2 expression . Perioperative administration of Fibapo improves fatty liver regeneration. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

7 CFR Exhibit B to Subpart I of... - Evaluation Report of Self-Help Technical Assistance (TA) Grants

Science.gov (United States)

2010-01-01

... ____ ____ FmHA Staff Turnover ____ ____ Bad Weather ____ ____ Loan Processing Delays ____ ____ Site Acquisition and Development ____ ____ Unavailable Loan/Grant Funds ____ ____ Lack of Participants... and percentage of loan docket rejections during reporting period: ___ (19) 7. a. Did any of the...

Spin reorientation and giant low-temperature magnetostriction of polycrystalline NdFe1.9 compound

Science.gov (United States)

Tang, Y. M.; He, Y.; Huang, Y.; Zhang, L.; Tang, S. L.; Du, Y. W.

2018-04-01

The spin reorientation and magnetostriction of polycrystalline NdFe1.9 cubic Laves phase compound were investigated. A prominent transition from tetragonal symmetry to orthorhombic symmetry in NdFe1.9 compound was determined by X-ray crystallographic study. Meanwhile, a large spontaneous magnetostriction λ111 of ∼3100 ppm was detected at 15 K, which is larger than the theoretical value of 2000 ppm predicted by single-ion model. NdFe1.9 exhibits larger low-field magnetostriction than PrFe1.9 and TbFe1.9 at 5 K in the magnetic field range of H ≤ 13 kOe, which makes it a promising material for low-temperature applications. The present work might be helpful to discover inexpensive Nd-based high-performance magnetostrictive and even magnetoelectric materials for low-temperature applications.

Alfven, Hugo. Die drei Schwedischen Rhapsodien op. 19, 24 und 47 / Andreas Meyer

Index Scriptorium Estoniae

Meyer, Andreas

1995-01-01

Uuest heliplaadist "Alfven, Hugo. Die drei Schwedischen Rhapsodien op. 19, 24 und 47, En skärgardssägen op. 20, Suite aus Der Berkönig. Königliche Stockholmer Philharmoniker, Neeme Järvi". AD: 1987-1992. BIS?Disco-Center CD 725 (WD: 77'00")

Complexes of gamma-tubulin with nonreceptor protein tyrosine kinases Src and Fyn in differentiating P19 embryonal carcinoma cells

Czech Academy of Sciences Publication Activity Database

Kukharskyy, Vitaliy; Sulimenko, Vadym; Macůrek, Libor; Sulimenko, Tetyana; Dráberová, Eduarda; Dráber, Pavel

2004-01-01

Roč. 298, - (2004), s. 218-228 ISSN 0014-4827 R&D Projects: GA AV ČR IAA5052004; GA ČR GA304/00/0553; GA ČR GA304/04/1273; GA MŠk LN00A026 Keywords : gamma-tubulin * P19 cells * Fyn and Src kinase Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.007, year: 2004

Polyguluronate sulfate and its oligosaccharides but not heparin promotes FGF19/FGFR1c signaling

Science.gov (United States)

Lan, Ying; Zeng, Xuan; Guo, Zhihua; Zeng, Pengjiao; Hao, Cui; Zhao, Xia; Yu, Guangli; Zhang, Lijuan

2017-06-01

Fibroblast growth factor 19(FGF19) functions as a hormone by affecting glucose metabolism. FGF19 improves glucose tolerance when overexpressed in mice with impaired glucose tolerance or diabetes. A functional cellular FGF19 receptor consists of FGF receptor (FGFR) and glycosaminoglycan complexed with either α Klotho or β Klotho. Interestingly, in mice with diet-induced diabetes, a single injection of FGF1 is enough to restore blood sugar levels to a healthy range. FGF1 binds heparin with high affinity whereas FGF19 does not, indicating that polysaccharides other than heparin might enhance FGF19/FGFR signaling. Using a FGFs/FGFR1c signaling-dependent BaF3 cell proliferation assay, we discovered that polyguluronate sulfate (PGS) and its oligosaccharides, PGS12 and PGS25, but not polyguluronate (PG), a natural marine polysaccharide, enhanced FGF19/FGFR1c signaling better than that of heparin based on 3H-thymidine incorporation. Interestingly, PGS6, PGS8, PGS10, PGS12, PGS25, and PGS, but not PG, had comparable FGF1/FGFR1c signal-stimulating activity compared to that of heparin. These results indicated that PGS and its oligosaccharides were excellent FGF1/FGFR1c and FGF19/FGFR1c signaling enhancers at cellular level. Since the inexpensive PGS and PGS oligosaccharides can be absorbed through oral route, these seaweed-derived compounds merit further investigation as novel agents for the treatment of type 2 diabetes through enhancing FGF1/FGFR1c and FGF19/FGFR1c signaling in future.

19 CFR 177.1 - General ruling practice and definitions.

Science.gov (United States)

2010-04-01

... authority to represent is known, any person appearing before the Customs Service as an agent in connection... 19 Customs Duties 2 2010-04-01 2010-04-01 false General ruling practice and definitions. 177.1 Section 177.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY...

Persistent modification of Nav1.9 following chronic exposure to insecticides and pyridostigmine bromide

International Nuclear Information System (INIS)

Nutter, Thomas J.; Cooper, Brian Y.

2014-01-01

Many veterans of the 1991 Gulf War (GW) returned from that conflict with a widespread chronic pain affecting deep tissues. Recently, we have shown that a 60 day exposure to the insecticides permethrin, chlorpyrifos, and pyridostigmine bromide (NTPB) had little influence on nociceptor action potential forming Na v 1.8, but increased K v 7 mediated inhibitory currents 8 weeks after treatment. Using the same exposure regimen, we used whole cell patch methods to examine whether the influences of NTPB could be observed on Na v 1.9 expressed in muscle and vascular nociceptors. During a 60 day exposure to NTPB, rats exhibited lowered muscle pain thresholds and increased rest periods, but these measures subsequently returned to normal levels. Eight and 12 weeks after treatments ceased, DRG neurons were excised from the sensory ganglia. Whole cell patch studies revealed little change in voltage dependent activation and deactivation of Na v 1.9, but significant increases in the amplitude of Na v 1.9 were observed 8 weeks after exposure. Cellular studies, at the 8 week delay, revealed that NTPB also significantly prolonged action potential duration and afterhyperpolarization (22 °C). Acute application of permethrin (10 μM) also increased the amplitude of Na v 1.9 in skin, muscle and vascular nociceptors. In conclusion, chronic exposure to Gulf War agents produced long term changes in the amplitude of Na v 1.9 expressed in muscle and vascular nociceptors. The reported increases in K v 7 amplitude may have been an adaptive response to increased Na v 1.9, and effectively suppressed behavioral pain measures in the post treatment period. Factors that alter the balance between Na v 1.9 and K v 7 could release spontaneous discharge and produce chronic deep tissue pain. - Highlights: • Rats were treated 60 days with permethrin, chlorpyrifos and pyridostigmine bromide. • 8 weeks after treatments, Nav1.9 activation and deactivation were unchanged. • The amplitude and

Characterization of Y1-xCaxBa2Cu4O8 (x=0.0˜ 0.1) with Double Cu-O Chains by Raman Spectra

Science.gov (United States)

Kodama, Yasuharu; Tanemura, Sakae; Ikeda, Teruki

1991-08-01

Raman spectra of Y1-xCaxBa2Cu4O8 (x=0.0, 0.02, 0.05 and 0.1) ceramic samples synthesized under high oxygen pressure were investigated. Seven clear peaks assigned to Ag modes were observed for the sample with x=0. With increasing x, the peaks at 238 cm-1, 332 cm-1, 430 cm-1 and 590 cm-1 were broadened. The origin of the broadening of the peaks at 238 cm-1 and 590 cm-1 is considered to be the destruction of the double Cu-O chains due to the substitution of Ca for Y.

Catalytic activity of matrix metalloproteinase-19 is essential for tumor suppressor and anti-angiogenic activities in nasopharyngeal carcinoma

Czech Academy of Sciences Publication Activity Database

Chan, K.C.; Ko, J.M.; Lung, H.L.; Sedláček, Radislav; Zhang, Z.F.; Luo, D.Z.; Feng, Z.B.; Chen, S.; Chen, H.; Chan, K.W.; Tsao, S.W.; Chua, D.T.; Zabarovsky, E.R.; Stanbridge, E.J.; Lung, M.L.

2011-01-01

Roč. 129, č. 8 (2011), s. 1826-1837 ISSN 0020-7136 Grant - others:Research Grants Council of the Hong Kong Special Administrative Region(CN) HKU661708M Institutional research plan: CEZ:AV0Z50520514 Keywords : MMP19 * nasopharyngeal carcinoma * tumor suppressor gene * angiogenesis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.444, year: 2011

19 CFR 141.1 - Liability of importer for duties.

Science.gov (United States)

2010-04-01

... Customs by the broker. (c) Claim against estate of importer. The claim of the Government for unpaid duties... 19 Customs Duties 2 2010-04-01 2010-04-01 false Liability of importer for duties. 141.1 Section 141.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT...

19 CFR 19.10 - Examination packages.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Examination packages. 19.10 Section 19.10 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY... Examination packages. Merchandise sent from a bonded warehouse to the appraiser's stores for examination shall...

The effect of constraint level on a crack path

Czech Academy of Sciences Publication Activity Database

Ševčík, Martin; Hutař, Pavel; Náhlík, Luboš; Seitl, Stanislav

2013-01-01

Roč. 29, APR (2013), s. 83-92 ISSN 1350-6307. [Crack paths 2012. Gaeta, 19.09.2012-21.09.2012] R&D Projects: GA ČR GA106/09/1954; GA MŠk(CZ) ED1.1.00/02.0068; GA MŠk EE2.3.30.0063 Grant - others:Rada Programu interní podpory projektů mezinárodní spolupráce AV ČR(CZ) M100420901 Institutional support: RVO:68081723 Keywords : Fracture mechanics * Constraint effect * Crack propagation * MTS criterion * Gear rim Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 1.130, year: 2013

Troy, a tumor necrosis factor receptor family member, interacts with Lgr5 to inhibit Wnt signaling in intestinal stem cells

Czech Academy of Sciences Publication Activity Database

Fafílek, Bohumil; Krausová, Michaela; Vojtěchová, Martina; Pospíchalová, Vendula; Tůmová, Lucie; Šloncová, Eva; Huranová, Martina; Stančíková, Jitka; Hlavatá, Adéla; Švec, Jiří; Sedláček, Radislav; Lukšan, O.; Olivierus, M.; Voska, L.; Jirsa, M.; Pačes, Jan; Kolář, Michal; Krivjanská, M.; Klimešová, Klára; Tlaskalová-Hogenová, Helena; Kořínek, Vladimír

2013-01-01

Roč. 144, č. 2 (2013), s. 381-391 ISSN 0016-5085 R&D Projects: GA MŠk 2B06077; GA ČR GAP305/11/1780; GA ČR(CZ) GAP304/11/1252; GA ČR(CZ) GD204/09/H058; GA ČR GAP305/10/2143; GA AV ČR KAN200520801 Grant - others:MŠMT(CZ) CZ 1.05/1.1.00/02.0109 Institutional support: RVO:68378050 ; RVO:61388971 Keywords : mouse model of colon cancer * β-catenin * TCF * Tnfrsf19 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 13.926, year: 2013

GS-8374, a Prototype Phosphonate-Containing Inhibitor of HIV-1 Protease, Effectively Inhibits Protease Mutants with Amino Acid Insertions

Czech Academy of Sciences Publication Activity Database

Grantz Šašková, Klára; Kožíšek, Milan; Stray, K.; Jong de, D.; Řezáčová, Pavlína; Brynda, Jiří; Maarseveen van, N. M.; Nijhuis, M.; Cihlář, T.; Konvalinka, Jan

2014-01-01

Roč. 88, č. 6 (2014), s. 3586-3590 ISSN 0022-538X R&D Projects: GA ČR GAP207/11/1798 Grant - others:OPPC(XE) CZ.2.16/3.1.00/24016 Institutional support: RVO:61388963 ; RVO:68378050 Keywords : virus type-1 protease * antiviral activity * drug resistance Subject RIV: EE - Microbiology, Virology Impact factor: 4.439, year: 2014

Parvovirus B19 1A complete genome from a fatal case in Brazil

Directory of Open Access Journals (Sweden)

Liliane Costa Conteville

2015-09-01

Full Text Available Parvovirus B19 (B19V infects individuals worldwide and is associated with an ample range of pathologies and clinical manifestations. B19V is classified into three distinct genotypes, all identified in Brazil. Here, we report a complete sequence of a B19V genotype 1A that was obtained by high-throughput metagenomic sequencing. This genome provides information that will contribute to the studies on B19V epidemiology and evolution.

Different Recognition of DNA Modified by Antitumor Cisplatin and Its Clinically Ineffective trans Isomer by Tumor Suppressor Protein p53

Czech Academy of Sciences Publication Activity Database

Kašpárková, Jana; Pospíšilová, Š.; Brabec, Viktor

2001-01-01

Roč. 276, č. 19 (2001), s. 16064-16069 ISSN 0021-9258 R&D Projects: GA ČR GA305/99/0695; GA ČR GA305/01/0418; GA ČR GA301/00/P094; GA AV ČR IAA5004101; GA MZd NL6058 Grant - others:HHMI(US) 55000313; Wellcome Trust(GB) 062366/Z/00/Z Institutional research plan: CEZ:AV0Z5004920 Keywords : Interstrand cross-links * platinum complexes * supercoiled DNA Subject RIV: BO - Biophysics Impact factor: 7.258, year: 2001

75 FR 6354 - NOAA Great Lakes Habitat Restoration Program Project Grants under the Great Lakes Restoration...

Science.gov (United States)

2010-02-09

...-04] RIN 0648-ZC10 NOAA Great Lakes Habitat Restoration Program Project Grants under the Great Lakes... Atmospheric Administration (NOAA), Department of Commerce. ACTION: Notice of funding availability; Date... on January 19, 2010. That notice announced the NOAA Great Lakes Habitat Restoration Program Project...

77 FR 65237 - Self-Regulatory Organizations; The NASDAQ Stock Market LLC; Order Granting Approval of Proposed...

Science.gov (United States)

2012-10-25

...-Regulatory Organizations; The NASDAQ Stock Market LLC; Order Granting Approval of Proposed Rule Change...Tree Trust October 19, 2012. I. Introduction On August 15, 2012, The NASDAQ Stock Market LLC (``Nasdaq... temporary defensive strategies that are inconsistent with its investment strategies, the Fund's ability to...

Age-related differences in 1p and 19q deletions in oligodendrogliomas

Directory of Open Access Journals (Sweden)

Del Bigio Marc R

2003-12-01

Full Text Available Abstract Background Recent reports indicate that anaplastic oligodendrogliomas frequently show allelic losses on chromosome arms 1p and 19q, and that these deletions are associated with better chemotherapeutic response and overall patient survival. Because of the diversified genetic makeup of the population and the centralized provincial referral system for brain tumor patients in Manitoba, the epidemiological features of such tumors sometimes differ from the published data acquired from non-community based settings. In this study, we assessed the prevalence of allelic deletions for chromosome arms 1p and 19q in anaplastic and in low-grade oligodendrogliomas in the Manitoba population. Methods Loss of heterozygosity (LOH analysis of brain tumors was carried out using 4 microsatellite markers (D1S508, D1S2734, D19S219 and D19S412 and a PCR based assay. The tumors were consecutively acquired during the period September 1999–March 2001 and a total of 63 tumors were assessed. Results We found that allelic loss of chromosome 1p and 19q was higher in oligodendrogliomas than in other diffuse gliomas and that for anaplastic oligodendrogliomas, younger patients exhibited significantly more deletions than older patients (>60 years of age. Conclusions These studies suggest that age may be a factor in the genetic alterations of oligodendrogliomas. In addition, these studies demonstrate that this assay can easily be carried out in a cost-effective manner in a small tertiary center.

Serum-dependent selective expression of EhTMKB1-9, a member of Entamoeba histolytica B1 family of transmembrane kinases.

Directory of Open Access Journals (Sweden)

Shiteshu Shrimal

Full Text Available Entamoeba histolytica transmembrane kinases (EhTMKs can be grouped into six distinct families on the basis of motifs and sequences. Analysis of the E. histolytica genome revealed the presence of 35 EhTMKB1 members on the basis of sequence identity (>or=95%. Only six homologs were full length containing an extracellular domain, a transmembrane segment and an intracellular kinase domain. Reverse transcription followed by polymerase chain reaction (RT-PCR of the kinase domain was used to generate a library of expressed sequences. Sequencing of randomly picked clones from this library revealed that about 95% of the clones were identical with a single member, EhTMKB1-9, in proliferating cells. On serum starvation, the relative number of EhTMKB1-9 derived sequences decreased with concomitant increase in the sequences derived from another member, EhTMKB1-18. The change in their relative expression was quantified by real time PCR. Northern analysis and RNase protection assay were used to study the temporal nature of EhTMKB1-9 expression after serum replenishment of starved cells. The results showed that the expression of EhTMKB1-9 was sinusoidal. Specific transcriptional induction of EhTMKB1-9 upon serum replenishment was further confirmed by reporter gene (luciferase expression and the upstream sequence responsible for serum responsiveness was identified. EhTMKB1-9 is one of the first examples of an inducible gene in Entamoeba. The protein encoded by this member was functionally characterized. The recombinant kinase domain of EhTMKB1-9 displayed protein kinase activity. It is likely to have dual specificity as judged from its sensitivity to different kinase inhibitors. Immuno-localization showed EhTMKB1-9 to be a surface protein which decreased on serum starvation and got relocalized on serum replenishment. Cell lines expressing either EhTMKB1-9 without kinase domain, or EhTMKB1-9 antisense RNA, showed decreased cellular proliferation and target cell

19 CFR 19.38 - Supervision of exportation.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Supervision of exportation. 19.38 Section 19.38 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS WAREHOUSES, CONTAINER STATIONS AND CONTROL OF MERCHANDISE THEREIN Duty-Free Stores § 19.38 Supervision of exportation. (a) Sales...

FEMA Grants Program Directorate - Preparedness (Non-Disaster) and Assistance to Firefighter Grants

Data.gov (United States)

Department of Homeland Security — The Grant Programs Directorate (GPD) strategically and effectively administers and manages FEMA grants to ensure critical and measurable results for customers and...

Magnetic Properties and Magnetocaloric Effect in Layered NdMn1.9Ti0.1Si2

Directory of Open Access Journals (Sweden)

M.F. Md Din

2014-04-01

Full Text Available The structural and magnetic properties of the NdMn1.9Ti0.1Si2 compund have been studied by high-intensity x-ray and high-resolution neutron powder diffraction, specific heat, dc magnetization, and differential scanning calorimetry measurements over the temperature range of 3-450 K. The Curie temperature and Néel temperature of layered NdMn1.9Ti0.1Si2 are indicated as TC ~ 22 K and TN ~ 374 K respectively. The first order magnetic transition from antiferromagnetic [AFil-type] to ferromagnetic [F(Nd+Fmc] around TC is found in layered NdMn1.9Ti0.1Si2 and is associated with large magnetocaloric effect. This behavior has been confirmed as a contribution of the magnetostructural coupling by using neutron and x-ray powder diffraction. The magnetic entropy change –ΔSM ~ 15.3 J kg-1 K-1 and adiabatic temperature change ΔTad ~ 4.7 K have been determined using magnetization and specific heat measurement under 0-5 T applied fields. This compound exhibits almost no thermal and magnetic hysteresis, thus potentially applicable in low temperature region for magnetic refrigerator material

High magnetic ordering temperature in the perovskites Sr{sub 4-x}La{sub x}Fe{sub 3}ReO{sub 12} (x=0.0, 1.0, 2.0)

Energy Technology Data Exchange (ETDEWEB)

Retuerto, M.; Li, M.-R.; Go, Y.B. [Department of Chemistry and Chemical Biology, Rutgers, The State University of New Jersey, 610 Taylor Road, Piscataway, NJ 08854 (United States); Ignatov, A.; Croft, M. [Department of Physics and Astronomy, Rutgers, The State University of New Jersey, 136 Frelinghuysen Road, Piscataway, NJ 08854 (United States); Ramanujachary, K.V. [Department of Chemistry and Physics, Rowan University, 210 Mullica Hill Road, Glassboro, NJ 08028 (United States); Herber, R.H.; Nowik, I. [Racah Institute of Physics, Hebrew University, Jerusalem, 91904 Israel (Israel); Hodges, J.P. [Spallation Neutron Source, Oak Ridge National Laboratory, Oak Ridge, TN 37831 (United States); Dachraoui, W.; Hadermann, J. [EMAT, University of Antwerp, Groenenborgerlaan 171, 2020 Antwerp (Belgium); Greenblatt, M., E-mail: martha@rutchem.rutgers.edu [Department of Chemistry and Chemical Biology, Rutgers, The State University of New Jersey, 610 Taylor Road, Piscataway, NJ 08854 (United States)

2012-10-15

A series of perovskites Sr{sub 4-x}La{sub x}Fe{sub 3}ReO{sub 12} (x=0.0, 1.0, 2.0) has been prepared by wet chemistry methods. The structure analyses by powder X-ray and neutron diffraction and electron microscopy show that these compounds adopt simple perovskite structures without cation ordering over the B sites: tetragonal (I4/mcm) for x=0.0 and 1.0 and orthorhombic (Pbmn) for x=2.0. The oxidation states of the cations in the compound with x=0.0 appear to be Fe{sup 3+/4+} and Re{sup 7+} and decrease for both with La substitution as evidenced by X-ray absorption spectroscopy. All the compounds are antiferromagnetically ordered above room temperature, as demonstrated by Moessbauer spectroscopy and the magnetic structures, which were determined by powder neutron diffraction. The substitution of Sr by La strongly affects the magnetic properties with an increase of T{sub N} up to {approx}750 K. - Graphical abstract: High resolution transmission electron microscopy image of Sr{sub 4-x}La{sub x}Fe{sub 3}ReO{sub 12} (x=2.0), showing twin domains. Fourier transforms are given of the areas indicated by the circles. Highlights: Black-Right-Pointing-Pointer Sr{sub 4-x}La{sub x}Fe{sub 3}ReO{sub 12} (x=0.0, 1.0, 2.0) perovskites prepared by wet chemistry. Black-Right-Pointing-Pointer PXD, PND, ED, indicate no cation ordering, I4/mcm) for x=0.0, 1.0, Pbmn for x=2. Black-Right-Pointing-Pointer XAS show oxidation states Fe{sup 3+/4+} and Re{sup 7+}; both decrease with increasing x. Black-Right-Pointing-Pointer All order antiferromagnetically above RT, with highest T{sub N} {approx}750 K.

76 FR 4968 - Self-Regulatory Organizations; NYSE Arca, Inc.; Order Granting Approval of Proposed Rule Change...

Science.gov (United States)

2011-01-27

...-Regulatory Organizations; NYSE Arca, Inc.; Order Granting Approval of Proposed Rule Change Relating to Listing and Trading Shares of the AdvisorShares Active Bear ETF January 19, 2011. I. Introduction On... of the security or investment in the portfolio. \\14\\ Under accounting procedures followed by the Fund...

42 CFR 51b.605 - How will grant applications be evaluated and the grants awarded?

Science.gov (United States)

2010-10-01

... HUMAN SERVICES GRANTS PROJECT GRANTS FOR PREVENTIVE HEALTH SERVICES Grants for Research, Demonstrations... has potential to directly benefit the national venereal disease control effort? (2) Are the project...

Wetland Program Development Grants (WPDGs)

Data.gov (United States)

U.S. Environmental Protection Agency — The Wetland Grant Database (WGD) houses grant data for Wetland Program Development Grants (created by EPA in 1990 under the Clean Water Act Section 104(b)(3)...

Fast and simultaneous determination of 1 H-1 H and 1 H-19 F scalar couplings in complex spin systems: Application of PSYCHE homonuclear broadband decoupling.

Science.gov (United States)

Kakita, Veera Mohana Rao; Rachineni, Kavitha; Hosur, Ramakrishna V

2017-07-21

The present manuscript focuses on fast and simultaneous determination of 1 H- 1 H and 1 H- 19 F scalar couplings in fluorinated complex steroid molecules. Incorporation of broadband PSYCHE homonuclear decoupling in the indirect dimension of zero-quantum filtered diagonal experiments (F1-PSYCHE-DIAG) suppresses 1 H- 1 H scalar couplings; however, it retains 1 H- 19 F scalar couplings (along F1 dimension) for the 19 F coupled protons while preserving the pure-shift nature for 1 H resonances uncoupled to 19 F. In such cases, along the direct dimensions, 1 H- 1 H scalar coupling multiplets deconvolute and they appear as duplicated multiplets for the 19 F coupled protons, which facilitates unambiguous discrimination of 19 F coupled 1 H chemical sites from the others. Further, as an added advantage, data acquisition has been accelerated by invoking the known ideas of spectral aliasing in the F1-PSYCHE-DIAG scheme and experiments demand only ~10 min of spectrometer times. Copyright © 2017 John Wiley & Sons, Ltd.

Ferromagnetic resonance response of electron-beam patterned arrays of ferromagnetic nanoparticles

Science.gov (United States)

Jung, Sukkoo; Watkins, Byron; Feller, Jeffrey; Ketterson, John; Chandrasekhar, Venkat

2001-03-01

We report on the fabrication and the dynamic magnetic properties of periodic permalloy dot arrays. Electron-beam lithography and e-gun evaporation have been used to make the arrays with the aspect ratio of 2 (dot diameter : 40 nm, height : 80 nm) and periods of 100 - 200 nm. The magnetic properties of the arrays and their interactions have been investigated by ferromagnetic resonance (FMR), magnetic force microscopy (MFM), and SQUID magnetometry. The measured FMR data show that the position and magnitude of resonant absorption peaks strongly depend on the angle between magnetic field and the lattice structure. The results of dot arrays with various kinds of structural parameters will be presented. Supported by Army Research Office, DAAD19-99-1-0334/P001

Green fluorescent protein (GFP color reporter gene visualizes parvovirus B19 non-structural segment 1 (NS1 transfected endothelial modification.

Directory of Open Access Journals (Sweden)

Thomas Wurster

Full Text Available BACKGROUND: Human Parvovirus B19 (PVB19 has been associated with myocarditis putative due to endothelial infection. Whether PVB19 infects endothelial cells and causes a modification of endothelial function and inflammation and, thus, disturbance of microcirculation has not been elucidated and could not be visualized so far. METHODS AND FINDINGS: To examine the PVB19-induced endothelial modification, we used green fluorescent protein (GFP color reporter gene in the non-structural segment 1 (NS1 of PVB19. NS1-GFP-PVB19 or GFP plasmid as control were transfected in an endothelial-like cell line (ECV304. The endothelial surface expression of intercellular-adhesion molecule-1 (CD54/ICAM-1 and extracellular matrix metalloproteinase inducer (EMMPRIN/CD147 were evaluated by flow cytometry after NS-1-GFP or control-GFP transfection. To evaluate platelet adhesion on NS-1 transfected ECs, we performed a dynamic adhesion assay (flow chamber. NS-1 transfection causes endothelial activation and enhanced expression of ICAM-1 (CD54: mean ± standard deviation: NS1-GFP vs. control-GFP: 85.3 ± 11.2 vs. 61.6 ± 8.1; P<0.05 and induces endothelial expression of EMMPRIN/CD147 (CD147: mean ± SEM: NS1-GFP vs. control-GFP: 114 ± 15.3 vs. 80 ± 0.91; P<0.05 compared to control-GFP transfected cells. Dynamic adhesion assays showed that adhesion of platelets is significantly enhanced on NS1 transfected ECs when compared to control-GFP (P<0.05. The transfection of ECs was verified simultaneously through flow cytometry, immunofluorescence microscopy and polymerase chain reaction (PCR analysis. CONCLUSIONS: GFP color reporter gene shows transfection of ECs and may help to visualize NS1-PVB19 induced endothelial activation and platelet adhesion as well as an enhanced monocyte adhesion directly, providing in vitro evidence of possible microcirculatory dysfunction in PVB19-induced myocarditis and, thus, myocardial tissue damage.

22 CFR 64.10 - Grant not to constitute a gift.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Grant not to constitute a gift. 64.10 Section... EMPLOYEES IN CULTURAL EXCHANGE PROGRAMS OF FOREIGN COUNTRIES § 64.10 Grant not to constitute a gift. A grant made under an approved program shall not constitute a gift for purposes of 22 CFR 10.735-203 and...

76 FR 19902 - Energy Conservation Program for Consumer Products: Decision and Order Granting 180-Day Extension...

Science.gov (United States)

2011-04-11

... Furnace Company; (16) New Yorker Residential Heating Boilers; (17) Nordyne; (18) NY Thermal Inc.; (19... Products LLC; (24) Trane; (25) Triangle Tube; (26) US Boiler Company; and (27) Weil-McLain. In the same... Conservation Program for Consumer Products: Decision and Order Granting 180-Day Extension of Compliance Date...

Microstructure and functional properties of Fe73.5Cu1Nb3Si15.5B7 amorphous alloy

Czech Academy of Sciences Publication Activity Database

Blagojević, V. A.; Vasić, M.; David, Bohumil; Minić, Dušan M.; Pizúrová, Naděžda; Žák, Tomáš; Minić, Dragica M.

2014-01-01

Roč. 145, 1-2 (2014), s. 12-17 ISSN 0254-0584 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0068; GA ČR(CZ) GAP108/11/1350 Grant - others:Ministry of Education and Science of Serbia(SD) 172015 Institutional support: RVO:68081723 Keywords : amorphous materials * mechanical properties * magnetic properties * annealing Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.259, year: 2014

VENUS-2 Benchmark Problem Analysis with HELIOS-1.9

International Nuclear Information System (INIS)

Jeong, Hyeon-Jun; Choe, Jiwon; Lee, Deokjung

2014-01-01

Since there are reliable results of benchmark data from the OECD/NEA report of the VENUS-2 MOX benchmark problem, by comparing benchmark results users can identify the credibility of code. In this paper, the solution of the VENUS-2 benchmark problem from HELIOS 1.9 using the ENDF/B-VI library(NJOY91.13) is compared with the result from HELIOS 1.7 with consideration of the MCNP-4B result as reference data. The comparison contains the results of pin cell calculation, assembly calculation, and core calculation. The eigenvalues from those are considered by comparing the results from other codes. In the case of UOX and MOX assemblies, the differences from the MCNP-4B results are about 10 pcm. However, there is some inaccuracy in baffle-reflector condition, and relatively large differences were found in the MOX-reflector assembly and core calculation. Although HELIOS 1.9 utilizes an inflow transport correction, it seems that it has a limited effect on the error in baffle-reflector condition

Molecular Study of Parvovirus B19 Infection in Children with

Science.gov (United States)

Tharwat Abou El-Khier, Noha; Darwish, Ahmad; El Sayed Zaki, Maysaa

2018-02-26

Background: Parvovirus B19 is a common viral infection in children. Nearby evidences are present about its association with acute leukemia, especially acute lymphoblast leukemia. Nevertheless, scanty reports have discussed any role in acute myeloid leukemia (AML). Purpose: To evaluate the frequency of virological markers of B19 infection including its DNA along with specific immunoglobulins G (IgG) and M (IgM) among children with newly diagnosed AML. Besides, describing the clinical importance of Parvovirus B19 infection in those patients. Patients and methods: A case-control retrospective study was conducted on 48 children recently diagnosed with AML before and during chemotherapy induction and 60 healthy control. Specific serum IgM and IgG levels were determined by enzyme linked immunosorbant assay (ELISA) and DNA detection by polymerase chain reaction (PCR). Results: Parvovirus DNA was detected in 20 patients with AML. IgM was found in sera of four patients and one case had positive DNA and IgG (5%). Patients with recent parvovirus B19 infection had a significantly reduced hemoglobin levels, RBCs counts, platelet counts, neutrophil counts and absolute lymphocytosis (p=0.01, p=0.0001, p=0.01, p=0.02, p=0.0003, respectively). There were no clinical findings with statistically significant association to recent infection. Half of the patients with AML had positive PCR and/or IgM for parvovirus B19. Among children with AML under chemotherapy, there were reduced hemoglobin levels (P=0.03), reduced platelet counts (P=0.0001) and absolute neutropenia (mean±SD, 1.200 ±1.00) in those with parvovirus B19 infection. More than half of patients with parvovirus B19 (72.2%) had positive PCR and/or IgM and 36.4% of them had positive IgG. Conclusion: This study highlights that parvovirus B19 is common in children with AML either at diagnosis or under chemotherapy. There are no clinical manifestations that can be used as markers for its presence, but hematological laboratory

17 CFR 240.15c1-9 - Use of pro forma balance sheets.

Science.gov (United States)

2010-04-01

... pro forma balance sheets. The term manipulative, deceptive, or other fraudulent device or contrivance... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Use of pro forma balance sheets. 240.15c1-9 Section 240.15c1-9 Commodity and Securities Exchanges SECURITIES AND EXCHANGE...

12038_2015_9557_Article_ESM 1..6

Indian Academy of Sciences (India)

2.20E-09. <0.001 regulation of phosphorus metabolic process. 19. 7. 152. 1.618. 2.40E-09. <0.001 negative regulation of cell cycle. 20. 13. 1227. 1.017. 1.20E-08. <0.001 cell development. 21. 12. 1018. 1.054. 1.50E-08. <0.001 positive regulation of cellular process. 22. 7. 207. 1.478. 2.00E-08. <0.001 induction of apoptosis.

Superfund Technical Assistance Grants

Data.gov (United States)

U.S. Environmental Protection Agency — This asset includes data related to the Superfund Technical Assistance Grant program, including grant number, award amounts, award dates, period of performance,...

77 FR 59934 - National Center for Advancing Translational Sciences; Notice of Closed Meetings

Science.gov (United States)

2012-10-01

.... to 3:00 p.m. Agenda: To review and evaluate grant applications. Place: Hilton Washington DC/Rockville...:00 p.m. Agenda: To review and evaluate grant applications. Place: Hilton Rockville, 1750 Rockville.... Time: 8:00 a.m. to 5:00 p.m. Agenda: To review and evaluate grant applications. Place: Hilton Rockville...

19p13.1 is a triple-negative-specific breast cancer susceptibility locus

DEFF Research Database (Denmark)

Stevens, Kristen N; Fredericksen, Zachary; Vachon, Celine M

2012-01-01

(PR), and human epidermal growth factor receptor-2 (HER2) status, using 48,869 breast cancer cases and 49,787 controls from the Breast Cancer Association Consortium (BCAC). Variants from 19p13.1 were not associated with breast cancer overall or with ER-positive breast cancer but were significantly......The 19p13.1 breast cancer susceptibility locus is a modifier of breast cancer risk in BRCA1 mutation carriers and is also associated with the risk of ovarian cancer. Here, we investigated 19p13.1 variation and risk of breast cancer subtypes, defined by estrogen receptor (ER), progesterone receptor...... associated with ER-negative breast cancer risk [rs8170 OR, 1.10; 95% confidence interval (CI), 1.05-1.15; P = 3.49 × 10(-5)] and triple-negative (ER-, PR-, and HER2-negative) breast cancer (rs8170: OR, 1.22; 95% CI, 1.13-1.31; P = 2.22 × 10(-7)). However, rs8170 was no longer associated with ER...

42 CFR 59.9 - For what purpose may grant funds be used?

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false For what purpose may grant funds be used? 59.9 Section 59.9 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS GRANTS FOR FAMILY PLANNING SERVICES Project Grants for Family Planning Services § 59.9 For what purpose may...

Do AAO-HNSF CORE Grants Predict Future NIH Funding Success?

Science.gov (United States)

Eloy, Jean Anderson; Svider, Peter F; Kanumuri, Vivek V; Folbe, Adam J; Setzen, Michael; Baredes, Soly

2014-08-01

To determine (1) whether academic otolaryngologists who have received an American Academy of Otolaryngology- Head and Neck Surgery Foundation (AAO-HNSF) Centralized Otolaryngology Research Efforts (CORE) grant are more likely to procure future National Institutes of Health (NIH) funding; (2) whether CORE grants or NIH Career Development (K) awards have a stronger association with scholarly impact. Historical cohort. Scholarly impact, as measured by the h-index, publication experience, and prior grant history, were determined for CORE-funded and non-CORE-funded academic otolaryngologists. All individuals were assessed for NIH funding history. Of 192 academic otolaryngologists with a CORE funding history, 39.6% had active or prior NIH awards versus 15.1% of 1002 non-CORE-funded faculty (P productivity than those with CORE funding history. Both cohorts had higher scholarly impact values than previously published figures among academic otolaryngologists, highlighting that both CORE grants and NIH K-grants awards are effective career development resources. © American Academy of Otolaryngology—Head and Neck Surgery Foundation 2014.

Poisson effect enhances compression force sensing with oxidized carbon nanotube network/polyurethane sensor

Czech Academy of Sciences Publication Activity Database

Slobodian, P.; Říha, Pavel; Olejník, R.; Matyáš, J.; Kovář, M.

2018-01-01

Roč. 271 (2018), s. 76-82 ISSN 0924-4247 R&D Projects: GA MŠk ED2.1.00/19.0409 Grant - others:Ministerstvo školství, mládeže a tělovýchovy (MŠMT)(CZ) LO1504; TBU in Zlin(CZ) IGA/CPS/2015/001 Institutional research plan: CEZ:AV0Z20600510 Keywords : compression force sensor * carbon nanotubes * polyurethane * polymer composite * nanocracks Subject RIV: BK - Fluid Dynamics OBOR OECD: Nano-processes (applications on nano-scale) Impact factor: 2.499, year: 2016

Crystal structures of CCa2CuO5 and CSr1.9Ca1.1Cu2O7 refined from single crystal data

International Nuclear Information System (INIS)

Kopnin, E.M.; Matveev, A.T.; Salamakha, P.S.; Sato, A.; Takayama-Muromachi, E.

2003-01-01

Single crystals were grown for new layered oxycarbonates CCa 2 CuO 5 and CSr 1.9 Ca 1.1 Cu 2 O 7 at 6 GPa using a belt-type apparatus. Their crystal structures were determined using single crystal X-ray diffraction data with R1(wR2)=0.0294(0.0659) and 0.0199(0.0457) for CCa 2 CuO 5 and CSr 1.9 Ca 1.1 Cu 2 O 7 , respectively. These phases crystallize in the space group P4/mmm (No. 123), Z=1 with a=3.8157(1) Angst, c=7.1426(3) Angst for CCa 2 CuO 5 and a=3.8753(1) Angst, c=10.6765(5) Angst for CSr 1.9 Ca 1.1 Cu 2 O 7 . In contrast to CSr 2 CuO 5 , no ordering in the orientation of the triangular CO 3 groups was revealed in CCa 2 CuO 5 and CSr 1.9 Ca 1.1 Cu 2 O 7

Synthetic Swan band profile of (1,0) of 12C12C and (0,0) of 12C12C and 12C13C in comets

International Nuclear Information System (INIS)

Swamy, K.S.K.

1987-01-01

The statistical equilibrium calculations of the 12 C 13 C molecule based on the resonance fluorescence process give similar results to those of the normal molecule. Therefore the assumption that the observed intensities of bands of the normal and the isotopic molecule differ only by their abundance ratio is reasonable. The synthetic profile of the (1,0) Swan band of 12 C 13 C (0,0) band of 12 C 12 C and 12 C 13 C have been calculated. The relative merits of using the rotational structure of the (1,0) or (0,0) band for the determination of the isotopic ratio 12 C/ 13 C is discussed briefly. (author)

Electrophysiological and Pharmacological Analyses of Nav1.9 Voltage-Gated Sodium Channel by Establishing a Heterologous Expression System

Directory of Open Access Journals (Sweden)

Xi Zhou

2017-11-01

Full Text Available Nav1. 9 voltage-gated sodium channel is preferentially expressed in peripheral nociceptive neurons. Recent progresses have proved its role in pain sensation, but our understanding of Nav1.9, in general, has lagged behind because of limitations in heterologous expression in mammal cells. In this work, functional expression of human Nav1.9 (hNav1.9 was achieved by fusing GFP to the C-terminal of hNav1.9 in ND7/23 cells, which has been proved to be a reliable method to the electrophysiological and pharmacological studies of hNav1.9. By using the hNav1.9 expression system, we investigated the electrophysiological properties of four mutations of hNav1.9 (K419N, A582T, A842P, and F1689L, whose electrophysiological functions have not been determined yet. The four mutations significantly caused positive shift of the steady-state fast inactivation and therefore increased hNav1.9 activity, consistent with the phenotype of painful peripheral neuropathy. Meanwhile, the effects of inflammatory mediators on hNav1.9 were also investigated. Impressively, histamine was found for the first time to enhance hNav1.9 activity, indicating its vital role in hNav1.9 modulating inflammatory pain. Taken together, our research provided a useful platform for hNav1.9 studies and new insight into mechanism of hNav1.9 linking to pain.

Surveys of current status in biomedical science grant review: funding organisations' and grant reviewers' perspectives

DEFF Research Database (Denmark)

Schroter, Sara; Groves, Trish; Højgaard, Liselotte

2010-01-01

The objectives of this research were (a) to describe the current status of grant review for biomedical projects and programmes from the perspectives of international funding organisations and grant reviewers, and (b) to explore funders' interest in developing uniform requirements for grant review...

46 CFR 52.25-7 - Electric boilers (modifies PEB-1 through PEB-19).

Science.gov (United States)

2010-10-01

... 46 Shipping 2 2010-10-01 2010-10-01 false Electric boilers (modifies PEB-1 through PEB-19). 52.25... ENGINEERING POWER BOILERS Other Boiler Types § 52.25-7 Electric boilers (modifies PEB-1 through PEB-19). Electric boilers required to comply with this part must meet the applicable provisions in this part and the...

Quantum Mechanical Scoring: Structural and Energetic Insights into Cyclin-Dependent Kinase 2 Inhibition by Pyrazolo[1,5-a]pyrimidines

Czech Academy of Sciences Publication Activity Database

Brahmkshatriya, Pathik; Dobeš, P.; Fanfrlík, Jindřich; Řezáč, Jan; Paruch, K.; Bronowska, A.; Lepšík, Martin; Hobza, Pavel

2013-01-01

Roč. 9, č. 1 (2013), s. 118-129 ISSN 1573-4099 R&D Projects: GA ČR GBP208/12/G016 Grant - others:Operational Program Research and Development for Innovations(XE) CZ.1.05/2.1.00/03.0058 Institutional support: RVO:61388963 Keywords : binding affinity * cyclin-dependent kinase 2 * QM/SQM/MM * PM6 * pyrazolo[1,5-a]pyrimidine * semiempirical quantum mechanics * scoring function Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.942, year: 2013

Optical properties, morphology and elemental chemical composition of atmospheric particles at T1 supersite on MILAGRO campaign

Science.gov (United States)

Carabali, G.; Mamani-Paco, R.; Castro, T.; Peralta, O.; Herrera, E.; Trujillo, B.

2011-05-01

Atmospheric particles were sampled at T1 supersite (19°43' N latitude, 98°58' W longitude, and 2340 m above sea level) during MILAGRO campaign. T1 was located at the north of Mexico City Metropolitan Area (MCMA). Aerosol sampling was done by placing transmission electron microscope (TEM) copper grids on the last 5 stages of an 8-stage MOUDI cascade impactor (d50 = 1.8, 1.0, 0.56, 0.32, and 0.18 μm). Samples were obtained at morning (06:00-09:00), noon (11:00-14:00), afternoon (16:00-19:00) and evening (21:00-24:00) local time. Absorption and scattering coefficients, and particles concentration (0.01-3 μm aerodynamic diameter) were measured simultaneously using a PASP absorption photometer (operated at 550 nm), a portable integrating nephelometer (at 530 nm) and a CNI particle counter. TEM images of particles were acquired at different magnifications using a CM 200 Phillips TEM-EDAX system. The morphology of atmospheric particles for two aerodynamic diameters (0.18 and 1.8 μm) was compared using border-based fractal dimension. Particles sampled under Mexico City pollution influence showed not much variability, suggesting the presence of more compact particles in smaller sizes (d50 = 1.8 μm) at the site. The presence of higher numbers of compact particles can be attributed to aerosol aging and secondary aerosol formation, among others. Under early morning conditions, smaller particles (d50 = 0.18 μm) had more irregular features resulting in a higher average fractal dimension. Energy dispersive X-ray spectroscopy (EDS) was used to determine the elemental composition of particles. EDS analysis in particles with d50 = 0.18 μm showed a higher content of carbonaceous material and relevant amounts of Si, Fe, K, and Co. This may indicate an impact from industrial and vehicle's emissions on atmospheric particles.

The Nav1.9 Channel Is a Key Determinant of Cold Pain Sensation and Cold Allodynia

Directory of Open Access Journals (Sweden)

Stéphane Lolignier

2015-05-01

Full Text Available Cold-triggered pain is essential to avoid prolonged exposure to harmfully low temperatures. However, the molecular basis of noxious cold sensing in mammals is still not completely understood. Here, we show that the voltage-gated Nav1.9 sodium channel is important for the perception of pain in response to noxious cold. Nav1.9 activity is upregulated in a subpopulation of damage-sensing sensory neurons responding to cooling, which allows the channel to amplify subthreshold depolarizations generated by the activation of cold transducers. Consequently, cold-triggered firing is impaired in Nav1.9−/− neurons, and Nav1.9 null mice and knockdown rats show increased cold pain thresholds. Disrupting Nav1.9 expression in rodents also alleviates cold pain hypersensitivity induced by the antineoplastic agent oxaliplatin. We conclude that Nav1.9 acts as a subthreshold amplifier in cold-sensitive nociceptive neurons and is required for the perception of cold pain under normal and pathological conditions.

Ms1, a novel sRNA interacting with the RNA polymerase core in mycobacteria

Czech Academy of Sciences Publication Activity Database

Hnilicová, Jarmila; Jirát-Matějčková, Jitka; Šiková, Michaela; Pospíšil, Jiří; Halada, Petr; Pánek, Josef; Krásný, Libor

2014-01-01

Roč. 42, č. 18 (2014), s. 11763-11776 ISSN 0305-1048 R&D Projects: GA ČR(CZ) GBP305/12/G034; GA ČR GP13-27150P Grant - others:Magistrát hl. m. P.(CZ) CZ.2.16/3.1.00/24023 Institutional support: RVO:61388971 Keywords : ESCHERICHIA-COLI * 6S RNA * NONCODING RNA Subject RIV: EE - Microbiology, Virology Impact factor: 9.112, year: 2014

Grants: View from the Campus.

Science.gov (United States)

Mohrman, Kathryn, Ed.

Each of 13 authors, all experienced in obtaining grants, examines a separate element of the grantsgetting process. The essays include: The Characteristics of an Effective Grants Officer (Julia B. Leverenz); The Grants Office (Morton Cooper); Working with the Academic Dean (Robert C. Nordvall); Working with the Development Office (Barbara A.…

Pressure dependence of resistivity and magnetic properties in a Mn1.9Cr0.1Sb alloy

Directory of Open Access Journals (Sweden)

D. V. Maheswar Repaka

2017-12-01

Full Text Available We report magnetic-field and hydrostatic pressure dependent electrical resistivity and magnetic properties of a Mn1.9Cr0.1Sb alloy. Upon cooling, the magnetization of Mn1.9Cr0.1Sb exhibits a first-order ferrimagnetic to antiferromagnetic transition at the exchange inversion temperature, TS = 261 K under a 0.1 T magnetic field. Our experimental results show that TS decreases with increasing magnetic field but increase with increasing hydrostatic pressure. The pressure induced transition is accompanied by a large positive baro-resistance of 30.5% for a hydrostatic pressure change of 0.69 GPa. These results show that the lattice parameters as well as the bond distance between Mn-Mn atoms play a crucial role in the magnetic and electronic transport properties of Mn1.9Cr0.1Sb. This sample also exhibits a large inverse magnetocaloric effect with a magnetic entropy change of ΔSm = +6.75 J/kg.K and negative magnetoresistance (44.5% for a field change of 5 T at TS in ambient pressure which may be useful for magnetic cooling and spintronics applications.

Auxin influx inhibitors 1-NOA, 2-NOA, and CHPAA interfere with membrane dynamics in tobacco cells

Czech Academy of Sciences Publication Activity Database

Laňková, Martina; Smith, R. S.; Pešek, Bedřich; Kubeš, Martin; Zažímalová, Eva; Petrášek, Jan; Hoyerová, Klára

2010-01-01

Roč. 61, č. 13 (2010), s. 3589-3598 ISSN 0022-0957 R&D Projects: GA AV ČR KJB600380702; GA MŠk(CZ) LC06034 Grant - others:_(CZ) CZ.2.16/3.1.00/21159 Institutional research plan: CEZ:AV0Z50380511 Keywords : Auxin efflux carrier * auxin influx carrier * auxin transport Subject RIV: EF - Botanics Impact factor: 4.818, year: 2010

SRA Grant Writing Tutorial

Science.gov (United States)

This tutorial will help give your organization a broad but succinct analysis of what the SRA grant program is about. This self-paced tutorial is organized under two segments: Overview of Grant Program and Program Details.

Spectroscopy of Na-18: Bridging the two-proton radioactivity of Mg-19

Czech Academy of Sciences Publication Activity Database

Assie, M.; de Oliveira Santos, F.; Achouri, L.; Angelique, J. C.; Borcea, C.; Borcea, R.; Caceres, L.; Chudoba, V.; Pang, D. Y.; Ducoin, D.; Fallot, M.; Kamalou, O.; Kiener, J.; Lam, Y.; Lefevre, A.; Lotay, G.; Mrázek, Jaromír; Perrot, L.; Sánchez, A.; Rotaru, F.

2012-01-01

Roč. 712, č. 3 (2012), s. 198-202 ISSN 0370-2693 Grant - others:European Commission(XE) RII3-CT-2004-506065 Institutional support: RVO:61389005 Keywords : two-proton radioactivity * resonant elastic scattering * (19)mg * Na-18 * Ne-17 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 4.569, year: 2012

The Receptor-Binding Domain in the VP1u Region of Parvovirus B19.

Science.gov (United States)

Leisi, Remo; Di Tommaso, Chiarina; Kempf, Christoph; Ros, Carlos

2016-02-24

Parvovirus B19 (B19V) is known as the human pathogen causing the mild childhood disease erythema infectiosum. B19V shows an extraordinary narrow tissue tropism for erythroid progenitor cells in the bone marrow, which is determined by a highly restricted uptake. We have previously shown that the specific internalization is mediated by the interaction of the viral protein 1 unique region (VP1u) with a yet unknown cellular receptor. To locate the receptor-binding domain (RBD) within the VP1u, we analyzed the effect of truncations and mutations on the internalization capacity of the recombinant protein into UT7/Epo cells. Here we report that the N-terminal amino acids 5-80 of the VP1u are necessary and sufficient for cellular binding and internalization; thus, this N-terminal region represents the RBD required for B19V uptake. Using site-directed mutagenesis, we further identified a cluster of important amino acids playing a critical role in VP1u internalization. In silico predictions and experimental results suggest that the RBD is structured as a rigid fold of three α-helices. Finally, we found that dimerization of the VP1u leads to a considerably enhanced cellular binding and internalization. Taken together, we identified the RBD that mediates B19V uptake and mapped functional and structural motifs within this sequence. The findings reveal insights into the uptake process of B19V, which contribute to understand the pathogenesis of the infection and the neutralization of the virus by the immune system.

Ulysses S. Grant and Reconstruction.

Science.gov (United States)

Wilson, David L.

1989-01-01

Discusses the role played by Ulysses S. Grant during the four years of Reconstruction before he became President of the United States. Describes the dynamics of the relationship between Grant and Andrew Johnson. Points out that Grant's attitude of service to the laws created by Congress submerged his desire to create a new South. (KO)

Radio properties of type 1.8 and 1.9 Seyfert galaxies

International Nuclear Information System (INIS)

Ulvestad, J.S.

1986-01-01

A number of type 1.8 and 1.9 Seyfert galaxies have been observed at the VLA in order to compare their properties with those of the other types of Seyfert galaxy. The observed types have radio luminosities in the range of 10 to the 39th-40.5th args/s, with the median near 10 to the 40th ergs/s. Most of these galaxies have radio sources with diameters of about 500 pc or less. The ratio of radio luminosity to featureless optical continuum luminosity in the Seyfert 1.8/12.9 galaxies and Seyfert 1.2/1.5 galaxies is intermediate between the values for Seyfert 1 and Seyfert 2 galaxies. The infrared-to-radio ratio decreases along the sequence from Seyfert 1 galaxies, through intermediate Seyfert galaxies, to Seyfert 2 galaxies. This systematic statistical difference in the ratio of two aspect-independent quantities implies that the differences among the Seyfert classes cannot be attributed solely to differences in viewing angle. 39 references

Computer Assisted Implementation of the 1999 WHO/ISH Hypertension Guidelines

Czech Academy of Sciences Publication Activity Database

Peleška, Jan; Zvára Jr., Karel; Tomečková, Marie; Zvárová, Jana

20 Suppl. 4, - (2002), s. 86 ISSN 0263-6352. [Scientific Meeting of the International Society of Hypertension /19./, Europeean Meeting on Hypertension /12./. 23.06.2002-27.06.2002, Prague] R&D Projects: GA MŠk LN00B107 Grant - others:MGT(XE) EC 4.FP Keywords : guidelines for hypertension * implementation * computer assisted implementation Subject RIV: BA - General Mathematics

76 FR 17711 - Notice of Availability of Calendar Year 2012 Competitive Grant Funds

Science.gov (United States)

2011-03-30

... , or visit the grants competition Web site at http://www.grants.lsc.gov . SUPPLEMENTARY INFORMATION... Delaware DE-1, MDE Guam GU-1 Idaho ID-1, MID, NID-1 Iowa IA-3, MIA Kansas KS-1 Maine ME-1, MMX-1, NME-1...

Cell Plate Restricted Association of DRP1A and PIN Proteins Is Required for Cell Polarity Establishment in Arabidopsis

Czech Academy of Sciences Publication Activity Database

Mravec, J.; Petrášek, Jan; Li, N.; Boeren, S.; Karlova, R.; Kitakura, S.; Pařezová, Markéta; Naramoto, S.; Nodzyński, T.; Dhonukshe, P.; Bednarek, S. Y.; Zažímalová, Eva; de Vries, S.; Friml, J.

2011-01-01

Roč. 21, č. 12 (2011), s. 1055-1060 ISSN 0960-9822 R&D Projects: GA MŠk(CZ) LC06034 Grant - others:European Fund for Regional Development(CZ) CZ.2.16/3.1.00/21159 Institutional research plan: CEZ:AV0Z50380511 Keywords : PLANT DEVELOPMENT * PLASMA- MEMBRANE * DYNAMIN Subject RIV: ED - Physiology Impact factor: 9.647, year: 2011

19 CFR 171.24 - Remission of forfeitures and payment of fees, costs or interest.

Science.gov (United States)

2010-04-01

... Disposition of Petitions § 171.24 Remission of forfeitures and payment of fees, costs or interest. Any seizure... fees, costs or interest from the Government. [T.D. 00-88, 65 FR 78093, Dec. 14, 2000] ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Remission of forfeitures and payment of fees...

FY2010 CoC Competition Grants

Data.gov (United States)

Department of Housing and Urban Development — This report displays the homeless assistance projects being awarded by HUD under the 2010 Continuum of Care (CoC) competitive grants process. Approximately $1.411...

42 CFR 59.4 - How does one apply for a family planning services grant?

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false How does one apply for a family planning services... GRANTS GRANTS FOR FAMILY PLANNING SERVICES Project Grants for Family Planning Services § 59.4 How does one apply for a family planning services grant? (a) Application for a grant under this subpart shall...

Doing Business with the Office of Naval Research

Science.gov (United States)

2012-08-01

DOING BUSINESS WITH THE OFFICE OF NAVAL RESEARCH Ms. Vera M. Carroll Acquisition Branch Head ONR BD 251 1 Report Documentation Page Form...COVERED 00-00-2012 to 00-00-2012 4. TITLE AND SUBTITLE Doing Business with the Office of Naval Research 5a. CONTRACT NUMBER 5b. GRANT NUMBER

Antigenicity analysis of human parvovirus B19-VP1u protein in the induction of anti-phospholipid syndrome.

Science.gov (United States)

Lin, Chun-Yu; Chiu, Chun-Ching; Cheng, Ju; Lin, Chia-Yun; Shi, Ya-Fang; Tsai, Chun-Chou; Tzang, Bor-Show; Hsu, Tsai-Ching

2018-01-01

Mounting evidence suggests a connection between human parvovirus B19 (B19) and autoimmune diseases, and especially an association between the B19-VP1 unique region (VP1u) and anti-phospholipid syndrome (APS). However, little is known about the antigenicity of B19-VP1u in the induction of APS-like syndrome. To elucidate the antigenicity of B19-VP1u in the induction of APS, N-terminal truncated B19-VP1u (tVP1u) proteins were prepared to immunize Balb/c mice to generate antibodies against B19-tVP1u proteins. The secreted phospholipase A2 (sPLA2) activities and binding specificity of mice anti-B19-tVP1u antibodies with cardiolipin (CL) and beta-2-glycoprotein I (β2GPI) were evaluated by performing immunoblot, ELISA and absorption experiments. A mice model of passively induced APS was adopted. Although sPLA2 activities were identified in all B19-tVP1u proteins, only amino acid residues 61-227 B19-tVP1u exhibited a higher sPLA2 activity. Autoantibodies against CL and β2GPI exhibited binding activities with all B19-tVP1u proteins. IgG that was purified from mice that had been immunized with amino acid residues 21-227 to 121-227 B19-tVP1u proteins exhibited significantly higher binding activity with CL. IgG that was purified from mice that had been immunized with amino acid residues 21-227, 31-227, 82-227 and 91-227 B19-tVP1u proteins exhibited significantly higher binding activity with β2GPI. Accordingly, significantly higher binding inhibition of CL was detected in the presence of amino acid residues 61-227 and 101-227 B19-tVP1u. Significantly higher binding inhibition of β2GPI was detected in the presence of amino acid residues 21-227, 31-227, 82-227 and 91-227 B19-tVP1u. The mice that received amino acid residues 31-227 or 61-227 anti-tB19-VP1u IgG revealed significant thrombocytopenia and those that received amino acid residues 21-227, 31-227, 61-227, 71-227, 82-227, 91-227, 101-227 or 114-227 anti-tB19-VP1u IgG exhibited significantly prolonged aPTT. These

The Nav1.9 channel is a key determinant of cold pain sensation and cold allodynia.

Science.gov (United States)

Lolignier, Stéphane; Bonnet, Caroline; Gaudioso, Christelle; Noël, Jacques; Ruel, Jérôme; Amsalem, Muriel; Ferrier, Jérémy; Rodat-Despoix, Lise; Bouvier, Valentine; Aissouni, Youssef; Prival, Laetitia; Chapuy, Eric; Padilla, Françoise; Eschalier, Alain; Delmas, Patrick; Busserolles, Jérôme

2015-05-19

Cold-triggered pain is essential to avoid prolonged exposure to harmfully low temperatures. However, the molecular basis of noxious cold sensing in mammals is still not completely understood. Here, we show that the voltage-gated Nav1.9 sodium channel is important for the perception of pain in response to noxious cold. Nav1.9 activity is upregulated in a subpopulation of damage-sensing sensory neurons responding to cooling, which allows the channel to amplify subthreshold depolarizations generated by the activation of cold transducers. Consequently, cold-triggered firing is impaired in Nav1.9(-/-) neurons, and Nav1.9 null mice and knockdown rats show increased cold pain thresholds. Disrupting Nav1.9 expression in rodents also alleviates cold pain hypersensitivity induced by the antineoplastic agent oxaliplatin. We conclude that Nav1.9 acts as a subthreshold amplifier in cold-sensitive nociceptive neurons and is required for the perception of cold pain under normal and pathological conditions. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.

Observations of the Magellanic Stream between declinations -200 and 00

International Nuclear Information System (INIS)

Cohen, R.J.

1982-01-01

The region of the Magellanic Stream between RA 23sup(h) 00sup(m) and 00sup(h) 20sup(m) and Dec - 20 0 and 0 0 (1950) has been mapped in the 21-cm line of neutral hydrogen using the Jodrell Bank Mk II telescope (beamwidth 31 x 34 arcmin 2 ). The detection level of the measurements is 0.1 K. The Stream is much more extensive in this part of the sky than hitherto realized, and has a very complex filamentary structure. All the filaments follow a regular velocity pattern. In addition to the known gradient of velocity along the Stream there is a gradient transverse to the Stream. In this and other respects the Stream is very similar to tidal bridges and tails seen in the nearby M81 group of galaxies. (author)

Antibodies against CKI1(RD), a receiver domain of the sensor histidine kinase in Arabidopsis thaliana: From antigen preparation to in planta immunolocalization

Czech Academy of Sciences Publication Activity Database

Borkovcová, P.; Pekárová, B.; Válková, M.; Dopitová, R.; Brzobohatý, Břetislav; Janda, L.; Hejatko, J.

2014-01-01

Roč. 100, APR 2014 (2014), s. 6-15 ISSN 0031-9422 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0068 Grant - others:GA ČR(CZ) GAP501/11/1150; GA ČR(CZ) GA13-25280S Program:GA; GA Institutional support: RVO:68081707 Keywords : Receiver domain * Polyclonal antibodies * Immunoprecipitation Subject RIV: BO - Biophysics Impact factor: 2.547, year: 2014

VP1u phospholipase activity is critical for infectivity of full-length parvovirus B19 genomic clones.

Science.gov (United States)

Filippone, Claudia; Zhi, Ning; Wong, Susan; Lu, Jun; Kajigaya, Sachiko; Gallinella, Giorgio; Kakkola, Laura; Söderlund-Venermo, Maria; Young, Neal S; Brown, Kevin E

2008-05-10

Three full-length genomic clones (pB19-M20, pB19-FL and pB19-HG1) of parvovirus B19 were produced in different laboratories. pB19-M20 was shown to produce infectious virus. To determine the differences in infectivity, all three plasmids were tested by transfection and infection assays. All three clones were similar in viral DNA replication, RNA transcription, and viral capsid protein production. However, only pB19-M20 and pB19-HG1 produced infectious virus. Comparison of viral sequences showed no significant differences in ITR or NS regions. In the capsid region, there was a nucleotide sequence difference conferring an amino acid substitution (E176K) in the phospholipase A2-like motif of the VP1-unique (VP1u) region. The recombinant VP1u with the E176K mutation had no catalytic activity as compared with the wild-type. When this mutation was introduced into pB19-M20, infectivity was significantly attenuated, confirming the critical role of this motif. Investigation of the original serum from which pB19-FL was cloned confirmed that the phospholipase mutation was present in the native B19 virus.

VP1u phospholipase activity is critical for infectivity of full-length parvovirus B19 genomic clones✰

Science.gov (United States)

Filippone, Claudia; Zhi, Ning; Wong, Susan; Lu, Jun; Kajigaya, Sachiko; Gallinella, Giorgio; Kakkola, Laura; Venermo, Maria S Söderlund; Young, Neal S.; Brown, Kevin E.

2008-01-01

Three full-length genomic clones (pB19-M20, pB19-FL and pB19-HG1) of parvovirus B19 were produced in different laboratories. pB19-M20 was shown to produce infectious virus. To determine the differences in infectivity, all three plasmids were tested by transfection and infection assays. All three clones were similar in viral DNA replication, RNA transcription, and viral capsid protein production. However, only pB19-M20 and pB19-HG1 produced infectious virus. Comparison of viral sequences showed no significant differences in ITR or NS regions. In the capsid region, there was a nucleotide sequence difference conferring an amino acid substitution (E176K) in the phospholipase A2-like motif of the VP1-unique (VP1u) region. The recombinant VP1u with the E176K mutation had no catalytic activity as compared with the wild-type. When this mutation was introduced into pB19-M20, infectivity was significantly attenuated, confirming the critical role of this motif. Investigation of the original serum from which pB19-FL was cloned confirmed that the phospholipase mutation was present in the native B19 virus. PMID:18252260

Scalable pumping approach for extracting the maximum TEM(00) solar laser power.

Science.gov (United States)

Liang, Dawei; Almeida, Joana; Vistas, Cláudia R

2014-10-20

A scalable TEM(00) solar laser pumping approach is composed of four pairs of first-stage Fresnel lens-folding mirror collectors, four fused-silica secondary concentrators with light guides of rectangular cross-section for radiation homogenization, four hollow two-dimensional compound parabolic concentrators for further concentration of uniform radiations from the light guides to a 3 mm diameter, 76 mm length Nd:YAG rod within four V-shaped pumping cavities. An asymmetric resonator ensures an efficient large-mode matching between pump light and oscillating laser light. Laser power of 59.1 W TEM(00) is calculated by ZEMAX and LASCAD numerical analysis, revealing 20 times improvement in brightness figure of merit.

Superelasticity, corrosion resistance and biocompatibility of the Ti–19Zr–10Nb–1Fe alloy

Energy Technology Data Exchange (ETDEWEB)

Xue, Pengfei [School of Materials Science and Engineering, Beihang University, Beijing 100191 (China); Key Laboratory of Aerospace Materials and Performance (Ministry of Education), Beihang University, Beijing 100191 (China); Li, Yan, E-mail: liyan@buaa.edu.cn [School of Materials Science and Engineering, Beihang University, Beijing 100191 (China); Key Laboratory of Aerospace Materials and Performance (Ministry of Education), Beihang University, Beijing 100191 (China); Li, Kangming [School of Materials Science and Engineering, Beihang University, Beijing 100191 (China); Key Laboratory of Aerospace Materials and Performance (Ministry of Education), Beihang University, Beijing 100191 (China); Zhang, Deyuan [Life Tech Scientific Corporation, Shenzhen 518057 (China); Zhou, Chungen [School of Materials Science and Engineering, Beihang University, Beijing 100191 (China)

2015-05-01

Microstructure, mechanical properties, superelasticity and biocompatibility of a Ti–19Zr–10Nb–1Fe alloy are investigated. X-ray diffraction spectroscopy and transmission electron microscopy observations show that the as-cast Ti–19Zr–10Nb–1Fe alloy is composed of α′ and β phases, but only the β phase exists in the as-rolled and as-quenched alloys. The tensile stress–strain tests indicate that the as-quenched alloy exhibits a good combination of mechanical properties with a large elongation of 25%, a low Young's modulus of 59 GPa and a high ultimate tensile stress of 723 MPa. Superelastic recovery behavior is found in the as-quenched alloy during tensile tests, and the corresponding maximum of superelastic strain is 4.7% at the pre-strain of 6%. A superelastic recovery of 4% with high stability is achieved after 10 cyclic loading–unloading training processes. Potentiodynamic polarization and ion release measurements indicate that the as-quenched alloy shows a lower corrosion rate in Hank's solution and a much less ion release rate in 0.9% NaCl solution than those of the NiTi alloys. Cell culture results indicate that the osteoblasts' adhesion and proliferation are similar on both the Ti–19Zr–10Nb–1Fe and NiTi alloys. A better hemocompatibility is confirmed for the as-quenched Ti–19Zr–10Nb–1Fe alloy, attributed to more stable platelet adhesion and small activation degree, and a much lower hemolysis rate compared with the NiTi alloy. - Highlights: • A stable superelastic strain of 4.0% is achieved for the Ti–19Zr–10Nb–1Fe alloy. • The ion release rates of Ti–19Zr–10Nb–1Fe are much lower than that of Ni in NiTi. • Ti–19Zr–10Nb–1Fe has a similar cytocompatibility compared with the NiTi alloy. • Ti–19Zr–10Nb–1Fe exhibits a better hemocompatibility than the NiTi alloy.

Persistent modification of Na{sub v}1.9 following chronic exposure to insecticides and pyridostigmine bromide

Energy Technology Data Exchange (ETDEWEB)

Nutter, Thomas J., E-mail: tnutter@dental.ufl.edu; Cooper, Brian Y., E-mail: bcooper@dental.ufl.edu

2014-06-15

Many veterans of the 1991 Gulf War (GW) returned from that conflict with a widespread chronic pain affecting deep tissues. Recently, we have shown that a 60 day exposure to the insecticides permethrin, chlorpyrifos, and pyridostigmine bromide (NTPB) had little influence on nociceptor action potential forming Na{sub v}1.8, but increased K{sub v}7 mediated inhibitory currents 8 weeks after treatment. Using the same exposure regimen, we used whole cell patch methods to examine whether the influences of NTPB could be observed on Na{sub v}1.9 expressed in muscle and vascular nociceptors. During a 60 day exposure to NTPB, rats exhibited lowered muscle pain thresholds and increased rest periods, but these measures subsequently returned to normal levels. Eight and 12 weeks after treatments ceased, DRG neurons were excised from the sensory ganglia. Whole cell patch studies revealed little change in voltage dependent activation and deactivation of Na{sub v}1.9, but significant increases in the amplitude of Na{sub v}1.9 were observed 8 weeks after exposure. Cellular studies, at the 8 week delay, revealed that NTPB also significantly prolonged action potential duration and afterhyperpolarization (22 °C). Acute application of permethrin (10 μM) also increased the amplitude of Na{sub v}1.9 in skin, muscle and vascular nociceptors. In conclusion, chronic exposure to Gulf War agents produced long term changes in the amplitude of Na{sub v}1.9 expressed in muscle and vascular nociceptors. The reported increases in K{sub v}7 amplitude may have been an adaptive response to increased Na{sub v}1.9, and effectively suppressed behavioral pain measures in the post treatment period. Factors that alter the balance between Na{sub v}1.9 and K{sub v}7 could release spontaneous discharge and produce chronic deep tissue pain. - Highlights: • Rats were treated 60 days with permethrin, chlorpyrifos and pyridostigmine bromide. • 8 weeks after treatments, Nav1.9 activation and deactivation were

Grant management procedure for energy saving TDM-PONs

Science.gov (United States)

Alaelddin, Fuad Yousif Mohammed; Newaz, S. H. Shah; AL-Hazemi, Fawaz; Choi, Jun Kyun

2018-01-01

In order to minimize energy consumption in Time Division Multiplexing-Passive Optical Network (TDM-PON), IEEE and ITU-T have mandated sleep mode mechanism for Optical Network Units (ONUs) in the latest TDM-PON standards (e.g. IEEE P1904.1 SIEPON, ITU-T G.sup45). The sleep mode mechanism is a promising mean for maximizing energy saving in an ONU. An ONU in sleep mode flips between sleep and active state depending on the presence or absent of upstream and downstream frames. To ensure Quality of Service (QoS) of upstream frames, the recent TDM-PON standards introduced an early wake-up mechanism, in which an ONU is forced to leave the sleep state on upstream frame arrival. When the Optical Line Terminal (OLT) of a TDM-PON allows early wake-up of its connected ONUs, it allocates gratuitous grants for the sleeping ONUs along with allocating upstream grants for the ONUs in active state. Note that, the gratuitous grants control message sent periodically by the OLT on Inter-Gratuitous grant Interval (IGI) time. After leaving sleep state due to the arrival of upstream frame, the ONU uses its allocated gratuitous grant to send a control message mentioning the amount of upstream bandwidth (upstream grant) required in order to forward the remaining frames in its buffer. However, the existing early wake-up process of ONU can lead to increase the energy consumption of an ONU. It is because of the ONU wakes-up immediately from the sleep state on arrival of the upstream frame, but even so, it needs to wait for forwarding the frame until its allocated gratuitous grant period, resulting in spending energy unnecessarily. In addition, current energy saving solution for TDM-PONs do not provide a clear solution on how to manage different types of grants (e.g. listening grant, upstream transmission grant) within a Dynamic Bandwidth Allocation (DBA) polling cycle. To address this problem, we propose a state-of-art Grant Management Procedure (GMP) in order to maximize energy saving in a TDM

VP1u phospholipase activity is critical for infectivity of full-length parvovirus B19 genomic clones

OpenAIRE

Filippone, Claudia; Zhi, Ning; Wong, Susan; Lu, Jun; Kajigaya, Sachiko; Gallinella, Giorgio; Kakkola, Laura; Söderlund-Venermo, Maria; Young, Neal S.; Brown, Kevin E.

2008-01-01

Three full-length genomic clones (pB19-M20, pB19-FL and pB19-HG1) of parvovirus B19 were produced in different laboratories. pB19-M20 was shown to produce infectious virus. To determine the differences in infectivity, all three plasmids were tested by transfection and infection assays. All three clones were similar in viral DNA replication, RNA transcription, and viral capsid protein production. However, only pB19-M20 and pB19-HG1 produced infectious virus. Comparison of viral sequences showe...

78 FR 75330 - Grant of Authority; Establishment of a Foreign-Trade Zone Under the Alternative Site Framework...

Science.gov (United States)

2013-12-11

... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [Order No. 1921] Grant of Authority... authority under the Foreign-Trade Zones Act of June 18, 1934, as amended (19 U.S.C. 81a-81u), the Foreign... adjacent to U.S. Customs and Border Protection ports of entry; Whereas, the Board adopted the alternative...

Genomic imprinting status of IGF-II and H19 in placentas of fetal ...

Indian Academy of Sciences (India)

velop metabolic syndrome later in life, manifesting as obe- ... Venous blood samples were collected from both the parents .... and five families of the group B2 were informative for H19. .... that may have impacts on the imprinting status of imprinted genes ... This work was supported by a grant from National Natural Science.

Audio watermarking robust against D/A and A/D conversions

Directory of Open Access Journals (Sweden)

Xiang Shijun

2011-01-01

Full Text Available Abstract Digital audio watermarking robust against digital-to-analog (D/A and analog-to-digital (A/D conversions is an important issue. In a number of watermark application scenarios, D/A and A/D conversions are involved. In this article, we first investigate the degradation due to DA/AD conversions via sound cards, which can be decomposed into volume change, additional noise, and time-scale modification (TSM. Then, we propose a solution for DA/AD conversions by considering the effect of the volume change, additional noise and TSM. For the volume change, we introduce relation-based watermarking method by modifying groups of the energy relation of three adjacent DWT coefficient sections. For the additional noise, we pick up the lowest-frequency coefficients for watermarking. For the TSM, the synchronization technique (with synchronization codes and an interpolation processing operation is exploited. Simulation tests show the proposed audio watermarking algorithm provides a satisfactory performance to DA/AD conversions and those common audio processing manipulations.

Expression study of CYP19A1 gene in a cohort of Iranian leiomyoma patients

Directory of Open Access Journals (Sweden)

Leila Emrahi

2018-07-01

Full Text Available Background: CYP19A1 gene encodes aromatase, a microsomal key enzyme that catalyzes the synthesis of estrogens from androgens. Accumulating evidence has revealed that aromatase plays an important role in the pathogenesis of leiomyoma through increasing local concentration of estrogens. In this study, we examined the levels of CYP19A1 mRNA to determine the impact of aromatase overexpression in uterine leiomyoma growth. Subjects and methods: Tissues were obtained via myomectomy or hysterectomy from 30 patients. Total RNA was extracted and cDNA was synthesized from each frozen sample. Using SYBR Green dye, Real-time PCR assay was performed by sequence-specific primers. Relative mRNA expression was normalized to the mean of the Ct values determined for HPRT1. Gene expression ratio in each sample was determined relative to the mean ΔCt value of tumor-free margin samples. Results: PCR efficiencies for amplification reactions of HPRT1, and CYP19A genes were calculated as 0.93 and 0.96, respectively. Regression coefficients (R for standard curves were above 0.90. The obtained data revealed that the mean fold increase of CYP19A1 gene expression in leiomyoma samples relative to normal samples was 3.551 (95% CI: 0.04–6.64, S.E., 0.29–5.35. Conclusions: Our results were in accordance with previous studies and imply that up-regulation of CYP19A1 is correlated with the pathogenesis of leiomyoma tumors. We also observed that expression level of CYP19A1 was not linked to the tumor size or localization. It can be concluded that; up-regulation of aromatase is a key factor in the initiation of tumor development as well as tumor growth. Keywords: Leiomyoma, CYP19A1, Real-time PCR, Gene expression study

Auxin molecular field maps define AUX1 selectivity: many auxin herbicides are not substrates

Czech Academy of Sciences Publication Activity Database

Hoyerová, Klára; Hošek, Petr; Quareshy, M.; Li, J.; Klíma, Petr; Kubeš, Martin; Yemm, A. A.; Neve, P.; Tripathi, A.; Bennett, M.J.; Napier, R. M.

2018-01-01

Roč. 217, č. 4 (2018), s. 1625-1639 ISSN 0028-646X R&D Projects: GA ČR(CZ) GA16-19557S; GA MŠk LD15137 Grant - others:OPPK(XE) CZ.2.16/3.1.00/21519 Institutional support: RVO:61389030 Keywords : auxin transport * cheminformatics * herbicide * herbicide resistance * molecular field maps * pharmacophore * structure–activity relationship * uptake carrier Subject RIV: ED - Physiology OBOR OECD: Cell biology Impact factor: 7.330, year: 2016

30 CFR 285.408 - May I assign my lease or grant interest?

Science.gov (United States)

2010-07-01

... RENEWABLE ENERGY ALTERNATE USES OF EXISTING FACILITIES ON THE OUTER CONTINENTAL SHELF Lease and Grant... application to MMS. The assignment application must include: (1) The MMS-assigned lease or grant number; (2) A... required financial assurance. (c) If you submit an application to assign a lease or grant, you will...

22 CFR 210.650 - Grant.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Grant. 210.650 Section 210.650 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE... to transfer a thing of value to the recipient to carry out a public purpose of support or stimulation...

15 CFR 29.650 - Grant.

Science.gov (United States)

2010-01-01

... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Grant. 29.650 Section 29.650 Commerce and Foreign Trade Office of the Secretary of Commerce GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE... Federal Government's direct benefit or use; and (b) In which substantial involvement is not expected...

Study of the transient X-ray source A0620-00. [reddening correction

Energy Technology Data Exchange (ETDEWEB)

Wu, Chia-Chao; Aalders, J W.G.; van Duinen, R J; Kester, D; Wesselius, P R [Rijksuniversiteit Groningen (Netherlands). Kapteyn Sterrewacht

1976-08-01

A0620-00 was observed 7 times with the 5-band ultraviolet photometric system on board the ANS in the period of 1975 September 28.91-30.52 UT. The observed spectrum is dereddened until a smooth energy distribution is obtained. The amount of reddening correction required is E(B-V) = 0.39 +- 0.02. The dereddened spectrum matches closely with that of a blackbody of temperature 28,000 K. The integrated fluxes between 1,550 and 3,300 A before and after the reddening correction are, respectively, 2.87 10/sup -10/ and 4.57 10/sup -9/ erg cm/sup -2/s/sup -1/. By assuming: 1) A0620-00 is a binary system, 2) optical brightening of ..delta..B = 8.sup(m)0 is caused by the X-ray heating of the companion, 3) the non-degenerate companion is a dwarf and 4) the orbital inclination is zero, a self-consistent model is constructed.

75 FR 60844 - Self-Regulatory Organizations; The NASDAQ Stock Market LLC; Notice of Filing and Order Granting...

Science.gov (United States)

2010-10-01

...-Regulatory Organizations; The NASDAQ Stock Market LLC; Notice of Filing and Order Granting Accelerated... Rule 19b-4 thereunder,\\2\\ notice is hereby given that on September 14, 2010, The NASDAQ Stock Market... voting on the election of a member of the board of directors of an issuer (except for a vote with respect...

78 FR 20090 - Grant of Authority; Establishment of a Foreign-Trade Zone Under the Alternative Site Framework...

Science.gov (United States)

2013-04-03

... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [Order No. 1886] Grant of Authority... its authority under the Foreign-Trade Zones Act of June 18, 1934, as amended (19 U.S.C. 81a-81u), the... in or adjacent to U.S. Customs and Border Protection ports of entry; Whereas, the Board adopted the...

78 FR 57837 - Grant of Authority; Establishment of a Foreign-Trade Zone Under the Alternative Site Framework...

Science.gov (United States)

2013-09-20

... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [Order No. 1909] Grant of Authority... to its authority under the Foreign-Trade Zones Act of June 18, 1934, as amended (19 U.S.C. 81a-81u... zones in or adjacent to U.S. Customs and Border Protection ports of entry; Whereas, the Board adopted...

19 CFR 11.1 - Cigars, cigarettes, medicinal preparations, and perfumery.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Cigars, cigarettes, medicinal preparations, and..., cigarettes, medicinal preparations, and perfumery. (a) All cigars and cigarettes imported into the United... domestic cigars, cigarettes, medicinal preparations, and perfumery, which are returned to the United States...

49 CFR 1242.50 - Fringe benefits (account 12-27-00).

Science.gov (United States)

2010-10-01

... 49 Transportation 9 2010-10-01 2010-10-01 false Fringe benefits (account 12-27-00). 1242.50 Section 1242.50 Transportation Other Regulations Relating to Transportation (Continued) SURFACE...-Equipment § 1242.50 Fringe benefits (account 12-27-00). Separate common expenses in proportion to the...

49 CFR 1242.63 - Fringe benefits (account 12-51-00).

Science.gov (United States)

2010-10-01

... 49 Transportation 9 2010-10-01 2010-10-01 false Fringe benefits (account 12-51-00). 1242.63 Section 1242.63 Transportation Other Regulations Relating to Transportation (Continued) SURFACE...-Transportation § 1242.63 Fringe benefits (account 12-51-00). Separate common expenses in proportion to the...

49 CFR 1242.85 - Fringe benefits (account 12-63-00).

Science.gov (United States)

2010-10-01

... 49 Transportation 9 2010-10-01 2010-10-01 false Fringe benefits (account 12-63-00). 1242.85 Section 1242.85 Transportation Other Regulations Relating to Transportation (Continued) SURFACE....85 Fringe benefits (account 12-63-00). Separate the common expenses in proportion to the total common...

49 CFR 1242.75 - Fringe benefits (account 12-53-00).

Science.gov (United States)

2010-10-01

... 49 Transportation 9 2010-10-01 2010-10-01 false Fringe benefits (account 12-53-00). 1242.75 Section 1242.75 Transportation Other Regulations Relating to Transportation (Continued) SURFACE...-Transportation § 1242.75 Fringe benefits (account 12-53-00). Separate common expenses in proportion to the...

49 CFR 1242.80 - Fringe benefits (account 12-55-00).

Science.gov (United States)

2010-10-01

... 49 Transportation 9 2010-10-01 2010-10-01 false Fringe benefits (account 12-55-00). 1242.80 Section 1242.80 Transportation Other Regulations Relating to Transportation (Continued) SURFACE...-Transportation § 1242.80 Fringe benefits (account 12-55-00). Separate common expenses in proportion to the...

49 CFR 1242.70 - Fringe benefits (account 12-52-00).

Science.gov (United States)

2010-10-01

... 49 Transportation 9 2010-10-01 2010-10-01 false Fringe benefits (account 12-52-00). 1242.70 Section 1242.70 Transportation Other Regulations Relating to Transportation (Continued) SURFACE...-Transportation § 1242.70 Fringe benefits (account 12-52-00). Separate common expenses in proportion to the...

49 CFR 1242.38 - Fringe benefits (account 12-26-00).

Science.gov (United States)

2010-10-01

... 49 Transportation 9 2010-10-01 2010-10-01 false Fringe benefits (account 12-26-00). 1242.38 Section 1242.38 Transportation Other Regulations Relating to Transportation (Continued) SURFACE...-Equipment § 1242.38 Fringe benefits (account 12-26-00). Separate common expenses in proportion to the split...

New possibilities for efficient laser surface treatment by diode-pumped kW-class lasers

Czech Academy of Sciences Publication Activity Database

Brajer, Jan; Švábek, Roman; Rostohar, Danijela; Divoký, Martin; Lucianetti, Antonio; Mocek, Tomáš; Madl, J.; Pitrmuc, Z.

2015-01-01

Roč. 2015, Aug (2015), s. 1-3 ISSN 1823-3430 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143 Institutional support: RVO:68378271 Keywords : amplifier Subject RIV: BH - Optics, Masers, Lasers

Preparation and Biological Properties of Ring-Substituted Naphthalene-1-Carboxanilides

Czech Academy of Sciences Publication Activity Database

Goněc, T.; Kos, J.; Nevin, E.; Govender, R.; Peško, M.; Tengler, J.; Kushkevych, I.; Štastná, V.; Oravec, Michal; Kolař, P.; Mahony, J. O.; Králová, K.; Coffey, A.; Jampílek, J.

2014-01-01

Roč. 19, č. 7 (2014), s. 10386-10409 ISSN 1420-3049 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0073 Institutional support: RVO:67179843 Keywords : Naphthalene * lipophilicity * in vitro antimycobacterial activity * in vitro cytotoxicity * photosynthetic electron transport inhibition * spinach chloroplasts Subject RIV: EH - Ecology, Behaviour Impact factor: 2.416, year: 2014

Welfare financing : Grant allocation and efficiency

NARCIS (Netherlands)

Toolsema-Veldman, Linda; Allers, M.A.

2012-01-01

Welfare is often administered locally, but financed through grants from the central government. This raises the question how the central government can prevent local governments from spending more than necessary. Block grants are more efficient than matching grants, because the latter reduce the

Global co-existence of two evolutionary lineages of parvovirus B19 1a, different in genome-wide synonymous positions.

Directory of Open Access Journals (Sweden)

Marijke W A Molenaar-de Backer

Full Text Available Parvovirus B19 (B19V can cause infection in humans. To date, three genotypes of B19V, with subtypes, are known, of which genotype 1a is the most prevalent genotype in the Western world. We sequenced the genome of B19V strains of 65 asymptomatic, recently infected Dutch blood donors, to investigate the spatio-temporal distribution of B19V strains, in the years 2003-2009. The sequences were compared to B19V sequences from Dutch patients with fifth disease, and to global B19V sequences as available from GenBank. All Dutch B19V strains belonged to genotype 1a. Phylogenetic analysis of the strains from Dutch blood donors showed that two groups of genotype 1a co-exist. A clear-cut division into the two groups was also found among the B19V strains from Dutch patients, and among the B19V sequences in GenBank. The two groups of genotype 1a co-exist around the world and do not appear to differ in their ability to cause disease. Strikingly, the two groups of B19V predominantly differ in synonymous mutations, distributed throughout the entire genome of B19V. We propose to call the two groups of B19V genotype 1a respectively subtype 1a1 and 1a2.

Thermodynamic and structural analysis of HIV protease resistance to darunavir - analysis of heavily mutated patient- derived HIV-1 proteases

Czech Academy of Sciences Publication Activity Database

Kožíšek, Milan; Lepšík, Martin; Grantz Šašková, Klára; Brynda, Jiří; Konvalinka, Jan; Řezáčová, Pavlína

2014-01-01

Roč. 281, č. 7 (2014), s. 1834-1847 ISSN 1742-464X R&D Projects: GA ČR GAP207/11/1798 Grant - others:OPPC(XE) CZ.2.16/3.1.00/24016 Institutional support: RVO:61388963 ; RVO:68378050 Keywords : enthropic contribution * HIV protease inhibitors * isothermal titration calorimetry * resistance mutation * X-ray crystallography Subject RIV: CE - Biochemistry Impact factor: 4.001, year: 2014

DC-magnetron sputtering of ZnO:Al films on (00.1)Al2O3 substrates from slip-casting sintered ceramic targets

International Nuclear Information System (INIS)

Miccoli, I.; Spampinato, R.; Marzo, F.; Prete, P.; Lovergine, N.

2014-01-01

Highlights: • ZnO:Al was DC-sputtered on sapphire >350 °C by slip-casting sintered AZO target. • Films are highly (00.1)-oriented, smooth and transparent in the NIR–visible range. • Films growth rate decreases with temperature, while their grain size increases. • A high temperature reduction for sticking coefficients of impinging species is proved. • We prove that Thornton model does not apply to high-temperature DC-sputtered ZnO. - Abstract: High (>350 °C) temperature DC-sputtering deposition of ZnO:Al thin films onto single-crystal (00.1) oriented Al 2 O 3 (sapphire) substrates is reported, using a ultrahigh-density, low-resistivity and low-cost composite ceramic target produced by slip-casting (pressureless) sintering of ZnO–Al 2 O 3 (AZO) powders. The original combination of high-angle θ–2θ (Bragg–Brentano geometry) X-ray diffraction with low angle θ–2θ X-ray reflectivity (XRR) techniques allows us to define the AZO target composition and investigate the structural properties and surface/interface roughness of as-sputtered ZnO:Al films; besides, the growth dynamics of ZnO:Al is unambiguously determined. The target turned out composed of the sole wurtzite ZnO and spinel ZnAl 2 O 4 phases. X-ray diffraction analyses revealed highly (00.1)-oriented (epitaxial) ZnO:Al films, the material mean crystallite size being in the 13–20 nm range and increasing with temperature between 350 °C and 450 °C, while the film growth rate (determined via XRR measurements) decreases appreciably. XRR spectra also allowed to determine rms surface roughness <1 nm for present films and showed ZnO:Al density changes by only a few percent between 350 °C and 450 °C. The latter result disproves the often-adopted Thornton model for the description of the sputter-grown ZnO films and instead points out toward a reduction of the sticking coefficients of impinging species, as the main origin of film growth rate and grain size dependence with temperature. Zn

19 CFR 4.1 - Boarding of vessels; cutter and dock passes.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Boarding of vessels; cutter and dock passes. 4.1... OF THE TREASURY VESSELS IN FOREIGN AND DOMESTIC TRADES Arrival and Entry of Vessels § 4.1 Boarding of... regulations. (4) The master of any vessel shall not authorize the boarding or leaving of his vessel by any...

Genotypic and allelic variability in CYP19A1 among populations of African and European ancestry.

Directory of Open Access Journals (Sweden)

Athena Starlard-Davenport

Full Text Available CYP19A1 facilitates the bioconversion of estrogens from androgens. CYP19A1 intron single nucleotide polymorphisms (SNPs may alter mRNA splicing, resulting in altered CYP19A1 activity, and potentially influencing disease susceptibility. Genetic studies of CYP19A1 SNPs have been well documented in populations of European ancestry; however, studies in populations of African ancestry are limited. In the present study, ten 'candidate' intronic SNPs in CYP19A1 from 125 African Americans (AA and 277 European Americans (EA were genotyped and their frequencies compared. Allele frequencies were also compared with HapMap and ASW 1000 Genomes populations. We observed significant differences in the minor allele frequencies between AA and EA in six of the ten SNPs including rs10459592 (p<0.0001, rs12908960 (p<0.0001, rs1902584 (p = 0.016, rs2470144 (p<0.0001, rs1961177 (p<0.0001, and rs6493497 (p = 0.003. While there were no significant differences in allele frequencies between EA and CEU in the HapMap population, a 1.2- to 19-fold difference in allele frequency for rs10459592 (p = 0.004, rs12908960 (p = 0.0006, rs1902584 (p<0.0001, rs2470144 (p = 0.0006, rs1961177 (p<0.0001, and rs6493497 (p = 0.0092 was observed between AA and the Yoruba (YRI population. Linkage disequilibrium (LD blocks and haplotype clusters that is unique to the EA population but not AA was also observed. In summary, we demonstrate that differences in the allele frequencies of CYP19A1 intron SNPs are not consistent between populations of African and European ancestry. Thus, investigations into whether CYP19A1 intron SNPs contribute to variations in cancer incidence, outcomes and pharmacological response seen in populations of different ancestry may prove beneficial.

Komparasi Aplikasi Perangkat Lunak Sistem Klasifikasi DDC: Athenaeum Light 8.5, DFW Version 1.00, Webdewey 2.0, E-DDC Edition 22

OpenAIRE

Wijaya Hardiati

2012-01-01

Librarian has many alternative to classify DDC (Dewey Decimal Classification) number. not only use printed DDC, but now DDC software to help identify DDC number is available. One of them is Athenaeum Light 8.5, DFW (Dewey For Windows) Version 1.00, WebDewey 2.0, e-DDC (electronic-Dewey Decimal Classification) Edition 22. In this paper, it will roll out about how to use software with it excess and deficiency.

Determination of the longitudinal relaxation time (T{sub 1}) of the carbon for the caura-16-E N-19-oic acid; Determinacao do tempo de relaxacao longitudinal (T{sub 1}) do carbono para derivados do acido-caura-16-en-19-oico

Energy Technology Data Exchange (ETDEWEB)

Pinheiro, J A; Rodrigues, A S [Ceara Univ., Fortaleza, CE (Brazil). Dept. de Quimica Organica e Inorganica

1992-12-31

In this work, we analyse, through the {sup 13} C longitudinal relaxation time (T{sub 1}), the solute-solute and solute-solvent interactions in some molecules of the c aura-16-en-19-oic acid such as: c aura-16-en-19-oic acid (I), c aura-15-acetoxy-16-en-19-oic acid (II), methyl esther of the c aura-16-en-19-oic acid (III) and c aura-16-en-19-ol (IV) 5 refs., 1 fig., 1 tab.

Silorane, ormocer, methacrylate and compomer long-term staining susceptibility using ΔE and ΔE 00 colour-difference formulas.

Science.gov (United States)

Gregor, Ladislav; Krejci, Ivo; Di Bella, Enrico; Feilzer, Albert J; Ardu, Stefano

2016-09-01

The aim of this study was to evaluate the staining susceptibility of a silorane (Filtek Silorane), an ormocer (Ceram X Duo), a methacrylate (Tetric EvoCeram) and a compomer (Dyract) exposed on the long term to various staining agents by using ΔE and ΔE 00 colour-difference formulas. Thirty-six disc-shaped specimens were made of each of the four chemically different materials, randomly divided in six groups (n = 6) and immersed in five staining solutions (red wine, juice, coke, tea and coffee) or stored dry (control) in an incubator at 37 °C for 99 days. Spectrophotometric measurements by means of a spectrophotometer (Spectroshade Handy Dental, MHT) were repeated over a white (L* = 92.6, a* = -1.2, b* = 2.9) and black (L* = 1.6, a* = 1.2, b* = -1.0) background made of plasticized paper, in order to determine the colour changes according to ΔE, ΔE 00 and translucency formulas. Statistical analysis was performed by means of factorial Anova, Fisher's LSD test (post hoc) and a Spearman rank correlation between ΔE and ΔE 00. When analysed over a white background, mean ΔE 00 values were highly significantly different and varied from 0.8 (Ceram X Duo/air) to 20.9 (Ceram X Duo/red wine). When analysed over a black background, mean ΔE 00 values were highly significantly different and varied from 1.0 (Ceram X Duo and Tetric/air) to 25.2 (Ceram X Duo/red wine). Differences in translucency varied from 0.3 (Ceram X Duo/air) to 21.1 (Ceram X Duo/juice). The correlation between ΔE and ΔE 00 over a white background was 0.9928, while over a black background, it was 0.9886.

Stable TEM00-mode Nd:YAG solar laser operation by a twisted fused silica light-guide

Science.gov (United States)

Bouadjemine, R.; Liang, D.; Almeida, J.; Mehellou, S.; Vistas, C. R.; Kellou, A.; Guillot, E.

2017-12-01

To improve the output beam stability of a TEM00-mode solar-pumped laser, a twisted fused silica light-guide was used to achieve uniform pumping along a 3 mm diameter and 50 mm length Nd:YAG rod. The concentrated solar power at the focal spot of a primary parabolic mirror with 1.18 m2 effective collection area was efficiently coupled to the entrance aperture of a 2D-CPC/2V-shaped pump cavity, within which the thin laser rod was pumped. Optimum solar laser design parameters were found through ZEMAX© non-sequential ray-tracing and LASCAD© laser cavity analysis codes. 2.3 W continuous-wave TEM00-mode 1064 nm laser power was measured, corresponding to 1.96 W/m2 collection efficiency and 2.2 W laser beam brightness figure of merit. Excellent TEM00-mode laser beam profile at M2 ≤ 1.05 and very good output power stability of less than 1.6% were achieved. Heliostat orientation error dependent laser power variation was considerably less than previous solar laser pumping schemes.

Structural and Catalytic Properties of S1 Nuclease from Aspergillus oryzae Responsible for Substrate Recognition, Cleavage, Non-Specificity, and Inhibition

Czech Academy of Sciences Publication Activity Database

Koval, Tomáš; Ostergaard, L. H.; Lehmbeck, J.; Norgaard, A.; Lipovová, P.; Dušková, Jarmila; Skálová, Tereza; Trundová, Mária; Kolenko, Petr; Fejfarová, Karla; Stránský, Jan; Švecová, Leona; Hašek, Jindřich; Dohnálek, Jan

2016-01-01

Roč. 11, č. 12 (2016), č. článku e0168832. E-ISSN 1932-6203 R&D Projects: GA ČR GA15-05228S; GA MŠk LG14009; GA MŠk(CZ) LM2015043 Grant - others:GA MŠk(CZ) CZ.1.05/1.1.00/02.0109 Institutional support: RVO:86652036 Keywords : macromolecular crystallography * crystal-structures * resolution * p1 Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology Impact factor: 2.806, year: 2016

Determination of maintainability for Dacia 1304, 1,9 D utility vehicle

Science.gov (United States)

Budiul Berghian, A.; Vasiu, T.; Birtok Baneasa, C.

2018-01-01

The study analyses the ability to be maintained or rehabilitation of Dacia 1304, 1,9D utility vehicle. The paper comprises the determination of its maintainability using the Weibull++8 specialized software.

MiR-19a targets suppressor of cytokine signaling 1 to modulate the progression of neuropathic pain.

Science.gov (United States)

Wang, Conghui; Jiang, Qi; Wang, Min; Li, Dong

2015-01-01

We aimed to investigate whether miR-19a is associated with neuropathic pain and elucidate the underlying regulatory mechanism. We established a neuropathic pain model of bilateral chronic constriction injury (bCCI). Then bCCI rats were injected with mo-miR-19a, siR-SOCS1 or blank expression vector through a microinjection syringe via an intrathecal catheter on 3 day before surgery and after surgery. Behavioral tests, such as mechanical allodynia, thermal hyperalgesia and acetone induced cold allodynia, were performed to evaluate the pain threshold. Besides, quantitative real-time polymerase chain reaction (qRT-PCR) was performed to determine the expression of miR-19a and western blotting was carried out to measure the expression of SOCS1. miR-19a expression levels were markedly increased in neuropathic pain models. Moreover, miR-19a significantly attenuated mechanical allodynia and thermal hyperalgesia, and similar results were obtained after knockdown of SOCS1 expression. However, miR-19a markedly increased the times that the rats appeared a sign of cold allodynia, and knockdown of SOCS1 expression had similar effects. Besides, the results of bioinformatics analysis and western blotting analysis were all confirmed that SOCS1 was a direct target of miR-19a in neuropathic pain models. Our finding indicate that SOCS1 is a direct target of miR-19a in neuropathic pain rats and miR-19a may play a critical role in regulating of neuropathic pain via targeting SOCS1.

Human parvovirus B19 VP1u Protein as inflammatory mediators induces liver injury in naïve mice.

Science.gov (United States)

Hsu, Tsai-Ching; Chiu, Chun-Ching; Chang, Shun-Chih; Chan, Hsu-Chin; Shi, Ya-Fang; Chen, Tzy-Yen; Tzang, Bor-Show

2016-01-01

Human parvovirus B19 (B19V) is a human pathogen known to be associated with many non-erythroid diseases, including hepatitis. Although B19V VP1-unique region (B19-VP1u) has crucial roles in the pathogenesis of B19V infection, the influence of B19-VP1u proteins on hepatic injury is still obscure. This study investigated the effect and possible inflammatory signaling of B19-VP1u in livers from BALB/c mice that were subcutaneously inoculated with VP1u-expressing COS-7 cells. The in vivo effects of B19-VP1u were analyzed by using live animal imaging system (IVIS), Haematoxylin-Eosin staining, gel zymography, and immunoblotting after inoculation. Markedly hepatocyte disarray and lymphocyte infiltration, enhanced matrix metalloproteinase (MMP)-9 activity and increased phosphorylation of p38, ERK, IKK-α, IκB and NF-κB (p-p65) proteins were observed in livers from BALB/c mice receiving COS-7 cells expressing B19-VP1u as well as the significantly increased CRP, IL-1β and IL-6. Notably, IFN-γ and phosphorylated STAT1, but not STAT3, were also significantly increased in the livers of BALB/c mice that were subcutaneously inoculated with VP1u-expressing COS-7 cells. These findings revealed the effects of B19-VP1u on liver injury and suggested that B19-VP1u may have a role as mediators of inflammation in B19V infection.

Mouse homologue of yeast Prp19 interacts with mouse SUG1, the regulatory subunit of 26S proteasome

International Nuclear Information System (INIS)

Sihn, Choong-Ryoul; Cho, Si Young; Lee, Jeong Ho; Lee, Tae Ryong; Kim, Sang Hoon

2007-01-01

Yeast Prp19 has been shown to involve in pre-mRNA splicing and DNA repair as well as being an ubiquitin ligase. Mammalian homologue of yeast Prp19 also plays on similar functional activities in cells. In the present study, we isolated mouse SUG1 (mSUG1) as binding partner of mouse Prp19 (mPrp19) by the yeast two-hybrid system. We confirmed the interaction of mPrp9 with mSUG1 by GST pull-down assay and co-immunoprecipitation assay. The N-terminus of mPrp19 including U-box domain was associated with the C-terminus of mSUG1. Although, mSUG1 is a regulatory subunit of 26S proteasome, mPrp19 was not degraded in the proteasome-dependent pathway. Interestingly, GFP-mPrp19 fusion protein was co-localized with mSUG1 protein in cytoplasm as the formation of the speckle-like structures in the presence of a proteasome inhibitor MG132. In addition, the activity of proteasome was increased in cells transfected with mPrp19. Taken together, these results suggest that mPrp19 involves the regulation of protein turnover and may transport its substrates to 26S proteasome through mSUG1 protein

41 CFR 105-74.650 - Grant.

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Grant. 105-74.650 Section 105-74.650 Public Contracts and Property Management Federal Property Management Regulations System...-GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 105-74.650 Grant. Grant...

Estimating global arthropod species richness: refining probabilistic models using probability bounds analysis

Czech Academy of Sciences Publication Activity Database

Hamilton, A. J.; Novotný, Vojtěch; Waters, E. K.; Basset, Y.; Benke, K. K.; Grimbacher, P. S.; Miller, S. E.; Samuelson, G. A.; Weiblen, G. D.; Yen, J. D. L.; Stork, N. E.

2013-01-01

Roč. 171, č. 2 (2013), s. 357-365 ISSN 0029-8549 R&D Projects: GA MŠk(CZ) LH11008; GA ČR GA206/09/0115 Grant - others:Czech Ministry of Education(CZ) CZ.1.07/2.3.00/20.0064; National Science Foundarion(US) DEB-0841885; Otto Kinne Foundation, Darwin Initiative(GB) 19-008 Institutional research plan: CEZ:AV0Z50070508 Institutional support: RVO:60077344 Keywords : host specificity * model * Monte Carlo Subject RIV: EH - Ecology, Behaviour Impact factor: 3.248, year: 2013 http://link.springer.com/article/10.1007%2Fs00442-012-2434-5

Plagiarism in Grant Proposals

Science.gov (United States)

Markin, Karen M.

2012-01-01

It is not news that software exists to check undergraduate papers for plagiarism. What is less well known is that some federal grant agencies are using technology to detect plagiarism in grant proposals. That variety of research misconduct is a growing problem, according to federal experts. The National Science Foundation, in its most recent…

77 FR 33476 - Center for Scientific Review; Notice of Closed Meetings

Science.gov (United States)

2012-06-06

... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health Center for Scientific Review... Hematology. Date: June 25-26, 2012. Time: 10:00 a.m. to 5:00 p.m. Agenda: To review and evaluate grant..., Drug Use, Food Insecurity. Date: June 26, 2012. Time: 1:00 p.m. to 5:00 p.m. Agenda: To review and...

44 CFR 204.25 - FEMA-State agreement for fire management assistance grant program.

Science.gov (United States)

2010-10-01

... GRANT PROGRAM Declaration Process § 204.25 FEMA-State agreement for fire management assistance grant... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false FEMA-State agreement for fire management assistance grant program. 204.25 Section 204.25 Emergency Management and Assistance FEDERAL...

Handbook of Inviscid Sphere-Cone Flow Fields and Pressure Distributions. Volume 1

Science.gov (United States)

1975-12-01

8.00 ANGLE OF ATTACK = 1.00 P / P FREE-STREAM AT PLANE ANGLES L/RN 0. 30. 60. 90. 120. iso . 180. S/RN 62.835 34.625 33.936 31.809 27.874 23.163 19.897...1.954 1 922 11273 6.972 3.241 3069 2663 2 2.20 27003 1.876 1.843 12*372 12817 3.228 3.046 2.619 2211 1.939 1.811 1.778 13.453 3*576 3.23t -4-,-G40 59...AT PLANE ANGLES -L/RN 0. 30. 60. 90. 1206 150. ISO * S/RN .728 55.729 51.603 41.628 30.695 22.303 17.474 15.941 1.296 o874 52.472 48.397 38.674 28.299

Fusion plasma theory grant: Task 1, Magnetic confinement fusion plasma theory

International Nuclear Information System (INIS)

Callen, J.D.

1989-07-01

The research performed under this grant during the current year has concentrated on key tokamak plasma confinement and heating theory issues: further development of neoclassical MHD; development of a new fluid/kinetic hybrid model; energy confinement degradation due to macroscopic phenomena in tokamaks; and some other topics (magnetics analysis, coherent structures, presheath structure). Progress and publications in these areas are briefly summarized in this report. 20 refs

22 CFR 63.5 - Grants to foreign participants to study.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Grants to foreign participants to study. 63.5 Section 63.5 Foreign Relations DEPARTMENT OF STATE PUBLIC DIPLOMACY AND EXCHANGES PAYMENTS TO AND ON BEHALF OF PARTICIPANTS IN THE INTERNATIONAL EDUCATIONAL AND CULTURAL EXCHANGE PROGRAM § 63.5 Grants to...

42 CFR 86.10 - Nature and purpose of training grants.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Nature and purpose of training grants. 86.10 Section 86.10 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OCCUPATIONAL... AND HEALTH Occupational Safety and Health Training Grants § 86.10 Nature and purpose of training...

Gaia Data Release 1 Open cluster astrometry: performance, limitations, and future prospects

Czech Academy of Sciences Publication Activity Database

van Leeuwen, F.; Vallenari, A.; Jordi, C.; Lindegren, L.; Bastian, U.; Prusti, T.; de Bruijne, J.H.J.; Brown, A.G.A.; Babusiaux, C.; Bailer-Jones, C.A.L.; Fuchs, Jan; Koubský, Pavel; Votruba, Viktor

2017-01-01

Roč. 601, May (2017), A19/1-A19/65 E-ISSN 1432-0746 R&D Projects: GA MŠk(CZ) LG15010 Grant - others:ESA(XE) ESA-PECS project No. 98058 Institutional support: RVO:67985815 Keywords : astrometry * open clusters and associations * proper motion and parallax Subject RIV: BN - Astronomy , Celestial Mechanics, Astrophysics OBOR OECD: Astronomy (including astrophysics,space science) Impact factor: 5.014, year: 2016

7 CFR 1948.95 - Grant monitoring.

Science.gov (United States)

2010-01-01

... 7 Agriculture 13 2010-01-01 2009-01-01 true Grant monitoring. 1948.95 Section 1948.95 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... § 1948.95 Grant monitoring. Each grant will be monitored by FmHA or its successor agency under Public Law...

Crystal field effect on the f-levels of R.sub.1+x./sub.Ba.sub.2-x./sub.Cu.sub.3./sub.O.sub.6+ë./sub..

Czech Academy of Sciences Publication Activity Database

Nekvasil, Vladimír; Jandl, S.; Barba, D.; Martin, A. A.; Cardona, M.; Diviš, E.; Maryško, Miroslav; Wolf, T.

226-230, - (2001), s. 985-987 ISSN 0304-8853 R&D Projects: GA ČR GA202/99/0184; GA ČR GA202/00/1602 Grant - others:FAPESP(BR) 98/14624-4 Institutional research plan: CEZ:A02/98:Z1-010-914 Keywords : crystal field * magnetic susceptibility * high Tc superconductivity Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.329, year: 2001

Identification of a novel NLS of herpes simplex virus type 1 (HSV-1) VP19C and its nuclear localization is required for efficient production of HSV-1.

Science.gov (United States)

Li, You; Zhao, Lei; Wang, Shuai; Xing, Junji; Zheng, Chunfu

2012-09-01

Herpes simplex virus type 1 (HSV-1) triplex is a complex of three protein subunits, consisting of two copies of VP23 and one copy of VP19C. Here, we identified a non-classical NLS of VP19C between aa 50 and 61, and the nuclear import of VP19C was mediated by RanGTP and importin β1-, but not importin α5-, dependent pathway. Additionally, recombinant virus harbouring this NLS mutation (NLSm) replicates less efficiently as wild-type. These data strongly suggested that the nuclear import of VP19C is required for efficient HSV-1 production.

MeCP2 silencing of LncRNA H19 controls hepatic stellate cell proliferation by targeting IGF1R

International Nuclear Information System (INIS)

Yang, Jing-Jing; Liu, Li-Ping; Tao, Hui; Hu, Wei; Shi, Peng; Deng, Zi-Yu; Li, Jun

2016-01-01

Highlights: • H19 plays a key role in HSCs proliferation and fibrosis. • MeCP2/H19 axis involvement in HSCs activation and fibrosis. • MeCP2 negative controls H19 expression in activated HSCs. • Identification of IGF1R as new target of H19 in HSC. - Abstract: Methyl-CpG-binding protein 2 (MeCP2) plays a key role in liver fibrosis. However, the potential mechanism of MeCP2 in liver fibrosis remains unclear. Early reports suggest that LncRNA H19 is important epigenetic regulator with critical roles in cell proliferation, but its role in hepatic fibrosis remains elusive. Sprague-Dawley rats liver fibrosis was generated by 12-weeks treatment with CCl 4 intraperitoneal injection. HSC-T6 cells were used in vitro study. The expression levels of MeCP2, H19, IGF1R, α-SMA, and Col1A1 were estimated by Western blotting, qRT-PCR and Immunohistochemistry. HSC-T6 cells were transfected with MeCP2-siRNA, pEGF-C1-MeCP2, pEX-3-H19, and H19-siRNA. Finally, cell proliferation ability was assessed by the MTT assay. Here, we found that H19 was significantly down-regulated in HSCs and fibrosis tissues, and an opposite pattern is observed for MeCP2 and IGF1R. Silencing of MeCP2 blocked HSCs proliferation. Knockdown of MeCP2 elevated H19 expression in activated HSCs, and over-expression of MeCP2 inhibited H19 expression in activated HSCs. Moreover, we investigated the effect of H19 on IGF1R expression. Overexpression of H19 in HSCs repressed the expression of IGF1R, and an opposite pattern is observed for H19 silenced. In addition, we reported that overexpression of H19 inhibited the TGF-β1-induced proliferation of HSCs. Furthermore, MeCP2 negative regulation of H19 by targeting the protein IGF1R. Taken together, these results demonstrated that MeCP2 silencing of H19 can alter the IGF1R overexpression, thus contributing to HSCs proliferation. These data could suggest the development of combination therapies that target the MeCP2.

Export support of renewable energy industries, grant number 1, deliverable number 3. Final report

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-01-14

The United States Export Council for Renewable Energy (US/ECRE), a consortium of six industry associations, promotes the interests of the renewable energy and energy efficiency member companies which provide goods and services in biomass, geothermal, hydropower, passive solar, photovoltaics, solar thermal, wind, wood energy, and energy efficiency technologies. US/ECRE`s mission is to catalyze export markets for renewable energy and energy efficiency technologies worldwide. Under this grant, US/ECRE has conducted a number of in-house activities, as well as to manage activities by member trade associations, affiliate organizations and non-member contractors and consultants. The purpose of this document is to report on grant coordination and effectiveness.

CK19 mRNA expression and its clinical significances in peripheral blood of non-small cell lung cancer patients before definitive chemoradiotherapy

International Nuclear Information System (INIS)

Chen Tingfeng; Zhang Yiqin; Jiang Guoliang; Wang Lijuan; Fu Xiaojuan; Qian Hao; Wu Kailiang; Zhao Sen

2007-01-01

Objective: To investigate the CK19 mRNA expression as the marker of micrometastasis and its clinical significance in peripheral blood of patients with non-small cell lung cancer(NSCLC) treated by definitive chemo-radiation. Methods: We measured CK19 mRNA, as the marker of micrometastasis by nested RT-PCR in the peripheral blood taken from 106 NSCLC patients before chemo-radiation and further investigated both their relationship with clinicopathological features and prognostic significance. Results: The positive rate of peripheral blood micrometastasis (PBMM) was 63% (67/106). PBMM was closely correlated to N-stage (χ 2 =10.41, P=0.001), pathological classification (χ 2 =5.22, P=0.022), and pathologic grade (χ 2 =7.82, P=0.020). However, it was not related to sex (χ 2 =2.70, P=0.100), T-stage (χ 2 =0.01, P=0.941), TNM stage (χ 2 =5.32, P=0.070), weight loss (χ 2 =0.71, P=0.399), or KPS status (χ 2 =0.23, P=0.629). The 3-year distant metastasis rate and iocoregional relapse rate for NSCLC patients with the positive and negative of PBMM were 70% vs 63% (χ 2 =0.34, P=0.559) and 69% vs 57% (χ 2 =0.61, P=0.435), respectively. For all patients, median overall survival and 3-year overall survival rate was 17 months and 24%, respectively. There was no survival difference in patients with the positive or negative of PBMM, with median overall survival of 16 months and 20 months and 3-yr overall survival of 21% and 28% , respectovely (χ 2 =0.61, P=0.435). Conclusion: Peripheral blood micrometastasis is closely in correlation with N-stage, pathological classification, and pathological grade in patients with NSCLC before definitive chemo-radiation. However, it possessed no prognostic significance. (authors)

Komparasi Aplikasi Perangkat Lunak Sistem Klasifikasi DDC: Athenaeum Light 8.5, DFW Version 1.00, Webdewey 2.0, E-DDC Edition 22

Directory of Open Access Journals (Sweden)

Wijaya Hardiati

2012-05-01

Full Text Available Librarian has many alternative to classify DDC (Dewey Decimal Classification number. not only use printed DDC, but now DDC software to help identify DDC number is available. One of them is Athenaeum Light 8.5, DFW (Dewey For Windows Version 1.00, WebDewey 2.0, e-DDC (electronic-Dewey Decimal Classification Edition 22. In this paper, it will roll out about how to use software with it excess and deficiency.

Féret en daarna

NARCIS (Netherlands)

Dommering, E.; Geus, M.J.; Hins, A.W.; Kroes, Q.R.; Nieuwenhuis, A.J.; Pietermaat, E.C.; Turner, C.J.; Voorhoof, D.

2013-01-01

In de zaak Féret1 veroordeelde het EHRM de haatzaaiende politicus voor discriminatie en aanzetten tot racisme, zonder dat in concreto een daad tot aanzetten van geweld of discriminatie door de nationale rechter was vastgesteld. Dit blijft, ondanks interne discussie in het Hof, vaste jurisprudentie.

short communication synthesis of stabilized phosphorus ylides from ...

African Journals Online (AJOL)

Preferred Customer

made from phosphine and an alkyl halide [1], and they are also obtained by the Michael addition of ... dialkyl acetylenedicarboxylates (DAAD), triphenylphosphine (TPP) and acids such as phenols, imides, amides ... protonation of the intermediate by an acid leads to vinyltriphenylphosphonium salts [7-16]. The salts are ...

Comparison of circulating MMP-9, TIMP-1 and CA19-9 in the detection of pancreatic cancer

DEFF Research Database (Denmark)

Jørgensen, Maiken Thyregod; Brunner, Nils; Schaffalitzky de Muckadell, Ove B.

2010-01-01

, TIMP-1 and CA19-9 in detecting pancreatic ductal adenocarcinoma were 58.82%, 47.1% and 86%, respectively, with specificities of 34.6%, 69.2% and 73%. The AUCs of MMP-9, TIMP-1 and CA19-9 were 0.50, 0.64 and 0.84, respectively. Combining the three markers did not significantly improve detection......Background/Aim: The performance of the circulating tumor markers carbohydrate antigen 19-9 (CA19-9), matrix metalloproteinase 9 (MMP-9) and tissue inhibitor of metalloproteinase 1 (TIMP-1) were evaluated separately and in combination for their potential value in detecting pancreatic ductal...... adenocarcinoma. PATIENTS AND METHODS: The patients had symptoms of pancreatic cancer. The discriminative strength of MMP-9 and TIMP-1 were compared to that of CA19-9 using receiver operating characteristics curves, area under the curves (AUC), specificity and sensitivity. RESULTS: The sensitivities of MMP-9...

42 CFR 52.6 - Grant awards.

Science.gov (United States)

2010-10-01

... grant to those applicants whose approved projects will in the Secretary's judgment best promote the..., the grant will initially be for one year and subsequent continuation awards will also be for one year... application nor the award of any grant commits or obligates the United States in any way to make any...

Prior publication productivity, grant percentile ranking, and topic-normalized citation impact of NHLBI cardiovascular R01 grants.

Science.gov (United States)

Kaltman, Jonathan R; Evans, Frank J; Danthi, Narasimhan S; Wu, Colin O; DiMichele, Donna M; Lauer, Michael S

2014-09-12

We previously demonstrated absence of association between peer-review-derived percentile ranking and raw citation impact in a large cohort of National Heart, Lung, and Blood Institute cardiovascular R01 grants, but we did not consider pregrant investigator publication productivity. We also did not normalize citation counts for scientific field, type of article, and year of publication. To determine whether measures of investigator prior productivity predict a grant's subsequent scientific impact as measured by normalized citation metrics. We identified 1492 investigator-initiated de novo National Heart, Lung, and Blood Institute R01 grant applications funded between 2001 and 2008 and linked the publications from these grants to their InCites (Thompson Reuters) citation record. InCites provides a normalized citation count for each publication stratifying by year of publication, type of publication, and field of science. The coprimary end points for this analysis were the normalized citation impact per million dollars allocated and the number of publications per grant that has normalized citation rate in the top decile per million dollars allocated (top 10% articles). Prior productivity measures included the number of National Heart, Lung, and Blood Institute-supported publications each principal investigator published in the 5 years before grant review and the corresponding prior normalized citation impact score. After accounting for potential confounders, there was no association between peer-review percentile ranking and bibliometric end points (all adjusted P>0.5). However, prior productivity was predictive (Pcitation counts, we confirmed a lack of association between peer-review grant percentile ranking and grant citation impact. However, prior investigator publication productivity was predictive of grant-specific citation impact. © 2014 American Heart Association, Inc.

7 CFR 4280.110 - Grant funding.

Science.gov (United States)

2010-01-01

... renewable energy system or energy efficiency improvement. (1) Post-application purchase and installation of... UTILITIES SERVICE, DEPARTMENT OF AGRICULTURE LOANS AND GRANTS Renewable Energy Systems and Energy Efficiency...-party equity contributions are acceptable for renewable energy system projects, including those that are...

Genetically heterogeneous glioblastoma recurring with disappearance of 1p/19q losses: case report.

Science.gov (United States)

Ito, Motokazu; Wakabayashi, Toshihiko; Natsume, Atsushi; Hatano, Hisashi; Fujii, Masazumi; Yoshida, Jun

2007-07-01

Intratumor heterogeneity is of great importance in many clinical aspects of glioma biology, including tumor grading, therapeutic response, and recurrence. Modifications in the genetic features of a specific primary tumor recurring after chemo- and radiotherapy are poorly understood. We report a recurrent glioblastoma case exhibiting loss of heterozygosity (LOH) on chromosome 10q, while the primary tumor exhibited heterogeneity in the LOH status of 1p, 19q, and 10q. To determine the relationship between such modifications and heterogeneous chemosensitivity, primary cultured cells heterogeneously showing 1p/19q/10q losses were established from a surgical specimen of oligoastrocytoma and were treated with chemotherapeutic agents. A 46-year-old woman with a 1-month history of headache and visual disturbances presented to our institution. A right temporoparietal craniotomy and gross total resection were performed. The pathological diagnosis was glioblastoma multiforme with oligodendroglial components. Whereas LOH on 10q was identified at all tumor sites, only the oligodendroglial components exhibited LOH on 1p and 19q. The tumor recurred 6 months after postoperative chemotherapy using interferon-beta and ranimustine, as well as a course of fractionated external-beam radiotherapy (total dose, 60 Gy). Gene analysis revealed no 1p/19q allelic losses but only 10q LOH. Intratumor heterogeneity might be explained by the presence of more than one subclone in the primary tumor. Here, the tumor cells exhibiting 1p/19q LOH with high chemosensitivity might have been killed by the adjuvant therapy and those exhibiting 10q LOH with chemoresistance recurred. This study and our preliminary laboratory findings might suggest an approach to brain tumor physiology, diagnosis, and therapy.

Biophysical and Pharmacological Characterization of Nav1.9 Voltage Dependent Sodium Channels Stably Expressed in HEK-293 Cells.

Directory of Open Access Journals (Sweden)

Zhixin Lin

Full Text Available The voltage dependent sodium channel Nav1.9, is expressed preferentially in peripheral sensory neurons and has been linked to human genetic pain disorders, which makes it target of interest for the development of new pain therapeutics. However, characterization of Nav1.9 pharmacology has been limited due in part to the historical difficulty of functionally expressing recombinant channels. Here we report the successful generation and characterization of human, mouse and rat Nav1.9 stably expressed in human HEK-293 cells. These cells exhibit slowly activating and inactivating inward sodium channel currents that have characteristics of native Nav1.9. Optimal functional expression was achieved by coexpression of Nav1.9 with β1/β2 subunits. While recombinantly expressed Nav1.9 was found to be sensitive to sodium channel inhibitors TC-N 1752 and tetracaine, potency was up to 100-fold less than reported for other Nav channel subtypes despite evidence to support an interaction with the canonical local anesthetic (LA binding region on Domain 4 S6. Nav1.9 Domain 2 S6 pore domain contains a unique lysine residue (K799 which is predicted to be spatially near the local anesthetic interaction site. Mutation of this residue to the consensus asparagine (K799N resulted in an increase in potency for tetracaine, but a decrease for TC-N 1752, suggesting that this residue can influence interaction of inhibitors with the Nav1.9 pore. In summary, we have shown that stable functional expression of Nav1.9 in the widely used HEK-293 cells is possible, which opens up opportunities to better understand channel properties and may potentially aid identification of novel Nav1.9 based pharmacotherapies.

78 FR 5468 - Center for Scientific Review; Notice of Closed Meetings

Science.gov (United States)

2013-01-25

... (2013/05). Date: February 20-21, 2013. Time: 9:00 a.m. to 5:00 p.m. Agenda: To review and evaluate grant... Technologies. Date: February 21-22, 2013. Time: 8:00 a.m. to 5:00 p.m. Agenda: To review and evaluate grant...: Medical Imaging. Date: February 21-22, 2013. Time: 8:00 a.m. to 5:00 p.m. Agenda: To review and evaluate...

Scientific-Technical and Business Careers Training Grant

Science.gov (United States)

Conway, Mary P.

2001-01-01

The 1996 renewal of the NGT2-1001 grant included three objectives and expected outcomes. The information highlights the results and progress to address the grant objectives and outcomes for the time period of July 1, 2000 through June 30, 2001. Objective Number One indicated that the internship staff would annually recruit and place at least 90 community college students in internship positions related to their college majors. Internship enrollments for the summer, fall, winter and spring quarters of 2000-2001 show an average enrollment of 121 students per quarter. This number includes (13) interns sponsored by Ames contractors.

Granting silence to avoid wireless collisions

KAUST Repository

Choi, Jung Il

2010-10-01

We describe grant-to-send, a novel collision avoidance algorithm for wireless mesh networks. Rather than announce packets it intends to send, a node using grant-to-send announces packets it expects to hear others send. We present evidence that inverting collision avoidance in this way greatly improves wireless mesh performance. Evaluating four protocols from 802.11 meshes and 802.15.4 sensor networks, we find that grant-to-send matches or outperforms CSMA and RTS/CTS in all cases. For example, in a 4-hop UDP flow, grantto- send can achieve 96% of the theoretical maximum throughput while maintaining a 99.9% packet delivery ratio. Grant-tosend is also general enough to replace protocol-specific collision avoidance mechanisms common to sensor network protocols. Grant-to-send is simple. For example, incorporating it into 802.11 requires only 11 lines of driver code and no hardware changes. Furthermore, as it reuses existing 802.11 mechanisms, grant-to-send inter-operates with current networks and can be incrementally deployed. © 2010 IEEE.

Granting silence to avoid wireless collisions

KAUST Repository

Choi, Jung Il; Jain, Mayank; Kazandjieva, Maria A.; Levis, Philip

2010-01-01

We describe grant-to-send, a novel collision avoidance algorithm for wireless mesh networks. Rather than announce packets it intends to send, a node using grant-to-send announces packets it expects to hear others send. We present evidence that inverting collision avoidance in this way greatly improves wireless mesh performance. Evaluating four protocols from 802.11 meshes and 802.15.4 sensor networks, we find that grant-to-send matches or outperforms CSMA and RTS/CTS in all cases. For example, in a 4-hop UDP flow, grantto- send can achieve 96% of the theoretical maximum throughput while maintaining a 99.9% packet delivery ratio. Grant-tosend is also general enough to replace protocol-specific collision avoidance mechanisms common to sensor network protocols. Grant-to-send is simple. For example, incorporating it into 802.11 requires only 11 lines of driver code and no hardware changes. Furthermore, as it reuses existing 802.11 mechanisms, grant-to-send inter-operates with current networks and can be incrementally deployed. © 2010 IEEE.

Nová missense mutace 574C>T v genu SURF1 - biochemická a molekulárně genetická studie u sedmi dětí s Leighovým syndromem

Czech Academy of Sciences Publication Activity Database

Čapková, M.; Hansíková, H.; Godinot, C.; Houšťková, H.; Houštěk, Josef; Zeman, J.

2002-01-01

Roč. 141, č. 20 (2002), s. 636-641 ISSN 0008-7335 R&D Projects: GA MZd(CZ) NE6555; GA MŠk(CZ) LN00A079 Grant - others:GA UK(CZ) 8/2000/C; FR-CZ(CZ) Barrande 2001/028-1 Institutional research plan: CEZ:AV0Z5011922 Keywords : Leigh syndrome * SURF1 gene * Surf1 protein Subject RIV: EB - Genetics ; Molecular Biology

19 CFR 113.1 - Authority to require security or execution of bond.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Authority to require security or execution of bond. 113.1 Section 113.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS BONDS General Provisions § 113.1 Authority to require security or...

SOFIA MID-INFRARED IMAGING AND CSO SUBMILLIMETER POLARIMETRY OBSERVATIONS OF G034.43+00.24 MM1

International Nuclear Information System (INIS)

Jones, T. J.; Gordon, Michael; Shenoy, Dinesh; Gehrz, R. D.; Vaillancourt, John E.; Krejny, M.

2016-01-01

We present 11.1 to 37.1 μ m imaging observations of the very dense molecular cloud core MM1 in G034.43+00.24 using FORCAST on SOFIA and submillimeter (submm) polarimetry using SHARP on the Caltech Submillimeter Observatory. We find that at the spatial resolution of SOFIA, the point-spread function (PSF) of MM1 is consistent with being a single source, as expected based on millimeter (mm) and submm observations. The spectral energy distributions (SEDs) of MM1 and MM2 have a warm component at the shorter wavelengths not seen in mm and submm SEDs. Examination of H(1.65 μ m) stellar polarimetry from the Galactic Plane Infrared Polarization Survey shows that G034 is embedded in an external magnetic field aligned with the Galactic Plane. The SHARP polarimetry at 450 μ m shows a magnetic field geometry in the vicinity of MM1 that does not line up with either the Galactic Plane or the mean field direction inferred from the CARMA interferometric polarization map of the central cloud core, but is perpendicular to the long filament in which G034 is embedded. The CARMA polarimetry does show evidence for grain alignment in the central region of the cloud core, and thus does trace the magnetic field geometry near the embedded Class 0 YSO.

38 CFR 61.41 - Special needs grants application.

Science.gov (United States)

2010-07-01

... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Special needs grants... (CONTINUED) VA HOMELESS PROVIDERS GRANT AND PER DIEM PROGRAM § 61.41 Special needs grants application. (a) To apply for a special needs grant, an applicant must obtain from VA a special needs grant application...

Increased expression of Matrix Metalloproteinase 9 in liver from NZB/W F1 mice received antibody against human parvovirus B19 VP1 unique region protein

Directory of Open Access Journals (Sweden)

Hsu Gwo-Jong

2009-01-01

Full Text Available Abstract Background Human parvovirus B19 infection has been postulated to the anti-phospholipid syndrome (APS in autoimmunity. However, the influence of anti-B19-VP1u antibody in autoimmune diseases is still obscure. Methods To elucidate the effect of anti-B19-VP1u antibodies in systemic lupus erythematosus (SLE, passive transfer of rabbit anti-B19-VP1u IgG was injected intravenously into NZB/W F1 mice. Results Significant reduction of platelet count and prolonged thrombocytopenia time were detected in anti-B19-VP1u IgG group as compared to other groups, whereas significant increases of anti-B19-VP1u, anti-phospholipid (APhL, and anti-double strand DNA (dsDNA antibody binding activity were detected in anti-B19-VP1u group. Additionally, significant increases of matrix metalloproteinase-9 (MMP9 activity and protein expression were detected in B19-VP1u IgG group. Notably, phosphatidylinositol 3-phosphate kinase (PI3K and phosphorylated extracellular signal-regulated kinase (ERK proteins were involved in the induction of MMP9. Conclusion These experimental results firstly demonstrated the aggravated effects of anti-B19-VP1u antibody in disease activity of SLE.

49 CFR 110.110 - After-grant requirements.

Science.gov (United States)

2010-10-01

... PUBLIC SECTOR TRAINING AND PLANNING GRANTS § 110.110 After-grant requirements. The Associate... must submit all financial, performance, and other reports required as a condition of the grant, within...

The orbital inclination of A0620 - 00 measured polarimetrically

International Nuclear Information System (INIS)

Dolan, J.F.; Tapia, S.

1989-01-01

The mass of the degenerate primary in A0620 - 00 is inferred from its spectroscopic mass function to be not less than 3.2 solar masses, making it an excellent candidate for a black hole. The exact value of the mass depends on the orbital inclination. The inclination of a binary system can be determined from the shape of its Stokes parameter light curves if the linear polarization of the system varies as a function of orbital phase. A0620 - 00 over one 8-hour binary period was observed with the 4.5-m equivalent MMT. Its polarization in the visible is variable with orbital phase. The standard theory of Brown et al. (1978) was used to derive an orbital inclination of i = 57 deg (+20 deg, -50 deg), where the error is the 90-percent confidence interval. An inclination of i = 57 deg corresponds to a mass of the compact primary of 6.6 solar masses, but the large uncertainty in the measured value of the inclination allows the derived mass of A0620 - 00 to be as low as 3.8 solar masses. If this is taken to be the maximum mass of any degenerate configuration consistent with general relativity except a black hole, then the mass of A0620 - 00 is still not well enough determined to conclude that it must be a black hole. 21 refs

GEF small grants programme - overview

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-12-01

This paper describes the GEF small grants program which seeks to enhance the role of households and communities in conserving global biodiversity, mitigating global climate change, and protecting international waters. Grants up to $50k have been granted for projects in 33 countries, with plans for 12 other countries. The author describes the framework that the program works under, and the methodology followed in developing and planning projects. The approach to climate change concerns is to emphasize the development of non-carbon energy development activities to provide energy sources and economic development.

Relaxation dynamics of femtosecond-laser-induced temperature modulation on the surfaces of metals and semiconductors

Czech Academy of Sciences Publication Activity Database

Levy, Yoann; Derrien, Thibault; Bulgakova, Nadezhda M.; Gurevich, E.L.; Mocek, Tomáš

2016-01-01

Roč. 374, Jun (2016), s. 157-164 ISSN 0169-4332 R&D Projects: GA MŠk ED2.1.00/01.0027 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143; OP VK 6(XE) CZ.1.07/2.3.00/20.0143 Institutional support: RVO:68378271 Keywords : LIPSS * modulated temperature relaxation * two-temperature model * nano-melting Subject RIV: BH - Optics, Masers, Lasers Impact factor: 3.387, year: 2016

Phonological Errors Predominate in Arabic Spelling across Grades 1-9

Science.gov (United States)

Abu-Rabia, Salim; Taha, Haitham

2006-01-01

Most of the spelling error analysis has been conducted in Latin orthographies and rarely conducted in other orthographies like Arabic. Two hundred and eighty-eight students in grades 1-9 participated in the study. They were presented nine lists of words to test their spelling skills. Their spelling errors were analyzed by error categories. The…

Lead (Pb) bioaccumulation; genera Bacillus isolate S1 and SS19 as a case study

Science.gov (United States)

Arifiyanto, Achmad; Apriyanti, Fitria Dwi; Purwaningsih, Puput; Kalqutny, Septian Hary; Agustina, Dyah; Surtiningsih, Tini; Shovitri, Maya; Zulaika, Enny

2017-06-01

Lead (Pb) includes a group of large heavy metal in nature was toxic either on animal or human and did not provide an advantage function biologically. Bacillus isolates S1 and SS19 known resistant to lead up to 50 mg / L PbCl2. In this research will be examined whether genera Bacillus isolates S1 and SS19 could accumulate metal lead (Pb), their capability in accumulating and profile protein differences when the bacteria genera Bacillus isolates S1 and SS19 get exposed metal lead (Pb). Inoculum at age ± 9 hours are used, with a Nutrient Broth (NB) containing 50, 75 and 100 mg / L PbCl2. Inductively Coupled Plasma Atomic Emission Spectrometry (ICP) used to assessed Pb2+ concentrations. Bioaccumulation levels of Pb2+ by Bacillus isolate S1 and SS19 related to the distinction of beginning concentration to the final concentration. Bacillus isolate S1 achieved 53% and 51% bioaccumulation efficiency rate in lead presence concentration (75 and 100 mg/L) and 51% (50 mg/L). Another way Bacillus isolate SS19 was able to accumulate 57% (50 mg/L PbCl2) and kept stable on 36% bioaccumulation efficiency rate (75 and 100 mg/L PbCl2). Regarding SDS-PAGE electrophoresis protein profile result, protein in ± 127 kDa, molecule mass detected in the presence of Lead for Bacillus isolate S1.

Serum AMH levels in healthy women from BRCA1/2 mutated families: are they reduced?

Science.gov (United States)

van Tilborg, Theodora C; Derks-Smeets, Inge A P; Bos, Anna M E; Oosterwijk, Jan C; van Golde, Ron J; de Die-Smulders, Christine E; van der Kolk, Lizet E; van Zelst-Stams, Wendy A G; Velthuizen, Maria E; Hoek, Annemieke; Eijkemans, Marinus J C; Laven, Joop S E; Ausems, Margreet G E M; Broekmans, Frank J M

2016-11-01

Do BRCA1/2 mutation carriers have a compromised ovarian reserve compared to proven non-carriers, based on serum anti-Müllerian hormone (AMH) levels? BRCA1/2 mutation carriers do not show a lower serum AMH level in comparison to proven non-carriers, after adjustment for potential confounders. It has been suggested that the BRCA genes play a role in the process of ovarian reserve depletion, although previous studies have shown inconsistent results regarding the association between serum AMH levels and BRCA mutation status. Hence, it is yet unclear whether BRCA1/2 mutation carriers may indeed be at risk of a reduced reproductive lifespan. STUDY DESIGN, SIZE, DURATION: A multicenter, cross-sectional study was performed between January 2012 and February 2015 in 255 women. We needed to include 120 BRCA1/2 mutation carriers and 120 proven non-carriers to demonstrate a difference in AMH levels of 0.40 µg/l (SD ± 0.12 µg/l, two-sided alpha-error 0.05, power 80%). Healthy women aged 18-45 years who were referred to the Clinical Genetics Department and applied for predictive BRCA1/2 testing because of a familial BRCA1/2 mutation were asked to participate. A cross-sectional assessment was performed by measuring serum AMH levels and filling out a questionnaire. Multivariate linear regression analyses adjusted for age, current smoking and current hormonal contraceptive use were performed on log-transformed serum AMH levels. Out of 823 potentially eligible women, 421 (51.2%) were willing to participate, and of those, 166 (39%) did not meet our inclusion criteria. Two hundred and fifty-five women were available for analyses; 124 BRCA1/2 mutation carriers and 131 proven non-carriers. The median [range] AMH level in carriers was 1.90 µg/l [0.11-19.00] compared to 1.80 µg/l [0.11-10.00] in non-carriers (P = 0.34). Adjusted linear regression analysis revealed no reduction in AMH level in the carriers (relative change = 0.98 (95%CI, 0.77-1.22); P = 0.76). Participants

Dar Es Salaam Medical Students' Journal - Vol 19, No 1 (2012)

African Journals Online (AJOL)

Eggs: clearing the charges, exploring the potential! EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Maryam Amour, Judith Boshe, 34-37. http://dx.doi.org/10.4314/dmsj.v19i1.7 ...

GSK3β attenuates TGF-β1 induced epithelial–mesenchymal transition and metabolic alterations in ARPE-19 cells

International Nuclear Information System (INIS)

Huang, Li; Zhang, Cheng; Su, Li; Song, Zhengyu

2017-01-01

While TGF-β1 is known to induce epithelial–mesenchymal transition (EMT), a major factor in the pathogenesis of proliferative vitreoretinopathy (PVR), in ARPE-19 cells. The molecular pathways involved in EMT formation have not yet to be fully characterized. In this study, we have found that TGF-β1-mediated induction of EMT in ARPE-19 cells varied in a dose- and time-dependent manner. Specifically, TGF-β1 inhibited GSK-3β by accelerating phosphorylation at ser9. GSK-3β inhibitor or knockdown of GSK-3β resulted in enhanced TGF-β1-mediated EMT, migration and collagen contraction in ARPE-19 cells, which were then abrogated by GSK-3β overexpression and PI3K/AKT inhibitor. Importantly, GSK-3β also mediated metabolic reprogramming in TGF-β1-treated cells. Our results indicate that GSK-3β plays a pivotal role in TGF-β1-mediated EMT in ARPE-19 cells. - Highlights: • GSK-3β mediates epithelial-mesenchymal transition in TGF-β1 treated ARPE-19 cells. • GSK-3β regulates cell migration and collagen contraction of ARPE-19 cells. • TGF-β1 induces extracellular metabolomic changes of ARPE-19 cells via a GSK-3β-dependent mechanism.

77 FR 21114 - Self-Regulatory Organizations; NYSE Arca, Inc.; Order Granting Approval of Proposed Rule Change...

Science.gov (United States)

2012-04-09

... Sugar 11. SB 03:30-14:00 2.25 ICE-US Cocoa CC 04:00-14:00 0.39 ICE-US Cotton 2. CT 21:00-14:30 1.24 CME... quotient of (i) the product of (a) the total annualized quantity traded of such Designated Contract during the relevant calculation period and (b) the sum of the products of (x) the Designated Contract...

17 CFR 270.19a-1 - Written statement to accompany dividend payments by management companies.

Science.gov (United States)

2010-04-01

... that an open-end company may treat as a separate source its net profits from such sales during its... specify the sources from which the remainder was paid. Every company which in any fiscal year elects to... dividend payments by management companies. 270.19a-1 Section 270.19a-1 Commodity and Securities Exchanges...

7 CFR 1290.8 - Grant agreements.

Science.gov (United States)

2010-01-01

... 7 Agriculture 10 2010-01-01 2010-01-01 false Grant agreements. 1290.8 Section 1290.8 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... minimum the following: (1) The projects in the approved State plan. (2) Total amount of Federal financial...

7 CFR 1291.8 - Grant agreements.

Science.gov (United States)

2010-01-01

... 7 Agriculture 10 2010-01-01 2010-01-01 false Grant agreements. 1291.8 Section 1291.8 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... minimum the following: (1) The projects in the approved State plan. (2) Total amount of Federal financial...

USEPA Grants

Data.gov (United States)

U.S. Environmental Protection Agency — This is a provisional dataset that contains point locations for all grants given out by the USEPA going back to the 1960s through today. There are many limitations...

Parvovirus B19 NS1 protein induces cell cycle arrest at G2-phase by activating the ATR-CDC25C-CDK1 pathway.

Directory of Open Access Journals (Sweden)

Peng Xu

2017-03-01

Full Text Available Human parvovirus B19 (B19V infection of primary human erythroid progenitor cells (EPCs arrests infected cells at both late S-phase and G2-phase, which contain 4N DNA. B19V infection induces a DNA damage response (DDR that facilitates viral DNA replication but is dispensable for cell cycle arrest at G2-phase; however, a putative C-terminal transactivation domain (TAD2 within NS1 is responsible for G2-phase arrest. To fully understand the mechanism underlying B19V NS1-induced G2-phase arrest, we established two doxycycline-inducible B19V-permissive UT7/Epo-S1 cell lines that express NS1 or NS1mTAD2, and examined the function of the TAD2 domain during G2-phase arrest. The results confirm that the NS1 TAD2 domain plays a pivotal role in NS1-induced G2-phase arrest. Mechanistically, NS1 transactivated cellular gene expression through the TAD2 domain, which was itself responsible for ATR (ataxia-telangiectasia mutated and Rad3-related activation. Activated ATR phosphorylated CDC25C at serine 216, which in turn inactivated the cyclin B/CDK1 complex without affecting nuclear import of the complex. Importantly, we found that the ATR-CHK1-CDC25C-CDK1 pathway was activated during B19V infection of EPCs, and that ATR activation played an important role in B19V infection-induced G2-phase arrest.

Update regarding the society of American Gastrointestinal and Endoscopic Surgeons (SAGES) grant distribution and impact on recipient's academic career.

Science.gov (United States)

DuCoin, Christopher; Petersen, Rebecca P; Urbach, David; Aggarwal, Rajesh; Madan, Atul K; Pryor, Aurora D

2018-07-01

Small seed grants strongly impact academic careers, result in future funding, and lead to increased involvement in surgical societies. We hypothesize that, in accordance with the SAGES Research and Career Development committee mission, there has been a shift in grant support from senior faculty to residents and junior faculty. We hypothesize that these junior physician-researchers are subsequently remaining involved with SAGES and advancing within their academic institutions. All current and previous SAGES grant recipients were surveyed through Survey Monkey™. Questions included current academic status and status at time of grant, ensuing funding, publication and presentation of grant, and impact on career. Results were verified through a Medline query. SAGES database was examined for involvement within the society. Respondent data were compared to 2009 data. One hundred and ninety four grants were awarded to 167 recipients. Of those, 75 investigators responded for a response rate 44.9%. 32% were trainees, 43% assistant professors, 16% associate professors, 3% full professors, 3% professors with tenure, and 3% in private practice. This is a shift from 2009 data with a considerable increase in funding of trainees by 19% and assistant professors by 10% and a decrease in funding of associate professors by 5% and professors by 10%. 41% of responders who were awarded the grant as assistant or associate professors had advanced to full professor and 99% were currently in academic medicine. Eighty-two percent indicated that they had completed their project and 93% believed that the award helped their career. All responders remained active in SAGES. SAGES has chosen to reallocate an increased percentage of grant money to more junior faculty members and residents. It appears that these grants may play a role in keeping recipients interested in the academic surgical realm and involved in the society while simultaneously helping them advance in faculty rank.

Multi-pass 1.9 um Tm:YLF slab laser pump source

CSIR Research Space (South Africa)

Strauss

2010-09-01

Full Text Available stream_source_info Strauss1_2010.pdf.txt stream_content_type text/plain stream_size 4116 Content-Encoding ISO-8859-1 stream_name Strauss1_2010.pdf.txt Content-Type text/plain; charset=ISO-8859-1 Multi-Pass 1.9 ?m Tm...:YLF Slab Laser Pump Source H.J. Strauss1, S.C. Burd2, W. Koen1, M.J.D. Esser1, C. Jacobs1, O.J.P. Collett1, K. Nyangaza1, D. Preussler1 and C. Bollig1 1 Laser Centre, Council for Scientific and Industrial Research, PO Box 395, Pretoria, 0001, South...

42 CFR 59.3 - Who is eligible to apply for a family planning services grant?

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Who is eligible to apply for a family planning... SERVICES GRANTS GRANTS FOR FAMILY PLANNING SERVICES Project Grants for Family Planning Services § 59.3 Who is eligible to apply for a family planning services grant? Any public or nonprofit private entity in...

Data of evolutionary structure change: 1BYUA-3RANC [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1BYUA-3RANC 1BYU 3RAN A C --EPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVPT...142 CA TYR A 147 10.374 24.725 19.466 1.00 14.34 C e-map> TYR TYR ...in> 3RAN C 3RANC e-map> TYR TYR GLN LEU ASN LYS LYS ARG... GLN CA 6.93 3.86 TYR CA 3.88 TYR CA e-map> S

Overexpression of an orchid (Dendrobium nobile SOC1/TM3-like ortholog, DnAGL19, in Arabidopsis regulates HOS1-FT expression

Directory of Open Access Journals (Sweden)

Xiao-ru eLiu

2016-02-01

Full Text Available Flowering in the appropriate season is critical for successful reproduction in angiosperms. The orchid species, Dendrobium nobile, requires vernalization to achieve flowering in the spring, but the underlying regulatory network has not been identified to date. The MADS-box transcription factor DnAGL19 was previously identified in a study of low-temperature treated D. nobile buds and was suggested to regulate vernalization-induced flowering. In this study, phylogenetic analysis of DnAGL9 and the MADS-box containing proteins showed that DnAGL19 is phylogenetically closely related to the SOC1-like protein from orchid Dendrobium Chao Parya Smile, DOSOC1. The orchid clade closed to but is not included into the SOC1-1/TM3 clades associated with either eudicots or monocots, suggesting that DnAGL19 is an SOC1-1/TM3-like ortholog. DnAGL19 was found to be highly expressed in pseudobulbs, leaves, roots and axillary buds but rarely in flowers, and to be substantially upregulated in axillary buds by prolonged low-temperature treatments. Overexpression of DnAGL19 in Arabidopsis thaliana resulted in a small but significantly reduced time to bolting, suggesting that flowering time was slightly accelerated under normal growth conditions. Consistent with this, the A. thaliana APETELA1 (AP1 gene was expressed at an earlier stage in transgenic lines than in wild type plants, while the FLOWERING LOCUS T (FT gene was suppressed, suggesting that altered regulations on these transcription factors caused the weak promotion of flowering. HIGH EXPRESSION OF OSMOTICALLY RESPONSIVE GENE 1 (HOS1 was slightly activated under the same conditions, suggesting that the HOS1-FT module may be involved in the DnAGL19-related network. Under vernalization conditions, FT expression was significantly upregulated, whereas HOS1 expression in the transgenic A. thaliana has a level similar to that in wild type. Taken together, these results suggest that DnAGL19 controls the action of the

LIMITED RESTAURANT SERVICE : ASCENSION AND WHITSUNTIDE WEEKENDS

CERN Multimedia

Restaurant Supervisory Committee

2002-01-01

Details of the arrangements to ensure the provision of a restaurant service during the Ascension and Whitsuntide weekends are given below. On all the days indicated, hot meals will be served from 11h30 to 14h00 and 18h00 to 19h30.   RESTAURANT SATELLITE CAFETERIAS KIOSQUE No. Opening times Usual opening times ASCENSION Thursday 9 May 1 2 3 08h00 - 21h00 Friday 10 May 1 2 3   07h00 - 21h00 07h00 - 18h00 Bldg. 40 Bldg. 30, 54 Bldg. 864 08h00 - 17h00     Saturday 11 May 1 2 3 07h00 - 23h00     Sunday 12 May 1 2 3 07h00 - 23h00     WHITSUNTIDE Saturday 18 May 1 2 3 08h00 - 21h00     Sunday 19 May 1 2 3 08h00 - 21h00     Monday 20 May 1 2 3 08h00 - 21h00     Restaurant Supervisory Committee Tel. 77551

The phosphatase activity of the isolated H4-H5 loop of Na(+)/K(+) ATPase resides outside its ATP binding site

Czech Academy of Sciences Publication Activity Database

Krumscheid, R.; Ettrich, Rüdiger; Sovová, Žofie; Sušánková, Klára; Lánský, Zdeněk; Hofbauerová, Kateřina; Linnertz, H.; Teisinger, Jan; Amler, Evžen; Schoner, W.

2004-01-01

Roč. 271, č. 19 (2004), s. 3923-3936 ISSN 0014-2956 R&D Projects: GA MŠk(CZ) LN00A141; GA ČR(CZ) GA204/01/0254; GA ČR(CZ) GA204/01/1001; GA ČR(CZ) GP206/03/D082; GA ČR(CZ) GA309/02/1479 Grant - others:Deutsche Forschungsgemeinschaft(DE) Bonn Scho 139/21-2+3; CZ-DE(CZ) TSR-088-97; CZ-DE(CZ) CZE 00/33 Institutional research plan: CEZ:AV0Z5011922 Keywords : Na(+)/K(+) ATPase * p-nitrophenylphosphate * H4-H5 loop Subject RIV: CE - Biochemistry Impact factor: 3.260, year: 2004

Na2 Vibrating in the Double-Well Potential of State 2 1Σu+ (JM = 00): A Pulsating "Quantum Bubble" with Antagonistic Electronic Flux.

Science.gov (United States)

Diestler, D J; Jia, D; Manz, J; Yang, Y

2018-03-01

The theory of concerted electronic and nuclear flux densities associated with the vibration and dissociation of a multielectron nonrotating homonuclear diatomic molecule (or ion) in an electronic state 2S+1 Σ g,u + (JM = 00) is presented. The electronic population density, nuclear probability density, and nuclear flux density are isotropic. A theorem of Barth , presented in this issue, shows that the electronic flux density (EFD) is also isotropic. Hence, the evolving system appears as a pulsating, or exploding, "quantum bubble". Application of the theory to Na 2 vibrating in the double-minimum potential of the 2   1 Σ u + (JM = 00) excited state reveals that the EFD consists of two antagonistic components. One arises from electrons that flow essentially coherently with the nuclei. The other, which is oppositely directed (i.e., antagonistic) and more intense, is due to the transition in electronic structure from "Rydberg" to "ionic" type as the nuclei traverse the potential barrier between inner and outer potential wells. This "transition" component of the EFD rises and falls sharply as the nuclei cross the barrier.

A novel mutation in SURF1 causes skipping of exon 8 in a patient with cytochrome c oxidase-deficient leigh syndrome and hypertrichosis

Czech Academy of Sciences Publication Activity Database

Williams, S. L.; Taanman, J. W.; Hansíková, H.; Houšťková, H.; Chowdhury, Subir; Zeman, J.; Houštěk, Josef

2001-01-01

Roč. 73, č. 4 (2001), s. 340-343 ISSN 1096-7192 R&D Projects: GA MŠk LN00A079; GA ČR GA302/99/0648; GA MZd NE6533 Grant - others:The Wellcome Trust(XX) 048410 Institutional research plan: CEZ:AV0Z5011922 Keywords : SURF1 * exon skipping * mitochondrial disorder Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.345, year: 2001

8 CFR 1209.2 - Adjustment of status of alien granted asylum.

Science.gov (United States)

2010-01-01

... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Adjustment of status of alien granted asylum. 1209.2 Section 1209.2 Aliens and Nationality EXECUTIVE OFFICE FOR IMMIGRATION REVIEW, DEPARTMENT OF JUSTICE IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS OF REFUGEES AND ALIENS GRANTED ASYLUM § 1209...

ATLAS PhD Grants 2015

CERN Multimedia

Marcelloni De Oliveira, Claudia

2015-01-01

ATLAS PHd Grants - We are excited to announce the creation of a dedicated grant scheme (thanks to a donation from Fabiola Gianotti and Peter Jenni following their award from the Fundamental Physics Prize foundation) to encourage young and high-caliber doctoral students in particle physics research (including computing for physics) and permit them to obtain world class exposure, supervision and training within the ATLAS collaboration. This special PhD Grant is aimed at graduate students preparing a doctoral thesis in particle physics (incl. computing for physics) to spend one year at CERN followed by one year support also at the home Institute.

Stable long range proton acceleration driven by intense laser pulse with underdense plasmas

Czech Academy of Sciences Publication Activity Database

Gu, Yanjun; Zhu, Z.; Li, F.X.; Yu, Q.; Huang, S.; Zhang, F.; Kong, Q.; Kawata, S.

2014-01-01

Roč. 21, č. 6 (2014), "063104-1"-"063104-6" ISSN 1070-664X R&D Projects: GA MŠk ED1.1.00/02.0061 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:68378271 Keywords : ion-acceleration * fast ignition * generation * beams * targets Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.142, year: 2014

7 CFR 3021.650 - Grant.

Science.gov (United States)

2010-01-01

... Regulations of the Department of Agriculture (Continued) OFFICE OF THE CHIEF FINANCIAL OFFICER, DEPARTMENT OF AGRICULTURE GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 3021.650 Grant. Grant means an award of financial assistance that, consistent with 31 U.S.C. 6304, is used to...

PRDM1 expression via human parvovirus B19 infection plays a role in the pathogenesis of Hashimoto thyroiditis.

Science.gov (United States)

Wang, Lu; Zhang, Wei-Ping; Yao, Li; Zhang, Wei; Zhu, Jin; Zhang, Wei-Chen; Zhang, Yue-Hua; Wang, Zhe; Yan, Qing-Guo; Guo, Ying; Fan, Lin-Ni; Liu, Yi-Xiong; Huang, Gao-Sheng

2015-12-01

Ectopic lymphoid follicle infiltration is a key event in Hashimoto thyroiditis (HT). Positive regulatory domain zinc finger protein 1 (PRDM1), which is induced by antigen stimulation, can regulate all lymphocyte lineages. Several groups independently demonstrated that human parvovirus B19 (PVB19) is closely associated with HT. Hence, we determined whether PRDM1 is expressed in HT thyroid tissue and whether there is any correlation between PRDM1 expression and PVB19 in the pathogenesis of HT. We detected PRDM1 expression in HT (n = 86), normal thyroid tissue (n = 30), and nontoxic nodular goiter (n = 20) samples using immunohistochemistry. We also detected PVB19 protein in HT samples in a double-blind manner and analyzed the correlation between the 2 proteins using immunofluorescence confocal detection and coimmunoprecipitation. Furthermore, we detected changes of the expression levels of PRDM1 and PVB19 in transfected primary thyroid follicular epithelial cells using real-time quantitative polymerase chain reaction. We found that PRDM1 protein is significantly highly expressed in the injured follicular epithelial cells in HT (83/86 cases) than in normal thyroid cells (0/30 cases) or in nontoxic nodular goiter cells (0/20 cases) (P thyroid epithelial cells also showed PRDM1 up-regulation after PVB19 NS1 transfection. Our findings suggest a previously unrecognized role of PRDM1 and PVB19 in the pathogenesis of HT. Copyright © 2015 Elsevier Inc. All rights reserved.

Photoluminescence of Eu2+-doped CaMgSi2xO6+2x (1.00≤x≤1.20) phosphors in UV-VUV region

International Nuclear Information System (INIS)

Zhang Zhiya; Wang Yuhua

2008-01-01

Alkaline-earth silicate phosphors CaMgSi 2x O 6+2x :Eu 2+ (1.00≤x≤1.20) were prepared by traditional solid-state reaction. The phosphors showed an intense blue emission centered around 453 nm, with both 254 and 147 nm excitations. The host absorption below 200 nm in the excitation spectra consisted of two bands around 160 and 190 nm. The band around 160 nm was ascertained to be associated with the SiO 4 -tetrahedra and MgO 6 -polyhedra, and that around 190 nm was due to the CaO 8 -polyhedra or some impurities. The incorporation of excess Si of less than 15% would not lead to formation of impurities and the results indicated that an appropriate Si excess could improve the Photoluminescence (PL) intensity in both ultraviolet (UV) and vacuum ultraviolet (VUV) regions

8 CFR 209.2 - Adjustment of status of alien granted asylum.

Science.gov (United States)

2010-01-01

... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Adjustment of status of alien granted asylum. 209.2 Section 209.2 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS OF REFUGEES AND ALIENS GRANTED ASYLUM § 209.2 Adjustment of status of alien...

The UGT1A6_19_GG genotype is a breast cancer risk factor

Directory of Open Access Journals (Sweden)

Christina eJustenhoven

2013-06-01

Full Text Available Validation of an association between the UGT1A6_19_T>G (rs6759892 polymorphism and overall breast cancer risk. A pilot study included two population-based case-control studies from Germany (MARIE-GENICA. An independent validation study comprised four independent breast cancer case-control studies from Finland (KBCP, OBCS, Germany (BBCC and Sweden (SASBAC. The pooled analysis included 7,418 cases and 8,720 controls from all six studies. Participants were of European descent. Genotyping was done by MALDI-TOF MS and statistical analysis was performed by logistic regression adjusted for age and study. The increased overall breast cancer risk for women with the UGT1A6_19_GG genotype which was observed in the pilot study was confirmed in the set of four independent study collections (OR 1.13, 95% CI 1.05-1.22; p = 0.001. The pooled study showed a similar effect (OR 1.09, 95% CI 1.04-1.14; p = 0.001. We confirmed the association of UGT1A6_19_GG with increased overall breast cancer risk and conclude that our result from a well powered multi-stage study adds a novel candidate to the panel of validated breast cancer susceptibility loci.

7 CFR 3550.102 - Grant and loan purposes.

Science.gov (United States)

2010-01-01

... Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, DEPARTMENT OF... Waste Disposal Grants § 3550.102 Grant and loan purposes. (a) Grant funds. Grant funds may be used only... repair or remodel dwellings to make them accessible and useable for household members with disabilities...

Design of a kJ-class HiLASE laser as a driver for inertial fusion energy

Czech Academy of Sciences Publication Activity Database

Lucianetti, Antonio; Sawicka, Magdalena; Slezák, Ondřej; Divoký, Martin; Pilař, Jan; Jambunathan, Venkatesan; Bonora, Stefano; Antipenkov, Roman; Mocek, Tomáš

2014-01-01

Roč. 2, e13 (2014), s. 1-10 ISSN 2095-4719 R&D Projects: GA MŠk ED1.1.00/02.0061 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061 Institutional support: RVO:68378271 Keywords : ASE * birefringence * cryogenic cooling * slab lasers * thermooptic effects Subject RIV: BH - Optics, Masers, Lasers

75 FR 14596 - Family Violence Prevention and Services/Grants for Domestic Violence Shelters/Grants to Native...

Science.gov (United States)

2010-03-26

...This announcement governs the proposed award of formula grants under the Family Violence Prevention and Services Act (FVPSA) to Native American Tribes (including Alaska Native Villages) and Tribal organizations. The purpose of these grants is to assist Tribes in establishing, maintaining, and expanding programs and projects to prevent family violence and to provide immediate shelter and related assistance for victims of family violence and their dependents (42 U.S.C. 10401). This announcement sets forth the application requirements, the application process, and other administrative and fiscal requirements for grants in Fiscal Year (FY) 2010. Grantees are to be mindful that although the expenditure period for grants is a two-year period, an application is required every year to provide continuity in the provision of services. (See Section II. Award Information, Expenditure Periods.)

The Principal's Guide to Grant Success.

Science.gov (United States)

Bauer, David G.

This book provides principals of public and private elementary and middle schools with a step-by-step approach for developing a system that empowers faculty, staff, and the school community in attracting grant funds. Following the introduction, chapter 1 discusses the principal's role in supporting grantseeking. Chapter 2 describes how to…

Capital Improvements Business Line

Science.gov (United States)

2012-08-08

NAVFAC Southwest Dan Waid Program & Business Mgmt NAVFAC SW Capital Improvements Business Line NAVFAC SW 8 August 2012 1 Report...REPORT TYPE 3. DATES COVERED 00-00-2012 to 00-00-2012 4. TITLE AND SUBTITLE Capital Improvements Business Line 5a. CONTRACT NUMBER 5b. GRANT...AVAILABILITY STATEMENT Approved for public release; distribution unlimited 13. SUPPLEMENTARY NOTES Presented at the 2012 Navy Gold Coast Small Business

The Role of Nav1.9 Channel in the Development of Neuropathic Orofacial Pain Associated with Trigeminal Neuralgia.

Science.gov (United States)

Lulz, Ana Paula; Kopach, Olga; Santana-Varela, Sonia; Wood, John N

2015-01-01

Trigeminal neuralgia is accompanied by severe mechanical, thermal and chemical hypersensitivity of the orofacial area innervated by neurons of trigeminal ganglion (TG). We examined the role of the voltage-gated sodium channel subtype Nav1.9 in the development of trigeminal neuralgia. We found that Nav1.9 is required for the development of both thermal and mechanical hypersensitivity induced by constriction of the infraorbital nerve (CION). The CION model does not induce change on Nav1.9 mRNA expression in the ipsilateral TG neurons when evaluated 9 days after surgery. These results demonstrate that Nav1.9 channels play a critical role in the development of orofacial neuropathic pain. New routes for the treatment of orofacial neuropathic pain focussing on regulation of the voltage-gated Nav1.9 sodium channel activity should be investigated. © 2015 Luiz et al.

Cr-substitution effect on structural, optical and electrical properties of Cr{sub x}Ce{sub 1−x}PO{sub 4} (x = 0.00, 0.08, 0.10 and 0.20) nanorods

Energy Technology Data Exchange (ETDEWEB)

Fadhalaoui, Amor [Laboratoire de Chimie des Matériaux, Faculté des Sciences de Bizerte, Zarzouna, Bizerte 7021 (Tunisia); Dhaouadi, Hassouna, E-mail: dhaouadihassouna@yahoo.fr [Laboratoire Matériaux Traitement et Analyse, INRAP, Technopôle Sidi-Thabet, Tunis 2020 (Tunisia); Marouani, Houda [Laboratoire de Chimie des Matériaux, Faculté des Sciences de Bizerte, Zarzouna, Bizerte 7021 (Tunisia); Kouki, Abdessalem [L3M, FSB, Zarzouna, Bizerte 7021 (Tunisia); Madani, Adel [Department of Physics, Applied Science College, Umm Al Qura University, Makkah (Saudi Arabia); Rzaigui, Mohamed [Laboratoire de Chimie des Matériaux, Faculté des Sciences de Bizerte, Zarzouna, Bizerte 7021 (Tunisia)

2016-01-15

Graphical abstract: The Cr{sub x}Ce{sub 1−x}PO{sub 4} (x = 0.00, 0.08, 0.10 and 0.20) nanorods synthesized under hydrothermal conditions. - Highlights: • Cr{sub x}Ce{sub 1−x}PO{sub 4} (x = 0.00–0.20) nanorods were synthesized by hydrothermal method. • Mean crystallite size of the products decreases with Cr-content. • Obvious improvements of the electrical conductivity comparatively to CePO4. - Abstract: Cr{sub x}Ce{sub 1−x}PO{sub 4} (x = 0.00–0.20) nanorods were synthesized using the hydrothermal method. The as-prepared samples were characterized by X-ray diffraction (XRD), infrared absorption spectroscopy (IR) and transmission electron microscopy (TEM). The XRD results revealed the formation of a pure CePO{sub 4} hexagonal phase. TEM images confirmed the nano-size character of the as-prepared samples. Impedance spectroscopy analysis was used to analyze the electrical behavior of samples as a function of frequency at different temperatures. The increase of Cr-amount led to an increase in the total conductivities and decreased the activation energies (E{sub a} (x = 0.00) = 1.08 eV to E{sub a} (x = 0.20) = 0.80 eV). The optical properties of Cr{sub x}Ce{sub 1−x}PO{sub 4} nanomaterials were investigated using UV–vis spectroscopy. The band-gap energy values decreased with increasing Cr-content showing a red-shift trend. The improvement of the electrical conductivity and optical properties makes the Cr{sub x}Ce{sub 1−x}PO{sub 4} nanomaterials possible candidates to be used as electrolytes in solid oxide fuel cells, in photocatalytic and photovoltaic applications.

Florida Tech professor gets three-year grant

CERN Multimedia

2003-01-01

"Dr. Marc Baarmand, Florida Tech associate professor of physics, has received a three-year grant from the U.S. Department of Energy's Division of High Energy Physics, to conduct research with the Compact Muon Solenoid experiment" (1/3 page).

76 FR 72978 - Premier Trim, LLC, Spectrum Trim, LLC and Grant Products International, Inc. D/B/A Spectrum Grant...

Science.gov (United States)

2011-11-28

..., Spectrum Trim, LLC and Grant Products International, Inc. D/B/A Spectrum Grant De Mexico Including Workers Whose Unemployment Insurance (UI) Wages Are Paid Through Grant Products International, Inc... Brownsville, TX; Amended Certification Regarding Eligibility To Apply for Worker Adjustment Assistance In...

Evolutionary Conservation of the Ribosomal Biogenesis Factor Rbm19/Mrd1: Implications for Function

OpenAIRE

Kallberg, Yvonne; Segerstolpe, Åsa; Lackmann, Fredrik; Persson, Bengt; Wieslander, Lars

2012-01-01

Ribosome biogenesis in eukaryotes requires coordinated folding and assembly of a pre-rRNA into sequential pre-rRNA-protein complexes in which chemical modifications and RNA cleavages occur. These processes require many small nucleolar RNAs (snoRNAs) and proteins. Rbm19/Mrd1 is one such protein that is built from multiple RNA-binding domains (RBDs). We find that Rbm19/Mrd1 with five RBDs is present in all branches of the eukaryotic phylogenetic tree, except in animals and Choanoflagellates, th...

TTC19 Plays a Husbandry Role on UQCRFS1 Turnover in the Biogenesis of Mitochondrial Respiratory Complex III.

Science.gov (United States)

Bottani, Emanuela; Cerutti, Raffaele; Harbour, Michael E; Ravaglia, Sabrina; Dogan, Sukru Anil; Giordano, Carla; Fearnley, Ian M; D'Amati, Giulia; Viscomi, Carlo; Fernandez-Vizarra, Erika; Zeviani, Massimo

2017-07-06

Loss-of-function mutations in TTC19 (tetra-tricopeptide repeat domain 19) have been associated with severe neurological phenotypes and mitochondrial respiratory chain complex III deficiency. We previously demonstrated the mitochondrial localization of TTC19 and its link with complex III biogenesis. Here we provide detailed insight into the mechanistic role of TTC19, by investigating a Ttc19 ?/? mouse model that shows progressive neurological and metabolic decline, decreased complex III activity, and increased production of reactive oxygen species. By using both the Ttc19 ?/? mouse model and a range of human cell lines, we demonstrate that TTC19 binds to the fully assembled complex III dimer, i.e., after the incorporation of the iron-sulfur Rieske protein (UQCRFS1). The in situ maturation of UQCRFS1 produces N-terminal polypeptides, which remain bound to holocomplex III. We show that, in normal conditions, these UQCRFS1 fragments are rapidly removed, but when TTC19 is absent they accumulate within complex III, causing its structural and functional impairment. Copyright © 2017. Published by Elsevier Inc.

CYP19A1 fine-mapping and Mendelian randomization

DEFF Research Database (Denmark)

Thompson, Deborah J; O'Mara, Tracy A; Glubb, Dylan M

2016-01-01

Candidate gene studies have reported CYP19A1 variants to be associated with endometrial cancer and with estradiol (E2) concentrations. We analyzed 2937 single nucleotide polymorphisms (SNPs) in 6608 endometrial cancer cases and 37 925 controls and report the first genome wide-significant associat...

34 CFR 75.232 - The cost analysis; basis for grant amount.

Science.gov (United States)

2010-07-01

... Secretary sets the amount of a new grant, the Secretary does a cost analysis of the project. The Secretary... objectives of the project with reasonable efficiency and economy under the budget in the application... 34 Education 1 2010-07-01 2010-07-01 false The cost analysis; basis for grant amount. 75.232...

Long non-coding RNA FBXL19-AS1 plays oncogenic role in colorectal cancer by sponging miR-203

International Nuclear Information System (INIS)

Shen, Bo; Yuan, Yuan; Zhang, Yan; Yu, Shaorong; Peng, Wei; Huang, Xin'en; Feng, Jifeng

2017-01-01

Long non-coding RNAs (lncRNAs) have emerged as critical regulators of the progression of human cancers, including colorectal cancer (CRC). The study of genome-wide lncRNA expression patterns in metastatic CRC could provide novel mechanism underlying CRC carcinogenesis. In here, we determined the lncRNA expression profiles correlating to CRC with or without lymph node metastasis (LNM) based on microarray analysis. We found that 2439 lncRNAs and 1654 mRNAs were differentially expressed in metastatic CRC relative to primary CRC. Among these dysregulated lncRNAs, FBXL19-AS1 was the most significantly upregulated lncRNA in metastatic tumors. Functionally, knockdown of FBXL19-AS1 played tumor-suppressive effects by inhibiting cell proliferation, migration and invasion in vitro and tumor growth and metastasis in vivo. Overexpression of FBXL19-AS1 was markedly correlated with TNM stage and LNM in CRC. Bioinformatics analysis predicted that miR-203 was potentially targeted by FBXL19-AS1, which was confirmed by dual-luciferase reporter assay. Pearson's correlation analysis showed that miR-203 expression was negatively related to FBXL19-AS1 in tumor tissues. Finally, miR-203 inhibition abrogated the effect of FBXL19-AS1 knockdown on the proliferation and invasion of LoVo cells. Our results reveal the cancer-promoting effect of FBXL19-AS1, acting as a molecular sponge in negatively modulating miR-203, which might provide a new insight for understanding of CRC development. - Highlights: • LncRNA expression signature was different between metastatic and primary tumors. • Knockdown of FBXL19-AS1 inhibits proliferation, migration and invasion in vitro. • Knockdown of FBXL19-AS1 inhibits tumorigenesis and metastasis in vivo. • FBXL19-AS1 was upregulated in CRC tissues and related with lymph node metastasis. • FBXL19-AS1, acting as a molecular sponge in negatively regulating miR-203.

Air pollution by c-PAHs and plasma levels of p53 and p21WAF1 proteins

Czech Academy of Sciences Publication Activity Database

Rössner ml., Pavel; Binková, Blanka; Milcová, Alena; Solanský, I.; Židzik, J.; Lyubomirova, K.; Farmer, P. B.; Šrám, Radim

2007-01-01

Roč. 620, - (2007), s. 34-40 ISSN 0027-5107 R&D Projects: GA MŽP SI/340/2/00; GA MŽP SL/740/5/03 Grant - others:EU(GB) 2000 -00091 Institutional research plan: CEZ:AV0Z50390512 Source of funding: R - rámcový projekt EK Keywords : air pollution * p53 and p21WAF1 plasma levels Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 4.159, year: 2007

77 FR 33474 - Center for Scientific Review; Notice of Closed Meetings

Science.gov (United States)

2012-06-06

...: 8:00 a.m. to 5:00 p.m. Agenda: To review and evaluate grant applications. Place: Ritz Carlton Hotel... 25, 2012. Time: 8:00 a.m. to 7:00 p.m. Agenda: To review and evaluate grant applications. Place: Ritz Carlton Hotel, 1150 22nd Street NW., Washington, DC 20037. Contact Person: Seetha Bhagavan, Ph.D...

FEMA Hazard Mitigation Grants Program Summary

Data.gov (United States)

Department of Homeland Security — The Hazard Mitigation Grant Program (HMGP, CFDA Number: 97.039) provides grants to States and local governments to implement long-term hazard mitigation measures...

Volumetric Behaviour of the (2,2,4-Trimethylpentane + Methylbenzene + Butan-1-ol) Ternary System and Its Binary Sub-Systems within the Temperature Range (298.15–328.15) K

Czech Academy of Sciences Publication Activity Database

Morávková, Lenka; Troncoso, J.; Machanová, Karolina; Sedláková, Zuzana

2013-01-01

Roč. 64, SEP 2013 (2013), s. 137-150 ISSN 0021-9614 R&D Projects: GA ČR GAP106/10/1194 Grant - others:MŠMT(CZ) CZ.1.05/2.1.00/03.0071; UV(IT) CN2012/227; UV(IT) 11VIA16 Institutional support: RVO:67985858 Keywords : excess molar volume * density * ERAS model Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.423, year: 2013

38 CFR 61.40 - Special needs grants-general.

Science.gov (United States)

2010-07-01

... (CONTINUED) VA HOMELESS PROVIDERS GRANT AND PER DIEM PROGRAM § 61.40 Special needs grants—general. (a) VA provides special needs grants to capital grant and per diem recipients under this part to assist with... that would change significantly the scope of the project for which a capital grant or per diem was...

38 CFR 61.11 - Applications for capital grants.

Science.gov (United States)

2010-07-01

... (CONTINUED) VA HOMELESS PROVIDERS GRANT AND PER DIEM PROGRAM § 61.11 Applications for capital grants. (a) To apply for a capital grant, an applicant must obtain from VA a capital grant application package and... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Applications for capital...

Down-Regulation of Na+/K+ ATPase Activity by Human Parvovirus B19 Capsid Protein VP1

Directory of Open Access Journals (Sweden)

Ahmad Almilaji

2013-05-01

Full Text Available Background/Aims: Human parvovirus B19 (B19V may cause inflammatory cardiomyopathy (iCMP which is accompanied by endothelial dysfunction. The B19V capsid protein VP1 contains a lysophosphatidylcholine producing phospholipase A2 (PLA sequence. Lysophosphatidylcholine has in turn been shown to inhibit Na+/K+ ATPase. The present study explored whether VP1 modifies Na+/K+ ATPase activity. Methods: Xenopus oocytes were injected with cRNA encoding VP1 isolated from a patient suffering from fatal B19V-iCMP or cRNA encoding PLA2-negative VP1 mutant (H153A and K+ induced pump current (Ipump as well as ouabain-inhibited current (Iouabain both reflecting Na+/K+-ATPase activity were determined by dual electrode voltage clamp. Results: Injection of cRNA encoding VP1, but not of VP1(H153A or water, was followed by a significant decrease of both, Ipump and Iouabain in Xenopus oocytes. The effect was not modified by inhibition of transcription with actinomycin (10 µM for 36 hours but was abrogated in the presence of PLA2 specific blocker 4-bromophenacylbromide (50 µM and was mimicked by lysophosphatidylcholine (0.5 - 1 µg/ml. According to whole cell patch clamp, lysophosphatidylcholine (1 µg /ml similarly decreased Ipump in human microvascular endothelial cells (HMEC. Conclusion: The B19V capsid protein VP1 is a powerful inhibitor of host cell Na+/K+ ATPase, an effect at least partially due to phospholipase A2 (PLA2 dependent formation of lysophosphatidylcholine.

A hollow-duct radiation delivery system in a power-scaled arrangement

Czech Academy of Sciences Publication Activity Database

Fibrich, Martin; Rus, Bedřich; Kramer, Daniel

2013-01-01

Roč. 10, č. 8 (2013), "085001-1"-"085001-5" ISSN 1612-2011 R&D Projects: GA MŠk EE.2.3.20.0091; GA MŠk ED1.1.00/02.0061 Grant - others:OP VK 1 LaserSys(XE) CZ.1.07/2.3.00/20.0091; ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061 Institutional support: RVO:68378271 Keywords : wave-guide * laser * optimization Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.964, year: 2013

Hadronic and electromagnetic fragmentation of ultrarelativistic heavy ions at LHC

Czech Academy of Sciences Publication Activity Database

Braun, H.H.; Fasso, Alberto; Ferrari, A.; Jowett, J.M.; Sala, P.R.; Smirnov, G.I.

2014-01-01

Roč. 17, č. 2 (2014), "021006-1"-"021006-14" ISSN 1098-4402 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:68378271 Keywords : ions * accelerators * beams Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.661, year: 2014

The B00 model coil in the ATLAS Magnet Test Facility

CERN Document Server

Dudarev, A; ten Kate, H H J; Anashkin, O P; Keilin, V E; Lysenko, V V

2001-01-01

A 1-m size model coil has been developed to investigate the transport properties of the three aluminum-stabilized superconductors used in the ATLAS magnets. The coil, named B00, is also used for debugging the cryogenic, power and control systems of the ATLAS Magnet Test Facility. The coil comprises two double pancakes made of the barrel toroid and end-cap toroid conductors and a single pancake made of the central solenoid conductor. The pancakes are placed inside an aluminum coil casing. The coil construction and cooling conditions are quite similar to the final design of the ATLAS magnets. The B00 coil is well equipped with various sensors to measure thermal and electrodynamic properties of the conductor inside the coils. Special attention has been paid to the study of the current diffusion process and the normal zone propagation in the ATLAS conductors and windings. Special pick-up coils have been made to measure the diffusion at different currents and magnetic field values. (6 refs).

30 CFR 735.14 - Coverage of grants.

Science.gov (United States)

2010-07-01

... systems, including data processing systems; (6) A planning process including a data base and information... ADMINISTRATION AND ENFORCEMENT § 735.14 Coverage of grants. (a) Program development grants. An agency may use... the initial administration and enforcement grant to the extent not covered by indirect costs or other...

2016-2017 Travel Expense Reports for Gordon Houlden, Ex-Governor

International Development Research Centre (IDRC) Digital Library (Canada)

Beata Bialic

Page 1. Purpose: Board meetings. Date(s):. 2016-05-15 to 2016-05-16. Destination(s):. Ottawa. Airfare: $979.19. Other. Transportation: $0.00. Accommodation: $0.00. Meals and. Incidentals: $0.00. Other: $0.00. Total: $979.19. Comments: 2016-2017 Travel Expense Reports for Gordon. Houlden, Ex-Governor.

Water Resources Research Grant Program project descriptions, fiscal year 1987

Science.gov (United States)

,

1987-01-01

This report contains information on the 34 new projects funded by the United States Geological Survey 's Water Resources Research Grant Program in fiscal year 1987 and on 3 projects completed during the year. For the new projects, the report gives the grant number, project title, performing organization, principal investigator(s), and a project description that includes: (1) identification of water related problems and problem-solution approach (2) contribution to problem solution, (3) objectives, and (4) approach. The 34 projects include 12 in the area of groundwater quality problems, 12 in the science and technology of water quality management, 1 in climate variability and the hydrologic cycle, 4 in institutional change in water resources management, and 5 in surface water management. For the three completed projects, the report furnishes the grant number; project title; performing organization; principal investor(s); starting data; data of receipt of final report; and an abstract of the final report. Each project description provides the information needed to obtain a copy of the final report. The report contains tables showing: (1) proposals received according to area of research interest, (2) grant awards and funding according to area of research interest, (3) proposals received according to type of submitting organization, and (4) awards and funding according to type of organization. (Author 's abstract)

19 CFR 19.41 - Movement of containerized cargo to a container station.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Movement of containerized cargo to a container station. 19.41 Section 19.41 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... THEREIN Container Stations § 19.41 Movement of containerized cargo to a container station. Containerized...

Conference Proceedings Manoeuvring Aerodynamics Held in Toulouse, France on 1-2 May 1991 (La Manoeuvrabilite par l’Aerodynamique)

Science.gov (United States)

1991-11-01

speed 20 rn/sec 150.0 PP ~ 0.0 ftbw .0 0 t0 20 30 40 50 40 P.0. Td OPW Ow) 20.0 f~ Flgure 6: VarItOn of -14te burnt frequency with tunnel 0M.0 sped -osan...than du to fieW res, td It had been slow. that the lWi of the 60 aellos wtlh the hIt e. This detad is held lore aid yating momen genraledm we omble on...0AD)-OS ).Or.... U.S 0.6 .11 D0.2.0 :. D -15 1.2 D1.9 .1.2D.,t9 .0. ED - 0 .01 D 00 -0.1 M 0.0 -071y 0o C1.0.8 L5-.5 .0.6 L53 - .5 .0.7 135. 0

38 CFR 61.10 - Capital grants-general.

Science.gov (United States)

2010-07-01

...) VA HOMELESS PROVIDERS GRANT AND PER DIEM PROGRAM § 61.10 Capital grants—general. (a) VA provides capital grants to public or nonprofit private entities so they can assist homeless veterans by helping to... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Capital grants-general...

Non-Maxwellian electron distributions in time-dependent simulations of low-Z materials illuminated by a high-intensity X-ray laser

Czech Academy of Sciences Publication Activity Database

de la Varga, A.G.; Velarde, P.; de Gaufridy de Dortan, Francois; Portillo, D.; Cotelo, M.; Barbas, A.; González, A.; Zeitoun, Ph.

2013-01-01

Roč. 9, č. 3 (2013), s. 542-547 ISSN 1574-1818 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE.2.3.20.0087 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; OP VK 2 LaserGen(XE) CZ.1.07/2.3.00/20.0087 Institutional support: RVO:68378271 Keywords : non-Maxwellian electron distribution * time - dependent atomic kinetics Subject RIV: BE - Theoretical Physics Impact factor: 1.519, year: 2013

Experimental investigation of hole boring and light sail regimes of RPA by varying laser and target parameters

Czech Academy of Sciences Publication Activity Database

Kar, S.; Kakolee, K.F.; Cerchez, M.; Doria, D.; Macchi, A.; McKenna, P.; Neely, D.; Osterholz, J.; Quinn, K.; Ramakrishna, B.; Sarri, G.; Willi, O.; Yuan, X.H.; Zepf, M.; Borghesi, Marco

2013-01-01

Roč. 55, č. 12 (2013), "124030-1"-"124030-6" ISSN 0741-3335 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:68378271 Keywords : plasmas * absorption Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.386, year: 2013

Controllable high-quality electron beam generation by phase slippage effect in layered targets

Czech Academy of Sciences Publication Activity Database

Yu, Q.; Gu, Yanjun; Li, X.F.; Huang, S.; Zhang, F.; Kong, O.; Ma, Y.Y.; Kawata, S.

2014-01-01

Roč. 21, č. 11 (2014), "113106-1"-"113106-6" ISSN 1070-664X R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279 Institutional support: RVO:68378271 Keywords : laser * plasma * electrons Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.142, year: 2014

Self-Organization of 1-Methylnaphthalene on the Surface of Artificial Snow Grains: A Combined Experimental - Computational Approach

Czech Academy of Sciences Publication Activity Database

Heger, D.; Nachtigallová, Dana; Surman, F.; Krausko, J.; Magyarová, B.; Brumovský, M.; Rubeš, M.; Gladich, Ivan; Klán, P.

2011-01-01

Roč. 115, č. 41 (2011), s. 11412-11422 ISSN 1089-5639 R&D Projects: GA MŠk LC512; GA MŠk ME09064; GA ČR(CZ) GAP208/10/1724 Grant - others:CE-TOCOEN(XE) CZ.1.05/2.1.00/01.0001; GA ČR(CZ) GAP503/10/0947; GA ČR(CZ) GP203/09/P445 Institutional research plan: CEZ:AV0Z40550506 Keywords : excimers * fluorescence spectroscopy * CC2 calculations Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.946, year: 2011

26 CFR 31.3121(b)(19)-1 - Services of certain nonresident aliens.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Services of certain nonresident aliens. 31.3121... 1954) General Provisions § 31.3121(b)(19)-1 Services of certain nonresident aliens. (a) (1) Services performed after 1961 by a nonresident alien individual who is temporarily present in the United States as a...

Evaluation of the responsiveness of pituitary gland to thyrotropin releasing hormone (TRH) in rats in the period of 8:00 to 12:00 a.m

International Nuclear Information System (INIS)

Borghi, V.C.; Nicolau, W.; Bojarczuk, C.; Pieroni, R.R.

1977-01-01

The functional pituitary capacity for the secretion thyrotropin in rats, in relation to the period of time 8:00-12:00 a.m. was studied by means of the administration of synthetic TRH (thyrotropin releasing hormone). The highest pituitary response to the hypothalamic hormone attains its peak between 9:50 and 10:30 a.m., a time in which the gland denotes a high and practically constant level of TSH secretion [pt

Taking Soft Skills for Granted?

Science.gov (United States)

Dutton, Gail

2012-01-01

The U.S. Department of Labor will award a total of $2 billion over the next four years through the Trade Adjustment Assistance Community College and Career Training Grant Program. Grants will support the development and improvement of postsecondary programs of two years or less that use evidence-based or innovative strategies to prepare students…

Do vehicle grants and vehicle adaptations grants promote transport mobility and community access for children with disabilities in Sweden?

Science.gov (United States)

Sjödin, Linda; Buchanan, Angus; Mundt, Beate; Karlsson, Emelie; Falkmer, Torbjörn

2012-02-01

A vast majority of the journeys made by children with disabilities in Sweden are in the family car, which usually is bought and adapted for the child with governmental subsidies. Despite the important philosophical views about accessible vehicles, little is known about the impact of vehicle adaptations on families' lives. The aim of the study was to investigate parent views about the impact of vehicle grants and vehicle adaptation grants on their children's transport mobility and community access. In total, 434 parents of children with disabilities in Sweden who had received vehicle grants and/or vehicle adaptation grants between 1998-2007 responded to a questionnaire comprising questions with both pre-selected and open-ended answers. A non-responder analysis was performed. Children with disabilities were found to increase their transport mobility and community access in society as vehicle grants and/or vehicle adaptation grants were given to their parents. Their travel patterns and their travel priorities with their family car indicated that family friends and relatives and leisure activities were frequently visited and prioritised destinations. The grants were linked to access to social and family activities, provided environmental gains and led to increased experienced security. The results also showed that the potential to make spontaneous trips had increased substantially and that families experienced feelings of freedom and enhanced community access. The non-responder analysis confirmed these results. According to parents, vehicle grants and vehicle adaptation grants for children with disabilities have a positive impact on the children's transport mobility and community access. © 2011 The Authors. Australian Occupational Therapy Journal © 2011 Occupational Therapy Australia.

High-contrast, high-intensity petawatt-class laser and applications

Czech Academy of Sciences Publication Activity Database

Kiriyama, H.; Mori, M.; Pirozhkov, A.S.; Ogura, K.; Sagisaka, A.; Kon, A.; Esirkepov, T.Z.; Hayashi, Y.; Kotaki, H.; Kanasaki, M.; Sakaki, H.; Fukuda, Y.; Koga, J.; Nishiuchi, M.; Kando, M.; Bulanov, S.; Kondo, K.; Bolton, P.R.; Slezák, Ondřej; Vojna, David; Sawicka-Chyla, Magdalena; Jambunathan, Venkatesan; Lucianetti, Antonio; Mocek, Tomáš

2015-01-01

Roč. 21, č. 1 (2015), s. 1601118 ISSN 0018-9197 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143; GA MŠk EE2.3.30.0057 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143; OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057 Institutional support: RVO:68378271 Keywords : petawatt laser * applications * Ti:saphire * ASE Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.843, year: 2015

Costs of community-based interventions from the Community Transformation Grants.

Science.gov (United States)

Khavjou, Olga A; Honeycutt, Amanda A; Yarnoff, Benjamin; Bradley, Christina; Soler, Robin; Orenstein, Diane

2018-07-01

Limited data are available on the costs of evidence-based community-wide prevention programs. The objective of this study was to estimate the per-person costs of strategies that support policy, systems, and environmental changes implemented under the Community Transformation Grants (CTG) program. We collected cost data from 29 CTG awardees and estimated program costs as spending on labor; consultants; materials, travel, and services; overhead activities; partners; and the value of in-kind contributions. We estimated costs per person reached for 20 strategies. We assessed how per-person costs varied with the number of people reached. Data were collected in 2012-2015, and the analysis was conducted in 2015-2016. Two of the tobacco-free living strategies cost less than $1.20 per person and reached over 6 million people each. Four of the healthy eating strategies cost less than $1.00 per person, and one of them reached over 6.5 million people. One of the active living strategies cost $2.20 per person and reached over 7 million people. Three of the clinical and community preventive services strategies cost less than $2.30 per person, and one of them reached almost 2 million people. Across all 20 strategies combined, an increase of 10,000 people in the number of people reached was associated with a $0.22 reduction in the per-person cost. Results demonstrate that interventions, such as tobacco-free indoor policies, which have been shown to improve health outcomes have relatively low per-person costs and are able to reach a large number of people. Copyright © 2018 Elsevier Inc. All rights reserved.

Carleton to oversee $40 million lab grant

CERN Multimedia

Singer, Zev

2003-01-01

"Carleton University got a major gift yesterday, as the federal government announced the university will oversee a $40-million grant to run the world's deepest underground lab at the Sudbury Neutrino Observatory. Five other universities are partners in the project" (1/2 page).

Eastern Africa Journal of Rural Development - Vol 19, No 1 (2003)

African Journals Online (AJOL)

Socio-economic Constraints Women Face When Running Micro-enterprises: A Comparative Case Study in Southern Malawi · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Abdi-Khalil Edriss, Esnart Kamvani, 41-51. http://dx.doi.org/10.4314/eajrd.v19i1.28351 ...

Pulse synchronization system for picosecond pulse-pumped OPCPA with femtosecond-level relative timing jitter

Czech Academy of Sciences Publication Activity Database

Batysta, František; Antipenkov, Roman; Green, Jonathan T.; Naylon, Jack A.; Novák, Jakub; Mazanec, Tomáš; Hříbek, Petr; Zervos, Charalampos; Bakule, Pavel; Rus, Bedřich

2014-01-01

Roč. 22, č. 24 (2014), s. 30281-30286 ISSN 1094-4087 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE.2.3.20.0091; GA MŠk ED3.1.00/10.0210 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; OP VK 1 LaserSys(XE) CZ.1.07/2.3.00/20.0091; CCIT: Centrum pro inovace a transfer technologií(XE) CZ.1.05/3.1.00/10.0210 Institutional support: RVO:68378271 Keywords : laser stabilization * optical amplifiers * lasers diode-pumped * parametric oscillators and amplifiers Subject RIV: BH - Optics, Masers, Lasers Impact factor: 3.488, year: 2014

Short-wavelength ablation of polymers in the high-fluence regime

Czech Academy of Sciences Publication Activity Database

Liberatore, Chiara; Mann, K.; Müller, M.; Pina, L.; Juha, Libor; Vyšín, Luděk; Rocca, J.J.; Endo, Akira; Mocek, Tomáš

T161, MAY (2014), "014066-1"-"014066-4" ISSN 0031-8949 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143 Institutional support: RVO:68378271 Keywords : extreme ultraviolet * soft x-ray * ablation * polymers Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.126, year: 2014

Temperature dependence of parametric instabilities in the context of the shock-ignition approach to inertial confinement fusion

Czech Academy of Sciences Publication Activity Database