WorldWideScience

Sample records for gourd luffa cylindrica

  1. Cardanol-based thermoset plastic reinforced by sponge gourd fibers (Luffa cylindrica

    Directory of Open Access Journals (Sweden)

    André Leandro da Silva

    2016-02-01

    Full Text Available Abstract A growing global trend for maximum use of natural resources through new processes and products has enhanced studies and exploration of renewable natural materials. In this study, cardanol, a component of the cashew nut shell liquid (CNSL, was used as a building block for the development of a thermosetting matrix, which was reinforced by raw and modified sponge gourd fibers (Luffa cylindrica. DSC and TG results showed that among biocomposites, the one reinforced by sponge gourd fibers treated with NaOH 10 wt% (BF10 had the highest thermal stability, besides the best performance in the Tensile testing, showing good incorporation, dispersion, and adhesion to polymer matrix, observed by SEM. After 80 days of simulated soil experiments, it has been discovered that the presence of treated fiber allowed better biodegradability behavior to biocomposites. The biobased thermoset plastic and biocomposites showed a good potential to several applications, such as manufacturing of articles for furniture and automotive industries, especially BF10.

  2. Study of mechanical and morphological properties of bio-based polyethylene (HDPE) and sponge-gourds (Luffa-cylindrica) agroresidue composites

    Science.gov (United States)

    Escocio, Viviane A.; Visconte, Leila L. Y.; Cavalcante, Andre de P.; Furtado, Ana Maria S.; Pacheco, Elen B. A. V.

    2015-05-01

    Brazil has a remarkable position in the use of renewable energy. The potential of natural resources in Brazil has motivated the use of these renewable resources to make technologies more sustainable. From the large variety of commercially available High Density Polyethylene (HDPE) from different sources, two were chosen for investigation: one produced from sugarcane ethanol, and the other one, a conventional polyethylene, produced from fossil resources. In the preparation of the composites, sponge-gourds also called Luffa cylindrica were selectec. The main application of this product is as bath sponge, whose production generates scraps that are generally burnt. In this work, the composites were prepared by blending the sponge scrap at different proportions (10, 20, 30 and 40% wt/wt) with high density polyethylene (HDPE) from renewable source by extrusion. The melt flow index analysis of the composites was determined and specimens were obtained by injection molding for the assessment of mechanical properties such as tensile (elasticity modulus), flexural and Izod impact strengths. The microstructure of the impact fractured surface of the specimen also was determined. The results showed that the addition of sponge scrap affects positively all the properties studied as compared to HDPE. The results of tensile strength, elasticity modulus and flexural strength were similar to those observed in the literature for composites of HDPE from fossil source. The microstructure corroborates the results of mechanical properties. It was shown that the sponge scrap has potential to be applied as cellulosic filler for renewable polyethylene, providing a totally renewable material with good mechanical properties.

  3. Investigation of mechanical properties of luffa cylindrica fibre ...

    African Journals Online (AJOL)

    DR OKE

    till now has been done to prepare hybrid composite with luffa cylindrica fiber. .... To enhance the conductivity of the samples a thin film of platinum is vacuum ..... area of research includes tribology, composite materials and nano-technology.

  4. Luffa aegyptiaca (Gourd) Fruit Juice as a Source of Peroxidase

    OpenAIRE

    Yadav, R. S. S.; Yadav, K. S.; Yadav, H. S.

    2011-01-01

    Peroxidases have turned out to be potential biocatalyst for a variety of organic reactions. The research work reported in this communication was done with the objective of finding a convenient rich source of peroxidase which could be used as a biocatalyst for organic synthetic reactions. The studies made have shown that Luffa aegyptiaca (gourd) fruit juice contains peroxidase activity of the order of 180 enzyme unit/mL. The K m values of this peroxidase for the substrates guaiacol and hydroge...

  5. Luffa aegyptiaca (Gourd) Fruit Juice as a Source of Peroxidase.

    Science.gov (United States)

    Yadav, R S S; Yadav, K S; Yadav, H S

    2011-01-01

    Peroxidases have turned out to be potential biocatalyst for a variety of organic reactions. The research work reported in this communication was done with the objective of finding a convenient rich source of peroxidase which could be used as a biocatalyst for organic synthetic reactions. The studies made have shown that Luffa aegyptiaca (gourd) fruit juice contains peroxidase activity of the order of 180 enzyme unit/mL. The K(m) values of this peroxidase for the substrates guaiacol and hydrogen peroxide were 2.0 and 0.2 mM, respectively. The pH and temperature optima were 6.5 and 60°C, respectively. Like other peroxidases, it followed double displacement type mechanism. Sodium azide inhibited the enzyme competitively with K(i) value of 3.35 mM.

  6. Luffa aegyptiaca (Gourd Fruit Juice as a Source of Peroxidase

    Directory of Open Access Journals (Sweden)

    R. S. S. Yadav

    2011-01-01

    Full Text Available Peroxidases have turned out to be potential biocatalyst for a variety of organic reactions. The research work reported in this communication was done with the objective of finding a convenient rich source of peroxidase which could be used as a biocatalyst for organic synthetic reactions. The studies made have shown that Luffa aegyptiaca (gourd fruit juice contains peroxidase activity of the order of 180 enzyme unit/mL. The Km values of this peroxidase for the substrates guaiacol and hydrogen peroxide were 2.0 and 0.2 mM, respectively. The pH and temperature optima were 6.5 and 60°C, respectively. Like other peroxidases, it followed double displacement type mechanism. Sodium azide inhibited the enzyme competitively with Ki value of 3.35 mM.

  7. Kinetic modelling for zinc (II) ions biosorption onto Luffa cylindrica

    International Nuclear Information System (INIS)

    Oboh, I.; Aluyor, E.; Audu, T.

    2015-01-01

    The biosorption of Zinc (II) ions onto a biomaterial - Luffa cylindrica has been studied. This biomaterial was characterized by elemental analysis, surface area, pore size distribution, scanning electron microscopy, and the biomaterial before and after sorption, was characterized by Fourier Transform Infra Red (FTIR) spectrometer. The kinetic nonlinear models fitted were Pseudo-first order, Pseudo-second order and Intra-particle diffusion. A comparison of non-linear regression method in selecting the kinetic model was made. Four error functions, namely coefficient of determination (R 2 ), hybrid fractional error function (HYBRID), average relative error (ARE), and sum of the errors squared (ERRSQ), were used to predict the parameters of the kinetic models. The strength of this study is that a biomaterial with wide distribution particularly in the tropical world and which occurs as waste material could be put into effective utilization as a biosorbent to address a crucial environmental problem

  8. Amputation of congo red dye from waste water using microwave induced grafted Luffa cylindrica cellulosic fiber.

    Science.gov (United States)

    Gupta, Vinod Kumar; Pathania, Deepak; Agarwal, Shilpi; Sharma, Shikha

    2014-10-13

    The present study deals with the surface modification of Luffa cylindrica fiber through graft copolymerization of methyl acrylate/acrylamide (MA/AAm) via microwave radiation without the use of initiator. Various reaction parameters effecting grafting yield were optimized and physico-chemical properties were evaluated. The grafted Luffa cylindrica fiber showed morphological transformations, thermal stability and chemical resistance. The adsorption potential of modified fiber was investigated using adsorption isotherms for hazardous congo red dye removal from aqueous system. The maximum adsorption capacity of dye onto grafted Luffa cylindrica fiber was found to be 17.39 mg/g with best fit for Langmuir adsorption isotherm. The values of thermodynamic parameters such as enthalpy change, ΔH(0) (21.27 kJ/mol), entropy change, ΔS(0) (64.71 J/mol K) and free energy change, ΔG(0) (-139.52 kJ/mol) were also calculated. Adsorption process was found spontaneous and endothermic in nature. Copyright © 2014 Elsevier Ltd. All rights reserved.

  9. Thorium binding by biochar fibres derived from Luffa Cylindrica after controlled surface oxidation

    Science.gov (United States)

    Liatsou, Ioanna; Christodoulou, Eleni; Paschalidis, Ioannis

    2017-04-01

    Controlled surface modification of biochar fibres derived from Luffa Cylindrica sponges has been carried out by nitric acid and the degree of oxidation could be controlled by changing the acid concentration or the reaction time. The extent of surface oxidation has been quantified by acid-base titration and FTIR-spectroscopy. Furthermore, thorium binding has been studied as a function of various parameters and the experimental results show that even under strong acidic conditions the relative sorption is above 70% and the sorption capacity of the biochar fibres for Th(IV) at pH 3 is qmax= 70 gṡkg-1.

  10. Pollen Deposition Is More Important than Species Richness for Seed Set in Luffa Gourd.

    Science.gov (United States)

    Ali, M; Saeed, S; Sajjad, A

    2016-10-01

    In the context of global biodiversity decline, it is imperative to understand the different aspects of bee communities for sustaining the vital ecosystem service of pollination. Bee species can be assigned to functional groups (average difference among species in functionally related traits) on the basis of complementarity (trait variations exhibited by individual organisms) in their behavior but is not yet known which functional group trait is most important for seed set. In this study, first, the functional groups of bees were made based on their five selected traits (pollen deposition, visitation rate, stay time, visiting time of the day, body size) and then related to the seed set of obligate cross-pollinated Luffa gourd (Luffa aegyptiaca). We found that bee diversity and abundance differed significantly among the studied plots, but only the bee species richness was positively related to the seed set. Functional group diversity in terms of pollen deposition explained even more of the variance in seed set (r 2  = 0.74) than did the species richness (r 2  = 0.53) making it the most important trait of bee species for predicting the crop reproductive success.

  11. A natural sorbent, Luffa cylindrica for the removal of a model basic dye

    International Nuclear Information System (INIS)

    Altinisik, Aylin; Guer, Emel; Seki, Yoldas

    2010-01-01

    In this work, application of Luffa cylindrica in malachite green (MG) removal from aqueous solution was studied in a batch system. The effect of contact time, pH and temperature on removal of malachite green was also investigated. By the time pH was increased from 3 to 5, the amount of sorbed malachite green also increased. Beyond the pH value of 5, the amount of sorbed malachite green remains constant. The fits of equilibrium sorption data to Langmuir, Freundlich and Dubinin-Radushkevich equations were investigated. Langmuir isotherm exhibited best fit with the experimental data. Monolayer sorption capacity increased with the increasing of temperature. Sorption kinetic was evaluated by pseudo-first-order, pseudo-second-order, Elovich rate equations and intraparticle diffusion models. It was inferred that sorption follows pseudo-second-order kinetic model. Thermodynamic parameters for sorption process were also found out. Spontaneous and endothermic nature of sorption was obtained due to negative value of free energy (ΔG o ) and positive value of enthalpy (ΔH o ) changes. FTIR analyses were also conducted to confirm the sorption of malachite green onto L. cylindrica.

  12. Genome Survey Sequencing of Luffa Cylindrica L. and Microsatellite High Resolution Melting (SSR-HRM) Analysis for Genetic Relationship of Luffa Genotypes.

    Science.gov (United States)

    An, Jianyu; Yin, Mengqi; Zhang, Qin; Gong, Dongting; Jia, Xiaowen; Guan, Yajing; Hu, Jin

    2017-09-11

    Luffa cylindrica (L.) Roem. is an economically important vegetable crop in China. However, the genomic information on this species is currently unknown. In this study, for the first time, a genome survey of L. cylindrica was carried out using next-generation sequencing (NGS) technology. In total, 43.40 Gb sequence data of L. cylindrica , about 54.94× coverage of the estimated genome size of 789.97 Mb, were obtained from HiSeq 2500 sequencing, in which the guanine plus cytosine (GC) content was calculated to be 37.90%. The heterozygosity of genome sequences was only 0.24%. In total, 1,913,731 contigs (>200 bp) with 525 bp N 50 length and 1,410,117 scaffolds (>200 bp) with 885.01 Mb total length were obtained. From the initial assembled L. cylindrica genome, 431,234 microsatellites (SSRs) (≥5 repeats) were identified. The motif types of SSR repeats included 62.88% di-nucleotide, 31.03% tri-nucleotide, 4.59% tetra-nucleotide, 0.96% penta-nucleotide and 0.54% hexa-nucleotide. Eighty genomic SSR markers were developed, and 51/80 primers could be used in both "Zheda 23" and "Zheda 83". Nineteen SSRs were used to investigate the genetic diversity among 32 accessions through SSR-HRM analysis. The unweighted pair group method analysis (UPGMA) dendrogram tree was built by calculating the SSR-HRM raw data. SSR-HRM could be effectively used for genotype relationship analysis of Luffa species.

  13. Morphological and Molecular Analysis Using RAPD in Biofield Treated Sponge and Bitter Gourd

    OpenAIRE

    Nayak, Gopal; Trivedi, Mahendra Kumar; Trivedi, Mahendra Kumar; Branton, Alice; Gangwar, Mayank; Jana, Snehasis

    2015-01-01

    Plants are known to have sense and can respond to touch, electric and magnetic field. The present study was designed on the sponge gourd (Luffa cylindrica) and bitter gourd (Momordica charantia) seeds with respect to biofield energy treatment. The seeds of each crop were divided into two groups, one was kept control, while the other group was subjected to Mr. Trivedi' biofield energy treatment. The variabilities in growth contributing parameters were studied and compared with their control. T...

  14. De novo sequencing and analysis of the transcriptome during the browning of fresh-cut Luffa cylindrica 'Fusi-3' fruits

    Science.gov (United States)

    Chen, Mindong; Wang, Bin; Zhang, Qianrong; Xue, Zhuzheng

    2017-01-01

    Fresh-cut luffa (Luffa cylindrica) fruits commonly undergo browning. However, little is known about the molecular mechanisms regulating this process. We used the RNA-seq technique to analyze the transcriptomic changes occurring during the browning of fresh-cut fruits from luffa cultivar ‘Fusi-3’. Over 90 million high-quality reads were assembled into 58,073 Unigenes, and 60.86% of these were annotated based on sequences in four public databases. We detected 35,282 Unigenes with significant hits to sequences in the NCBInr database, and 24,427 Unigenes encoded proteins with sequences that were similar to those of known proteins in the Swiss-Prot database. Additionally, 20,546 and 13,021 Unigenes were similar to existing sequences in the Eukaryotic Orthologous Groups of proteins and Kyoto Encyclopedia of Genes and Genomes databases, respectively. Furthermore, 27,301 Unigenes were differentially expressed during the browning of fresh-cut luffa fruits (i.e., after 1–6 h). Moreover, 11 genes from five gene families (i.e., PPO, PAL, POD, CAT, and SOD) identified as potentially associated with enzymatic browning as well as four WRKY transcription factors were observed to be differentially regulated in fresh-cut luffa fruits. With the assistance of rapid amplification of cDNA ends technology, we obtained the full-length sequences of the 15 Unigenes. We also confirmed these Unigenes were expressed by quantitative real-time polymerase chain reaction analysis. This study provides a comprehensive transcriptome sequence resource, and may facilitate further studies aimed at identifying genes affecting luffa fruit browning for the exploitation of the underlying mechanism. PMID:29145430

  15. De novo sequencing and analysis of the transcriptome during the browning of fresh-cut Luffa cylindrica 'Fusi-3' fruits.

    Directory of Open Access Journals (Sweden)

    Haisheng Zhu

    Full Text Available Fresh-cut luffa (Luffa cylindrica fruits commonly undergo browning. However, little is known about the molecular mechanisms regulating this process. We used the RNA-seq technique to analyze the transcriptomic changes occurring during the browning of fresh-cut fruits from luffa cultivar 'Fusi-3'. Over 90 million high-quality reads were assembled into 58,073 Unigenes, and 60.86% of these were annotated based on sequences in four public databases. We detected 35,282 Unigenes with significant hits to sequences in the NCBInr database, and 24,427 Unigenes encoded proteins with sequences that were similar to those of known proteins in the Swiss-Prot database. Additionally, 20,546 and 13,021 Unigenes were similar to existing sequences in the Eukaryotic Orthologous Groups of proteins and Kyoto Encyclopedia of Genes and Genomes databases, respectively. Furthermore, 27,301 Unigenes were differentially expressed during the browning of fresh-cut luffa fruits (i.e., after 1-6 h. Moreover, 11 genes from five gene families (i.e., PPO, PAL, POD, CAT, and SOD identified as potentially associated with enzymatic browning as well as four WRKY transcription factors were observed to be differentially regulated in fresh-cut luffa fruits. With the assistance of rapid amplification of cDNA ends technology, we obtained the full-length sequences of the 15 Unigenes. We also confirmed these Unigenes were expressed by quantitative real-time polymerase chain reaction analysis. This study provides a comprehensive transcriptome sequence resource, and may facilitate further studies aimed at identifying genes affecting luffa fruit browning for the exploitation of the underlying mechanism.

  16. Empleo del estropajo común (Luffa cylindrica en la remoción de contaminantes.

    Directory of Open Access Journals (Sweden)

    Ricardo Ignacio Pereira-Martínez

    2017-06-01

    Full Text Available Interesa a la ingeniería, el desarrollo biotecnológico de técnicas de tratamiento de agua para la remoción de contaminantes, aprovechando las propiedades de las fibras de Luffa cylindrica (FLc. Así lo exponen los argumentos explicados en varias investigaciones realizadas en todo el mundo en las que se describe un sugestivo escenario de razones válidas para considerar a la fibra del estropajo, como un material industrialmente promisorio y sostenible, apto para la realización de tratamientos de remoción de contaminantes y en la separación de sustancias inmersas en matrices fluidas. También explican la utilización de las fibras como matriz inmovilizadora para sostener comunidades microbianas activas implantadas con fines específicos; incluso, al comprender la arquitectura y las propiedades mecánicas de las FLc, se explora su utilización como agregado en la obtención de materiales compuestos, en la producción de nuevas sustancias y su capacidad para retener humedad. El presente artículo se refiere a la descripción de los procesos de adsorción e inmovilización en los que se ha involucrado a las FLc haciendo una revisión de experiencias investigativas. A la vez se estudian, los razonamientos que han permitido describir las técnicas y que posibilitan el aporte de soluciones al problema de la remoción de contaminantes y del tratamiento de agua.

  17. Seed Characteristics Diversity in Sponge Gourd (Luffa aegyptiaca Mill. Germplasms from Hatay Region in Turkey

    Directory of Open Access Journals (Sweden)

    Kazım MAVİ

    2018-05-01

    Full Text Available The objective of this study was to evaluate seed characteristics of sponge gourd, to establish a core collection of sponge gourd with the germplasm collected throughout the Hatay region. A mini-core collection was assessed for morphological performance and some seed traits. Substantial variations of seed characteristics: seed length, seed width, seed thickness (mm, seed index (length/width, seed size (length × width, mm2, seed colour, seed-coat surface, seed shape, seed wing, and 100-seed weight were investigated. Seed length, width and thickness were varied as 15.12-8.97 mm, 9.71-6.25 mm and 2.86-2.16 mm respectively. The seed sizes were determined from small (31 DÖ 06 to big (31 DE 04. Seed colours were ranged from black to white, even a brown colour like 07 MA 01. A hundred seed weights were observed as 16.43 g (31 AL 02 and 7.41 (31 DÖ 06. The results of dendrogram indicated that seed traits of the sponge gourd genotypes were separating in five groups. This collection of sponge gourds will be useful for the gene pools and a wide range of phenotypic variations to provide a good source of diversity for developing of sponge gourd cultivars in breeding programs.

  18. Microsatellite analysis of genetic diversity and population structure of hermaphrodite ridge gourd (Luffa hermaphrodita).

    Science.gov (United States)

    Pandey, Sudhakar; Ansari, W A; Choudhary, B R; Pandey, Maneesh; Jena, S N; Singh, A K; Dubey, R K; Singh, Bijendra

    2018-01-01

    Out of 103 microsatellite markers used for studying the genetic diversity among local landraces of Luffa species, 56 were found polymorphic, including 38 gSSR and 18 eSSR, respectively. A total of 197 amplification products were obtained. The mean number of alleles per locus was 3.52. The PIC ranged from 0.037 to 0.986, while size of amplified product ranged from 105 to 500 bp. Cucumber-derived SSRs were amplified within L. acutangula (68%), L. aegyptiaca (61.16%), and L. hermaphrodita (60.2%), with an average of 63.12% cross-transferability. The Jaccard's coefficient ranged from 0.66 to 0.97, with an average of 0.81. High genetic variability was observed for node of 1st hermaphrodite flower (6.4-17), days to 1st hermaphrodite flower (38-52.1), days to 1st fruit harvest (43-65), number of fruit per cluster (1-5.9), fruit length (3.9-25 cm), fruit weight (18.4-175 g), number of fruit per plant (20-147.5), and yield per plant (2.2-4.7 kg). Two sub-populations were identified including 21 genotypes (sub-population I) and 06 genotypes (sub-population II), these two sub-populations showed 0.608-0.395% of the ancestral relationship to each other. This study provides information for future exploration, collection, and utilization of Luffa genotypes, as well as the polymorphic markers identified could be available for the study of landmarks in linkages, genomic structures, evolutionary ecology, and marker-assisted selection (MAS) in Luffa species.

  19. Bioaccumulation of heavy metals and metalloids in luffa (luffa cylindrica l.) irrigated with domestic wastewater in jhang, pakistan: a prospect for human nutrition

    International Nuclear Information System (INIS)

    Khani, Z.I.; Ahmad, K.

    2015-01-01

    In the present study, 12 heavy metals (Cr, Mn, Ni, Cd, Co, Cu, Pb, Zn, Fe, Se, As, and Mo) were assessed in a potential vegetable Luffa cylindrica. The vegetable was collected randomly from two different sites located at Jhang, Punjab Pakistan. The analyses of variance of data collected from soil showed non-significant effect on Se, Zn, As, Cr, Ni, Mo and Pb while significant effect on Fe, Co, Mn, Cu and Cd metals. Concentrations of all 12 heavy metals in the soil samples were low at sampling site-I as compared to those at site-II except Ni. These concentrations were found below the safe limits except that of Cd. At site-I, the concentrations recorded for different heavy metals were: As > Fe > Pb > Mn > Cd > Co > Cu > Mo > Zn > Ni > Se > Cr while at site-II were: As > Fe > Mn > Pb > Co > Cd > Cu > Mo > Zn > Ni > Se > Cr. Enrichment co-efficient of Cr was higher which showed that root of luffa plant accumulated more Cr concentration from the contaminated soil. The order of enrichment co-efficient was recorded at site-I as: Cr > Zn > Mn > Cu > Fe > Ni > Mo > Pb > As > Se > Co > Cd, and at site-II Cr > Zn > Mn > Ni > Cu > Fe > Mo > Pb > Se > As > Co > Cd. The transfer co-efficient of Mn was higher which indicates that more contents of Mn were transferred from roots to upper edible part. The order of transfer co-efficient at site-I was: Ni > Se > Mo > Cr > Zn > Fe > Mn > Cd > Pb > As > Cu > Co and at site-II was Mn > Zn > As > Fe > Pb > Se > Cd > Co > Mo > Cu > Ni > Cr. Correlation analysis showed that Mn, Se, Co, Cd, Ni, Mo and Pb had positive non-significant correlation, whereas a negative and non-significant correlation for Zn, As, Fe and Cr. The order of pollution load index at site-I was Cd > Mo > Se > Pb > Cu > Co > As > Fe > Mn > Ni > Zn > Cr and at site-II: Cd > Mo > Se > Pb > Cu > Co > As > Fe > Mn > Ni > Zn > Cr. Overall, at both sites, lowest concentration of Cr and highest of As were observed which need substantial awareness. Health risk index depends on

  20. Comparison of Luffa cylindrica L. sponge discs and Ca-alginate gel ...

    African Journals Online (AJOL)

    At the end of 96 h fermentation, the ethanol yields were 64.67 ± 0.016 and 65.21 ± 0.030 g/l molasses, with luffa and Ca-alginate entrapped S. cerevisiae cells exhibiting 89.90 ± 0.008 and 91.86 ± 0.072% sugar conversion, respectively. There was no statistically significant difference [Fisher's least significance difference ...

  1. Combined effect of morphactin and gamma radiation on growth, sex expression, and yield in Luffa cylindrica (Linn.) Roem

    International Nuclear Information System (INIS)

    Kaushik, M.P.; Singh, I.

    1978-01-01

    Investigations were carried out to study the combined effect of morphactin and gamma radiation on growth, sex expression and yield in Luffa cylindrica variety, 'Pusa Chikni'. Healthy seeds were subjected to gamma radiation dose of 1000 rad and grown in seed beds. Solutions of 1,10 and 1100 mg/1 of morphactin were sprayed on the plants at two to four true leaf stage. Plants grown from irradiated seeds, on which morphactin solutions were sprayed showed remarkable healthy growth. Application of morphactin at 1,10 and 100 mg/1 increased the position of node bearing first staminate flower, whereas a reduction was observed in the position of node bearing first pistillate flower. Days for anthesis to first staminate flower increased progressively while days for anthesis to first pistillate flower decreased gradually. Decrease in the production of staminate flowers was observed, while the production of pistillate flowers increased significantly in all the treatments. The ratio of staminate/ pistillate flowers decreased progressively with increasing morphactin concentration. One mg/1 morphactin application increased the length of vine whereas number of lateral branches increased in all the treatments. The number, length, diameter and weight of fruit increased at 1 and 10 mg/1 morphactin while at 100 mg/1 treatment these characters decreased significantly. (author)

  2. Phytochemical Screening of Aqueous Extract of Luffa aegyptiaca (Sponge gourd) Leave Sample from Northern Nigeria: A Short Communication

    OpenAIRE

    Mhya DH; Mankilik, M

    2014-01-01

    Aqueous extract of the leaves of Luffa aegyptiaca was preliminary screened with the aim of assessing the availability of some biologically active compounds. Pulverized leaves sample of Luffa aegyptiaca was extracted with water; the filtrate was concentrated on water bath and then air-dried at 25oC. The prepared aqueous-extract was used for the phytochemical screening study which was carried out using standard methods. The phytochemicals screened from the aqueous extract of Luffa aegyptiaca sh...

  3. Effect of heat treatment on yield and quality of loofah (luffa cylindrica linn.) seed oil

    International Nuclear Information System (INIS)

    Akinoso, R.

    2015-01-01

    Effect of heat treatment on yield and some quality parameters of loofah seed (Luffa cylindrical Linn.) oil was the focus of this study. Central composite rotatable response surface methodology design for two variables was used for this investigation. Fatty acid composition of the un-treated oil was determined. The independent variables roasting temperature were 102, 110, 130, 150, 158 degree C and duration 16, 20, 30, 40, 44 min while oil yield, moisture content, free fatty acid, colour, refractive index and specific gravity of the oil were the dependent variables. All determinations were done using standard methods. Linoleic acid (50.66%), oleic acid (27.66%), palmitic acid (12.28%) and stearic acid (6.44%) were the major fatty acids. Mean oil yield, moisture, free fatty acid, colour, refractive index and specific gravity were 25.9 ± 5.16%, 0.035 ± 0.003%, 5.3 ± 2.47%, 15.23 ± 1.83 mg/100g, 1.47 ± 0.002 ND 40 and 0.913 ± 0.02, respectively. All the parameters were significantly affected by heat treatment (p<0.05). Regression models were not fit to express the relation, thus optimisation using response surface approach was not adequate. (author)

  4. Evaluación de un sistema de filtros de cascarilla de arroz y luffa cylindrica para el tratamiento de aguas lluvias

    Directory of Open Access Journals (Sweden)

    Paola Mesa

    2015-06-01

    Full Text Available Se evaluó un sistema de tratamiento para agua lluvia cosechada en los techos de la Universidad Libre, sede Bosque Popular empleando elementos lignocelulósicos mediante dos filtros de flujo descendente con lecho profundo. Uno que consta de luffa cylindrica como soporte combinado con cascarilla de arroz como medio filtrante y otro que solo funcionó con cascarilla de arroz como medio filtrante. La eficiencia del tratamiento se evaluó a través de análisis físicos, químicos y biológicos como pH, turbiedad, sólidos disueltos totales, sólidos suspendidos totales, DQO y coliformes para un período de 10 días. Algunos de estos parámetros no mejoraron con el sistema en el período de prueba. Se observó además la ausencia de alcalinidad y dureza, lo que puede permitir el uso de esta agua en procesos diferentes al de consumo humano.

  5. Biotemplating of Luffa cylindrica sponges to self-supporting hierarchical zeolite macrostructures for bio-inspired structured catalytic reactors

    International Nuclear Information System (INIS)

    Zampieri, Alessandro; Mabande, Godwin T.P.; Selvam, Thangaraj; Schwieger, Wilhelm; Rudolph, Alexander; Hermann, Ralph; Sieber, Heino; Greil, Peter

    2006-01-01

    Biomorphic self-supporting MFI-type zeolite frameworks with hierarchical porosity and complex architecture were prepared using a 2-step (in-situ seeding and secondary crystal growth) hydrothermal synthesis in the presence of a biological template (Luffa sponge), employed as a macroscale sacrificial structure builder. The bio-inspired zeolitic replica inherited the complex spongy morphology and the intricate open-porous architecture of the biotemplate. Moreover, it exhibited reasonable mechanical stability in order to study the applicability of the biomorphic catalyst in a technical catalytic process. A bio-inspired catalytic reactor utilising the self-supporting ZSM-5 scaffold in monolithic configuration was developed in order to test the catalytic performance of the material

  6. Influence of CaCO3, Al2O3, and TiO2 microfillers on physico-mechanical properties of Luffa cylindrica/polyester composites

    Directory of Open Access Journals (Sweden)

    Vinay Kumar Patel

    2016-06-01

    Full Text Available The development of natural fibre reinforced polymer composites has gained popularity in many applications due to their environment friendly characteristics over the synthetic fibre based polymer composites. This paper describes the fabrication and physical, mechanical, three-body abrasive wear and water absorption behaviour of Luffa fibre reinforced polyester composites with and without addition of micro-fillers of Al2O3, CaCO3 and TiO2. The ranking of the composite materials has been made by using Technique for order preference by similarity to ideal solution (TOPSIS method with output parameters of their physical, mechanical and abrasive wear and water absorption attributes. The addition of microfillers has enhanced greatly the physical and mechanical properties of Luffa-fibre based composites. The addition of microfillers has influenced the physico-mechanical properties of Luffa-fibre based polyester composites in descending order of CaCO3, Al2O3, and TiO2.

  7. Análisis comparativo de modelos cinéticos para un Filtro Biológico sin recirculación con medio de soporte en Luffa Cylindrica para el tratamiento de aguas residuales combinadas (domésticas y pecuarias

    Directory of Open Access Journals (Sweden)

    Juan Pablo Rodriguez Miranda

    2018-01-01

    Full Text Available El presente artículo considera un análisis de los diferentes modelos cinéticos para la estabilización de la materia orgánica en un filtro biológico con lecho en Luffa cylindrica, en donde el modelo que más influyó en la cinética con el modelo matemático expuesto por Velz estableció un promedio la constante cinética de 0,116 (d-1. En cuanto a la remoción de la materia orgánica, se obtuvieron resultados de eficiencia en donde se alcanzaron valores entre 85%, 76%, 55%.

  8. Genetic Linkage Map Construction and QTL Analysis of Two Interspecific Reproductive Isolation Traits in Sponge Gourd.

    Science.gov (United States)

    Wu, Haibin; He, Xiaoli; Gong, Hao; Luo, Shaobo; Li, Mingzhu; Chen, Junqiu; Zhang, Changyuan; Yu, Ting; Huang, Wangping; Luo, Jianning

    2016-01-01

    The hybrids between Luffa acutangula (L.) Roxb. and L.cylindrica (L.) Roem. have strong heterosis effects. However, some reproductive isolation traits hindered their normal hybridization and fructification, which was mainly caused by the flowering time and hybrid pollen sterility. In order to study the genetic basis of two interspecific reproductive isolation traits, we constructed a genetic linkage map using an F2 population derived from a cross between S1174 [L. acutangula (L.) Roxb.] and 93075 [L. cylindrica (L.) Roem.]. The map spans 1436.12 CentiMorgans (cM), with an average of 8.11 cM among markers, and consists of 177 EST-SSR markers distributed in 14 linkage groups (LG) with an average of 102.58 cM per LG. Meanwhile, we conducted colinearity analysis between the sequences of EST-SSR markers and the genomic sequences of cucumber, melon and watermelon. On the basis of genetic linkage map, we conducted QTL mapping of two reproductive isolation traits in sponge gourd, which were the flowering time and hybrid male sterility. Two putative QTLs associated with flowering time (FT) were both detected on LG 1. The accumulated contribution of these two QTLs explained 38.07% of the total phenotypic variance (PV), and each QTL explained 15.36 and 22.71% of the PV respectively. Four QTLs for pollen fertility (PF) were identified on LG 1 (qPF1.1 and qPF1.2), LG 3 (qPF3) and LG 7 (qPF7), respectively. The percentage of PF explained by these QTLs varied from 2.91 to 16.79%, and all together the four QTLs accounted for 39.98% of the total PV. Our newly developed EST-SSR markers and linkage map are very useful for gene mapping, comparative genomics and molecular marker-assisted breeding. These QTLs for interspecific reproductive isolation will also contribute to the cloning of genes relating to interspecific reproductive isolation and the utilization of interspecific heterosis in sponge gourd in further studies.

  9. Comportamiento de dos variedades de sandía Citrullus lanatus (Thunb Matsura y Nakan, injertadas sobre los portainjertos de calabaza, Lagenaria siceraria, zapallo Cucurbita moschata, ahuyama Cucurbita máxima y estropajo Luffa cylindrica The performance of two varieties of water melon Citrullus lanatus (Thub Matsura and nakai, grafted over pumpkin Lagenaria siceraria, zapallo Cucurbita moschata, ahuyama Cucurbita maxima and estropajo Luffa cylindrica graftholders

    Directory of Open Access Journals (Sweden)

    Moreno Juan Carlos

    1992-12-01

    Full Text Available

    En 1987-I, se realizó en predios de la Universidad Nacional de Colombia, Sede Palmira un estudio para evaluar la viabilidad de los injertos, cuantificar la producción e introducir alternativas de manejo de los problemas fitosanitarios. El suelo bien estructurado tiene textura FArL, pH 7.0, materia orgánica 3%, P 48 ppm, K .7 me/100g de suelo y una CIC de 19 me/100g de suelo. Se realizó un injerto de púa o escudete con plántulas de sandía de las variedades Charleston Gray y Sugar baby sobre los patrones de las especies citadas. Al patrón se le eliminó el meristemo apical y se rajó longitudinalmente 1.0 - 1.5 cm y se le introdujo la púa en forma de cuña. La púa consistió en el 50% del tallo, las hojas cotiledonares y el meristemo apical. Las unidades experimentales en el campo se distribuyeron en bloques completos al azar, en donde los tratamientos fueron las plantas injertadas y los tratamientos testigos las variedades de sandía sembradas directamente por semillas. El prendimiento de las púas superó el 90% en todos los casos. Los portainjertos Lagenaria y Cucurbita influyeron en mayor aumento de área foliar, mientras que Luffa disminuyó ostensiblemente. Los portainjertos no desmejoraron las características organolépticas de las frutas de las dos variedades. El número de frutos en las plantas infestadas sobre zapallo y estropajo disminuyeron.

    In the first semester of 1987 was done this experiment at Universidad Nacional, Palmira. The objectives were to evaluate grafts viability, to quantify production and to give alternatives to phytosanitary problems. It was done a prick or escutcheon graft with water melon small plants from Charleston Gray and Sugar Baby. The summit bud was eliminated and it was longitudinally cut 1.0 - 1.5 cm for inserting the prick cotyledon leaves and the summit bud. Experimental units were distributed in random complete blocks, where experiment treatments were grafted plants and control the

  10. Genotoxicity and antigenotoxicity study of aqueous and hydro-methanol extracts of Spondias mombin L., Nymphaea lotus L. and Luffa cylindrical L. using animal bioassays

    OpenAIRE

    Oyeyemi, Ifeoluwa Temitayo; Yekeen, Olaide Maruf; Odusina, Paul Olayinka; Ologun, Taiwo Mary; Ogbaide, Orezimena Michelle; Olaleye, Olayinka Israel; Bakare, Adekunle A.

    2015-01-01

    Spondias mombin (Linn), Nymphaea lotus (Linn) and Luffa cylindrica (Linn) (syn Luffa aegyptiaca Mill) are plants traditionally used as food ingredients and in the management of diseases, including cancer, in Nigeria. Despite the therapeutic potentials attributed to these plants, reports on their genotoxicity are scanty. In this study, the genotoxicity of the aqueous and hydro-methanol extract of these plants was evaluated using mouse bone marrow micronucleus and sperm morphology assays. Antig...

  11. Phytoremediation of anthracene- and fluoranthene contaminated soil by Luffa acutangula

    Directory of Open Access Journals (Sweden)

    Khanitta Somtrakoon

    2014-09-01

    Full Text Available Phytoremediation of soil contaminated with anthracene and fluoranthene, either alone or together, by ridge gourd (Luffa acutangula was investigated through laboratory pot experiments in a greenhouse for 45 days. The i nitial concentration of anthracene or fluoranthene was 100 mg kg -1 when each was spiked alone. When spiked together, the initial concentration of each hydrocarbon was 50 mg kg -1 . The ridge gourd grew normally in anthracene-contaminated soil based on assessment of shoot growth at the end of the experiment. Fluoranthene spiked either alone or together with anthracene was toxic to the plant as shown by significantly reduced shoot and root growth, especiall y on day 45 after transplantation. Planting of ridge gourd was more effective in decreasing the amount of anthracene and fluoranthene from soil than un-planted control during the 45-day experiment. Only 0.5-1.8% and 3.1-14.1% of anthracene and fluoranthene respectively were detected in planted soil on day 45. In contrast, 27.7-48.2% and 46.9-73.8% of anthracene and fluoranthene respectively, spiked alone or together, remained in the control un-planted soil during the same period. The two aromatic hydrocarbons were neither detected in the shoot nor root tissue of the ridge gourd, which suggests that phytostimulation may be the most likely mechanism by which these hydrocarbons were removed from soil.

  12. Effect of heat on loofah gourd seeds chemical composition and fatty ...

    African Journals Online (AJOL)

    Dehulled loofah gourd seeds (DLGS), Luffah cylindrica was divided into three parts namely; raw (DLGSR), boiled for 5 min at 100 oC (DLGSB) and cooked for 30 min (DGLSC). Proximate composition, amino acids, amino acid scores and energy were determined in DLGSR, DLGSB and DLGSC and fatty acids constituents ...

  13. Genetic Linkage Map Construction and QTL Analysis of Two Interspecific Reproductive Isolation Traits in Sponge Gourd

    OpenAIRE

    Wu, Haibin; He, Xiaoli; Gong, Hao; Luo, Shaobo; Li, Mingzhu; Chen, Junqiu; Zhang, Changyuan; Yu, Ting; Huang, Wangping; Luo, Jianning

    2016-01-01

    The hybrids between Luffa acutangula (L.) Roxb. and L.cylindrica (L.) Roem. have strong heterosis effects. However, some reproductive isolation traits hindered their normal hybridization and fructification, which was mainly caused by the flowering time and hybrid pollen sterility. In order to study the genetic basis of two interspecific reproductive isolation traits, we constructed a genetic linkage map using an F2 population derived from a cross between S1174 [L. acutangula (L.) Roxb.] and 9...

  14. Fuel properties of loofah (Luffa cylindrica L.) biofuel blended with ...

    African Journals Online (AJOL)

    ajl6

    Fuel properties of loofah oil and its ethyl ester blended with diesel were experimentally determined. ... The escalating prices of petroleum fuels, the .... equation developed by Bamgboye and Hansen (2008) was used to ..... Renewable Energy.

  15. Bitter Gourd: Botany, Horticulture, Breeding

    Science.gov (United States)

    Bitter gourd fruits are a good source of carbohydrates, proteins, vitamins, and minerals and have the highest nutritive value among cucurbits. Moreover, the crude protein content (11.4-20.9 g.kg-1) of bitter gourd fruits is higher than that of tomato and cucumber. This book chapter focuses on the ...

  16. Gourds: Bitter, Bottle, Wax, Snake, Sponge and Ridge

    Science.gov (United States)

    Minor cucurbits include bitter gourd, bottle gourd, wax gourd, snake gourd, and sponge and ridge gourd, which are significant dietary sources of nutrients such as vitamin A and C, iron and calcium. These cucurbits are cultivated and marketed by smallholder farmers and remain important components of ...

  17. From Imperata cylindrica grasslands to productive agroforestry

    NARCIS (Netherlands)

    Murniati,

    2002-01-01

    Keywords: Ecosystem, Agroforestry, Imperata cylindrica , pioneer, mycorrhizae, inter-cropping, tree architecture, biomass, functional branching analysis

    Conversion of an Imperata cylindrica ecosystem into an agroforestry

  18. Nonpolar compounds from Luffa aegyptiaca fruit

    OpenAIRE

    Nirmal S.A.; Kothawade P.C.; Datir S.B.; Pal S.C.; Mandal S.C.; Pattan S.R.

    2009-01-01

    The unsaponifiable and saponifiable constituents from the alcoholic extract of Luffa aegyptiaca fruit (Cucurbitaceae) were investigated by GC-MS. The results showed the presence of hydrocarbons viz., n-tricosane (0.41 %), n-tetracosane (0.83 %), nhexacosane (2.02 %), n-heptacosane (4.88 %), n-octacosane (2.57 %) and fatty acids viz., nanodecane-6-ol (17.65 %), eicosane-6-ol (2.54 %), dieicosane-6-ol (7.85 %), tetraeicosane-6-ol (1.75 %).

  19. Economic feasibility of intercropping of chili with sweet gourd

    Directory of Open Access Journals (Sweden)

    J Hossain

    2015-12-01

    Full Text Available A field experiment was conducted at Regional Agricultural Research Station, Bangladesh Agricultural Research Institute (BARI, Ishurdi, Pabna during two consecutive years of 2012-2013 and 2013-2014 to find out the suitable combination of intercropping of chili with sweet gourd for increasing the productivity and economic return. The treatments were T1=100% sweet gourd (2m x 2m + 40% chili (50cm x 100cm + 100% recommended fertilizer (RF of chili, T2=100% sweet gourd (2m x 2m + 40% chili (50cm x 100cm + 75% RF of chili, T3=100% sweet gourd (2m x 2m + 40% chili (50cm x 100cm + 50% RF of chili, T4=100% sweet gourd (2m x 2m + 50% chili (50cm x 80cm + 100% RF of chili, T5=100% sweet gourd (2m x 2m + 50% chili (50cm x 80cm + 75% RF of chili, T6=100% sweet gourd (2m x 2m + 50% chili (50cm x 80cm + 50% RF of chili, T7=Sole sweet gourd, T8= Sole chili. The experiment was laid out in a randomized complete block design with three replications. Fruit yield was calculated for sweet gourd and chili in ton per hectare considering the whole plot as harvested area. Results revealed that the yield of both sweet gourd and chili significantly affected by plant population and fertilizer dose in the intercropping systems. The highest equivalent yield of sweet gourd (21.21 t ha-1, land equivalent ratio (1.59, gross return (Tk. 318150.00 ha-1, gross margin (Tk. 237935.00 ha-1 and benefit cost ratio (3.97 were obtained from 100% sweet gourd (2m x 2m + 50% chili (50cm x 80cm + 100% RF of chili (T4. Sole crop of chili (T8 gave the lowest equivalent yield of sweet gourd (7.38 t ha-1, gross return (Tk. 110700.00 ha-1, gross margin (Tk. 37455.00 ha-1 and benefit cost ratio (1.51. Therefore, sweet gourd (100% and chili (50% with recommended fertilizer (100% of chili might be economically profitable for chili with sweet gourd intercropping system.

  20. Characterization of a translation inhibitory protein from Luffa aegyptiaca.

    Science.gov (United States)

    Ramakrishnan, S; Enghlid, J J; Bryant, H L; Xu, F J

    1989-04-28

    A protein with a molecular weight of about 30,000 was purified from the seeds of Luffa aegyptiaca. This protein inhibited cell free translation at pM concentrations. In spite of functional similarity to other ribosomal inhibitory proteins, the NH2-terminal analysis did not show any significant homology. Competitive inhibition studies indicate no immunological crossreactivity between the inhibitory protein from Luffa aegyptiaca, pokeweed antiviral protein (PAP) and recombinant ricin A chain. Chemical linkage of the protein to a monoclonal antibody reactive to transferrin receptor resulted in a highly cytotoxic conjugate.

  1. [Chemical constituents from Imperata cylindrica].

    Science.gov (United States)

    Liu, Xuan; Zhang, Binfeng; Chou, Guixin; Yang, Li; Wang, Zhengtao

    2012-08-01

    Chemical investigation of Imperata cylindrica led to the isolation of thirteen compounds using various chromatographic techniques. The structure of these compounds were identified as: three phenylpropanoids, 1-(3,4,5-trimethoxyphenyl)-1,2,3-propanetriol ( 1 ), 1-O-p-coumaroylglycerol (2), 4-methoxy-5-methyl coumarin-7-O-beta-D-glucopyranoside (3); four organic acids, 4-hydroxybenzene carboxylic acid(4), 3,4-dihydroxybenzoic acid (5), vanillic acid (6), 3, 4-dihydroxybutyric acid (7); one phenolic compound, salicin (8); and five triterpenes, namely, arundoin (9), cylindrin (10), fernenol (11), simiarenol (12), glutinone (13) by their physicochemical properties and spectral data analysis. Among them, compounds 1-8 were isolated from the genus Imperata for the first time.

  2. Studies on the structure and properties of thermoplastic starch/luffa fiber composites

    International Nuclear Information System (INIS)

    Kaewtatip, Kaewta; Thongmee, Jariya

    2012-01-01

    Highlights: ► Thermoplastic starch/luffa fiber composites were prepared using compression molding. ► The tensile strengths of the composites were higher than for thermoplastic starch. ► Degradation temperatures of the composites were higher than for thermoplastic starch. ► Luffa fiber decreases the water absorption of TPS. -- Abstract: Thermoplastic starch (TPS)/luffa fiber composites were prepared using compression molding. The luffa fiber contents ranged from 0 wt.% to 20 wt.%. The tensile strength of the TPS/luffa fiber composite with 10 wt.% of luffa fiber had a twofold increase compared to TPS. The temperature values of maximum weight loss of the TPS/luffa fiber composites were higher than for TPS. The water absorption of the TPS/luffa fiber composites decreased significantly when the luffa fiber contents increased. The strength of adhesion between the luffa fiber and the TPS matrix was clearly demonstrated by their compatibility presumably due to their similar chemical structures as shown by scanning electron microscope (SEM) micrographs and Fourier transform infrared (FTIR) spectra.

  3. End of the road for Imperata cylindrica?

    NARCIS (Netherlands)

    Ng, F.S.P.

    1999-01-01

    The other day, a young local biologist asked me what ‘lalang’ (Imperata cylindrica) looked like. Everybody used to know what lalang looked like, because it used to grow all along the roadsides. But not anymore. There are at least two species of grasses being planted along the new highways that

  4. Genotoxicity and antigenotoxicity study of aqueous and hydro-methanol extracts of Spondias mombin L., Nymphaea lotus L. and Luffa cylindrical L. using animal bioassays.

    Science.gov (United States)

    Oyeyemi, Ifeoluwa Temitayo; Yekeen, Olaide Maruf; Odusina, Paul Olayinka; Ologun, Taiwo Mary; Ogbaide, Orezimena Michelle; Olaleye, Olayinka Israel; Bakare, Adekunle A

    2015-12-01

    Spondias mombin (Linn), Nymphaea lotus (Linn) and Luffa cylindrica (Linn) (syn Luffa aegyptiaca Mill) are plants traditionally used as food ingredients and in the management of diseases, including cancer, in Nigeria. Despite the therapeutic potentials attributed to these plants, reports on their genotoxicity are scanty. In this study, the genotoxicity of the aqueous and hydro-methanol extract of these plants was evaluated using mouse bone marrow micronucleus and sperm morphology assays. Antigenotoxicity was assessed by the bone marrow micronucleus test. The highest attainable dose of 5 000 mg/kg according to OECD guidelines was first used to assess acute toxicity of the aqueous and hydro-methanol extracts in Swiss albino mice. For each extract, there were five groups of mice (n=4/group) treated with different concentrations of the extract as against the negative and positive control group for the genotoxicity study. In the antigenotoxicity study, five groups of mice were exposed to five different concentrations of the extracts along with 60 mg/kg of methyl methane sulfonate (MMS), which was used to induce genotoxicity. The mice were administered 0.2 mL of extract per day for 10 days in the genotoxicity and antigenotoxicity groups. Administration of each of the extracts at the concentration of 5 000 mg/kg did not induce acute toxicity in mice. At the concentrations tested, all the extracts, except aqueous S. mombin, increased micronucleated polychromatic erythrocytes. The aqueous and hydro-methanol extracts of N. lotus increased the frequency of aberrant sperm cells. All the extracts were also able to ameliorate MMS induced genotoxicity in bone marrow cells of the exposed mice. The results showed the potential of the extracts to induce somatic and germ cell mutation in male mice. The extracts also ameliorated the genotoxic effect of MMS.

  5. Genotoxicity and antigenotoxicity study of aqueous and hydro-methanol extracts of Spondias mombin L., Nymphaea lotus L. and Luffa cylindrical L. using animal bioassays

    Directory of Open Access Journals (Sweden)

    Oyeyemi Ifeoluwa Temitayo

    2015-12-01

    Full Text Available Spondias mombin (Linn, Nymphaea lotus (Linn and Luffa cylindrica (Linn (syn Luffa aegyptiaca Mill are plants traditionally used as food ingredients and in the management of diseases, including cancer, in Nigeria. Despite the therapeutic potentials attributed to these plants, reports on their genotoxicity are scanty. In this study, the genotoxicity of the aqueous and hydro-methanol extract of these plants was evaluated using mouse bone marrow micronucleus and sperm morphology assays. Antigenotoxicity was assessed by the bone marrow micronucleus test. The highest attainable dose of 5 000 mg/kg according to OECD guidelines was first used to assess acute toxicity of the aqueous and hydro-methanol extracts in Swiss albino mice. For each extract, there were five groups of mice (n=4/group treated with different concentrations of the extract as against the negative and positive control group for the genotoxicity study. In the antigenotoxicity study, five groups of mice were exposed to five different concentrations of the extracts along with 60 mg/kg of methyl methane sulfonate (MMS, which was used to induce genotoxicity. The mice were administered 0.2 mL of extract per day for 10 days in the genotoxicity and antigenotoxicity groups. Administration of each of the extracts at the concentration of 5 000 mg/kg did not induce acute toxicity in mice. At the concentrations tested, all the extracts, except aqueous S. mombin, increased micronucleated polychromatic erythrocytes. The aqueous and hydro-methanol extracts of N. lotus increased the frequency of aberrant sperm cells. All the extracts were also able to ameliorate MMS induced genotoxicity in bone marrow cells of the exposed mice. The results showed the potential of the extracts to induce somatic and germ cell mutation in male mice. The extracts also ameliorated the genotoxic effect of MMS.

  6. Fixed-bed biosorption of cadmium using immobilized Scenedesmus obliquus CNW-N cells on loofa (Luffa cylindrica) sponge.

    Science.gov (United States)

    Chen, Bor-Yann; Chen, Chun-Yen; Guo, Wan-Qian; Chang, Hao-Wei; Chen, Wen-Ming; Lee, Duu-Jong; Huang, Chieh-Chen; Ren, Nan-Qi; Chang, Jo-Shu

    2014-05-01

    A continuous fixed-bed biosorption process was established for cadmium (Cd) removal by Scenedesmus obliquus CNW-N (isolated from southern Taiwan) cells immobilized onto loofa sponge. This immobilized-cell biosorption process allows better recovery and reusability of the microalgal biomass. The growth of microalgae on the matrix support with appropriate nutrient supplementation could enhance the overall metal removal activity. Major operating parameters (e.g., feeding flow rate, cycle number of medium replacement, and particle diameter of the sponge) were studied for treatability evaluation. The most promising cell growth on the sponge support was obtained at a flow rate of 0.284 bed volume (BV)/min, sponge particle diameter of 1 cm, and with one cycle of medium replacement. The performance of fixed-bed biosorption (adsorption capacity of 38.4 mg, breakthrough time at 15.5 h) was achieved at a flow rate of 5 ml/min with an influent concentration of 7.5 mg Cd/l. Copyright © 2014 Elsevier Ltd. All rights reserved.

  7. Fiches techniques Les triacylglycérols des huiles de graines de quatre Cucurbitacées tropicales des genres Lagenaria et Luffa

    Directory of Open Access Journals (Sweden)

    Grondin Isabelle

    2002-03-01

    Full Text Available Les huiles de graines de quatre Cucurbitacées tropicales de l’île de la Réunion, provenant respectivement de deux variétés de l’espèce Lagenaria leucaritha (calebasses bouteille et la gale et de deux espèces du genre Luffa (pipangailles lisse et à côtes, ont été analysées aussi bien pour la fraction saponifiable que pour la fraction insaponifiable. L’étude de la fraction saponifiable a été consacrée, d’une part, à la détermination de la composition quantitative et qualitative en acides gras des différentes huiles dont les résultats ont fait l’objet d’une publication antérieure [1] et, d’autre part, à celle de leurs triacylglycérols. Une comparaison des compositions en acides gras des deux genres étudiés a permis de mettre en évidence les spécificités propres à chaque genre. Les genres Lagenaria et Luffa, présentant une composition en acides gras qualitativement similaire, contiennent ainsi les AG couramment rencontrés dans le règne végétal, à savoir les acides palmitique, stéarique, oléique et linoléique. Ce dernier est, par ailleurs, l’acide gras majoritaire avec des teneurs supérieures à 50%. La présence de cet acide gras essentiel confère ainsi à ces huiles de bonnes propriétés diététiques et nutritionnelles. Au sein du genre Lagenaria, les huiles des graines des variétés bouteille et la gale se caractérisent par leur teneur élevée en acide linoléique (71,5% pour la variété bouteille, et 81,5% pour la variété la gale. Les huiles de Lagenaria leucaritha sont du type palmitique-linoléique car ces deux acides gras représentent quantitativement plus de 85% des AG totaux. Contrairement à ces deux huiles, celles du genre Luffa se différencient, d’une part, par une teneur moindre en acide linoléique avec 55,3% pour l’espèce Luffa acutangula et 51,2% pour l’espèce Luffa cylindrica. D’autre part, elles sont du type palmitique-oléique-linoléique puisque ces trois

  8. Transoceanic drift and the domestication of African bottle gourds in the Americas.

    Science.gov (United States)

    Kistler, Logan; Montenegro, Alvaro; Smith, Bruce D; Gifford, John A; Green, Richard E; Newsom, Lee A; Shapiro, Beth

    2014-02-25

    Bottle gourd (Lagenaria siceraria) was one of the first domesticated plants, and the only one with a global distribution during pre-Columbian times. Although native to Africa, bottle gourd was in use by humans in east Asia, possibly as early as 11,000 y ago (BP) and in the Americas by 10,000 BP. Despite its utilitarian importance to diverse human populations, it remains unresolved how the bottle gourd came to be so widely distributed, and in particular how and when it arrived in the New World. A previous study using ancient DNA concluded that Paleoindians transported already domesticated gourds to the Americas from Asia when colonizing the New World [Erickson et al. (2005) Proc Natl Acad Sci USA 102(51):18315-18320]. However, this scenario requires the propagation of tropical-adapted bottle gourds across the Arctic. Here, we isolate 86,000 base pairs of plastid DNA from a geographically broad sample of archaeological and living bottle gourds. In contrast to the earlier results, we find that all pre-Columbian bottle gourds are most closely related to African gourds, not Asian gourds. Ocean-current drift modeling shows that wild African gourds could have simply floated across the Atlantic during the Late Pleistocene. Once they arrived in the New World, naturalized gourd populations likely became established in the Neotropics via dispersal by megafaunal mammals. These wild populations were domesticated in several distinct New World locales, most likely near established centers of food crop domestication.

  9. Transoceanic drift and the domestication of African bottle gourds in the Americas

    Science.gov (United States)

    Kistler, Logan; Montenegro, Álvaro; Smith, Bruce D.; Gifford, John A.; Green, Richard E.; Newsom, Lee A.; Shapiro, Beth

    2014-01-01

    Bottle gourd (Lagenaria siceraria) was one of the first domesticated plants, and the only one with a global distribution during pre-Columbian times. Although native to Africa, bottle gourd was in use by humans in east Asia, possibly as early as 11,000 y ago (BP) and in the Americas by 10,000 BP. Despite its utilitarian importance to diverse human populations, it remains unresolved how the bottle gourd came to be so widely distributed, and in particular how and when it arrived in the New World. A previous study using ancient DNA concluded that Paleoindians transported already domesticated gourds to the Americas from Asia when colonizing the New World [Erickson et al. (2005) Proc Natl Acad Sci USA 102(51):18315–18320]. However, this scenario requires the propagation of tropical-adapted bottle gourds across the Arctic. Here, we isolate 86,000 base pairs of plastid DNA from a geographically broad sample of archaeological and living bottle gourds. In contrast to the earlier results, we find that all pre-Columbian bottle gourds are most closely related to African gourds, not Asian gourds. Ocean-current drift modeling shows that wild African gourds could have simply floated across the Atlantic during the Late Pleistocene. Once they arrived in the New World, naturalized gourd populations likely became established in the Neotropics via dispersal by megafaunal mammals. These wild populations were domesticated in several distinct New World locales, most likely near established centers of food crop domestication. PMID:24516122

  10. Dried Fruit of the Luffa Sponge as a Source of Chitin for Applications as Skin Substitutes

    OpenAIRE

    Jiang, Ping-Lun; Chien, Mei-Yin; Sheu, Ming-Thau; Huang, Yi-You; Chen, Meng-Hsun; Su, Ching-Hua; Liu, Der-Zen

    2014-01-01

    LUFFACHITIN obtained from the residue of the sponge-like dried fruit of Luffa aegyptiaca was developed as a weavable skin substitute in this study. A chemical analysis revealed that LUFFACHITIN was composed of a copolymer containing N-acetyl-glucosamine (~40%) as a major monomer with a filamentary structure as demonstrated by both optical and scanning electron microscopy. The pulp-like white residue of the sponge-like dried fruit of Luffa aegyptiaca after treatment was...

  11. Four new compounds from Imperata cylindrica.

    Science.gov (United States)

    Liu, Xuan; Zhang, Bin-Feng; Yang, Li; Chou, Gui-Xin; Wang, Zheng-Tao

    2014-04-01

    Four new compounds, impecylone (1), deacetylimpecyloside (2), seguinoside K 4-methylether (3) and impecylenolide (4), were isolated from Imperata cylindrica along with two known compounds, impecyloside (5) and seguinoside K (6). Their structures were elucidated mainly by spectroscopic analyses including 1D- and 2D-NMR techniques, and the absolute configuration of 1 was confirmed by X-ray diffraction analysis. In calcium assay, the result indicated that compounds 1, 2, 4 and 5 cannot obviously inhibit the calcium peak value compared with the negative control, and suggested that the four compounds could not have anti-inflammatory activity.

  12. Nutritional value OF Bottle Gourd ( Lagenaria siceraria ) Seeds ...

    African Journals Online (AJOL)

    Whole seeds, dehulled seeds and seed coats of bottle gourd seed (Lagenaria siceraria) were analysed for their proximate, amino acids and mineral compositions. The results of the analysis showed that, whole seed has highest content of moisture (17.5 0.21%) and ash (5.80 0.83%) while dehulled had highest amount ...

  13. Genetic variability, correlation and path analysis in sponge gourd ...

    African Journals Online (AJOL)

    Windows-7

    2013-02-06

    Feb 6, 2013 ... the Middle East and India, China, Japan and Malaysia. (Porterfield, 1955). Sponge gourd is native to Tropical. Asia, probably India and South East Asia. The tender fruit is used as vegetable which is easily digestible and increase appetite when consumed (Okusanya et al.,. 1981). Besides being a vegetable ...

  14. Immediate effect of bitter gourd, ash gourd, Knol-khol juices on blood sugar levels of patients with type 2 diabetes mellitus: A pilot study

    Directory of Open Access Journals (Sweden)

    G. Selvakumar

    2017-10-01

    Conclusion: This study shows the significance of hypoglycemic effects of bitter gourd and Knol khol juices among the type 2 Diabetic patients. Hence Bitter gourd juice, Knol khol juices may be beneficial in Diabetes patients to reduce the blood glucose level.

  15. Chemical Constituents of Luffa acutangula (L.) Roxb Fruit

    Science.gov (United States)

    Suryanti, V.; Marliyana, S. D.; Astuti, I. Y.

    2017-04-01

    The phytochemical screening conducted on ethanol extract of Luffa acutangula (L.) Roxb’s fruit revealed the presence of alkaloids, saponins, carotenoids and terpenoids and the absence of flavonoids, tannins and anthraquinones. The GC-MS of the analysis L. acutangula (L.) Roxb’s fraction resulted in the identification of six compounds. The compounds that could be identified were 2,3-dihydro,3,5-dihydroxy-6-methyl-(4H)-pyran-4-one; 3,7,11,15-tetramethyl-2-hexadecen-1-ol; (3β, 20R)-cholest-5-en-3-ol; n-hexadecanoic acid; 9, 12, 15-octadecatrienoic acid methyl ester and citronellyl tiglate. The present study provides evidence that L. acutangula’s fruit contains medicinally important bioactive compounds and this justifies the possibly use of these fruits as traditional medicine for treatment of various diseases.

  16. Genome-Wide Analysis of Simple Sequence Repeats in Bitter Gourd (Momordica charantia

    Directory of Open Access Journals (Sweden)

    Junjie Cui

    2017-06-01

    Full Text Available Bitter gourd (Momordica charantia is widely cultivated as a vegetable and medicinal herb in many Asian and African countries. After the sequencing of the cucumber (Cucumis sativus, watermelon (Citrullus lanatus, and melon (Cucumis melo genomes, bitter gourd became the fourth cucurbit species whose whole genome was sequenced. However, a comprehensive analysis of simple sequence repeats (SSRs in bitter gourd, including a comparison with the three aforementioned cucurbit species has not yet been published. Here, we identified a total of 188,091 and 167,160 SSR motifs in the genomes of the bitter gourd lines ‘Dali-11’ and ‘OHB3-1,’ respectively. Subsequently, the SSR content, motif lengths, and classified motif types were characterized for the bitter gourd genomes and compared among all the cucurbit genomes. Lastly, a large set of 138,727 unique in silico SSR primer pairs were designed for bitter gourd. Among these, 71 primers were selected, all of which successfully amplified SSRs from the two bitter gourd lines ‘Dali-11’ and ‘K44’. To further examine the utilization of unique SSR primers, 21 SSR markers were used to genotype a collection of 211 bitter gourd lines from all over the world. A model-based clustering method and phylogenetic analysis indicated a clear separation among the geographic groups. The genomic SSR markers developed in this study have considerable potential value in advancing bitter gourd research.

  17. Cucurbit powdery mildew-resistant bitter gourd breeding lines reveal four races of Podosphaera xanthii in Asia

    Science.gov (United States)

    Bitter gourd (Momordica charantia L.) is a commercially and nutritionally important market vegetable in Asia cultivated mainly by smallholder farmers. Cucurbit powdery mildew (CPM) caused by Podosphaera xanthii (Px) is a nearly ubiquitous and serious fungal disease of bitter gourd. Five bitter gourd...

  18. Assessment of raw luffa as a natural hollow oleophilic fibrous sorbent for oil spill cleanup

    Directory of Open Access Journals (Sweden)

    Ola Abdelwahab

    2014-03-01

    Full Text Available Oil spills have a global concern due to its environmental and economical impact. Various commercial systems have been developed to control these spills, including the use of fibers as sorbents. However, plant biomass is renewable resource that can be converted into useful materials and energy. Luffa, an agricultural waste, was used as a sorbent material. The present study examines the adsorption capacity of raw luffa fibers for different types of oil and water pickup. The investigation revealed that the efficiency of fibers to remove crude oil from sea water was related to the surface properties of the fibers, concentration of the oil, amount of the fibers, as well as the temperature of the crude oil. The results show high sorption efficiency of luffa fibers for different kinds of oil. This sorbent also exhibited a good reusability since the decrease in sorption efficiency did not exceed 50% of the initial value after three sorption cycles.

  19. Composition, speciation and distribution of iron minerals in Imperata cylindrica.

    Science.gov (United States)

    Amils, Ricardo; de la Fuente, Vicenta; Rodríguez, Nuria; Zuluaga, Javier; Menéndez, Nieves; Tornero, Jesús

    2007-05-01

    A comparative study of the roots, rhizomes and leaves of an iron hyperaccumulator plant, Imperata cylindrica, isolated from the banks of an extreme acidic environment, using complementary techniques: Mösbauer spectroscopy (MS), X-ray diffraction (XRD), scanning electron microscopy (SEM) coupled to energy-dispersive X-ray microanalysis (EDAX) and transmission electron microscopy (TEM), has shown that two main biominerals, jarosite and ferrihydrate-ferritin, accumulate in the different tissues. Jarosite accumulates mainly in roots and rhizomes, while ferritin has been detected in all the structures. A model of iron management in I. cylindrica is presented.

  20. Increase in the free radical scavenging capability of bitter gourd by a heat-drying process.

    Science.gov (United States)

    Wei, Lu; Shaoyun, Wang; Shutao, Liu; Jianwu, Zhou; Lijing, Ke; Pingfan, Rao

    2013-12-01

    Bitter gourd (Momordica charantia Linn.) is widely regarded as one of the best remedy foods for diabetes. The positive effect of bitter gourd on diabetes has been attributed in part to the remarkable free radical scavenging activity of its boiled water extract from sun-dried fruits. It is well known that a heat process significantly influences the antioxidant activity of fresh fruits. However, the heat drying processes of bitter gourd have not been studied so far. Here, we show that the free radical scavenging capability of bitter gourd extract significantly increases after the heat drying process, while the content of flavonoids and phenols, which are generally regarded as the main antioxidant components in bitter gourd, remain unaffected. Furthermore, the content of free amino acids and the total reducing sugar were found to decrease with increasing browning index, indicating the progression of the Maillard reaction, products of which are known to possess significant antioxidant activity. Therefore, it suggests that Maillard reaction products may be the main contributors to the increase in antioxidant capability. Finally, the bitter gourd extract with the higher antioxidant activity, was shown to manifest a corresponding higher proliferation activity on NIT-1 beta-cells. These results suggest that controllable conditions in the heat-drying processing of fresh bitter gourd fruit is of significance for enhancing the total free radical scavenging capacity, beta-cell proliferation activity and possibly the anti-diabetic activity of this fruit.

  1. Evolution and loss of long-fringed petals: a case study using a dated phylogeny of the snake gourds, Trichosanthes (Cucurbitaceae

    Directory of Open Access Journals (Sweden)

    de Boer Hugo J

    2012-07-01

    Full Text Available Abstract Background The Cucurbitaceae genus Trichosanthes comprises 90–100 species that occur from India to Japan and southeast to Australia and Fiji. Most species have large white or pale yellow petals with conspicuously fringed margins, the fringes sometimes several cm long. Pollination is usually by hawkmoths. Previous molecular data for a small number of species suggested that a monophyletic Trichosanthes might include the Asian genera Gymnopetalum (four species, lacking long petal fringes and Hodgsonia (two species with petals fringed. Here we test these groups’ relationships using a species sampling of c. 60% and 4759 nucleotides of nuclear and plastid DNA. To infer the time and direction of the geographic expansion of the Trichosanthes clade we employ molecular clock dating and statistical biogeographic reconstruction, and we also address the gain or loss of petal fringes. Results Trichosanthes is monophyletic as long as it includes Gymnopetalum, which itself is polyphyletic. The closest relative of Trichosanthes appears to be the sponge gourds, Luffa, while Hodgsonia is more distantly related. Of six morphology-based sections in Trichosanthes with more than one species, three are supported by the molecular results; two new sections appear warranted. Molecular dating and biogeographic analyses suggest an Oligocene origin of Trichosanthes in Eurasia or East Asia, followed by diversification and spread throughout the Malesian biogeographic region and into the Australian continent. Conclusions Long-fringed corollas evolved independently in Hodgsonia and Trichosanthes, followed by two losses in the latter coincident with shifts to other pollinators but not with long-distance dispersal events. Together with the Caribbean Linnaeosicyos, the Madagascan Ampelosicyos and the tropical African Telfairia, these cucurbit lineages represent an ideal system for more detailed studies of the evolution and function of petal fringes in plant

  2. Agrobacterium-mediated transformation of bottle gourd (Lagenaria siceraria Standl.).

    Science.gov (United States)

    Han, J-S; Kim, C K; Park, S H; Hirschi, K D; Mok, I- G

    2005-03-01

    We describe a procedure for producing transgenic bottle gourd plants by inoculating cotyledon explants with Agrobacterium tumefaciens strain AGL1 that carries the binary vector pCAMBIA3301 containing a glufosinate ammonium-resistance (bar) gene and the beta-D-glucuronidase (GUS) reporter gene. The most effective bacterial infection was observed when cotyledon explants of 4-day-old seedlings were co-cultivated with Agrobacterium for 6-8 days on co-cultivation medium supplemented with 0.1-0.001 mg/l L-alpha-(2-aminoethoxyvinyl) glycine (AVG). The putatively transformed shoots directly emerged at the proximal end of cotyledon explants after 2-3 weeks of culturing on selection medium containing 2 mg/l DL-phosphinothricin. These shoots were rooted after 3 weeks of culturing on half-strength MS medium containing 0.1 mg/l indole acetic acid and 1 mg/l DL-phosphinothricin. Transgenic plants were obtained at frequencies of 1.9%. Stable integration and transmission of the transgenes in T1 generation plants were confirmed by a histochemical GUS assay, polymerase chain reaction and Southern blot analyses. Genetic segregation analysis of T1 progenies showed that transgenes were inherited in a Mendelian fashion. To our knowledge, this study is the first to show Agrobacterium-mediated transformation in bottle gourd.

  3. Hierarchical chirality transfer in the growth of Towel Gourd tendrils

    Science.gov (United States)

    Wang, Jian-Shan; Wang, Gang; Feng, Xi-Qiao; Kitamura, Takayuki; Kang, Yi-Lan; Yu, Shou-Wen; Qin, Qing-Hua

    2013-01-01

    Chirality plays a significant role in the physical properties and biological functions of many biological materials, e.g., climbing tendrils and twisted leaves, which exhibit chiral growth. However, the mechanisms underlying the chiral growth of biological materials remain unclear. In this paper, we investigate how the Towel Gourd tendrils achieve their chiral growth. Our experiments reveal that the tendrils have a hierarchy of chirality, which transfers from the lower levels to the higher. The change in the helical angle of cellulose fibrils at the subcellular level induces an intrinsic torsion of tendrils, leading to the formation of the helical morphology of tendril filaments. A chirality transfer model is presented to elucidate the chiral growth of tendrils. This present study may help understand various chiral phenomena observed in biological materials. It also suggests that chirality transfer can be utilized in the development of hierarchically chiral materials having unique properties. PMID:24173107

  4. Dried fruit of the Luffa sponge as a source of chitin for applications as skin substitutes.

    Science.gov (United States)

    Jiang, Ping-Lun; Chien, Mei-Yin; Sheu, Ming-Thau; Huang, Yi-You; Chen, Meng-Hsun; Su, Ching-Hua; Liu, Der-Zen

    2014-01-01

    LUFFACHITIN obtained from the residue of the sponge-like dried fruit of Luffa aegyptiaca was developed as a weavable skin substitute in this study. A chemical analysis revealed that LUFFACHITIN was composed of a copolymer containing N-acetyl-glucosamine (~40%) as a major monomer with a filamentary structure as demonstrated by both optical and scanning electron microscopy. The pulp-like white residue of the sponge-like dried fruit of Luffa aegyptiaca after treatment was then woven into a thin, porous membrane by filtration and lyophilization as a skin substitute for conducting wound-healing study on rats. The results indicated that the LUFFACHITIN membrane showed significant wound-healing enhancement (25 days to complete healing) compared to cotton gauze (>30 days), but not inferior to that of SACCHACHITIN. Furthermore, the LUFFACHITIN membrane had advantages of having a high yield, better physical properties for fabrication, and a more attractive appearance.

  5. Dried Fruit of the Luffa Sponge as a Source of Chitin for Applications as Skin Substitutes

    Directory of Open Access Journals (Sweden)

    Ping-Lun Jiang

    2014-01-01

    Full Text Available LUFFACHITIN obtained from the residue of the sponge-like dried fruit of Luffa aegyptiaca was developed as a weavable skin substitute in this study. A chemical analysis revealed that LUFFACHITIN was composed of a copolymer containing N-acetyl-glucosamine (~40% as a major monomer with a filamentary structure as demonstrated by both optical and scanning electron microscopy. The pulp-like white residue of the sponge-like dried fruit of Luffa aegyptiaca after treatment was then woven into a thin, porous membrane by filtration and lyophilization as a skin substitute for conducting wound-healing study on rats. The results indicated that the LUFFACHITIN membrane showed significant wound-healing enhancement (25 days to complete healing compared to cotton gauze (>30 days, but not inferior to that of SACCHACHITIN. Furthermore, the LUFFACHITIN membrane had advantages of having a high yield, better physical properties for fabrication, and a more attractive appearance.

  6. Neuroprotective 2-(2-phenylethyl)chromones of Imperata cylindrica.

    Science.gov (United States)

    Yoon, Jeong Seon; Lee, Mi Kyeong; Sung, Sang Hyun; Kim, Young Choong

    2006-02-01

    Bioactivity-guided fractionation of the methanolic extract of the rhizomes of Imperata cylindrica afforded a new compound, 5-hydroxy-2-(2-phenylethyl)chromone (1), together with three known compounds, 5-hydroxy-2-[2-(2-hydroxyphenyl)ethyl]chromone (2), flidersiachromone (3), and 5-hydroxy-2-styrylchromone (4). Among these four compounds, 1 and 2 showed significant neuroprotective activity against glutamate-induced neurotoxicity in primary cultures of rat cortical cells.

  7. A new lignan glycoside from the rhizomes of Imperata cylindrica.

    Science.gov (United States)

    Lee, Dae-Young; Han, Kyung-Min; Song, Myoung-Chong; Lee, Do-Gyeong; Rho, Yeong-Deok; Baek, Nam-In

    2008-01-01

    A new lignan glycoside, 6-acetyl-1-[1,3-(4,4'-dihydroxy-3,3'-dimethoxy-beta-truxinyl)-beta-d-fructofuranosyl]-alpha-d-glucopyranoside (1), named impecyloside, was isolated from the rhizomes of Imperata cylindrica. The structure of the compound was determined by spectroscopic data including FABMS, UV, IR, 1H NMR and 13C NMR (DEPT) and 2D NMR (COSY, HSQC, HMBC).

  8. Cogongrass ( Imperata cylindrica ) affects above- and belowground processes in commercial loblolly pine ( Pinus taeda ) stands

    Science.gov (United States)

    Adam N. Trautwig; Lori G. Eckhardt; Nancy J. Loewenstein; Jason D. Hoeksema; Emily A. Carter; Ryan L. Nadel

    2017-01-01

    Cogongrass (Imperata cylindrica), an invasive grass species native to Asia, has been shown to reduce tree vigor in loblolly pine (Pinus taeda) plantations, which comprise more than 50% of growing stock in commercial forests of the United States. I. cylindrica produces exudates with possible allelopathic effects that may influence abundance of P. taeda symbionts, such...

  9. Effect of drying methods on total antioxidant capacity of bitter gourd (momordica charantia) fruit

    Science.gov (United States)

    Tan, Ee Shian; Abdullah, Aminah; Maskat, Mohammad Yusof

    2013-11-01

    The effect of thermal and non-thermal drying methods on hydrophilic and lipophilic antioxidant capacities of bitter gourd fruit was investigated in this study. The bitter gourd fruits were dried by following methods: (i) oven drying 40°C, (ii) oven drying 50°C, (iii) oven drying 60°C, (iv) microwave drying (medium low power), (v) microwave drying (medium power) and (vi) freeze drying. Pure acetone and hexane were used to extract the hydrophilic and lipophilic antioxidant compounds from dried bitter gourd fruits. Freeze dried extracts reported to have highest values in DPPH scavenging activity (hydrophilic and lipophilic fractions), FRAP (lipophilic fraction) and TPC (hydrophilic and lipophilic fraction). Thermal drying slightly increased the values of DPPH scavenging activity, FRAP and TPC assays for hydrophilic extracts. Results concluded bitter gourd fruit is a good source of natural antioxidants and its total antioxidant quality was most preserved by freeze drying. Additionally, the higher value reported in DPPH scavenging activity, FRAP and TPC assays for lipophilic extracts than the hydrophilic extracts suggested that the lipophilic antioxidant compounds of bitter gourd fruit might possess stronger antioxidant power than its counterpart.

  10. Preliminary evaluation of resistance to powdery mildew (Podosphaera xanthii) in AVRDC collections of bitter gourd (Momordica charantia L.)

    Science.gov (United States)

    Bitter gourd (Momordica charantia L.) is an important market vegetable in Asia, where it is also used in folk medicine to manage type 2 diabetes. Powdery mildew caused by Podosphaera xanthii is a serious fungal disease of bitter gourd and yield losses of up to 50% have been reported. After observi...

  11. First Report of Anthracnose on Bitter Gourd Caused by Colletotrichum gloeosporioides in Korea

    Directory of Open Access Journals (Sweden)

    Ju-Hee Kim

    2015-03-01

    Full Text Available Anthracnose occurred in bitter gourd grown in Jeongup areas of Korea in 2011. Anthracnose of bitter gourd appeared as dark brown circular spots on naturally infected leaves and fruits. The symptoms of infected leaves and fruits were small brown to dark brown spots and gradually enlarged to larger cylindrical dark brown lesions. The causal fungus of anthracnose isolated from the diseased plants was identified as Colletotrichum gloeosporioides based on the morphological and cultural characteristics and ITS rDNA sequence analysis. All isolates of C. gloeosporioides produced symptoms on the host leaves by artificial inoculation. This is the first report of anthracnose on bitter gourd caused by C. gloeosporioides in Korea.

  12. Evaluation of the Natural Adsorbent Luffa cylindrical for the Removal of Cadmium (II from Aqueous Environments

    Directory of Open Access Journals (Sweden)

    Ali Shahidi

    2015-07-01

    Full Text Available Contamination of water resources with heavy metals has nowadays become a global problem that requires continuous monitoring and control. An annual quantity of about 25,000 tons of cadmium is normally discharged into the environment. The objective of this study was to investigate cadmium removal from aqueous environments with the natural Luffa sorbent using equilibrium experiments consisting of the batch flow mode and the continuous flow mode reactors with a fixed bed column. The effects of pH, contact time, adsorbent dosage, and initial solution concentration on the uptake of metal ions by the adsorbent in the batch operation were examined. Langmuir and Freundlich isotherm models were used to investigate the adsorption equilibrium. The adsorption behavior of Cd(II ions fitted both isotherms but followed the Langmuir isotherm most precisely (R2=0.987, with a maximum adsorption capacity of 6.711 mg/g. Cadmium removal in the continuous flow mode using a fixed bed column was also studied. The effecte of operating parameters such as flow rate and inlet Cd(II concentration on the sorption characteristics of Luffa were determined by assessing the breakthrough curve. The data confirmed that the total amount of sorbet Cd(II and equilibrium Cd(II uptakes decreased with increasing flow rate but increased with increasing inlet Cd(II concentration. The Adams–Bohart model was applied to the experimental data to predict the breakthrough curves and to determine the characteristic parameters of the column useful for process design. Results showed that the natural Luffa absorbent was capable of efficiently removing cadmium from water.

  13. Draft genome sequence of bitter gourd (Momordica charantia), a vegetable and medicinal plant in tropical and subtropical regions.

    Science.gov (United States)

    Urasaki, Naoya; Takagi, Hiroki; Natsume, Satoshi; Uemura, Aiko; Taniai, Naoki; Miyagi, Norimichi; Fukushima, Mai; Suzuki, Shouta; Tarora, Kazuhiko; Tamaki, Moritoshi; Sakamoto, Moriaki; Terauchi, Ryohei; Matsumura, Hideo

    2017-02-01

    Bitter gourd (Momordica charantia) is an important vegetable and medicinal plant in tropical and subtropical regions globally. In this study, the draft genome sequence of a monoecious bitter gourd inbred line, OHB3-1, was analyzed. Through Illumina sequencing and de novo assembly, scaffolds of 285.5 Mb in length were generated, corresponding to ∼84% of the estimated genome size of bitter gourd (339 Mb). In this draft genome sequence, 45,859 protein-coding gene loci were identified, and transposable elements accounted for 15.3% of the whole genome. According to synteny mapping and phylogenetic analysis of conserved genes, bitter gourd was more related to watermelon (Citrullus lanatus) than to cucumber (Cucumis sativus) or melon (C. melo). Using RAD-seq analysis, 1507 marker loci were genotyped in an F2 progeny of two bitter gourd lines, resulting in an improved linkage map, comprising 11 linkage groups. By anchoring RAD tag markers, 255 scaffolds were assigned to the linkage map. Comparative analysis of genome sequences and predicted genes determined that putative trypsin-inhibitor and ribosome-inactivating genes were distinctive in the bitter gourd genome. These genes could characterize the bitter gourd as a medicinal plant. © The Author 2016. Published by Oxford University Press on behalf of Kazusa DNA Research Institute.

  14. The ribosome-inactivating, antiproliferative and teratogenic activities and immunoreactivities of a protein from seeds of Luffa aegyptiaca (Cucurbitaceae).

    Science.gov (United States)

    Ng, T B; Chan, W Y; Yeung, H W

    1993-05-01

    1. The protein isolated from Luffa aegyptiaca seeds was capable of inhibiting protein synthesis in a rabbit reticulocyte lysate system and [3H]thymidine uptake by mouse melanoma (B16) cells. 2. It also adversely affected the development of mouse embryos in culture. 3. In enzyme-linked immunosorbent assay it reacted with antisera raised against other ribosome-inactivating proteins.

  15. Effect of gamma rays on morphogenesis from different explants of bitter gourd (Momordica charantia L.)

    International Nuclear Information System (INIS)

    Mustafa, M.D.; Rao, A.M.; Nirmala, N.; Mallaiah, B.

    1993-01-01

    Different doses of irradiation were used on seeds of bitter gourd to elucidate their effect of morphogenetic response. Lower doses like 2-4 kRs favoured in multiple shoots induction and higher doses proved as the lethal. (author). 13 refs., 1 tab., 1 fig

  16. De novo assembly and characterization of the transcriptome, and development of SSR markers in wax gourd (Benicasa hispida.

    Directory of Open Access Journals (Sweden)

    Biao Jiang

    Full Text Available BACKGROUND: Wax gourd is a widely used vegetable of Cucuribtaceae, and also has important medicinal and health values. However, the genomic resources of wax gourd were scarcity, and only a few nucleotide sequences could be obtained in public databases. METHODOLOGY/PRINCIPAL FINDINGS: In this study, we examined transcriptome in wax gourd. More than 44 million of high quality reads were generated from five different tissues of wax gourd using Illumina paired-end sequencing technology. Approximately 4 Gbp data were generated, and de novo assembled into 65,059 unigenes, with an N50 of 1,132 bp. Based on sequence similarity search with known protein database, 36,070 (55.4% showed significant similarity to known proteins in Nr database, and 24,969 (38.4% had BLAST hits in Swiss-Prot database. Among the annotated unigenes, 14,994 of wax gourd unigenes were assigned to GO term annotation, and 23,977 were found to have COG classifications. In addition, a total of 18,713 unigenes were assigned to 281 KEGG pathways. Furthermore, 6,242 microsatellites (simple sequence repeats were detected as potential molecular markers in wax gourd. Two hundred primer pairs for SSRs were designed for validation of the amplification and polymorphism. The result showed that 170 of the 200 primer pairs were successfully amplified and 49 (28.8% of them exhibited polymorphisms. CONCLUSION/SIGNIFICANCE: Our study enriches the genomic resources of wax gourd and provides powerful information for future studies. The availability of this ample amount of information about the transcriptome and SSRs in wax gourd could serve as valuable basis for studies on the physiology, biochemistry, molecular genetics and molecular breeding of this important vegetable crop.

  17. Luffa echinata Roxb.-A review on its ethanomedicinal, phytochemical and pharmacological perspective

    Directory of Open Access Journals (Sweden)

    Anuj Modi

    2014-02-01

    Full Text Available Luffa echinata Roxb. (Cucurbitaceae is a spreading climbing herb of tremendous medicinal importance, distributed throughout Pakistan, India, Bangladesh and Northern Tropical Africa. Traditionally various parts of the plant are being used for the treatment of different ailments such as jaundice, intestinal colic, enlargement of liver and spleen, leprosy, diabetes, bronchitis, nephritis, rheumatism, cirrhosis, dropsy, anthelmintic, stomach ache, snake bite, dog bite, fever, diarrohea and hemorrhoid disorder. The plant also possesses antioxidant, analgesic, anti-inflammatory, antidepressant, anxiolytic, antiepileptic, hepatoprotective, antibacterial, antifungal, antiulcer and anticancer activity. Research has been carried out using different techniques to support most of these claims. This review is an attempt to compile an up-to-date data on its ethanomedicinal, phytochemical and pharmacological perspective.

  18. Effect of bitter gourd and spent turmeric on glycoconjugate metabolism in streptozotocin-induced diabetic rats.

    Science.gov (United States)

    Vijayalakshmi, B; Kumar, G Suresh; Salimath, P V

    2009-01-01

    Changes in glycoconjugate metabolism during the development of diabetic complications and their modulation by feeding bitter gourd and spent turmeric as fiber-rich source. This was studied by measuring the contents of total sugar, uronic acid, amino sugar, and sulfate in the streptozotocin-induced diabetic rats. Total sugar content decreased in liver, spleen, and brain, while an increase was observed in heart and lungs. Uronic acid content in liver, spleen, and brain decreased, and marginal increase was observed in testis. Amino sugar content decreased in liver, spleen, lungs and heart during diabetes, and augmentation was observed to different extents. Decrease in sulfation of glycoconjugates was observed in liver, spleen, lungs and heart during diabetes and was significantly ameliorated by bitter gourd and spent turmeric, except brain. Protein content decreased in liver, while an increase was observed in brain. The studies clearly showed alteration in glycoconjugate metabolism during diabetes and amelioration to different extents by feeding bitter gourd and spent turmeric. Improvement is due to slow release of glucose by fiber in the gastrointestinal track and short-chain fatty acid production from fiber by colon microbes.

  19. Bitter gourd reduces elevated fasting plasma glucose levels in an intervention study among prediabetics in Tanzania.

    Science.gov (United States)

    Krawinkel, Michael B; Ludwig, Christine; Swai, Mark E; Yang, Ray-Yu; Chun, Kwok Pan; Habicht, Sandra D

    2018-04-24

    Impaired glucose tolerance and diabetes mellitus have become major health issues even in non-industrialized countries. As access to clinical management is often poor, dietary interventions and alternative medicines are required. For bitter gourd, Momordica charantia L., antidiabetic properties have been claimed. The main objective of the intervention study was to assess antidiabetic effects of daily bitter gourd consumption of 2.5g powder over the course of eight weeks among prediabetic individuals. In a randomized placebo-controlled single blinded clinical trial, 52 individuals with prediabetes were studied after consuming a bitter gourd or a cucumber juice. For reducing the impact of between subject differences in the study population, a crossover design was chosen with eight weeks for each study period and four weeks washout in between. Fasting plasma glucose was chosen as the primary outcome variable. Comparing the different exposures, the CROS analysis (t=-2.23, p=0.031, r=0.326) revealed a significant difference in the change of FPG of 0.31mmol/L (5.6mg/dL) with a trend (R 2 =0,42387). The number of 44 finally complete data sets achieved a power of 0.82, with a medium-to-large effect size (Cohen's d 0.62). The effect was also proven by a general linear mixed model (estimate 0.31; SE: 0.12; p: 0.01; 95%CI: 0.08; 0.54). Not all participants responded, but the higher the initial blood glucose levels were, the more pronounced the effect was. No serious adverse effects were observed. Bitter gourd supplementation appeared to have benefits in lowering elevated fasting plasma glucose in prediabetes. The findings should be replicated in other intervention studies to further investigate glucose lowering effects and the opportunity to use bitter gourd for dietary self-management, especially in places where access to professional medical care is not easily assured. Copyright © 2018 The Authors. Published by Elsevier B.V. All rights reserved.

  20. Chemical Composition, Antioxidant, and Antimicrobial Activities of Lichen Umbilicaria cylindrica (L. Delise (Umbilicariaceae

    Directory of Open Access Journals (Sweden)

    Nedeljko T. Manojlovic

    2012-01-01

    Full Text Available The phytochemical analysis of methanol and chloroform extracts of Umbilicaria cylindrica was determined by HPLC-UV method. The predominant phenolic compound in both extracts was depsidone, salazinic acid (1. Besides salazinic acid, the tested extracts of U. cylindrica contain norstictic acid (2, methyl-β-orcinol carboxylate (3, ethyl haematommate (4, atranorin (5, and usnic acid (6, in different amounts and relations. The lichen extracts showed comparable and strong antioxidant activity, exhibited higher DPPH and hydroxyl radical scavengings, chelating activity, and inhibitory activity towards lipid peroxidation. The lichen extracts demonstrated important antimicrobial activity against eight strains with MIC values from 15.62 to 62.50 μg/mL. This is the first report of the detail chemical composition and antioxidant activity of the lichen Umbilicaria cylindrica, and the results suggest that this lichen can be used as a new source of the natural antioxidants and the substances with antimicrobial features.

  1. Response of the Invasive Grass Imperata cylindrica to Disturbance in the Southeastern Forests, USA

    Directory of Open Access Journals (Sweden)

    Shibu Jose

    2012-09-01

    Full Text Available Imperata cylindrica is an invasive plant species that threatens diversity and forest productivity in southeastern ecosystems. We examined the effects of disturbance events, particularly fire and hurricane/salvage harvesting, to determine the effects on I. cylindrica abundance in longleaf pine (Pinus palustris forests in the Florida panhandle. Areas that were burned or had greater biomass removal following a hurricane had a greater number of I. cylindrica patches and larger patch size. These results highlight the importance of disturbance events on expanding invasive species populations in this region and are likely applicable for other invasive species as well. Monitoring and treatment should follow disturbance events to ensure that invasive species populations do not exceed unmanageable levels.

  2. Adsorpsi Pb2+ dan Zn2+ pada Biomassa Imperata cylindrica

    Directory of Open Access Journals (Sweden)

    Noer Komari

    2017-03-01

    Full Text Available Metode alternatif untuk mengatasi pencemaran logam berat adalah biosorpsi menggunakan biomassa sebagai adsorben. Telah dilakukan penelitian kajian adsorpsi campuran Pb2+ dan Zn2+ pada biomassa Imperata cylindrica sebagai adsorben. Tujuan penelitian adalah mengetahui kemampuan biomassa mengadsorpsi Pb2+ dan Zn2+. Preparasi biomassa dilakukan dengan aktivasi menggunakan asam nitrat dan amonium hidroksida. Adsorpsi dilakukan dengan sistem batch. Parameter yang diukur adalah pH optimum, waktu kontak optimum, kapasitas adsorpsi dan recovery ion logam. Analisis kadar logam dilakukan dengan menggunakan Spektrofotometer Serapan Atom (AAS. Hasil penelitian menunjukkan pH optimum adsorpsi Pb2+ dan Zn2+ masing-masing pada pH 5 dan pH 6. Waktu kontak optimum adsorpsi Pb2+ dan Zn2+ masing masing pada 40 menit dan 30 pertama. Kapasitas adsorpsi Pb2+ dan Zn2+ pada konsentrasi awal 10 ppm masing-masing adalah 90,95% dan 43,60%. Recovery Pb2+ dan Zn2+ masing-masing 84,45% dan 57,13%.

  3. Development of Insertion and Deletion Markers for Bottle Gourd Based on Restriction Site-associated DNA Sequencing Data

    Directory of Open Access Journals (Sweden)

    Xinyi WU

    2017-01-01

    Full Text Available Bottle gourd is an important cucurbit crop worldwide. To provide more available molecular markers for this crop, a bioinformatic approach was employed to develop insertion–deletions (InDels markers in bottle gourd based on restriction site-associated DNA sequencing (RAD-Seq data. A total of 892 Indels were predicted, with the length varying from 1 bp to 167 bp. Single-nucleotide InDels were the predominant types of InDels. To validate these InDels, PCR primers were designed from 162 loci where InDels longer than 2 bp were predicated. A total of 112 InDels were found to be polymorphic among 9 bottle gourd accessions under investigation. The rate of prediction accuracy was thus at a high level of 72.7%. DNA fingerprinting for 4 cultivars were performed using 8 selected Indels markers, demonstrating the usefulness of these markers.

  4. Identification and Validation of a New Male Sex-Specific ISSR Marker in Pointed Gourd (Trichosanthes dioica Roxb.

    Directory of Open Access Journals (Sweden)

    Sinchan Adhikari

    2014-01-01

    Full Text Available The aim of the present study was to develop a genetic sex marker for the pointed gourd (Trichosanthes dioica Roxb. to allow gender determination at any stage in the life cycle. Screening of genomic DNA with intersimple sequence repeat (ISSR primers was used to discover sex-specific touch-down polymerase chain reaction (Td-PCR amplification products. Using pooled DNA from male and female genotypes and 42 ISSR primers, a putative male specific marker (~550 bp was identified. DNA marker specific to male is an indication of existence of nonepigenetic factors involved in gender development in pointed gourd. The ISSR technique has proved to be a reliable technique in gender determination of pointed gourd genotypes at the seedling phenophase. The sex marker developed here could also be used as a starting material towards sequence characterization of sex linked genes for better understanding the developmental as well as evolutionary pathways in sexual dimorphism.

  5. Two Paralogous Genes Encoding Auxin Efflux Carrier Differentially Expressed in Bitter Gourd (Momordica charantia

    Directory of Open Access Journals (Sweden)

    Yi-Li Li

    2017-11-01

    Full Text Available The phytohormone auxin regulates various developmental programs in plants, including cell growth, cell division and cell differentiation. The auxin efflux carriers are essential for the auxin transport. To show an involvement of auxin transporters in the coordination of fruit development in bitter gourd, a juicy fruit, we isolated novel cDNAs (referred as McPIN encoding putative auxin efflux carriers, including McPIN1, McPIN2 (allele of McPIN1 and McPIN3, from developing fruits of bitter gourd. Both McPIN1 and McPIN3 genes possess six exons and five introns. Hydropathy analysis revealed that both polypeptides have two hydrophobic regions with five transmembrane segments and a predominantly hydrophilic core. Phylogenetic analyses revealed that McPIN1 shared the highest homology to the group of Arabidopsis, cucumber and tomato PIN1, while McPIN3 belonged to another group, including Arabidopsis and tomato PIN3 as well as PIN4. This suggests different roles for McPIN1 and McPIN3 in auxin transport involved in the fruit development of bitter gourd. Maximum mRNA levels for both genes were detected in staminate and pistillate flowers. McPIN1 is expressed in a particular period of early fruit development but McPIN3 continues to be expressed until the last stage of fruit ripening. Moreover, these two genes are auxin-inducible and qualified as early auxin-response genes. Their expression patterns suggest that these two auxin transporter genes play a pivotal role in fruit setting and development.

  6. Polyploidization in Heuchera cylindrica (Saxifragaceae) did not result in a shift in climatic requirements.

    Science.gov (United States)

    Godsoe, William; Larson, Megan A; Glennon, Kelsey L; Segraves, Kari A

    2013-03-01

    Polyploidization is a key factor involved in the diversification of plants. Although polyploids are commonly found, there remains controversy on the mechanisms that lead to their successful establishment. One major problem that has been identified is that newly formed polyploids lack mates of the appropriate ploidy level and may experience severely reduced fertility due to nonproductive intercytotype crosses. Niche differentiation has been proposed as a primary mechanism that can alleviate this reproductive disadvantage and facilitate polyploid establishment. Here we test whether the establishment of tetraploid cytotypes of Heuchera cylindrica (Saxifragaceae) is consistent with climatic niche differentiation. • We use a combination of field surveys, flow cytometry and species distribution models to: (1) examine the distribution of diploid and tetraploid cytotypes; and (2) determine whether tetraploid Heuchera cylindrica occupy climates that differ from those of its diploid progenitors. • The geographic distributions of diploid and tetraploid cytotypes are largely allopatric as an extensive survey of 636 plants from 43 locations failed to detect any populations with both cytotypes. Although diploids and tetraploids occur in different geographic areas, polyploid Heuchera cylindrica occur almost exclusively in environments that are predicted to be suitable to diploid populations. • Climatic niche differentiation does not explain the geographic distribution of tetraploid Heuchera cylindrica. We propose instead that tetraploid lineages were able to establish by taking advantage of glacial retreat and expanding into previously unoccupied sites.

  7. Improving local technologies to manage speargrass (Imperata cylindrica) in southern Benin

    NARCIS (Netherlands)

    Vissoh, P.V.; Kuyper, T.W.; Gbehounou, G.; Hounkonnou, D.; Ahanchede, A.; Röling, N.G.

    2008-01-01

    Speargrass (Imperata cylindrica) is difficult to control in the tropics. Farmers allocate most of their time and labour to weeding speargrass. We investigated in a joint experiment concluded with farmers, how effectively grain legumes suppress speargrass, and the relationships between speargrass

  8. Evaluating hybridization as a potential facilitator of successful cogongrass (Imperata cylindrica) invasion in Florida, USA

    Science.gov (United States)

    Rima Lucardi; L.E. Wallace; G.N. Ervin

    2014-01-01

    Interspecific hybridization is cited as one potential mechanism for increased invasiveness, particularly among some grass species. In the southeastern United States, the successful invasion of cogongrass (Imperata cylindrica) has sometimes been attributed to hybridization with the previously naturalized Imperata brasiliensis. This...

  9. Use of Glyphosate and Imazapyr for Cogongrass (Imperata cylindrica) management in southern pine forests

    Science.gov (United States)

    Patrick J. Minogue; James H. Miller; Dwight K. Lauer

    2012-01-01

    Cogongrass (Imperata cylindrica [L.] P. Beauv. var. major [Nees] C.E. Hubb) is one of the most invasive perennial grasses worldwide and has progressively infested managed and natural habitats in the mid-South over the past 100 years. To extend past research toward the goal of eradication on forested sites, we tested the most effective herbicides (glyphosate and...

  10. Refining rates and treatment sequences for cogongrass (Imperata Cylindrica) control with imazapyr and glyphosate

    Science.gov (United States)

    James H. Miller

    2001-01-01

    Cogongrass (Imperata cylindrica (L.) Palisot) is an aggressive invasive plant on all continents and has been spreading northward in the Southeast's Gulf Coastal Plain and into Florida for 80 years. It spreads by prolific windblown seeds and with movement of infested soils while infestations increase in size and become more dense by rhizome...

  11. Ecotype variability and edaphic characteristics for cogongrass (Imperata cylindrica) populations in Mississippi

    Science.gov (United States)

    Cogongrass (Imperata cylindrica) is a highly invasive perennial grass in the southeastern United States and is found on all continents except Antartica. It has been reported from a wide array of habitats; however, soils from cogongrass populations have never been characterized. Live cogongrass pla...

  12. Right-of-way management: A key to controlling the spread of cogograss (Imperata cylindrica)

    Science.gov (United States)

    W.H. Faircloth; M.G. Patterson; James H. Miller; D.H. Teem

    2004-01-01

    Cogongrass [Imperata cylindrica(L.) Beauv.] is an undesired species on highway rights-of-way (ROWS) due to its displacenent of native and/or more manageable grasses, unsightly growth characteristic, and propensity for fire. Fire not only poses a danger to motorists but could cause property loss to adjoining landowners. Most importantly, ROWS provide...

  13. New varieties of Magnolia biondii and Magnolia cylindrica (Magnoliaceae) in China

    NARCIS (Netherlands)

    Wang, Y.L.; Ejder, E.; Yang, J.F.; Kang, Y.X.; Ye, W.; Zhang, S.Z.

    2013-01-01

    Magnolia biondii var. purpurascens var. nov. and Magnolia cylindrica var. purpurascens var. nov. (Magnoliaceae) are described as two new varieties endemic to China. Magnolia biondii var. purpurascens is mainly restricted to forests of Shaanxi and SE Gansu provinces. It differs from the typical

  14. Fabrication of porous bioceramics for bone tissue applications using luffa cylindrical fibres (LCF as template

    Directory of Open Access Journals (Sweden)

    Mazen Alshaaer

    2017-03-01

    Full Text Available Three-dimensionally ordered macroporous biomaterials containing hydroxyapatite were synthesized using natural luffa cylindrical fibres (with diameter of 100–400 µm as templates. The preliminary evaluation of this novel method for production of porous bioceramics showed promising potential applications in bone tissue engineering. The produced bioceramics were subjected to microstructural, physical, mechanical, and in vitro characterisation. Mercury intrusion porosimetry, supported by SEM analysis, showed the presence of bimodal porosity (smaller pores with diameters of 10 to 30 µm and cylindrical macropores with diameters from 100 to 400 µm and 60% of the interconnected porosity. These porous calcium phosphate ceramics proved to be bioactive and exhibited mechanical properties comparable to those of natural spongy bones with compressive strength up to 3 MPa and elastic modulus in compression around 0.05 GPa. In vitro characterization of the porous ceramics showed cells attaching to the apatite crystals that make up the scaffold matrix. Cell adhesion resulted in elongated and highly stretched cells within the macropores with focal adhesion points on the scaffolds. Moreover, the cells adhered to the calcium phosphate cement (CPC and developed cytoplasmic extensions as shown by SEM imagery. Their proliferation in the scaffolds in culture demonstrates that the scaffold architecture is suitable for Mesenchymal stem cells seeding and growth.

  15. Comparison study on biosynthesis of silver nanoparticles using fresh and hot air oven dried IMPERATA CYLINDRICA leaf

    Science.gov (United States)

    Najmi Bonnia, Noor; Fairuzi, Afiza Ahmad; Akhir, Rabiatuladawiyah Md.; Yahya, Sabrina M.; Rani, Mohd Azri Ab; Ratim, Suzana; Rahman, Norafifah A.; Akil, Hazizan Md

    2018-01-01

    The perennial rhizomatous grass; Imperata cylindrica (I. cylindrica) has been reported rich in various phytochemicals. In present study, silver nanoparticles were synthesized from aqueous leaf extract of I. cylindrica at two different leaf conditions; fresh leaves and hot-air oven dried leaves. Biosynthesized silver nanoparticles were characterized by UV-visible spectroscopy, field emission scanning electron microscopy (FESEM) and Fourier transform infrared spectroscopy (FTIR). Maximum absorption was recorded between 400 nm to 500 nm. FESEM analysis revealed that the silver nanoparticles predominantly form spherical shapes. The particles sizes were ranging from 22-37 nm. The elemental composition of the synthesized silver nanoparticles was confirmed by using energy dispersive X-ray spectroscopy (EDX) analysis. Fourier transform infrared spectroscopy (FTIR) confirmed the reducing and stabilizing actions came from biomolecules associated with I. cylindrica leaf extract. Thus in this investigation, an environmentally safe method to synthesized silver nanoparticles using local plant extract was successfully established.

  16. Transferability of Cucurbita SSR markers for genetic diversity assessment of Turkish bottle gourd (Lagenaria siceraria) genetic resources

    Science.gov (United States)

    The genetic diversity present in crop landraces represents a valuable genetic resource for breeding and genetic studies. Bottle gourd (Lagenaria siceraria) landraces in Turkey are highly genetically diverse. However, the limited genomic resources available for this crop hinder the molecular characte...

  17. First Complete Genome Sequence of Papaya ringspot virus-W Isolated from a Gourd in the United States.

    Science.gov (United States)

    Ali, Akhtar

    2017-01-12

    In the United States, the Papaya ringspot virus was first reported from papaya in Florida in 1949. Here, we determined the first complete genome sequence (10,302 nucleotides) of a Papaya ringspot virus-W isolate, which was collected from a commercial field of gourd in Tulsa, OK. Copyright © 2017 Ali.

  18. A preliminary report on the genetic variation in pointed gourd (Trichosanthes dioica Roxb.) as assessed by random amplified polymorphic DNA.

    Science.gov (United States)

    Adhikari, S; Biswas, A; Bandyopadhyay, T K; Ghosh, P D

    2014-06-01

    Pointed gourd (Trichosanthes dioica Roxb.) is an economically important cucurbit and is extensively propagated through vegetative means, viz vine and root cuttings. As the accessions are poorly characterized it is important at the beginning of a breeding programme to discriminate among available genotypes to establish the level of genetic diversity. The genetic diversity of 10 pointed gourd races, referred to as accessions was evaluated. DNA profiling was generated using 10 sequence independent RAPD markers. A total of 58 scorable loci were observed out of which 18 (31.03%) loci were considered polymorphic. Genetic diversity parameters [average and effective number of alleles, Shannon's index, percent polymorphism, Nei's gene diversity, polymorphic information content (PIC)] for RAPD along with UPGMA clustering based on Jaccard's coefficient were estimated. The UPGMA dendogram constructed based on RAPD analysis in 10 pointed gourd accessions were found to be grouped in a single cluster and may represent members of one heterotic group. RAPD analysis showed promise as an effective tool in estimating genetic polymorphism in different accessions of pointed gourd.

  19. Proteomic analysis of heat treated bitter gourd (Momordica charantia L. var. Hong Kong Green) using 2D-DIGE.

    Science.gov (United States)

    Ng, Zhi Xiang; Chua, Kek Heng; Kuppusamy, Umah Rani

    2014-04-01

    This study aimed to investigate the changes in the proteome of bitter gourd prior to and after subjecting to boiling and microwaving. A comparative analysis of the proteome profiles of raw and thermally treated bitter gourds was performed using 2D-DIGE. The protein content and number of protein spots in raw sample was higher when compared to the cooked samples. Qualitative analysis revealed that 103 (boiled sample) and 110 (microwaved sample) protein spots were up regulated whereas 120 (boiled sample) and 107 (microwaved sample) protein spots were down regulated. Ten protein spots with the highest significant fold change in the cooked samples were involved in carbohydrate/energy metabolisms and stress responses. Small heat shock proteins, superoxide dismutase, quinone oxidoreductase, UDP-glucose pyrophosphorylase and phosphoglycerate kinase play a role in heat-stress-mediated protection of bitter gourd. This study suggests that appropriate heat treatment (cooking methods) can lead to induction of selected proteins in bitter gourd. Copyright © 2013 Elsevier Ltd. All rights reserved.

  20. Drought tolerance of selected bottle gourd [Lagenaria siceraria (Molina) Standl.] landraces assessed by leaf gas exchange and photosynthetic efficiency.

    Science.gov (United States)

    Mashilo, Jacob; Odindo, Alfred O; Shimelis, Hussein A; Musenge, Pearl; Tesfay, Samson Z; Magwaza, Lembe S

    2017-11-01

    Successful cultivation of bottle gourd in arid and semi-arid areas of sub-Saharan Africa and globally requires the identification of drought tolerant parents for developing superior genotypes with increased drought resistance. The objective of this study was to determine the level of drought tolerance among genetically diverse South African bottle gourd landraces based on leaf gas exchange and photosynthetic efficiency and identify promising genotypes for breeding. The responses of 12 bottle gourd landraces grown in glasshouse under non-stressed (NS) and drought-stressed (DS) conditions were studied. A significant genotype x water regime interaction was observed for gs, T, A, A/C i , IWUE, WUE ins , F m ', F v '/F m ', Ф PSII , qP, qN, ETR, ETR/A and AES indicating variability in response among the studied bottle gourd landraces under NS and DS conditions. Principal component analysis identified three principal components (PC's) under drought stress condition contributing to 82.9% of total variation among leaf gas exchange and chlorophyll fluorescence parameters measured. PC1 explained 36% of total variation contributed by gs, T, F 0 ', F m ', F v '/F m ' and qN, while PC2 explained 28% of the variation and highly correlated with A, A/C i , IWUE, WUE ins ETR/A and AES. PC3 explained 14% of total variation contributed by Ф PSII , qP and ETR. Principal biplot analysis allowed the identification of drought tolerant genotypes such as BG-27, BG-48, BG-58, BG-79, BG-70 and BG-78 which were grouped based on high gs, A, F m 'F v '/F m ', qN, ETR/A and AES under DS condition. The study suggests that the identified physiological traits could be useful indicators in the selection of bottle gourd genotypes for increased drought tolerance. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  1. Foraging dynamics and pollination efficiency of Apis mellifera and Xylocopa olivacea on Luffa aegyptiaca Mill (Cucurbitaceae in southern Ghana

    Directory of Open Access Journals (Sweden)

    Mensah, Ben

    2011-05-01

    Full Text Available As a result of different levels of pollination efficiency of pollinators, knowledge on appropriate pollinators of a plant has become important, especially in the management and conservation of both the pollinators and the plants. In this study, the pollination efficiency of Apis mellifera and Xylocopa olivacea, important pollinators of Luffa aegyptiaca, were assessed in the southern coastal part of Ghana from June 2009 to September 2010. Pollination efficiency of A. mellifera and X. olivacea was estimated in terms of fruit set and fruit size. Further, data on daily and seasonal nectar dynamics of Luffa aegyptiaca were collected. In the early mornings (0600-0700, X. olivacea was the most frequent visitor (0.47 min-1 on the female flowers compared to A. mellifera (0.13 min-1. The mean nectar (sugar concentration in the dry season was 36.58 ± 0.55 %, which was higher than the 34.03 ± 0.38 % obtained for the rainy season (F = 14.986; df = 2; P χ2 = 14.33, df = 1, P X. olivacea had a mean weight of 428.7g and were 1.5 times heavier than fruits from flowers visited by A. mellifera (286.76 g. X. olivacea was more efficient than A. mellifera in terms of number of fruit set per single visit. This study has provided some knowledge on pollination ecology of L. aegyptiaca, which can be exploited to improve fruit production in commercially grown vine crops.

  2. Characterization of 21 microsatellite markers from cogongrass, Imperata cylindrica (Poaceae), a weed species distributed worldwide.

    Science.gov (United States)

    Chiang, Yu-Chung; Tsai, Chi-Chu; Hsu, Tsai-Wen; Chou, Chang-Hung

    2012-11-01

    Microsatellite loci were developed from Imperata cylindrica, a traditional medicinal herb in Asia and among the top 10 worst invasive weeds in the world, to aid in the identification of the limits of asexual clonal individuals. A total of 21 microsatellite markers, including 18 polymorphic and three monomorphic loci, were developed from I. cylindrica using a magnetic bead enrichment protocol. The primers amplified dinucleotide, trinucleotide, and complex repeats. The number of alleles ranged from one to 19 per locus, with an observed heterozygosity ranging from 0.09 to 1.00. Several loci deviated significantly from the within-population Hardy-Weinberg equilibrium as a result of asexual clonal reproduction. These polymorphic markers should be useful tools in further studies on the identification of the range of clonal reproduction units and the selection and classification of the medicinal cultivar.

  3. PENGARUH PENINGKATAN SUHU TERHADAP KELIMPAHAN ZOOXANTHELLAE PADA KARANG PORITES CYLINDRICA DALAM BAK TERKONTROL

    OpenAIRE

    Abdul, Waris

    2016-01-01

    ABSTRAK ABDUL WARIS. Pengaruh Peningkatan Suhu Terhadap Kelimpahan Zooxanthellae Pada Karang Porites cylindrical Dalam Bak Terkontrol. Dibawah Bimbingan oleh CHAIR RANI dan SUPRIADI. Karang Porites merupakan salah satu genus karang yang tidak rentan dalam menerima pengaruh dari peningkatan suhu dan jika mengalami bleaching mereka cenderung pulih dengan sedikit atau tidak ada peningkatan kematian. Spesies karang yang digunakan dalam penelitian ini yaitu P.cylindrica. Penelitian ini bert...

  4. Anti-Cancer Effects of Imperata cylindrica Leaf Extract on Human Oral Squamous Carcinoma Cell Line SCC-9 in Vitro.

    Science.gov (United States)

    Keshava, Rohini; Muniyappa, Nagesh; Gope, Rajalakshmi; Ramaswamaiah, Ananthanarayana Saligrama

    2016-01-01

    Imperata cylindrica, a tall tufted grass which has multiple pharmacological applications is one of the key ingredients in various traditional medicinal formula used in India. Previous reports have shown that I. cylindrica plant extract inhibited cell proliferation and induced apoptosis in various cancer cell lines. To our knowledge, no studies have been published on the effect of I. cylindrica leaf extract on human oral cancers. The present study was undertaken in order to evaluate the anticancer properties of the leaf extract of I. cylindrica using an oral squamous cell carcinoma cell line SCC-9 as an in vitro model system. A methanol extract from dried leaves of I. cylindrica (ICL) was prepared by standard procedures. Effects of the ICL extract on the morphology of SCC-9 cells was visualized by microscopy. Cytotoxicity was determined by MTT assay. Effects of the ICL extract on colony forming ability of SCC-9 cells was evaluated using clonogenic assay. Cell cycle analysis was performed by flow cytometry and induction of apoptosis was determined by DNA fragmentation assay. The ICL extract treatment caused cytotoxicity and induced cell death in vitro in SCC-9 cells in a dose-dependent manner. This treatment also significantly reduced the clonogenic potential and inhibited cell proliferation by arresting the cell cycle in the G2/M phase. Furthermore, DNA fragmentation assays showed that the observed cell death was caused by apoptosis. This is the first report showing the anticancer activity of the methanol extracts from the leaves of I. cylindrica in human oral cancer cell line. Our data indicates that ICL extract could be considered as one of the lead compounds for the formulation of anticancer therapeutic agents to treat/manage human oral cancers. The natural abundance of I. cylindrica and its wide geographic distribution could render it one of the primary resource materials for preparation of anticancer therapeutic agents.

  5. Genetic Diversity of Aegilops cylindrica Species from West of Iran Using Morphological and Phenological Traits

    Directory of Open Access Journals (Sweden)

    M. Arabbeigi

    2015-12-01

    Full Text Available Aegilops cylindrica species (CCDD, 2n = 4x = 28 is one of the wild relatives of wheat and hence known as a valuable source of genes related to biotic and abiotic stress tolerance. In this study genetic variation of 66 Aegilops cylindrica genotypes collected from west and northwestern of Iran was evaluated using quantitative and qualitative morphological traits. The results indicated that glumelle (lemma length and glume color traits had the highest variation as the quantitative and qualitative traits, respectively. The principal components analysis (PCA indicated 6 components that first component justified %30.3 total variation. Flag leaf color and fluffiness had the highest contribution in this component and thus the first component named as the flag leaf component. The cluster analysis divided the studied genotypes into three groups.  Genotypes originating from west of Iran were included in the first group and genotypes from northwestern Iran were clustered into the second and third groups. It could be concluded that the high genetic variation among genotypes of Ae. cylindrica revealed in this study can be utilized to improve wheat particularly for tolerance to biotic and abiotic stresses.

  6. Influence of fibre treatments on mechanical properties of short Sansevieria cylindrica/polyester composites

    International Nuclear Information System (INIS)

    Sreenivasan, V.S.; Ravindran, D.; Manikandan, V.; Narayanasamy, R.

    2012-01-01

    Highlights: ► Fibre treatments were performed to improve interfacial bond between SCF and matrix. ► Mechanical properties of treated SCFP composites are greater than USCFP composites. ► PSCFP composites show maximum mechanical properties among treated SCFP composites. ► SEM analysis revealed that the wetting of PSCFs by the polyester resin was good. ► KMnO 4 treatment is ideal treatment for SCFs to get optimum mechanical properties. -- Abstract: In the present study, to improve the interfacial bond between Sansevieria cylindrica fibres (SCFs) and polyester matrix, chemical surface treatments have been performed on the fibres. Treatments including alkali, benzoyl peroxide, potassium permanganate and stearic acid were carried out to modify the fibre surface. Raw and each type of treated SCF samples were utilised separately for fabricating the composites. The mechanical properties of composites prepared from the chemically treated SCFs are found to be much better than those of the untreated ones. Potassium-permanganate-treated S. cylindrica fibre/polyester (PSCFP) composites showed optimum mechanical properties among the treated S. cylindrica fibre/polyester (SCFP) composites. The surface morphologies of fracture surfaces of composites were recorded using scanning electron microscopy (SEM). The SEM micrographs reveal that interfacial bonding between potassium-permanganate-treated SCF (PSCF) and polyester matrix has significantly improved, suggesting that better dispersion of PSCF into the matrix has occurred upon potassium permanganate treatment of SCF.

  7. Effects of dehydration, packaging and irradiation on the microbial and sensory quality of bitter gourd

    International Nuclear Information System (INIS)

    Shah, A.S.; Zeb, A.; Alam, S.; Hashim, M.M.; Hashmi, M.S.; Riaz, A.

    2007-01-01

    The research was carried out in the Food Technology Section at Nuclear Institute for Food and Agriculture (NIFA) Peshawar, Pakistan during 2004-05 to study the effect of potassium metabisulphite, packaging and irradiation on the dehydrated bitter gourd. Samples were stored at ambient temperature for a period of three months and analyzed after 15 days of intervals for microbial (Total bacterial count, Total fungal count) and organoleptic (appearance, taste, after-taste, overall acceptability) characteristics. Mean score of taste panel for appearance, taste, after-taste and overall acceptability significantly (p less than 0.05) decreased, while microbial growth significantly (p less than 0.05) increased during storage. Results showed that sample (T5) i.e. (Blanched+0. I% potassium metabisulphite + Dehydrated + Irradiation (3kGy) + Packed) had negligible microbial growth, maintained maximum nutrients stability and best quality characteristics during storage

  8. An Update Review on the Anthelmintic Activity of Bitter Gourd, Momordica charantia.

    Science.gov (United States)

    Poolperm, Sutthaya; Jiraungkoorskul, Wannee

    2017-01-01

    Momordica charantia (Family: Cucurbitales ), as known as bitter melon or gourd, is a daily consumption as food and traditional medicinal plant in Southeast Asia and Indo-China. It has been shown to possess anticancer, antidepressant, antidiabetic, anti-inflammatory, antimicrobial, antiobesity, antioxidant, and antiulcer properties. Its common phytochemical components include alkaloids, charantin, flavonoids, glycosides, phenolics, tannins, and terpenoids. This plant is rich in various saponins including momordicin, momordin, momordicoside, karavilagenin, karaviloside, and kuguacin, all of which have been reported to contribute to its remedial properties including antibacterial, antifungal, antiviral, and antiparasitic infections. Based on established literature on the anthelmintic activity of M. charantia and possible mode of action, this review article has attempted to compile M. charantia could be further explored for the development of potential anthelmintic drug.

  9. Effect of Luffa aegyptiaca (seeds) and Carissa edulis (leaves) extracts on blood glucose level of normal and streptozotocin diabetic rats.

    Science.gov (United States)

    El-Fiky, F K; Abou-Karam, M A; Afify, E A

    1996-01-01

    The present study investigates the effect of oral administration of the ethanolic extracts of Luffa aegyptiaca (seeds) and Carissa edulis (leaves) on blood glucose levels both in normal and streptozotocin (STZ) diabetic rats. Treatment with both extracts significantly reduced the blood glucose level in STZ diabetic rats during the first three hours of treatment. L. aegyptiaca extract decreased blood glucose level with a potency similar to that of the biguanide, metformin. The total glycaemic areas were 589.61 +/- 45.62 mg/dl/3 h and 660.38 +/- 64.44 mg/dl/3 h for L. aegyptiaca and metformin, respectively, vs. 816.73 +/- 43.21 mg/dl/3 h for the control (P < 0.05). On the other hand, in normal rats, both treatments produced insignificant changes in blood glucose levels compared to glibenclamide treatment.

  10. Effect of Elevated Carbon Dioxide on Two Scleractinian Corals: Porites cylindrica (Dana, 1846 and Galaxea fascicularis (Linnaeus, 1767

    Directory of Open Access Journals (Sweden)

    Yii-Siang Hii

    2009-01-01

    Full Text Available This study reveals the effect of elevated pCO2 on Porites cylindrica and Galaxea fascicularis. The corals responded differently under elevated pCO2. Zooxanthellae cell density, cell mitotic index, and photosynthesis rate of P. cylindrica decreased drastically under the elevated pCO2. At the end of the experiment, P. cylindrica suffered from a declining calcium carbonate precipitation rate. G. fascicularis increased its respiration rate and expelled 71% of its symbiotic zooxanthellae algae under elevated pCO2. Photosynthetic pigments in the remaining zooxanthellae algae increased from 1.85 to 11.5 times to sustain its photosynthetic outputs. At the end of the experiment, G. fascicularis managed to increase the rate of its calcium carbonate precipitation. Increase pCO2 in the atmosphere may affect species diversity of coral reefs.

  11. Experimental investigation of various vegetable fibers as sorbent materials for oil spills.

    Science.gov (United States)

    Annunciado, T R; Sydenstricker, T H D; Amico, S C

    2005-11-01

    Oil spills are a global concern due to their environmental and economical impact. Various commercial systems have been developed to control these spills, including the use of fibers as sorbents. This research investigates the use of various vegetable fibers, namely mixed leaves residues, mixed sawdust, sisal (Agave sisalana), coir fiber (Cocos nucifera), sponge-gourd (Luffa cylindrica) and silk-floss as sorbent materials of crude oil. Sorption tests with crude oil were conducted in deionized and marine water media, with and without agitation. Water uptake by the fibers was investigated by tests in dry conditions and distillation of the impregnated sorbent. The silk-floss fiber showed a very high degree of hydrophobicity and oil sorption capacity of approximately 85goil/g sorbent (in 24hours). Specific gravity measurements and buoyancy tests were also used to evaluate the suitability of these fibers for the intended application.

  12. Experimental investigation of various vegetable fibers as sorbent materials for oil spills

    Energy Technology Data Exchange (ETDEWEB)

    Annunciado, T.R.; Sydenstricker, T.H.D.; Amico, S.C. [Federal University of Parana, Curitiba, (Brazil). Department of Mechanical Engineering

    2005-11-15

    Oil spills are a global concern due to their environmental and economical impact. various commercial systems have been developed to control these spills, including the use of fibers as sorbents. This research investigates the use of various vegetable fibers, namely mixed leaves residues, mixed sawdust, sisal (Agave sisalana), coir fiber (Cocos nucifera), sponge-gourd (Luffa cylindrica) and silk-floss as sorbent materials of crude oil. Sorption tests with crude oil were conducted in deionized and marine water media, with and without agitation. Water uptake by the fibers was investigated by tests in dry conditions and distillation of the impregnated sorbent. The silk-floss fiber showed a very high degree of hydrophobicity and oil sorption capacity of approximately 85 g oil/g sorbent (in 24 hours). Specific gravity measurements and buoyancy tests were also used to evaluate the suitability of these fibers for the intended application. (author)

  13. Wild bitter gourd improves metabolic syndrome: A preliminary dietary supplementation trial

    Directory of Open Access Journals (Sweden)

    Tsai Chung-Huang

    2012-01-01

    Full Text Available Abstract Background Bitter gourd (Momordica charantia L. is a common tropical vegetable that has been used in traditional or folk medicine to treat diabetes. Wild bitter gourd (WBG ameliorated metabolic syndrome (MetS in animal models. We aimed to preliminarily evaluate the effect of WBG supplementation on MetS in Taiwanese adults. Methods A preliminary open-label uncontrolled supplementation trial was conducted in eligible fulfilled the diagnosis of MetS from May 2008 to April 2009. A total of 42 eligible (21 men and 21 women with a mean age of 45.7 ± 11.4 years (23 to 63 years were supplemented with 4.8 gram lyophilized WBG powder in capsules daily for three months and were checked for MetS at enrollment and follow-up monthly. After supplementation was ceased, the participants were continually checked for MetS monthly over an additional three-month period. MetS incidence rate were analyzed using repeated-measures generalized linear mixed models according to the intention-to-treat principle. Results After adjusting for sex and age, the MetS incidence rate (standard error, p value decreased by 7.1% (3.7%, 0.920, 9.5% (4.3%, 0.451, 19.0% (5.7%, 0.021, 16.7% (5.4%, 0.047, 11.9% (4.7%, 0.229 and 11.9% (4.7%, 0.229 at visit 2, 3, 4, 5, 6, and 7 compared to that at baseline (visit 1, respectively. The decrease in incidence rate was highest at the end of the three-month supplementation period and it was significantly different from that at baseline (p = 0.021. The difference remained significant at end of the 4th month (one month after the cessation of supplementation (p = 0.047 but the effect diminished at the 5th and 6th months after baseline. The waist circumference also significantly decreased after the supplementation (p Conclusion This is the first report to show that WBG improved MetS in human which provides a firm base for further randomized controlled trials to evaluate the efficacy of WBG supplementation.

  14. Expression pattern of salt tolerance-related genes in Aegilops cylindrica.

    Science.gov (United States)

    Arabbeigi, Mahbube; Arzani, Ahmad; Majidi, Mohammad Mahdi; Sayed-Tabatabaei, Badraldin Ebrahim; Saha, Prasenjit

    2018-02-01

    Aegilops cylindrica , a salt-tolerant gene pool of wheat, is a useful plant model for understanding mechanism of salt tolerance. A salt-tolerant USL26 and a salt-sensitive K44 genotypes of A. cylindrica , originating from Uremia Salt Lake shores in Northwest Iran and a non-saline Kurdestan province in West Iran, respectively, were identified based on screening evaluation and used for this work. The objective of the current study was to investigate the expression patterns of four genes related to ion homeostasis in this species. Under treatment of 400 mM NaCl, USL26 showed significantly higher root and shoot dry matter levels and K + concentrations, together with lower Na + concentrations than K44 genotype. A. cylindrica HKT1;5 ( AecHKT1;5 ), SOS1 ( AecSOS1 ), NHX1 ( AecNHX1 ) and VP1 ( AecVP1 ) were partially sequenced to design each gene specific primer. Quantitative real-time PCR showed a differential expression pattern of these genes between the two genotypes and between the root and shoot tissues. Expressions of AecHKT1;5 and AecSOS1 was greater in the roots than in the shoots of USL26 while AecNHX1 and AecVP1 were equally expressed in both tissues of USL26 and K44. The higher transcripts of AecHKT1;5 in the roots versus the shoots could explain both the lower Na + in the shoots and the much lower Na + and higher K + concentrations in the roots/shoots of USL26 compared to K44. Therefore, the involvement of AecHKT1;5 in shoot-to-root handover of Na + in possible combination with the exclusion of excessive Na + from the root in the salt-tolerant genotype are suggested.

  15. Variability, heritability, character association, path analysis and morphological diversity in snake gourd

    Directory of Open Access Journals (Sweden)

    A.S.M. Mahbubur Rahman Khan

    2016-11-01

    Full Text Available Genetic variability, heritability and path coefficient analysis were studied in 21 genotypes of snake gourd. The phenotypic coefficient of variations was found slightly higher than the genotypic coefficient of variations for all characters studied, indicating that the apparent variation is not only genetic but also influenced by the growing environment in the expression of the traits. The genotypic coefficient of variation was high for the fruit yield, number of fruits per vine, length of fruit and single fruit weight. High heritability coupled with high-to-moderate genetic advance was estimated for all characters studied. Correlation studies revealed that the fruit yield had a significant, positive correlation with the number of fruits per vine, length of fruit and single fruit weight. Importantly, more than 90% of the genotypic total variation was contributed by the characters included in the path analysis. The highest, direct, positive effect was recorded for the number of fruits per vine. The divergence value for cluster analysis indicated that the genotypes from clusters II and III had the highest inter-cluster distance and were expected to provide high heterosis in hybridization and to show wide variability in genetic architecture. The selection of high yielding genotypes should give emphasis to the number of fruits per vine, length of fruit and single fruit weight.

  16. Antifungal Potential of Indigenous Medicinal Plants against Myrothecium Leaf Spot of Bitter Gourd ( Momordica charantia L.

    Directory of Open Access Journals (Sweden)

    Muhammad Abid

    2017-08-01

    Full Text Available ABSTRACT Bitter gourd is of great importance due to its usage against the treatment of numerous ailments in human beings. A comprehensive survey at four localities of Southern Punjab, Pakistan was carried out to determine the severity of Myrothecium leaf spot. Maximum disease severity was at C1 (Chak 11/NP and least at C2 (Kot Mehtab. Among isolated species Myrothecium roridum was found more prevalent and pathogenic as compared to M. verrucaria. Antifungal activity using solvent extracts of five medicinal plants (Mangifera indica, Melia azedarach, Nicotiana tabacum, Moringa oleifera and Eucalyptus globosum were evaluated against isolated species by agar well diffusion method at various concentrations (0.01, 0.10, 1.0 and 10.0 µg / mL. N. tabacum revealed maximum zone size (13.40 mm and 8.28 mm with ethanol and chloroform solvents respectively followed by M. azedarach (9.00mm and 6.48mm. However, least inhibition was observed with ethanol and chloroform extracts of E. globosum (6.04mm and 3.88mm zone size respectively. Ethanol extracts showed highest activity when compared to chloroform extracts. Qualitative phytochemical analysis showed that all the selected plants are rich in chemical compounds such as alkaloids, terpenoids, flavonoids and phenols whereas Saponins was only present in N. tabacum while absent in rest of the extracts.

  17. Correlation and path coefficient analysis of quantitative characters in spine gourd (Momordica dioica Roxb.).

    Science.gov (United States)

    Aliya, F; Begum, H; Reddy, M T; Sivaraj, N; Pandravada, S R; Narshimulu, G

    2014-05-01

    Fifty genotypes of spine gourd (Momordica dioica Roxb.) were evaluated in a randomized block design with two replications at the Vegetable Research Station, Rajendranagar, Hyderabad, Andhra Pradesh, India during kharif, 2012. Correlation and path coefficient analysis were carried out to study the character association and contribution, respectively for twelve quantitative characters namely vine length (m), number of stems per plant, days to first female flower appearance, first female flowering node, days to first fruit harvest, days to last fruit harvest, fruiting period (days), fruit length (cm), fruit width (cm), fruit weight (g), number of fruits per plant and fruit yield per plant (kg) for identification of the potential selection indices. Correlation and path coefficient analyses revealed that fruiting period and number of fruits per plant not only had positively significant correlation with fruit yield but also had positively high direct effect on it and are regarded as the main determinants of fruit yield. Days to first fruit harvest had positively moderate direct effect on fruit yield and its association was negatively significant, days to last fruit harvest had negatively high direct effect on fruit yield and its association was significant positively, hence restricted simultaneous selection can be made for days to first fruit harvest and days to last fruit harvest. The improvement in fruit yield can be effective if selection is based on days to first fruit harvest, days to last fruit harvest, fruiting period and number of fruits per plant.

  18. Crystallization and preliminary X-ray studies of a galactose-specific lectin from the seeds of bitter gourd (Momordica charantia)

    International Nuclear Information System (INIS)

    Chandran, Thyageshwar; Sharma, Alok; Vijayan, M.

    2010-01-01

    A galactose-specific lectin purified from the seeds of bitter gourd (M. charantia) has been crystallized and preliminary X-ray study of the crystals has been carried out. A galactose-specific lectin from the seeds of bitter gourd (Momordica charantia) is a four-chain type II ribosome-inactivating protein (RIP) resulting from covalent association through a disulfide bridge between two identical copies of a two-chain unit. The available structural information on such four-chain RIPs is meagre. The bitter gourd lectin was therefore crystallized for structural investigation and the crystals have been characterized. It is anticipated that the structure of the orthorhombic crystals will be analysed using molecular replacement by taking advantage of its sequence, and presumably structural, homology to normal two-chain type II RIPs

  19. Leaf litter decomposition of Piper aduncum, Gliricidia sepium and Imperata cylindrica in the humid lowlands of Papua New Guinea

    NARCIS (Netherlands)

    Hartemink, A.E.; O'Sullivan, J.N.

    2001-01-01

    No information is available on the decomposition and nutrient release pattern of Piper aduncum and Imperata cylindrica despite their importance in shifting cultivation systems of Papua New Guinea and other tropical regions. We conducted a litter bag study (24 weeks) on a Typic Eutropepts in the

  20. Internal iron biomineralization in Imperata cylindrica, a perennial grass: chemical composition, speciation and plant localization.

    Science.gov (United States)

    Rodríguez, N; Menéndez, N; Tornero, J; Amils, R; de la Fuente, V

    2005-03-01

    * The analysis of metal distribution in Imperata cylindrica, a perennial grass isolated from the banks of Tinto River (Iberian Pyritic Belt), an extreme acidic environment with high content in metals, has shown a remarkable accumulation of iron. This property has been used to study iron speciation and its distribution among different tissues and structures of the plant. * Mossbauer (MS) and X-ray diffraction (XRD) were used to determine the iron species, scanning electron microscopy (SEM) to locate iron biominerals among plant tissue structures, and energy-dispersive X-ray microanalysis (EDAX), X-ray fluorescence (TXRF) and inductively coupled plasma emission spectroscopy (ICP-MS) to confirm their elemental composition. * The MS spectral analysis indicated that iron accumulated in this plant mainly as jarosite and ferritin. The presence of jarosite was confirmed by XRD and the distribution of both minerals in structures of different tissues was ascertained by SEM-EDAX analysis. * The convergent results obtained by complementary techniques suggest a complex iron management system in I. cylindrica, probably as a consequence of the environmental conditions of its habitat.

  1. Comparative leaf proteomic profiling of salt-treated natural variants of Imperata cylindrica

    Directory of Open Access Journals (Sweden)

    Yun-Jhih Shih

    2018-06-01

    Full Text Available Cogon grass (Imperata cylindrica (L. Beauv. var. major (Nees Hubb. is one of the top-ten weeds worldwide. It is also a C4 medicinal plant. In particular, an ecotype from Chuwei (CW mangrove forest was found to be salt tolerant. Comparative proteomic analysis using two-dimensional (2D-difference in gel electrophoresis coupled with liquid chromatography-mass spectrometry (LC-MS was carried out to identify responsive leaf proteins in the CW ecotype and salt-intolerant Sarlun (SL population following three days of 150 mM sodium chloride salt stress treatment. We identified five photosynthesis proteins including Rubisco small subunit, uncharacterized protein LOC100194054, Cyt b6-f, oxygen-evolving enhancer 2, and photosystem I reaction center subunit IV which were significantly up- or down-regulated by salt stress in CW ecotype but not SL population. Gene ontology enrichment analysis showed that photosynthesis was over-represented. The mass spectrometry proteomics data were deposited to the ProteomeXchange Consortium via the PRIDE partner repository with the dataset identifier PXD008482. Taken together, our proteomic study identified differentially accumulated proteins which provide additional evidence of ecophysiological variation in two natural variants of I. cylindrica.

  2. Formation of biomineral iron oxides compounds in a Fe hyperaccumulator plant: Imperata cylindrica (L.) P. Beauv.

    Science.gov (United States)

    Fuente, V; Rufo, L; Juárez, B H; Menéndez, N; García-Hernández, M; Salas-Colera, E; Espinosa, A

    2016-01-01

    We report a detailed work of composition and location of naturally formed iron biominerals in plant cells tissues grown in iron rich environments as Imperata cylindrica. This perennial grass grows on the Tinto River banks (Iberian Pyritic Belt) in an extreme acidic ecosystem (pH∼2.3) with high concentration of dissolved iron, sulphate and heavy metals. Iron biominerals were found at the cellular level in tissues of root, stem and leaf both in collected and laboratory-cultivated plants. Iron accumulated in this plant as a mix of iron compounds (mainly as jarosite, ferrihydrite, hematite and spinel phases) was characterized by X-ray diffraction (XRD), X-ray absorption spectroscopy (XAS), Mössbauer spectroscopy (MS), magnetometry (SQUID), electron microscopy with energy dispersive X-ray spectroscopy (SEM-EDX; TEM-EDX; HRSTEM). A low fraction of phosphorous was detected in this iron hyperaccumulator plant. Root and rhizomes tissues present a high proportion of ferromagnetic iron oxide compounds. Iron oxides-rich zones are localized in electron dense intra and inter-cellular aggregates that appear as dark deposits covering the inner membrane and organelles of the cell. This study aims to contribute to a better understanding of the mechanisms of accumulation, transport, distribution of iron in Imperata cylindrica. Copyright © 2015 Elsevier Inc. All rights reserved.

  3. Effect of concentration of imperata cylindrica L leaf extraction synthesis process of gold nanoparticles

    International Nuclear Information System (INIS)

    Iwan Syahjoko Saputra; Yoki Yulizar; Sudirman

    2018-01-01

    Gold Nanoparticles (Gold NPs) successful was performed using HAuCl 4 precursor as Au 3+ ion source with 7 x 10 -4 M concentration. There search aims to knows effect of concentration variation of Imperata cylindrica L leaf extract on synthesis process of gold nanoparticles. There search used of green synthesis method. Colloid of nanoparticles which is formed in analyzed using UV - Vis Spectrophotometer, FT-IR Spectroscopy, PSA, PZC, XRD and TEM. The results of synthesis showed the best concentration of Imperata cilyndrica L leaf extract at 3.46 %, happen a shift of wave length at UV-Vis from 216 nm to 530 nm with 1.779 absorbance value. The PSA analysis showed a particle size of 51.87 nm and a PZC value of -19.2 mV. The result of FT - IR indicated a shift of wave number in the hydroxyl group from 3354 cm -1 to 3390 cm -1 and showed a interaction of hydroxyl group at imperata cylindrica L leaf extract with Au 3+ ion. TEM analysis shows the morphology of Gold NPs that spherical shape with a particle size of 20 nm. XRD calculation results show crystallite size of gold nano particles is 15.47 nm. (author)

  4. A RAD-Based Genetic Map for Anchoring Scaffold Sequences and Identifying QTLs in Bitter Gourd (Momordica charantia)

    Science.gov (United States)

    Cui, Junjie; Luo, Shaobo; Niu, Yu; Huang, Rukui; Wen, Qingfang; Su, Jianwen; Miao, Nansheng; He, Weiming; Dong, Zhensheng; Cheng, Jiaowen; Hu, Kailin

    2018-01-01

    Genetic mapping is a basic tool necessary for anchoring assembled scaffold sequences and for identifying QTLs controlling important traits. Though bitter gourd (Momordica charantia) is both consumed and used as a medicinal, research on its genomics and genetic mapping is severely limited. Here, we report the construction of a restriction site associated DNA (RAD)-based genetic map for bitter gourd using an F2 mapping population comprising 423 individuals derived from two cultivated inbred lines, the gynoecious line ‘K44’ and the monoecious line ‘Dali-11.’ This map comprised 1,009 SNP markers and spanned a total genetic distance of 2,203.95 cM across the 11 linkage groups. It anchored a total of 113 assembled scaffolds that covered about 251.32 Mb (85.48%) of the 294.01 Mb assembled genome. In addition, three horticulturally important traits including sex expression, fruit epidermal structure, and immature fruit color were evaluated using a combination of qualitative and quantitative data. As a result, we identified three QTL/gene loci responsible for these traits in three environments. The QTL/gene gy/fffn/ffn, controlling sex expression involved in gynoecy, first female flower node, and female flower number was detected in the reported region. Particularly, two QTLs/genes, Fwa/Wr and w, were found to be responsible for fruit epidermal structure and white immature fruit color, respectively. This RAD-based genetic map promotes the assembly of the bitter gourd genome and the identified genetic loci will accelerate the cloning of relevant genes in the future. PMID:29706980

  5. A RAD-Based Genetic Map for Anchoring Scaffold Sequences and Identifying QTLs in Bitter Gourd (Momordica charantia

    Directory of Open Access Journals (Sweden)

    Junjie Cui

    2018-04-01

    Full Text Available Genetic mapping is a basic tool necessary for anchoring assembled scaffold sequences and for identifying QTLs controlling important traits. Though bitter gourd (Momordica charantia is both consumed and used as a medicinal, research on its genomics and genetic mapping is severely limited. Here, we report the construction of a restriction site associated DNA (RAD-based genetic map for bitter gourd using an F2 mapping population comprising 423 individuals derived from two cultivated inbred lines, the gynoecious line ‘K44’ and the monoecious line ‘Dali-11.’ This map comprised 1,009 SNP markers and spanned a total genetic distance of 2,203.95 cM across the 11 linkage groups. It anchored a total of 113 assembled scaffolds that covered about 251.32 Mb (85.48% of the 294.01 Mb assembled genome. In addition, three horticulturally important traits including sex expression, fruit epidermal structure, and immature fruit color were evaluated using a combination of qualitative and quantitative data. As a result, we identified three QTL/gene loci responsible for these traits in three environments. The QTL/gene gy/fffn/ffn, controlling sex expression involved in gynoecy, first female flower node, and female flower number was detected in the reported region. Particularly, two QTLs/genes, Fwa/Wr and w, were found to be responsible for fruit epidermal structure and white immature fruit color, respectively. This RAD-based genetic map promotes the assembly of the bitter gourd genome and the identified genetic loci will accelerate the cloning of relevant genes in the future.

  6. First full-length genome sequence of the polerovirus luffa aphid-borne yellows virus (LABYV) reveals the presence of at least two consensus sequences in an isolate from Thailand.

    Science.gov (United States)

    Knierim, Dennis; Maiss, Edgar; Kenyon, Lawrence; Winter, Stephan; Menzel, Wulf

    2015-10-01

    Luffa aphid-borne yellows virus (LABYV) was proposed as the name for a previously undescribed polerovirus based on partial genome sequences obtained from samples of cucurbit plants collected in Thailand between 2008 and 2013. In this study, we determined the first full-length genome sequence of LABYV. Based on phylogenetic analysis and genome properties, it is clear that this virus represents a distinct species in the genus Polerovirus. Analysis of sequences from sample TH24, which was collected in 2010 from a luffa plant in Thailand, reveals the presence of two different full-length genome consensus sequences.

  7. THE CURRENT STATE OF SEED PRODUCTION OF VEGETABLES AND GOURDS IN RUSSIAN FEDERATION; NATIONAL FOOD SAFETY

    Directory of Open Access Journals (Sweden)

    S. M. Sirota

    2017-01-01

    Full Text Available The current state of seed market of vegetable and gourds in Russian Federation in the frame of national food safety program is given in the article. Russia as a country with well-developed  seed production  in the last century has now  ceded  its  position,  and according  to  last experts’ association estimations the 80%  of  required volume of seeds of vegetables and gourds, amounting from 8 to 12 thousand per year is imported.  Not  less than 15 thousands  of  hectares  are  needed  to  be  necessary  for demand  of  Russian seed  production  sector,  however, presently only 2 thousands of hectares is a total certified land used for seed production.  Moreover, the seed production sector of some countries that export seeds rises becoming a profitable branch of agriculture, and providing local employment. The lack of competitiveness in Russia causes that many foreign companies increase annually purchasing prices for seeds and their production services. Therefore, now the total volume of seeds imported  in  Russian Federation has nearly been  twice less for the last years than in 2012, but in currency earnings in exporting countries the insignificant changes can be seen, where deviation is only 19-25%  from  average annual value, that means 1675 thousand dollars per year. Besides, for the Russian budget in the ruble currency the total cost of imported seeds has become 2.5 times more expensive since 2012, but the increase of combined cost of  marketable  vegetables  has been  over  2.7  billion  of rubles.  The  main  idea  that  the  seed  production  is  a process requiring the participation of breeders, seed producers and seed companies is main factor to succeed in recovering seed production sector. Exception of any participant or ignoring his interests may destroy all process. For instance, there is a chronic problem of plagiarism and royalty nonpayment causes the break between the business and

  8. Gourds and squashes (Cucurbita spp.) adapted to megafaunal extinction and ecological anachronism through domestication.

    Science.gov (United States)

    Kistler, Logan; Newsom, Lee A; Ryan, Timothy M; Clarke, Andrew C; Smith, Bruce D; Perry, George H

    2015-12-08

    The genus Cucurbita (squashes, pumpkins, gourds) contains numerous domesticated lineages with ancient New World origins. It was broadly distributed in the past but has declined to the point that several of the crops' progenitor species are scarce or unknown in the wild. We hypothesize that Holocene ecological shifts and megafaunal extinctions severely impacted wild Cucurbita, whereas their domestic counterparts adapted to changing conditions via symbiosis with human cultivators. First, we used high-throughput sequencing to analyze complete plastid genomes of 91 total Cucurbita samples, comprising ancient (n = 19), modern wild (n = 30), and modern domestic (n = 42) taxa. This analysis demonstrates independent domestication in eastern North America, evidence of a previously unknown pathway to domestication in northeastern Mexico, and broad archaeological distributions of taxa currently unknown in the wild. Further, sequence similarity between distant wild populations suggests recent fragmentation. Collectively, these results point to wild-type declines coinciding with widespread domestication. Second, we hypothesize that the disappearance of large herbivores struck a critical ecological blow against wild Cucurbita, and we take initial steps to consider this hypothesis through cross-mammal analyses of bitter taste receptor gene repertoires. Directly, megafauna consumed Cucurbita fruits and dispersed their seeds; wild Cucurbita were likely left without mutualistic dispersal partners in the Holocene because they are unpalatable to smaller surviving mammals with more bitter taste receptor genes. Indirectly, megafauna maintained mosaic-like landscapes ideal for Cucurbita, and vegetative changes following the megafaunal extinctions likely crowded out their disturbed-ground niche. Thus, anthropogenic landscapes provided favorable growth habitats and willing dispersal partners in the wake of ecological upheaval.

  9. Micro-electrolysis/retinervus luffae-based simultaneous autotrophic and heterotrophic denitrification for low C/N wastewater treatment.

    Science.gov (United States)

    Li, Jinlong; Li, Desheng; Cui, Yuwei; Xing, Wei; Deng, Shihai

    2017-07-01

    Nitrogen bioremediation in organic insufficient wastewater generally requires an extra carbon source. In this study, nitrate-contaminated wastewater was treated effectively through simultaneous autotrophic and heterotrophic denitrification based on micro-electrolysis carriers (MECs) and retinervus luffae fructus (RLF), respectively. The average nitrate and total nitrogen removal rates reached 96.3 and 94.0% in the MECs/RLF-based autotrophic and heterotrophic denitrification (MRAHD) system without ammonia and nitrite accumulation. The performance of MRAHD was better than that of MEC-based autotrophic denitrification for the wastewater treatment with low carbon nitrogen (COD/N) ratio. Real-time quantitative polymerase chain reaction (qPCR) revealed that the relative abundance of nirS-type denitrifiers attached to MECs (4.9%) and RLF (5.0%) was similar. Illumina sequencing suggested that the dominant genera were Thiobacillus (7.0%) and Denitratisoma (5.7%), which attached to MECs and RLF, respectively. Sulfuritalea was discovered as the dominant genus in the middle of the reactor. The synergistic interaction between autotrophic and heterotrophic denitrifiers played a vital role in the mixotrophic substrate environment.

  10. High-density natural luffa sponge as anaerobic microorganisms carrier for degrading 1,1,1-TCA in groundwater.

    Science.gov (United States)

    Wang, Wenbing; Wu, Yanqing; Zhang, Chi

    2017-03-01

    Anaerobic microorganisms were applied to degrade organic contaminants in groundwater with permeable reactive barriers (PRBs). However, anaerobic microorganisms need to select optimal immobilizing material as carrier. The potential of high-density natural luffa sponge (HDLS) (a new variety of luffa) for the immobilization and protection of anaerobic microorganisms was investigated. The HDLS has a dense structure composed of a complicated interwoven fibrous network. Therefore, the abrasion rate of HDLS (0.0068 g s -1 ) was the smallest among the four carriers [HDLS, ordinary natural luffa sponge (OLS), polyurethane sponge (PS), and gel carrier AQUAPOROUSGEL (APG)]. The results suggest that it also had the greatest water retention (10.26 H 2 O-g dry carrier-g -1 ) and SS retention (0.21 g dry carrier-g -1 ). In comparison to well-established commercialized gel carrier APG, HDLS was of much better mechanical strength, hydrophilicity and stability. Microbial-immobilized HDLS also had the best performance for the remediation of 1,1,1-TCA simulated groundwater. Analysis of the clone libraries from microorganism-immobilized HDLS showed the HDLS could protect microorganisms from the toxicity of 1,1,1-TCA and maintain the stability of microbial community diversity. The mechanism of HDLS immobilizing and protecting microorganisms was proposed as follows. The HDLS had a micron-scale honeycomb structure (30-40 μm) and an irregular ravine structure (4-20 μm), which facilitate the immobilization of anaerobic microorganisms and protect the anaerobic microorganisms.

  11. Effect of bitter gourd and spent turmeric on constituents of glycosaminoglycans in different tissues in streptozotocin induced diabetic rats.

    Science.gov (United States)

    Kumar, G Suresh; Vijayalakshmi, B; Salimath, P V

    2006-06-01

    Diet is now one of the well established means in the management of diabetes. Bitter gourd and spent turmeric at 10% level were tested for their efficacy on glycosaminoglycan metabolism in various tissues viz., liver, spleen, lungs, heart and testis in control, diabetic and treated rats. The glycosaminoglycans (GAGs) were isolated from defatted and dried tissues. The contents of sulfated GAGs decreased in all the tissues and the decrease was more prominent in heart and testis. In the isolated GAGs, contents of total sugar, amino sugar, uronic acid and sulfate were studied. Decrease in total sugar content was maximum in testis. Amino sugar content decreased considerably in testis (38%) and lungs (15%). The content of uronic acid also decreased in testis (33%) besides heart (29%) and liver (25%). Sulfate groups in GAGs perform pivotal functions in many biological events and decrease in sulfate content was significant in heart (40%), testis (37%) and liver (37%). GAGs profile on the cellulose acetate electrophoresis revealed that heparan sulfate (HS), hyaluronic acid (HA) and chondroitin sulfate/dermatan sulfate (CS/DS) were present in liver, spleen and lungs. HS, CS were present in heart, DS/CS was observed in testis. The observed beneficial effects in GAGs metabolism during diabetes may be due to the presence of high amounts of dietary fibres present in bitter gourd and spent turmeric, besides, possible presence of bioactive compounds in one or both of them.

  12. Accumulation and distribution characteristics of biomass and nitrogen in bitter gourd (Momordica charantia L.) under different fertilization strategies.

    Science.gov (United States)

    Zhang, Baige; Li, Mingzhu; Li, Qiang; Cao, Jian; Zhang, Changyuan; Zhang, Fusuo; Song, Zhao; Chen, Xinping

    2018-05-01

    The elemental uptake and allocation patterns of crops create insight for nutrient management. Two-year field experiments were conducted to determine the growth and nitrogen (N) uptake patterns of bitter gourd and to evaluate different N management strategies. Two N practices during the nursery stage, namely the conventional fertilizer method (Scon) and the controlled-release fertilizer management method (Scrf), combined with three N management strategies after transplanting, namely zero N fertilizer application (Nno), the conventional strategy (Ncon) and the systematic N management strategy (Nopt), were assessed. Averaged over two years, the Scrf-Nopt treatment performed best, producing 33.1 t ha -1 fruit yield with 310 kg N ha -1 , indicating that the yield was 22.6% greater by using 18.8% less fertilizer N than in the Scon-Ncon treatment. The Scrf-Nopt treatment facilitated plant growth by accumulating 20.0% more total dry weight and prioritized its allocation to productive organs (57.2%), while the Scon-Ncon strategy was biased toward leaves (56.3%) over fruits (43.8%). Nitrogen uptake and distribution closely followed the pattern of biomass. The Scrf-Nopt fertilization strategy coordinated the important role that N plays in total accumulation and well proportion of biomass and N in bitter gourd developmental processes. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  13. Genetic relationships in Cucurbita pepo (pumpkin, squash, gourd) as viewed with high frequency oligonucleotide–targeting active gene (HFO–TAG) markers

    Science.gov (United States)

    Cucurbita pepo is a highly diverse, economically important member of the Cucurbitaceae. C. pepo encompasses hundreds of cultivars of pumpkins, squash, and gourds. Although C. pepo has been scrutinized with various types of DNA markers, the relationships among the cultivar-groups of C. pepo subsp. p...

  14. Some competition experiments with alang-alang (Imperata cylindrica (L.) Beauv.) in replacement series.

    Science.gov (United States)

    Eussen, J H H

    1979-01-01

    The interaction between alang-alang (Imperata cylindrica) and maize or sorghum was studied in competition experiments according to the replacement principle. Dry matter yield of alang-alang in these experiments appeared hardly affected by the presence of maize or sorghum, while this yield of the latter two was strongly reduced by the presence of alang-alang. The relative yield total (RYT) reached unity except in one experiment in which a value of 0.6 was obtained.The results suggest that the allelopathic activity of alang-alang will find expression in an RYT deviating from one only if alang-alang is not able to utilize all available space.

  15. Mootrala Karma of Kusha [Imperata cylindrica Beauv.] and Darbha [Desmostachya bipinnata Stapf.] - A comparative study.

    Science.gov (United States)

    Shah, Niti T; Pandya, Tarulata N; Sharma, Parameshwar P; Patel, Bhupesh R; Acharya, Rabinarayan

    2012-07-01

    Kusha (Imperata cylindrica Beauv.) and Darbha (Desmostachya bipinnata Stapf.) are enlisted among Trinapanchamoola, which is a well-known diuretic and are individually enumerated in the Mootravirechaneeya Dashemani. The article deals with the evaluation and comparison of the individual Mootrala (diuretic) action of the two drugs in healthy volunteers. In this study, 29 healthy volunteers were divided into three groups administered with Darbha Moola Churna, Kusha Moola Churna, and placebo in each group for 14 days. The volunteers were subjected to evaluation of diuretic activity by maintaining the daily total input-output charts during the course of the study. The volunteers were advised to consume a minimum 2 l of water daily. Results show that Darbha and Kusha leaded to a percentage increase in urine volume as compared to placebo group, but the result was statistically insignificant.

  16. Silicon in Imperata cylindrica (L.) P. Beauv: content, distribution, and ultrastructure.

    Science.gov (United States)

    Rufo, Lourdes; Franco, Alejandro; de la Fuente, Vicenta

    2014-07-01

    Silicon concentration, distribution, and ultrastructure of silicon deposits in the Poaceae Imperata cylindrica (L.) P. Beauv. have been studied. This grass, known for its medicinal uses and also for Fe hyperaccumulation and biomineralization capacities, showed a concentration of silicon of 13,705 ± 9,607 mg/kg dry weight. Silicon was found as an important constituent of cell walls of the epidermis of the whole plant. Silica deposits were found in silica bodies, endodermis, and different cells with silicon-collapsed lumen as bulliforms, cortical, and sclerenchyma cells. Transmission electron microscope observations of these deposits revealed an amorphous material of an ultrastructure similar to that previously reported in silica bodies of other Poaceae.

  17. Assessing Genetic Diversity Based on Gliadin Proteins in Aegilops cylindrica Populations from Northwest of Iran

    Directory of Open Access Journals (Sweden)

    Toraj KHABIRI

    2013-02-01

    Full Text Available Wild wheat progenitors served as a valuable gene pool in breeding perspectives. In this respect, gliadins could be an important tool in assessing genetic variability as protein markers. Thus, genetic diversity of gliadin protein patterns in seventeen populations of Aegilops cylindrica collected from northwest of Iran were investigated using acid polyacrylamide gel electrophoresis. Results showed that the highest number of bands in the electrophoregrams were related to the ω type of geliadins. Conversely, the lowest number of bands were pertained to the β type of gliadins. Genetic diversity between populations was greater than within population variation. Assessment of total variation for the three gliadin types indicated that the highest total variation was related to β type while, the lowest one was belonged to ω type. Cluster analysis using complete linkage method divided populations into two separated groups in which genetic diversity does not follow from geographical distribution.

  18. Bioselective synthesis of gold nanoparticles from diluted mixed Au, Ir, and Rh ion solution by Anabaena cylindrica

    Science.gov (United States)

    Rochert, Anna S.; Rösken, Liz M.; Fischer, Christian B.; Schönleber, Andreas; Ecker, Dennis; van Smaalen, Sander; Geimer, Stefan; Wehner, Stefan

    2017-11-01

    Over the last years, an environmentally friendly and economically efficient way of nanoparticle production has been found in the biosynthesis of metal nanoparticles by bacteria and cyanobacteria. In this study, Anabaena cylindrica, a non-toxic cyanobacterium, is deployed in a diluted ionic aqueous mixture of equal concentrations of gold, iridium, and rhodium, of 0.1 mM each, for the selective biosynthesis of metal nanoparticles (NPs). To analyze the cyanobacterial metal uptake, X-ray powder diffraction (XRD), transmission electron microscopy (TEM), and inductively coupled plasma mass spectrometry (ICP-MS) were applied. Only gold can be found in crystalline and nanoparticle form inside the cells of A. cylindrica, and it is the only metal for which ICP-MS analyses show a rapid decrease of the concentration in the culture medium. A slight decrease of rhodium and none of iridium was observed in the evaluated timeline of 51 h. The average diameter size of the emerging gold nanoparticles increased over the first few days, but is found to be below 10 nm even after more than 2 days. A new evaluation method was used to determine the spatially resolved distribution of the nanoparticles inside the cyanobacterial cells. This new method was also used to analyze TEM images from earlier studies of A. cylindrica and Anabaena sp., both incubated with an overall concentration of 0.8 mM Au3+ to compare the metal uptake. A. cylindrica was found to be highly selective towards the formation of gold nanoparticles in the presence of rhodium and iridium.

  19. Dry Matter Yield And Competitiveness Of Alang-alang (Imperata Cylindrica) And Guinea Grass (Panicum Maximum) In Intercropping

    OpenAIRE

    Rusdy, M

    2012-01-01

    The objectives of this experiment were to determine dry matter yield and competitiveness of alang-alang (Imperata cylindrica) and Guinea grass (Panicum maximum) in intercropping. The experiment was arranged in factorial combinations of four planting proportions, two levels of nitrogen fertilization and three harvesting intervals with three replications. Planting proportions were 0, 33.3, 66.7, and 100% of alang-alang (planting densities of 0, 1, 2 and 3 plants/pot) combined with 100, 66.7, 33...

  20. Kandungan Total Polifenol dan Aktivitas Antioksidan dari Ekstrak Metanol Akar Imperata cylindrica (L) Beauv. (Alang-alang)

    OpenAIRE

    Diah Dhianawaty; Ruslin

    2015-01-01

    Hypertension is caused by many factors, including by the activity of angiotensin converting enzyme (ACE), reactive oxygen species (ROS). Methanol extract of Imperata cylindrica (alang-alang) root has been proven as having anti-hypertensive activities. Study shows various antioxidant therapies can decrease blood pressure. Polyphenol compounds of plants have many benefits, including as an antioxidant. Therefore, an experimental study was performed to measure the total polyphenol content using v...

  1. Preclinical evaluation of Luffa operculata Cogn. and its main active principle in the treatment of bacterial rhinosinusitis.

    Science.gov (United States)

    Silva, Leonardo; Costa, Henrique Olival; Souza, Flávia Coelho de; Lopes, Elaine Monteiro Cardoso; Ueda, Suely Mitoi Ykko

    2016-12-26

    The prevalence of rhinosinusitis is quite high. Despite the widespread use of antibiotics for rhinosinusitis, there are other forms of treatment, including phytotherapy. One of the most widely used herbal medicines for treatment of rhinosinusitis is Luffa operculata. This study aimed to evaluate the efficacy of topical nasal solution of the aqueous extract of L. operculata, determining the toxicity to its use and identifying the active principles presented in the aqueous extract. The secondary objective was to evaluate the action of active principles on bacteria commonly involved in acute rhino sinusitis. The study was conducted in experimental model of sinusitis. Three different concentrations of L. operculata were used as local treatment of rhino sinusitis. The results were compared with those observed in control groups that received nasal saline solution. Histological examination of the liver, kidney, spleen, myocardium, brain and lungs of all animals evaluated the toxicity of L. operculata. The aqueous extract used was subjected to chromatographic analysis and an active principle was isolated and tested for in vitro inhibition of bacterial colonies usually found in rhino sinusitis. Intranasal treatment of sinusitis with L. operculata showed better clinical evolution than control group. Statistically significant difference (p>0.10) between the treated group and the control group was observed in the histologic evaluation for inflammatory pattern. The aqueous extract of L. operculata used presented a predominance of 2,3-dicafeoilglicaric acid, a substance not yet described in the literature. There was a significant difference in bacterial growth of Streptococcus pyogenes on blood-agar plates when under the influence of both the aqueous extract and the active substance. Topical nasal solution of the aqueous extract of L. operculata is effective compared to the application of saline solution for the treatment of bacterial rhinosinusitis in an experimental model. L

  2. Early development of zooxanthella-containing eggs of the corals Porites cylindrica and Montipora digitata: The endodermal localization of zooxanthellae.

    Science.gov (United States)

    Hirose, Mamiko; Hidaka, Michio

    2006-10-01

    We studied the early development of zooxanthellae-containing eggs of the scleractinian corals Porites cylindrica and Montipora digitata to elucidate how zooxanthellae become localized to the endoderm of planulae during the course of development. In both species, zooxanthellae were distributed evenly in the oocytes and delivered almost equally to the blastomeres during cleavage. In P. cylindrica, gastrulation occurred via delamination or ingression, and blastomeres containing zooxanthellae dropped into the blastocoel during gastrulation. Thus, zooxanthellae were restricted to the endodermal cells at the gastrula or early planula stage in P. cylindrica. In M. digitata, gastrulation occurred by a combination of invagination and epiboly to form a somewhat concave gastrula. Zooxanthellae were present in both endodermal and ectodermal cells of early planulae, but they disappeared from the ectoderm as the planulae matured. In our previous study on two species of Pocillopora, we found that zooxanthellae were localized in eggs as well as in embryos, and that blastomeres containing zooxanthellae later dropped into the blastocoel to become restricted to the endoderm (Hirose et al., 2000). The timing and mechanism of zooxanthella localization and types of gastrulation differed among species belonging to the three genera. These results suggest that zooxanthella localization in the embryos reflects the timing of the determination of presumptive endoderm cells and/or specificity of zooxanthellae toward presumptive endoderm cells.

  3. Comparison studies on catalytic properties of silver nanoparticles biosynthesized via aqueous leaves extract of Hibiscus rosa sinensis and Imperata cylindrica

    Science.gov (United States)

    Fairuzi, Afiza Ahmad; Bonnia, Noor Najmi; Akhir, Rabiatuladawiyah Md.; Akil, Hazizan Md; Yahya, Sabrina M.; Rahman, Norafifah A.

    2018-05-01

    Synthesis of silver nanoparticles has been developed by using aqueous leaves extract (ALE) of Hibiscus rosa sinensis (H. rosa sinensis) and Imperata cylindrica (I. cylindrica). Both plants extract acts as reducing and capping agent. The colour change in reaction mixture (pale yellow to dark brown) was observed during the synthesis process. The formation of silver nanoparticles was confirmed by surface Plasmon Resonance (SPR) at range 300-700 nm for both leaves using UV-Vis Spectroscopy. The reduction of silver ions to silver nanoparticles was completed within 2 hour for H. rosa sinensis and 30 minutes for I. cylindrica extract. The synthesized nanoparticles were characterized using UV-Vis spectroscopy, field emission scanning electron microscope (FESEM) and Fourier transform infrared (FTIR) spectroscopy. The morphology of silver nanoparticles was found to be different when synthesized using different plant extract. In addition, this study also reported on the effect of silver nanoparticles on the degradation of organic dye by sodium borohydride (NaBH4). The silver nanoparticles synthesis by aqueous leaf extract demonstrates rapid, simple and inexpensive method compared to the conventional physical and physical methods. The efficiency of silver nanoparticles as a promising candidate for the catalysis of organic dyes by NaBH4 through the electron transfer is established in the present study.

  4. Immunocytochemical analysis of the subcellular distribution of ferritin in Imperata cylindrica (L.) Raeuschel, an iron hyperaccumulator plant.

    Science.gov (United States)

    de la Fuente, Vicenta; Rodríguez, Nuria; Amils, Ricardo

    2012-05-01

    Ferritin is of interest at the structural and functional level not only as storage for iron, a critical element, but also as a means to prevent cell damage produced by oxidative stress. The main objective of this work was to confirm by immunocytochemistry the presence and the subcellular distribution of the ferritin detected by Mösbauer spectroscopy in Imperata cylindrica, a plant which accumulates large amounts of iron. The localization of ferritin was performed in epidermal, parenchymal and vascular tissues of shoots and leaves of I. cylindrica. The highest density of immunolabeling in shoots appeared in the intracellular space of cell tissues, near the cell walls and in the cytoplasm. In leaves, ferritin was detected in the proximity of the dense network of the middle lamella of cell walls, following a similar path to that observed in shoots. Immunolabeling was also localized in chloroplasts. The abundance of immunogold labelling in mitochondria for I. cylindrica was rather low, probably because the study dealt with tissues from old plants. These results further expand the localization of ferritin in cell components other than chloroplasts and mitochondria in plants. Copyright © 2011 Elsevier GmbH. All rights reserved.

  5. Purification and characterisation of an antifungal protein, MCha-Pr, from the intercellular fluid of bitter gourd (Momordica charantia) leaves.

    Science.gov (United States)

    Zhang, Beibei; Xie, Chengjian; Wei, Yunming; Li, Jing; Yang, Xingyong

    2015-03-01

    An antifungal protein, designated MCha-Pr, was isolated from the intercellular fluid of bitter gourd (Momordica charantia) leaves during a screen for potent antimicrobial proteins from plants. The isolation procedure involved a combination of extraction, ammonium sulphate precipitation, gel filtration on Bio-Gel P-6, ion exchange chromatography on CM-Sephadex, an additional gel filtration on HiLoad 16/60 Superdex 30, and finally, HPLC on a SOURCE 5RPC column. Matrix-assisted laser desorption/ionisation time-of-flight mass spectrometry indicated that the protein had a molecular mass of 25733.46Da. Automated Edman degradation was used to determine the N-terminal sequence of MCha-Pr, and the amino acid sequence was identified as V-E-Y-T-I-T-G-N-A-G-N-T-P-G-G. The MCha-Pr protein has some similarity to the pathogenesis-related proteins from Atropa belladonna (deadly nightshade), Solanum tuberosum (potato), Ricinus communis (castor bean), and Nicotiana tabacum (tobacco). Analysis of the circular dichroism spectra indicated that MCha-Pr predominantly contains α-helix and β-sheet structures. MCha-Pr had inhibitory effects towards a variety of fungal species and the 50% inhibition of fungal growth (IC50) for Alternaria brassicae, Cercospora personata, Fusarium oxysporum, Mucor sp., and Rhizoctonia solani are 33 μM, 42 μM, 37 μM, 40 μM, and 48 μM, respectively. In addition, this antifungal protein can inhibit the germination of A. brassicae spores at 12.5 μM. These results suggest that MCha-Pr in bitter gourd leaves plays a protective role against phytopathogens and has a wide antimicrobial spectrum. Copyright © 2014 Elsevier Inc. All rights reserved.

  6. Application of acid-modified Imperata cylindrica powder for latent fingerprint development.

    Science.gov (United States)

    Low, Wei Zeng; Khoo, Bee Ee; Aziz, Zalina Binti Abdul; Low, Ling Wei; Teng, Tjoon Tow; bin Abdullah, Ahmad Fahmi Lim

    2015-09-01

    A novel powdering material that utilizes acid-modified Imperata cylindrica (IC) powder for the development of fingermarks was studied. Experiments were carried out to determine the suitability, adherence quality and sensitivity of the acid-modified IC powder. Fingermarks of different constituents (eccrine, sebaceous and natural fingermarks) on different types of surfaces were used. Acid-modified IC powder was also used to develop fingermarks of different ages as well as aged fingermarks recovered from the water. From the visual inspection, acid-modified IC powder was able to interact with different fingermark constituents and produced distinct ridge details on the examined surfaces. It was also able to develop aged fingermarks and fingermarks that were submerged in water. A statistical comparison was made against the Sirchie® Hi-Fi black powder in terms of the powders' sensitivity and quality of the developed natural fingermarks. The image quality was analyzed using MITRE's Image Quality of Fingerprint (IQF) software. From the experiments, acid-modified IC powder has the potential as a fingermark development powder, although natural fingermarks developed by Sirchie® black powder showed better quality and sensitivity based on the results of the statistical comparison. Copyright © 2015 The Chartered Society of Forensic Sciences. Published by Elsevier Ireland Ltd. All rights reserved.

  7. Isoeugenin, a Novel Nitric Oxide Synthase Inhibitor Isolated from the Rhizomes of Imperata cylindrica

    Directory of Open Access Journals (Sweden)

    Hyo-Jin An

    2015-12-01

    Full Text Available Phytochemical studies on the constituents of the rhizomes of Imperata cylindrica (Gramineae were performed using high-performance liquid chromatography (HPLC. We also aimed to search for any biologically active substance capable of inhibiting nitric oxide (NO formation in lipopolysaccharide (LPS-activated macrophage 264.7 cells, by testing four compounds isolated from this plant. Four compounds, including a new chromone, isoeugenin, along with ferulic acid, p-coumaric acid, and caffeic acid were isolated and identified by NMR spectroscopy. The structure of isoeugenin was determined as 7-hydroxy-5-methoxy-2-methylchromone by the 2D-NMR technique. Among the four compounds, isoeugenin has the lowest IC50 value on the inhibition of NO production in LPS-activated macrophage RAW264.7 cells (IC50, 9.33 μg/mL. In addition, isoeugenin significantly suppressed the LPS-induced expressions of inducible nitric oxide synthase (iNOS, cyclooxygenase-2 (COX-2, and proinflammatory cytokines mRNA levels. Taken together, these results suggest that the anti-inflammatory activity of isoeugenin is associated with the down-regulation of iNOS, COX-2, and pro-inflammatory cytokines in RAW264.7 cells. Accordingly, our results suggest that the new chromone isoegenin should be considered a potential treatment for inflammatory disease.

  8. Biological and molecular characterization of a putative new sobemovirus infecting Imperata cylindrica and maize in Africa.

    Science.gov (United States)

    Sérémé, Drissa; Lacombe, Séverine; Konaté, Moumouni; Pinel-Galzi, Agnès; Traoré, Valentin Stanislas Edgar; Hébrard, Eugénie; Traoré, Oumar; Brugidou, Christophe; Fargette, Denis; Konaté, Gnissa

    2008-01-01

    A new virus was isolated from both the grass Imperata cylindrica and maize plants that had yellow mottle symptoms in Burkina Faso, West Africa. The virus has isometric particles ca. 32 nm in diameter. The experimental host range was restricted to Rottboellia exaltata. Virions were isolated from leaves of systemically infected maize plants. Koch's postulates were completed by mechanically inoculating uninfected Imperata or maize with either purified virus or sap from infected Imperata plants. Virion preparations were used to produce a specific polyclonal antiserum, and an enzyme-linked immunosorbent assay test was set up. The full genome of the virus was sequenced, and it comprised 4,547 nucleotides. Phylogenetic studies indicated that the virus is closely related to rice yellow mottle virus, a sobemovirus that infects monocotyledons in Africa, and is more distantly related to cocksfoot mottle virus, another sobemovirus that infects monocotyledons. Although the virus can infect R. exaltata experimentally, it differs from Rottboellia yellow mottle virus, a member of a tentative species of the genus Sobemovirus that also infects monocotyledons in Africa. Particle morphology, serological properties, genomic organization, and phylogenetic analysis are all consistent with assignment of the new virus to the genus Sobemovirus. The name Imperata yellow mottle virus is proposed.

  9. Isoeugenin, a Novel Nitric Oxide Synthase Inhibitor Isolated from the Rhizomes of Imperata cylindrica.

    Science.gov (United States)

    An, Hyo-Jin; Nugroho, Agung; Song, Byong-Min; Park, Hee-Juhn

    2015-12-01

    Phytochemical studies on the constituents of the rhizomes of Imperata cylindrica (Gramineae) were performed using high-performance liquid chromatography (HPLC). We also aimed to search for any biologically active substance capable of inhibiting nitric oxide (NO) formation in lipopolysaccharide (LPS)-activated macrophage 264.7 cells, by testing four compounds isolated from this plant. Four compounds, including a new chromone, isoeugenin, along with ferulic acid, p-coumaric acid, and caffeic acid were isolated and identified by NMR spectroscopy. The structure of isoeugenin was determined as 7-hydroxy-5-methoxy-2-methylchromone by the 2D-NMR technique. Among the four compounds, isoeugenin has the lowest IC50 value on the inhibition of NO production in LPS-activated macrophage RAW264.7 cells (IC50, 9.33 μg/mL). In addition, isoeugenin significantly suppressed the LPS-induced expressions of inducible nitric oxide synthase (iNOS), cyclooxygenase-2 (COX-2), and proinflammatory cytokines mRNA levels. Taken together, these results suggest that the anti-inflammatory activity of isoeugenin is associated with the down-regulation of iNOS, COX-2, and pro-inflammatory cytokines in RAW264.7 cells. Accordingly, our results suggest that the new chromone isoegenin should be considered a potential treatment for inflammatory disease.

  10. Molecular Evidence for Occurrence of Tomato leaf curl New Delhi virus in Ash Gourd (Benincasa hispida) Germplasm Showing a Severe Yellow Stunt Disease in India.

    Science.gov (United States)

    Roy, Anirban; Spoorthi, P; Panwar, G; Bag, Manas Kumar; Prasad, T V; Kumar, Gunjeet; Gangopadhyay, K K; Dutta, M

    2013-06-01

    An evaluation of 70 accessions of ash gourd germplasm grown at National Bureau of Plant Genetic Resources, New Delhi, India during Kharif season (2010) showed natural occurrence of a yellow stunt disease in three accessions (IC554690, IC036330 and Pusa Ujjwal). A set of begomovirus specific primers used in PCR gave expected amplicon from all the symptomatic plants; however no betasatellite was detected. Complete genome of the begomovirus (DNA-A and DNA-B), amplified through rolling circle amplification, was cloned and sequenced. The begomovirus under study shared high sequence identities to different isolates of Tomato leaf curl New Delhi virus (ToLCNDV) and clustered with them. Among those isolates, the DNA-A and DNA-B of the present begomovirus isolate showed highest 99.6 and 96.8 % sequence identities, respectively with an isolate reported on pumpkin from India (DNA-A: AM286433, DNA-B: AM286435). Based on the sequence analysis, the begomovirus obtained from ash gourd was considered as an isolate of ToLCNDV. Thus, the present findings constitute the first report of occurrence of a new yellow stunt disease in ash gourd from India and demonstrated the association of ToLCNDV with the symptomatic samples. Occurrence of ToLCNDV in ash gourd germplasm not only adds up a new cucurbitaceous host of this virus but also raises the concern about the perpetuation of this virus in absence of its main host tomato and thus has an epidemiological relevance for understanding the rapid spread of this virus in tomato and other hosts in Indian sub-continent.

  11. Foraging dynamics and pollination efficiency of Apis mellifera and Xylocopa olivacea on Luffa aegyptiaca Mill (Cucurbitaceae) in southern Ghana

    OpenAIRE

    Mensah, Ben

    2011-01-01

    As a result of different levels of pollination efficiency of pollinators, knowledge on appropriate pollinators of a plant has become important, especially in the management and conservation of both the pollinators and the plants. In this study, the pollination efficiency of Apis mellifera and Xylocopa olivacea, important pollinators of Luffa aegyptiaca, were assessed in the southern coastal part of Ghana from June 2009 to September 2010. Pollination efficiency of A. mellifera and X. olivacea ...

  12. PENGARUH PEMBERIAN IBA DAN KOMPOSISI MEDIA TERHADAP PERTUMBUHAN STEK Sansevieria cylindrica var. patula

    Directory of Open Access Journals (Sweden)

    Sesar Fikri Firmansyah

    2014-06-01

    Full Text Available Sansevieria is an ornamental plant commonly known as mother-in-law's tongue, devil's tongue, and snake tongue. It has many functions e.g. uses as medicine, its fiber for the textile industry, and as indoor air pollutants absorber. However, the growth of Sansevieria is slow. Therefore the supply of it seeds in large quantities in the short time was difficult. The use of Plant Growth Regulator (PGR was one solution to accelerate the propagation of Sansevieria leaf cuttings. This study aimed to determine the concentration of IBA and the composition of media to increase the leaf cuttings propagation of Sansevieria cylindrica var. patula. The method was randomized block design with factorials. Factor I was the IBA concentrations comprised of  K0 at 0 ppm, K1 at 50 ppm, K2 at 100 ppm, K3 at 150 ppm, and K4 at 200 ppm. Factor II was the ratio of manure:sand:rice-husk-ash as the growth media, comprised of M1 with 1:1:1 ratio, M2 with 1:2:1 ratio, and M3 with 1:1:2 ratio respectively. Each with three replicates overall was 45 experimental units. The parameters observed were a percentage of propagated cuttings, the number of roots, the longest length of roots, the number of shoots. The results showed the IBA could not increase the growth of cuttings in all media composition; however media compositions could enhance the number of shoots. The effective media composition propagated the cuttings was the M1 a 1:1:1 ratio of manure:sand:rice-husk-ash.

  13. Cogongrass (Imperata cylindrica invasions in the US: Mechanisms, impacts, and threats to biodiversity

    Directory of Open Access Journals (Sweden)

    James A. Estrada

    2015-01-01

    Full Text Available Invasions of non-native species can suppress biodiversity and alter ecosystem functions, but for many of the most widespread invasive species the mechanisms underlying their invasive success and effects on native species are poorly understood. Here we evaluated the peer-reviewed literature on causes and impacts of invasion by cogongrass (Imperata cylindrica, one of the most problematic invasive plant species in the southeast US. We assess what is known about why cogongrass is particularly invasive and how it affects native communities and ecosystems, review patterns in research methods employed, and provide a roadmap for future research on cogongrass. Although many studies have focused on the basic biology and management of cogongrass, we found surprisingly few (30 studies that have directly tested mechanisms or impacts of cogongrass invasions. The most commonly tested mechanisms, disturbance and allelopathy, were evaluated 4 and 12 times, respectively, and studies on invasion impacts were limited to five studies total: native plant diversity (2 studies, nitrogen cycling (2, decomposition (1, and fine fuel loads (1. Excluding laboratory studies on allelopathy, 75% (6/8 of impact studies used observational methods, raising questions about cause and effect. Given the paucity of studies on the ecology of cogongrass invasions, and the need to protect conservation areas from invasions, we urge that research efforts focus on: (1 environmental correlates of distribution and performance, (2 the role of propagule pressure in invasion success, (3 enemy release and post-introduction evolution as mechanisms of invasion, and (4 experimental tests of community and ecosystem impacts of invasions.

  14. Acrapex azumai Sugi (Lepidoptera, Noctuidae) as a possible biological control agent of the invasive weed Imperata cylindrica (L.) Beauv. (Poaceae) in the United States

    Science.gov (United States)

    Lepidopteran larvae were discovered boring in the basal stems of Imperata cylindrica (L.) Beauv. (Poaceae) in Itoshima city, Fukuoka Prefecture, Kyushu, Japan. Adults reared from these larvae were identified as Acrapex azumai Sugi (Lepidoptera: Noctuidae). Sequencing of the CO1 (cytochrome oxidase 1...

  15. Flow sorting of C-genome chromosomes from wild relatives of wheat Aegilops markgrafii, Ae. triuncialis and Ae. cylindrica, and their molecular organization

    Czech Academy of Sciences Publication Activity Database

    Molnár, I.; Vrána, Jan; Farkas, A.; Kubaláková, Marie; Cseh, A.; Molnár-Láng, M.; Doležel, Jaroslav

    2015-01-01

    Roč. 116, č. 2 (2015), s. 189-200 ISSN 0305-7364 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Aegilops markgrafii * Ae. triuncialis * Ae. cylindrica Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.982, year: 2015

  16. Development of extract library from indonesian biodiversity: exploration of antibacterial activity of mangrove bruguiera cylindrica leaf extracts

    Science.gov (United States)

    Audah, K. A.; Amsyir, J.; Almasyhur, F.; Hapsari, A. M.; Sutanto, H.

    2018-03-01

    Antibacterial drugs derived from natural sources play significant roles in the prevention and treatment of bacterial infections since antibiotics have become less effective against many infectious diseases. Mangroves are very potential natural antibacterial sources among great numbers of wild medicinal plants. Bruguiera cylindrica is one of the many mangroves species which spread along Indonesian coastline. The aim of this study was to explore the antibacterial activity of B. cylindrica wet and dried leaf extracts. The wet extracts study was conducted with three different solvents system (water, ethanol, and n-Hexane) against Escherichia coli and Staphylococcus aureus. While, the dried extracts study was conducted with four different solvents system (water, ethanol, chloroform and n-Hexane) against three types of bacteria, Escherichia coli, Staphylococcus epidermidis and Staphylococcus aureus. The study showed that ethanol was the best solvent for extraction of phenolic and flavonoid. Antibacterial actitivity was measured by zone of inhibition which obtained from agar-disk diffusion method. The widest area of zone of inhibition was showed by wet extracts with ethanol against S. aureus and E. coli are 14.30 and 13.30 mm, respectively. While, the zone of inhibition dried extracts with ethanol against S. aureus, S. epidermidis and E. coli are 9.32, 6.59 and 6.20 mm, respectively. In conclusion, both type of extracts showed significant antibacterial activity against gram-positive bacteria as crude extracts.

  17. Time-dependent growth of crystalline Au0-nanoparticles in cyanobacteria as self-reproducing bioreactors: 2. Anabaena cylindrica

    Directory of Open Access Journals (Sweden)

    Liz M. Rösken

    2016-03-01

    Full Text Available Microbial biosynthesis of metal nanoparticles as needed in catalysis has shown its theoretical ability as an extremely environmentally friendly production method in the last few years, even though the separation of the nanoparticles is challenging. Biosynthesis, summing up biosorption and bioreduction of diluted metal ions to zero valent metals, is especially ecofriendly, when the bioreactor itself is harmless and needs no further harmful reagents. The cyanobacterium Anabaena cylindrica (SAG 1403.2 is able to form crystalline Au0-nanoparticles from Au3+ ions and does not release toxic anatoxin-a. X-ray powder diffraction (XRD, transmission electron microscopy (TEM and laser-induced breakdown spectroscopy (LIBS are applied to monitor the time-dependent development of gold nanoparticles for up to 40 hours. Some vegetative cells (VC are filled with nanoparticles within minutes, while the extracellular polymeric substances (EPS of vegetative cells and the heterocyst polysaccharide layer (HEP are the regions, where the first nanoparticles are detected on most other cells. The uptake of gold starts immediately after incubation and within four hours the average size remains constant around 10 nm. Analyzing the TEM images with an image processing program reveals a wide distribution for the diameter of the nanoparticles at all times and in all regions of the cyanobacteria. Finally, the nanoparticle concentration in vegetative cells of Anabaena cylindrica is about 50% higher than in heterocysts (HC. These nanoparticles are found to be located along the thylakoid membranes.

  18. Time-dependent growth of crystalline Au(0)-nanoparticles in cyanobacteria as self-reproducing bioreactors: 2. Anabaena cylindrica.

    Science.gov (United States)

    Rösken, Liz M; Cappel, Felix; Körsten, Susanne; Fischer, Christian B; Schönleber, Andreas; van Smaalen, Sander; Geimer, Stefan; Beresko, Christian; Ankerhold, Georg; Wehner, Stefan

    2016-01-01

    Microbial biosynthesis of metal nanoparticles as needed in catalysis has shown its theoretical ability as an extremely environmentally friendly production method in the last few years, even though the separation of the nanoparticles is challenging. Biosynthesis, summing up biosorption and bioreduction of diluted metal ions to zero valent metals, is especially ecofriendly, when the bioreactor itself is harmless and needs no further harmful reagents. The cyanobacterium Anabaena cylindrica (SAG 1403.2) is able to form crystalline Au(0)-nanoparticles from Au(3+) ions and does not release toxic anatoxin-a. X-ray powder diffraction (XRD), transmission electron microscopy (TEM) and laser-induced breakdown spectroscopy (LIBS) are applied to monitor the time-dependent development of gold nanoparticles for up to 40 hours. Some vegetative cells (VC) are filled with nanoparticles within minutes, while the extracellular polymeric substances (EPS) of vegetative cells and the heterocyst polysaccharide layer (HEP) are the regions, where the first nanoparticles are detected on most other cells. The uptake of gold starts immediately after incubation and within four hours the average size remains constant around 10 nm. Analyzing the TEM images with an image processing program reveals a wide distribution for the diameter of the nanoparticles at all times and in all regions of the cyanobacteria. Finally, the nanoparticle concentration in vegetative cells of Anabaena cylindrica is about 50% higher than in heterocysts (HC). These nanoparticles are found to be located along the thylakoid membranes.

  19. Kandungan Total Polifenol dan Aktivitas Antioksidan dari Ekstrak Metanol Akar Imperata cylindrica (L Beauv. (Alang-alang

    Directory of Open Access Journals (Sweden)

    Diah Dhianawaty

    2015-03-01

    Full Text Available Hypertension is caused by many factors, including by the activity of angiotensin converting enzyme (ACE, reactive oxygen species (ROS. Methanol extract of Imperata cylindrica (alang-alang root has been proven as having anti-hypertensive activities. Study shows various antioxidant therapies can decrease blood pressure. Polyphenol compounds of plants have many benefits, including as an antioxidant. Therefore, an experimental study was performed to measure the total polyphenol content using visible spectrophotometry method-Folin-Ciocalteu reagent as well as to test the antioxidant activity using 1,1-diphenyl-method 2-pikrilhidrazil (DPPH from July to December 2014. The results showed that the extract had a total polyphenol content of 1.53% galad acid aquevalent (GAE and antioxidant activity IC50 0.32 mg/mL. The polyphenol compounds have the ability to donate hydrogen atom to DPPH free radical, which leads to reduced DPPHmarked by the color change of DPPH from purple to yellow. Thus, antioxidant activity of methanol extract of Imperata cylindrica root was supported by the presence of polyphenol compounds. In conclusion, the extract has a total polyphenol content of 1.53% (GAE and antioxidant activity IC50 0.32 of 0.32 mg/mL. The presence of polyphenol compounds supports the antioxidant activity of the extract.

  20. Imperata cylindrica sp as Novel Silica-Based Heterogeneous Catalysts for Transesterification of Palm Oil Mill Sludge.

    Science.gov (United States)

    Ngaini, Zainab; Shahrom, Farra Diana; Jamil, Nurfarahen; Wahi, Rafeah; Ahmad, Zainal Abiddin

    2016-06-01

    Biodiesel from palm oil mill sludge (POMS) was prepared in the presence of novel silica-based heterogeneous catalysts derived from Imperata cylindrica sp. Imperatacid and Imperatabase are two types of heterogeneous catalysts derived from Imperata cylindrica sp and characterized using scanning electron microscopy, Energy Dispersive X-ray, Brunauer-Emmett-Teller surface area and pore size measurement. Imperatacid has particle size of 43.1-83.9 µm while Imperatabase in the range of 89-193 µm. Imperatacid was conveniently applied in esterification step to afford > 90 wt% oil in 1:3 (oil/methanol) and 10 wt% catalyst, followed by transesterification with 1 wt% Imperatabase and 1:1 (oil/methanol) for 1 h at 65°C to afford 80% biodiesel with higher percentage of methyl palmitate (48.97%) and methyl oleate (34.14%) compare to conventional homogeneous catalyst. Reusability of the catalyst up to three times afforded biodiesel ranging from 78-80% w/w. The biodiesel was demonstrated onto alternative diesel engine (Megatech(®)-Mark III) and showed proportional increased of torque (ɽ) to biodiesel loading.

  1. Acute and subchronic toxicity study of the water extract from root of Imperata cylindrica (Linn. Raeusch. in rats

    Directory of Open Access Journals (Sweden)

    Siharat Chunlaratthanaphorn

    2007-03-01

    Full Text Available The water extract from root of Imperata cylindrica (Linn. Raeusch. was studied for acute and subchronic toxicities. The extract at a single dose of 5,000 mg/kg was administered orally to female and male rats (5 male, 5 female. After 14 days, signs and behavioral changes, mortality, gross and histopathological changes of internal organs were examined. The extract did not produce signs of toxicity. For the subchronic toxicity test, the extract at doses of 300, 600 and 1,200 mg/kg body weight was orally administered to rats daily for 90 days (10 male, 10 female. The observation of signs, behavior and health status showed no abnormality in the test groups as compared with the controls. At the end of the study, necropsy and histopathology examination were performed in all animals in the control group, the test groups and the satellite group in which the extract was discontinued for another 28 days. Body and organ weights, hematological and blood clinical chemistry were also examined. The results suggest that the water extract of Imperata cylindrica (Linn. Raeusch does not cause acute and subchronic toxicities in rats.

  2. The responses of antioxidant system in bitter melon, sponge gourd, and winter squash under flooding and chilling stresses

    Science.gov (United States)

    Do, Tuong Ha; Nguyen, Hoang Chinh; Lin, Kuan-Hung

    2018-04-01

    The objective of this paper was to review the responses of antioxidant system and physiological parameters of bitter melon (BM), sponge gourd (SG), and winter squash (WS) under waterlogged and low temperature conditions. The BM and SG plants were subjected to 0-72 h flooding treatments, and BM and WS plants were exposed to chilling at 12/7 °C (day/night) for 0-72 h. Different genotypes responded differently to environmental stress according to their various antioxidant system and physiological parameters. Increased ascorbate peroxidase (APX) and superoxide dismutase (SOD) activities provided SG and WS plants with increased waterlogging and chilling stress tolerance, respectively, compared to BM plants. The APX gene from SG and the SOD gene from WS were then cloned, and the regulation of APX and SOD gene expressions under flooding and chilling stress, respectively, were also measured. Increased expression of APX and SOD genes was accompanied by the increased activity of the enzyme involved in detoxifying reactive oxygen species (ROS) in response to those stresses. Both APX and SOD activities can be used for selecting BM lines with the best tolerances to water logging and chilling stresses.

  3. Proteomic study related to vascular connections in watermelon scions grafted onto bottle-gourd rootstock under different light intensities.

    Directory of Open Access Journals (Sweden)

    Sowbiya Muneer

    Full Text Available Although grafting is broadly used in the production of crops, no information is available about the proteins involved in vascular connections between rootstock and scion. Similarly, proteome changes under the light intensities widely used for grafted seedlings are of practical use. The objective of this study was to determine the proteome of vascular connections using watermelon (Citrullus vulgaris Schrad. 'Sambok Honey' and 'Speed' as the scion and bottle gourd (Lagenaria siceraria Stanld. 'RS Dongjanggun' as the rootstock grown under different light intensities (25, 50, 75 and 100 μmol m-2 s-1. Our proteomic analysis revealed 24 and 27 differentially expressed proteins in 'Sambok Honey' and 'Speed', respectively, under different light intensities. The identified proteins were largely involved in ion binding, amino acid metabolism, transcriptional regulation and defense response. The enhancement of ion-binding, transcriptional regulation, amino acid metabolism, and defense response proteins suggests a strengthening of the connection between the rootstock and scion under high light intensity. Indeed, the accumulation of key enzymes in the biological processes described above appears to play an important role in the vascular connections of grafted seedlings. Moreover, it appears that 100 μmol m-2 s-1 results in better protein expression responses in grafted seedlings.

  4. An Empirical Study for the Mobile Food Trace ability: Private Trace ability System for the White Gourd in Tianjin, China

    Directory of Open Access Journals (Sweden)

    Liu Yu-Chuan

    2016-01-01

    Full Text Available As the food supply chain globalization became inevitable, transparency in the way agriculture was grown and handled throughout the supply chain process resulted in an important issue of ‘traceability’ in global food trade and safety for health management. Traceability in agriculture is faced with the technological challenges including food product label and identification, activity/process characterization, information systems for data capture, analysis, storage, and the integration of the overall traceable data for the supply chain, i.e., from farm to table. While some field data can be automatically acquired and transmitted by sensor networking, most agricultural activity information was recorded by manual handwriting for the traceability information systems. System architecture, operation scenarios, and the implementation examples for the mobile farming data collection system to automatically record the agricultural activities information for famers were proposed in this research. The farming information for farming activities is coded in two-dimensional labels of quick response (QR codes. By scanning the proper operation labels, the corresponding farming data can be captured and uploaded simultaneously to the back-end web server. A collaborative research project for the traceability of white gourd planting in Tianjin was performed. The system can be implemented for public traceability system data collection and importing, as well as playing the roles of a private traceability system. The consumers’ confidence for healthy food choices with clear food traceability can be improved.

  5. [Effects of water table manipulation on leaf photosynthesis, morphology and growth of Phragmites australis and Imperata cylindrica in the reclaimed tidal wetland at Dongtan of Chongming Island, China].

    Science.gov (United States)

    Zhong, Qi-Cheng; Wang, Jiang-Tao; Zhou, Jian-Hong; Ou, Qiang; Wang, Kai-Yun

    2014-02-01

    During the growing season of 2011, the leaf photosynthesis, morphological and growth traits of Phragmites australis and Imperata cylindrica were investigated along a gradient of water table (low, medium and high) in the reclaimed tidal wetland at the Dongtan of Chongming Island in the Yangtze Estuary of China. A series of soil factors, i. e., soil temperature, moisture, salinity and inorganic nitrogen content, were also measured. During the peak growing season, leaf photosynthetic capacity of P. australis in the wetland with high water table was significantly lower than those in the wetland with low and medium water tables, and no difference was observed in leaf photosynthetic capacity of I. cylindrica at the three water tables. During the entire growing season, at the shoot level, the morphological and growth traits of P. australis got the optimum in the wetland with medium water table, but most of the morphological and growth traits of I. cylindrica had no significant differences at the three water tables. At the population level, the shoot density, leaf area index and aboveground biomass per unit area were the highest in the wetland with high water table for P. australis, but all of the three traits were the highest in the wetland with low water table for I. cylindrica. At the early growing season, the rhizome biomass of P. australis in the 0-20 cm soil layer had no difference at the three water tables, and the rhizome biomass of I. cylindrica in the 0-20 cm soil layer in the wetland with high water table was significantly lower than those in the wetland with low and medium water table. As a native hygrophyte before the reclamation, the variations of performances of P. australis at the three water tables were probably attributed to the differences in the soil factors as well as the intensity of competition from I. cylindrica. To appropriately manipulate water table in the reclaimed tidal wetland may restrict the growth and propagation of the mesophyte I

  6. Bottle gourd rootstock-grafting promotes photosynthesis by regulating the stomata and non-stomata performances in leaves of watermelon seedlings under NaCl stress.

    Science.gov (United States)

    Yang, Yanjuan; Yu, Li; Wang, Liping; Guo, Shirong

    2015-08-15

    Previously, we found that the amelioration of photosynthetic capacity by bottle gourd (Lagenaria siceraria Standl.) rootstock in watermelon seedlings (Citrullus lanatus [Thunb.] Mansf.) with salt treatment might be closely related to the enzymes in Calvin cycle such as ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) (Yang et al., 2012). We confirmed this and showed more details in this study that improved photosynthesis of watermelon plants by bottle gourd rootstock was associated with the decreased stomata resistance and the increased photochemical activity and photosynthetic metabolism with or without 100mM NaCl stress for 3 days. The analysis of gas exchange parameters showed that self-grafted plants suffered serious non-stomatal limitation to photosynthesis under salt stress while rootstock-grafted plants were mainly affected by stomata limitation in stress conditions. Further, results showed that NaCl stress markedly reduced the chlorophyll content, damaged the structure of photosynthetic apparatus, and inhibited photochemical activity and CO2 assimilation in self-grafted plants. In contrast, rootstock-grafting increased the chlorophyll content, especially chlorophyll b, and minimized the harmful effects on photosystem II (PSII) reaction center and the thylakoids structure induced by NaCl stress. Furthermore, rootstock-grafting enhanced the content and activity of Rubisco and thus elevated carbon fixation in the leaves of watermelon scions under salt stress. The gene expressions of enzymes related to ribulose-1,5-bisphosphate (RuBP) regeneration were also up-regulated by rootstock and this probably guaranteed the sufficient supply of RuBP for the operation of Calvin cycle in watermelon scions under salt stress. Thus, bottle gourd rootstock promoted photosynthesis by the activation of stomatal and non-stomatal abilities, especially the regulation of a variety of photosynthetic enzymes, including Rubisco in grafted watermelon plants under NaCl stress

  7. Evaluation of three immobilization supports and two nutritional ...

    African Journals Online (AJOL)

    Polyurethane foam, Luffa cylindrica sponge and Ca-alginate (3% w/v) were evaluated as immobilization supports for removing reactive black 5 dye using the white rot fungus Trametes versicolor at 1, 4 and 8 days of colonization. According to statistical results, the L. cylindrica sponge was the best support at 4 days of ...

  8. Morphology-Property relationship of high density Polyethylene/Hevea Brasiliensis Leaves/Imperata cylindrica hybrid composite: Impact strength

    Science.gov (United States)

    Rashidi, A. R.; Muhammad, A.; Roslan, A.

    2017-09-01

    This research studies about the Hevea Brasiliensis Leaves and Imperata Cylindrica that was used as filler in High Density Polyethylene (HDPE). The fillers content were varied in the composite by 5 wt%, 15 wt% and 25 wt% respectively. This polymer composite are being studied by using Impact Test and Scanning Electron Microscopy (SEM). The analysis show that the impact strength value increased when the percent of bio filler used is low. The result between pure HDPE and the composites shows an outcome of significant changes in impact energy values, while the values between different composite change slightly. A composite that contained 5 wt% of fillers is the better energy absorber than 15 wt% and 25 wt% according to impact testing. In addition, the morphology studies on the composite sample show that the bio-filler was successfully embedded. Overall, these finding suggest that HBL and IC can be an alternative filler to be incorporated in polymer matrix.

  9. Genome-wide identification and comparative analysis of grafting-responsive mRNA in watermelon grafted onto bottle gourd and squash rootstocks by high-throughput sequencing.

    Science.gov (United States)

    Liu, Na; Yang, Jinghua; Fu, Xinxing; Zhang, Li; Tang, Kai; Guy, Kateta Malangisha; Hu, Zhongyuan; Guo, Shaogui; Xu, Yong; Zhang, Mingfang

    2016-04-01

    Grafting is an important agricultural technique widely used to improve plant growth, yield, and adaptation to either biotic or abiotic stresses. However, the molecular mechanisms underlying grafting-induced physiological processes remain unclear. Watermelon (Citrullus lanatus L.) is an important horticultural crop worldwide. Grafting technique is commonly used in watermelon production for improving its tolerance to stresses, especially to the soil-borne fusarium wilt disease. In the present study, we used high-throughput sequencing to perform a genome-wide transcript analysis of scions from watermelon grafted onto bottle gourd and squash rootstocks. Our transcriptome and digital gene expression (DGE) profiling data provided insights into the molecular aspects of gene regulation in grafted watermelon. Compared with self-grafted watermelon, there were 787 and 3485 genes differentially expressed in watermelon grafted onto bottle gourd and squash rootstocks, respectively. These genes were associated with primary and secondary metabolism, hormone signaling, transcription factors, transporters, and response to stimuli. Grafting led to changes in expression of these genes, suggesting that they may play important roles in mediating the physiological processes of grafted seedlings. The potential roles of the grafting-responsive mRNAs in diverse biological and metabolic processes were discussed. Obviously, the data obtained in this study provide an excellent resource for unraveling the mechanisms of candidate genes function in diverse biological processes and in environmental adaptation in a graft system.

  10. Colobopsis explodens sp. n., model species for studies on “exploding ants” (Hymenoptera, Formicidae), with biological notes and first illustrations of males of the Colobopsis cylindrica group

    OpenAIRE

    Alice Laciny; Herbert Zettel; Alexey Kopchinskiy; Carina Pretzer; Anna Pal; Kamariah Abu Salim; Mohammad Javad Rahimi; Michaela Hoenigsberger; Linda Lim; Weeyawat Jaitrong; Irina S. Druzhinina

    2018-01-01

    A taxonomic description of all castes of Colobopsis explodens Laciny & Zettel, sp. n. from Borneo, Thailand, and Malaysia is provided, which serves as a model species for biological studies on “exploding ants” in Southeast Asia. The new species is a member of the Colobopsis cylindrica (COCY) group and falls into a species complex that has been repeatedly summarized under the name Colobopsis saundersi (Emery, 1889) (formerly Camponotus saundersi). The COCY species group is known under ...

  11. Colobopsis explodens sp. n., model species for studies on "exploding ants" (Hymenoptera, Formicidae), with biological notes and first illustrations of males of the Colobopsis cylindrica group

    OpenAIRE

    Laciny, Alice; Zettel, Herbert; Kopchinskiy, Alexey; Pretzer, Carina; Pal, Anna; Abu Salim, Kamariah; Javad Rahimi, Mohammad; Hoenigsberger, Michaela; Lim, Linda; Jaitrong, Weeyawat; Druzhinina, Irina S.

    2018-01-01

    A taxonomic description of all castes of Colobopsis explodens Laciny & Zettel, sp. n. from Borneo, Thailand, and Malaysia is provided, which serves as a model species for biological studies on "exploding ants" in Southeast Asia. The new species is a member of the Colobopsis cylindrica (COCY) group and falls into a species complex that has been repeatedly summarized under the name Colobopsis saundersi (Emery, 1889) (formerly Camponotus saundersi). The COCY species group is known under its vern...

  12. UJI AKTIVITAS ANTIOKSIDAN DARI EKSTRAK CAMPURAN TUMBUHAN ALANG-ALANG (Imperata cylindrica) DAN LIDAH ULAR (Hedyotis corymbosa) SEBAGAI PEREDAM RADIKAL BEBAS ASAM LINOLEAT

    OpenAIRE

    Syana Asri Nurmuhaimina; Resna Maulia; Isnani Yuniarti; Dewi Umaningrum

    2009-01-01

    Telah dilakukan penelitian tentang uji aktivitas antioksidan campuran ekstrak alang-alang (Imperata cylindrica) dan lidah ular (Hedyotis corymbrosa) sebagai peredam radikal bebas asam linoleat. Penelitian ini dilakukan untuk mengetahui seberapa besar kemampuan dari ekstrak campuran alang-alang dan lidah ular dalam meredam radikal bebas asam linoleat. Penelitian ini meliputi uji kualitatif identifikasi metabolit sekunder yang terdapat pada tumbuhan alang-alang dan lidah ular serta uji aktivita...

  13. A PCR-based genotyping method to distinguish between wild-type and ornamental varieties of Imperata cylindrica.

    Science.gov (United States)

    Cseke, Leland J; Talley, Sharon M

    2012-02-20

    Wild-type I. cylindrica (cogongrass) is one of the top ten worst invasive plants in the world, negatively impacting agricultural and natural resources in 73 different countries throughout Africa, Asia, Europe, New Zealand, Oceania and the Americas(1-2). Cogongrass forms rapidly-spreading, monodominant stands that displace a large variety of native plant species and in turn threaten the native animals that depend on the displaced native plant species for forage and shelter. To add to the problem, an ornamental variety [I. cylindrica var. koenigii (Retzius)] is widely marketed under the names of Imperata cylindrica 'Rubra', Red Baron, and Japanese blood grass (JBG). This variety is putatively sterile and noninvasive and is considered a desirable ornamental for its red-colored leaves. However, under the correct conditions, JBG can produce viable seed (Carol Holko, 2009 personal communication) and can revert to a green invasive form that is often indistinguishable from cogongrass as it takes on the distinguishing characteristics of the wild-type invasive variety(4) (Figure 1). This makes identification using morphology a difficult task even for well-trained plant taxonomists. Reversion of JBG to an aggressive green phenotype is also not a rare occurrence. Using sequence comparisons of coding and variable regions in both nuclear and chloroplast DNA, we have confirmed that JBG has reverted to the green invasive within the states of Maryland, South Carolina, and Missouri. JBG has been sold and planted in just about every state in the continental U.S. where there is not an active cogongrass infestation. The extent of the revert problem in not well understood because reverted plants are undocumented and often destroyed. Application of this molecular protocol provides a method to identify JBG reverts and can help keep these varieties from co-occurring and possibly hybridizing. Cogongrass is an obligate outcrosser and, when crossed with a different genotype, can produce

  14. Luffa echinata Roxb. Induces Human Colon Cancer Cell (HT-29 Death by Triggering the Mitochondrial Apoptosis Pathway

    Directory of Open Access Journals (Sweden)

    Yan Yu

    2012-05-01

    Full Text Available The antiproliferative properties and cell death mechanism induced by the extract of the fruits of Luffa echinata Roxb. (LER were investigated. The methanolic extract of LER inhibited the proliferation of human colon cancer cells (HT-29 in both dose-dependent and time-dependent manners and caused a significant increase in the population of apoptotic cells. In addition, obvious shrinkage and destruction of the monolayer were observed in LER-treated cells, but not in untreated cells. Analysis of the cell cycle after treatment of HT-29 cells with various concentrations indicated that LER extracts inhibited the cellular proliferation of HT-29 cells via G2/M phase arrest of the cell cycle. The Reactive oxygen species (ROS level determination revealed that LER extracts induced apoptotic cell death via ROS generation. In addition, LER treatment led to a rapid drop in mitochondrial membrane potential (MMP as a decrease in fluorescence. The transcripts of several apoptosis-related genes were investigated by RT-PCR analysis. The caspase-3 transcripts of HT-29 cells significantly accumulated and the level of Bcl-XL mRNA was decreased after treatment with LER extract. Furthermore, the ratio of mitochondria-dependent apoptosis genes (Bax and Bcl-2 was sharply increased from 1.6 to 54.1. These experiments suggest that LER has anticancer properties via inducing the apoptosis in colon cancer cells, which provided the impetus for further studies on the therapeutic potential of LER against human colon carcinoma.

  15. Effect of radiation processing on shelf life and antioxidant properties of minimally processed ready to cook (RTC) cauliflower and ash gourd

    International Nuclear Information System (INIS)

    Vaishnav, Jasraj; Tripathi, Jyoti; Variyar, Prasad S.

    2017-01-01

    The demand for minimally processed vegetables are increasing because consumers now spend less time for cooking every day due to their busy life style, while insisting on more hygienic premium quality products with minimal change in nutritional and sensory properties. Minimally processed cauliflower and ash gourd products were developed using radiation processing. Products were irradiated with different doses of gamma radiation (0.5-2.5kGy), and stored at different temperatures (4,10 and 15 °C). At optimum processing conditions (0.5 kGy; 4 °C) RTC cauliflower was analyzed for their microbial and nutritional qualities (DPPH radical scavenging activity, total phenolic content, total flavonoid content and total ascorbic acid content) during a storage period of 21 days. An irradiation dose of 0.5 kGy extended the shelf life by 7 days as compared to the control which has shelf life of 14 days, along with significant increase in DPPH radical scavenging activity and total phenolic content. While in case of RTC ash gourd, optimum processing condition (2kGy;10 ° C) improved the shelf life by 7 days in comparison to control samples which have shelflife of 5 days. Irradiated samples had total phenolic content of 103.3 ± 5.2 mg kg"-"1 and total antioxidant activity of 384.2 ± 9.7 mg kg"-"1 while corresponding values for control samples were 67.8 ± 5.4 and 115.5 ± 7.0 mg kg"-1 at the end of storage period. However no significant effect was observed in total ascorbic acid content in both the products due to radiation processing. (author)

  16. In vitro and in vivo α-amylase and α-glucosidase inhibiting activities of the protein extracts from two varieties of bitter gourd (Momordica charantia L.).

    Science.gov (United States)

    Poovitha, Sundar; Parani, Madasamy

    2016-07-18

    α-amylase and α-glucosidase digest the carbohydrates and increase the postprandial glucose level in diabetic patients. Inhibiting the activity of these two enzymes can control postprandial hyperglycemia, and reduce the risk of developing diabetes. Bitter gourd or balsam pear is one of the important medicinal plants used for controlling postprandial hyperglycemia in diabetes patients. However, there is limited information available on the presence of α-amylase and α-glucosidase inhibiting compounds. In the current study, the protein extracts from the fruits of M. charantia var. charantia (MCC) and M. charantia var. muricata (MCM) were tested for α-amylase and α-glucosidase inhibiting activities in vitro, and glucose lowering activity after oral administration in vivo. The protein extract from both MCC and MCM inhibited the activity of α-amylase and α-glucosidase through competitive inhibition, which was on par with Acarbose as indicated by in vitro percentage of inhibition (66 to 69 %) and IC50 (0.26 to 0.29 mg/ml). Both the protein extracts significantly reduced peak blood glucose and area under the curve in Streptozotocin-induced diabetic rats, which were orally challenged with starch and sucrose. Protein extracts from the fruits of the two varieties of bitter gourd inhibited α-amylase and α-glucosidase in vitro and lowered the blood glucose level in vivo on par with Acarbose when orally administrated to Streptozotocin-induced diabetic rats. Further studies on mechanism of action and methods of safe and biologically active delivery will help to develop an anti-diabetic oral protein drug from these plants.

  17. Optimasi Konsentrasi Ekstrak Alang-Alang (Imperata cylindrica L. untuk Memacu Pertumbuhan dan Produksi Jagung Manis (Zea mays Saccharata Sturt

    Directory of Open Access Journals (Sweden)

    Mayta Novaliza Isda

    2016-03-01

    Full Text Available Sweet corn (Zea mays saccharata Struts a type of corn of high economic value, not only used for consumption also used to make syrup. Imperata is one of the weeds that interfere with crop cultivation, but efforts continue to be made use of weeds as an addition to soil organic matter. The study was conducted to determine the concentration of the extract Imperata (Imperata cylindrica L. appropriate in the sweet corn growth and determine the concentration of extract proper Imperata in the growth and production. The research method is a Completely Randomized Design (CRD with 9 treatments and 3 replicates. The results showed that treatment of Imperata extracts with varying concentrations significantly influenced the growth of plant height and leaf number. But not significantly to the growth of the leaf length, leaf width, stem diameter, number of rows per cob, number of seeds per row and plant dry weight. At a concentration of 200 g / 250 ml was able to reduce the vegetative and generative growth of sweet corn.

  18. Biosynthesis and characterization of ZnO nanoparticles using the aqueous leaf extract of Imperata cylindrica L.

    Science.gov (United States)

    Saputra, I. S.; Yulizar, Y.

    2017-04-01

    ZnO nanoparticles (ZnO NPs) were biosynthesized.The growth was observed by a sol-gel method. ZnO were successfully formed through the reaction of zinc nitrate tetrahydrate Zn(NO3)2.4H2O precursor with aqueous leaf extract of Imperata cylindrica L (ICL). The structural and optical properties of ZnO were investigated. The as-synthesized products were characterized by UV-Visible (UV-Vis), UV diffuse reflectance spectroscopy (UV-DRS), Fourier transform infrared spectroscopy (FTIR), X-ray diffraction (XRD), scanning electron microscopy (SEM), and energy-dispersive X-ray spectroscopy (EDS). UV-Vis absorption data showed hydrolysis and characteristic of absorption peak at 300 nm of Zn(OH)2. UV-DRS confirmed that ZnO NPs has the indirect band gap at 3.13 eV. FTIR spectrum revealed the functional groups and indicated the presence of protein as the capping and stabilizing agent on the ZnO surface. Powder XRD studies indicated the formation of pure wurtzite hexagonal structure with particle size of 11.9 nm. The detailed morphological and structural characterizations revealed that the synthesized products were hexagonal nanochip.

  19. The Heterogeneity of the Internal Transcribed Spacers (ITS of rDNAs in Imperata cylindrica in Taiwan

    Directory of Open Access Journals (Sweden)

    Chi-Chu Tsai

    2000-09-01

    Full Text Available Ribosomal DNA for internal transcribed spacers ITS, ITS1, 5.8S rRNA gene, ITS2 and the adjoining regions of the 17S and 25S rRNA genes were obtained from 45 individuals of Imperata cylindrica (Cogongrass in Taiwan via PCR amplification. The length of each PCR product was 692 bp, except for one sample (about 702 bp. All ITS DNA fragments were digested with EcoRV, CfoI, BanI, HaeIII, MspI, HinfI, BstOI, Sau96I, StyI and Eco109I, respectively. The ITS, including ITS1, 5.8S rRNA gene and ITS2, were very heterogeneous within an individual of Cogongrass in Taiwan. Of 45 individuals of Cogongrass in Taiwan, the ITS1 and ITS2 regions showed at least eight type variants, and 5.8S rRNA gene showed at least five type variants among Cogongrass population in Taiwan based on PCR-amplified RFLP. In conclusion, the ITS repeat sequences from Cogongrass in Taiwan was very high heterogeneous.

  20. The effects of soil flooding on the establishment of cogongrass (Imperata cylindrica), a nonindigenous invader of the southeastern United States

    Science.gov (United States)

    King, S.E.; Grace, J.B.

    2000-01-01

    Cogongrass (Imperata cylindrica), an invasive perennial introduced from Southeast Asia, is currently spreading throughout the southeastern United States from Florida to Louisiana. In the U.S., cogongrass is generally not considered a wetland species, although it's range is expanding in regions with high wetland abundance. The objective of this study was to determine if excessive soil moisture might prevent cogongrass from establishing in areas with seasonally flooded soils. In one greenhouse experiment, we examined cogongrass germination and seedling growth in soils that were freely drained, saturated, and inundated. We performed a second greenhouse experiment to evaluate growth and survival of cogongrass seedlings of four different size classes in five soil moisture treatments ranging from dry to inundated. Cogongrass germination was lowest when seeds were overtopped with water. There were no differences in germination between saturated and freely drained treatments; however, seedlings grew largest in freely drained soil and were smallest when immersed. In our second experiment, most cogongrass plants survived except when given no water, but growth differed by watering treatment depending on seedling size. Increasing moisture was more detrimental to the growth of small seedlings compared to the growth of larger cogongrass plants. Overall, cogongrass was most sensitive to soil inundation in the earliest stages of establishment; thus, excessive moisture conditions in the spring, during early seedling development, could restrict invasion of cogongrass by seed. Once cogongrass is established, however, its tolerance of flooding appears to increase.

  1. Development of novel simple sequence repeat markers in bitter gourd (Momordica charantia L.) through enriched genomic libraries and their utilization in analysis of genetic diversity and cross-species transferability.

    Science.gov (United States)

    Saxena, Swati; Singh, Archana; Archak, Sunil; Behera, Tushar K; John, Joseph K; Meshram, Sudhir U; Gaikwad, Ambika B

    2015-01-01

    Microsatellite or simple sequence repeat (SSR) markers are the preferred markers for genetic analyses of crop plants. The availability of a limited number of such markers in bitter gourd (Momordica charantia L.) necessitates the development and characterization of more SSR markers. These were developed from genomic libraries enriched for three dinucleotide, five trinucleotide, and two tetranucleotide core repeat motifs. Employing the strategy of polymerase chain reaction-based screening, the number of clones to be sequenced was reduced by 81 % and 93.7 % of the sequenced clones contained in microsatellite repeats. Unique primer-pairs were designed for 160 microsatellite loci, and amplicons of expected length were obtained for 151 loci (94.4 %). Evaluation of diversity in 54 bitter gourd accessions at 51 loci indicated that 20 % of the loci were polymorphic with the polymorphic information content values ranging from 0.13 to 0.77. Fifteen Indian varieties were clearly distinguished indicative of the usefulness of the developed markers. Markers at 40 loci (78.4 %) were transferable to six species, viz. Momordica cymbalaria, Momordica subangulata subsp. renigera, Momordica balsamina, Momordica dioca, Momordica cochinchinesis, and Momordica sahyadrica. The microsatellite markers reported will be useful in various genetic and molecular genetic studies in bitter gourd, a cucurbit of immense nutritive, medicinal, and economic importance.

  2. Pengaruh Campuran Ampas Tebu Dan Alang-Alang (Imperata Cylindrica) Sebagai Media Pertumbuhan Terhadap Kandungan Nutrisi Jamur Tiram Putih (Pleurotus Ostreatus)

    OpenAIRE

    Naila, Ishmatun; Purnomo, Adi Setyo

    2016-01-01

    Penelitian ini bertujuan untuk mengetahui pengaruh ampas tebu dan alang-alang (Imperata cylindrica) sebagai media pertumbuhan jamur tiram putih (Pleurotus ostreatus) terhadap kandungan nutrisinya. Ampas tebu dan alang-alang dipilih sebagai media pertumbuhan alternatif, karena tidak hanya mengandung lignoseluosa, tapi juga tersedia berlimpah di lingkungan. Variasi komposisi ampas tebu:alang-alang yang digunakan adalah 75:25 (A1); 50:50 (A2); 25:75 (A3); 0:100 (A4); dan 100:0 (A5). Pada penelit...

  3. PEMANFAATAN ASAP CAIR ALANG-ALANG (Imperata cylindrica SEBAGAI PENGAWET TERHADAP KARAKTERISTIK BUAH PISANG MAKAU (Musa spp.

    Directory of Open Access Journals (Sweden)

    Dian Fitriarni

    2018-03-01

    Full Text Available Research on the utilization of liquid smoke especially for preservation of fruit has been done and become one of alternative methods that can be used to maintain fruit shelf life. Liquid smoke raw materials can come from a variety of sources one of which comes from the Alang-alang (Imperata cylindrica. This study aims to determine the ability of liquid smoke made from  alang-alang as a preservative of bananas and to know the effect on the characteristics of bananas. The sample used in this research is a local banana known as Pisang Makau (Musa spp. This research uses experimental method with 7 days of storage time. Initial stages of the research are cleaning the fruit, dyeing, drying, and storage at room temperature. This research uses liquid smoke from alang-alang by using 2 various concentrations 50% and 100%. The next stage is the analysis of the characteristics of bananas such as color, fruit texture, fruit weight, sugar content, and vitamin C levels. Based on the analysis results obtained by Pisang Makau with the treatment of liquid has a longer shelf life than the control. Based on the results of the analysis of the shelf life of fruit treated with liquid smoke decreased levels of sugar and vitamin C levels. Percentage decrease levels of sugar and vitamin C between the fruit with the treatment and control not much different. This shows that liquid smoke from alang-alang has the ability to retain the shelf life of bananas without affecting sugar and vitamin C levels in bananas in this case for Pisang Makau. Levels of sugar and vitamin C in bananas decreased during the process of storage and bunding of fruit

  4. Allelopathic exudates of cogongrass (Imperata cylindrica): implications for the performance of native pine savanna plant species in the southeastern US.

    Science.gov (United States)

    Hagan, Donald L; Jose, Shibu; Lin, Chung-Ho

    2013-02-01

    We conducted a greenhouse study to assess the effects of cogongrass (Imperata cylindrica) rhizochemicals on a suite of plants native to southeastern US pine savanna ecosystems. Our results indicated a possible allelopathic effect, although it varied by species. A ruderal grass (Andropogon arctatus) and ericaceous shrub (Lyonia ferruginea) were unaffected by irrigation with cogongrass soil "leachate" (relative to leachate from mixed native species), while a mid-successional grass (Aristida stricta Michx. var. beyrichiana) and tree (Pinus elliottii) were negatively affected. For A. stricta, we observed a 35.7 % reduction in aboveground biomass, a 21.9 % reduction in total root length, a 24.6 % reduction in specific root length and a 23.5 % reduction in total mycorrhizal root length, relative to the native leachate treatment. For P. elliottii, there was a 19.5 % reduction in percent mycorrhizal colonization and a 20.1 % reduction in total mycorrhizal root length. Comparisons with a DI water control in year two support the possibility that the treatment effects were due to the negative effects of cogongrass leachate, rather than a facilitative effect from the mixed natives. Chemical analyses identified 12 putative allelopathic compounds (mostly phenolics) in cogongrass leachate. The concentrations of most compounds were significantly lower, if they were present at all, in the native leachate. One compound was an alkaloid with a speculated structure of hexadecahydro-1-azachrysen-8-yl ester (C23H33NO4). This compound was not found in the native leachate. We hypothesize that the observed treatment effects may be attributable, at least partially, to these qualitative and quantitative differences in leachate chemistry.

  5. Role of Antidesma ghaesembilla Gaertn in Enriching the Depauperate Bird Community in “Cogon” Imperata cylindrica (L. Raeuschel Dominated Grassland in Swidden Vegetation Matrix

    Directory of Open Access Journals (Sweden)

    Alejandro A. Bernardo Jr.

    2017-11-01

    Full Text Available The study was conducted to understand the role of Antidesma ghaesembilla Gaertn in enhancing the avifaunal diversity in Imperata cylindrica (L. Raeuschel dominated grassland patches and to realize the influence of adjacent vegetations on the assemblage of birds that feed on the fruit of this tree. An avifaunal survey was conducted on “Cogon” dominated grassland patches adjacent to selected vegetations such as primary forest, secondary forest and upland agricultural area. A total of 250 birds belonging to 19 species representing ten families were found feeding on the fruits of Antidesma ghaesembilla. The site adjacent to secondary forest has the highest species richness, abundance and diversity index values. This accentuates the combined influence of the open and forest dwelling bird species thriving in the secondary forest. The sites adjacent to the primary forest and to the agricultural area have the same species richness but differ in species composition as reflected by the low similarity index. More forest dwelling bird species were recorded near the forest while more open dwelling bird species were recorded near the agricultural area. This highlights the spillover effect of the adjacent vegetations on the feeding bird assemblage. The presence of several endemic and conservation priority bird species that feed on the fruits of Antidesma ghaesembilla unfolds its important role in avifaunal conservation. Finally, the wide collection of fruit eating bird species attracted to it emphasized its importance in improving the overall avifaunal diversity in Imperata cylindrica dominated grassland patches within the swidden vegetation matrix.

  6. Model of the process with piecewise-constant extremals to minimize losses of vitamins during the melting of melons and gourds

    Directory of Open Access Journals (Sweden)

    E. V. Inochkina

    2017-01-01

    Full Text Available The extension of periods of storage of fruits of gourds is an urgent task processing industry. The most developed and available for injection is a method of dehydration of raw materials due to supply of heat transfer fluids. In addition to solid dry frame in raw materials is 80–90% water. In the period of moisture removal from raw material changes of thermal-physical and structural-mechanical and physicochemical characteristics. The ratio of water and dry matter in vegetative raw materials largely determines the modes of drying and storage conditions of the finished product. During drying, there are a number of limitations: the drying temperature should not exceed the degradation temperature of vitamins and proteins, and the magnitude of course, the moisture content of the product depends on the reaction prevention malonodinitrile sugars at the critical moisture content. An important problem of the drying of production is quality control stages of drying, the dynamics of which is quite difficult to describe using mathematical models. The main factors of optimization of industrial drying processes is preservation of valuable components of the feedstock, the drying time, energy and resource conservation. Development of effective control algorithm for the process of dehydration of raw materials described in the article on the example of drying of slices of melon. Experimental approach a two-stage process of drying of melon varieties Taman, the proposed regression model with the relaxation-based on humidity and content of vitamin C from the variable in time temperature and pressure, based on the available literature and own experimental data. According to the optimal control of the drying process to search for the thermobaric regime that maximizes the vitamin C content at the end of the drying, under specified conditions, the humidity. The main findings are the solution of the problem for the case of piecewise constant temperature and pressure in

  7. Cogongrass Imperata cylindrica

    Science.gov (United States)

    James H. Miller

    1999-01-01

    Plant: Aggressive, colony-forming perennial grass, mostly 0.5-1.2 m (1 1/2-4 ft) tall. with upright or matforming light green leaves having rough margins and an off-centered midrib, from sharp-tipped white-scaly rhizomes with fibrous roots.

  8. Phytoextraction of lead-contaminated soil using vetivergrass (Vetiveria zizanioides L.), cogongrass (Imperata cylindrica L.) and carabaograss (Paspalum conjugatum L.).

    Science.gov (United States)

    Paz-Alberto, Annie Melinda; Sigua, Gilbert C; Baui, Bellrose G; Prudente, Jacqueline A

    2007-11-01

    The global problem concerning contamination of the environment as a consequence of human activities is increasing. Most of the environmental contaminants are chemical by-products and heavy metals such as lead (Pb). Lead released into the environment makes its way into the air, soil and water. Lead contributes to a variety of health effects such as decline in mental, cognitive and physical health of the individual. An alternative way of reducing Pb concentration from the soil is through phytoremediation. Phytoremediation is an alternative method that uses plants to clean up a contaminated area. The objectives of this study were: (1) to determine the survival rate and vegetative characteristics of three grass species such as vetivergrass, cogongrass and carabaograss grown in soils with different Pb levels; and (2) to determine and compare the ability of the three grass species as potential phytoremediators in terms of Pb accumulation by plants. The three test plants: vetivergrass (Vetiveria zizanioides L.); cogongrass (Imperata cylindrica L.); and carabaograss (Paspalum conjugatum L.) were grown in individual plastic bags containing soils with 75 mg kg(-1) (37.5 kg ha(-1)) and 150 mg kg(-1) (75 kg ha(-1)) of Pb, respectively. The Pb contents of the test plants and the soil were analyzed before and after experimental treatments using an atomic absorption spectrophotometer. This study was laid out following a 3 x 2 factorial experiment in a completely randomized design. On the vegetative characteristics of the test plants, vetivergrass registered the highest whole plant dry matter weight (33.85-39.39 Mg ha(-1)). Carabaograss had the lowest herbage mass production of 4.12 Mg ha(-1) and 5.72 Mg ha(-1) from soils added with 75 and 150 mg Pb kg(-1), respectively. Vetivergrass also had the highest percent plant survival which meant it best tolerated the Pb contamination in soils. Vetivergrass registered the highest rate of Pb absorption (10.16 +/- 2.81 mg kg(-1)). This was

  9. Radiosensitivity and parameters for its measurement in some cucurbits

    Energy Technology Data Exchange (ETDEWEB)

    Vishnoi, A.K.; Joshi, M.C. (Defence Research and Development Organization, Almora (India). Agricultural Research Unit)

    1981-12-01

    Treatment with gamma-rays resulted in a significant reduction in the germination percentage and root and shoot lengths in Luffa cylindrica (inn). M. Roem, Momordica charantia Linn. Lagenaria siceraria (Mol.) Standl. and Cylanthera pedata Schrad., but radiation had no significant effect on nuclear volume. Species having higher value of nuclear volume had more radiosensitivity.

  10. Optimization of laccase and manganese peroxidase production in ...

    African Journals Online (AJOL)

    The effect of temperature, pH, carbon, nitrogen, Cu2+, 2,5- xylidine, ferulic acid, Mn2+ and immobilization using Luffa cylindrica sponges in submerged culture fermentations were investigated for maximum enzymes production. After 7 days of incubation, 83 to 100% oxidation of RBBR, ABTS and guaiacol was observed.

  11. Radiosensitivity and parameters for its measurement in some cucurbits

    International Nuclear Information System (INIS)

    Vishnoi, A.K.; Joshi, M.C.

    1981-01-01

    Treatment with gamma-rays resulted in a significant reduction in the germination percentage and root and shoot lengths in Luffa cylindrica (inn). M. Roem, Momordica charantia Linn. Lagenaria siceraria (Mol.) Standl. and Cylanthera pedata Schrad., but radiation had no significant effect on nuclear volume. Species having higher value of nuclear volume had more radiosensitivity. (author)

  12. Impact of transgene genome location on gene migration from herbicide-resistant wheat (Triticum aestivum L.) to jointed goatgrass (Aegilops cylindrica Host).

    Science.gov (United States)

    Rehman, Maqsood; Hansen, Jennifer L; Mallory-Smith, Carol A; Zemetra, Robert S

    2017-08-01

    Wheat (Triticum aestivum) (ABD) and jointed goatgrass (Aegilops cylindrica) (CD) can cross and produce hybrids that can backcross to either parent. Such backcrosses can result in progeny with chromosomes and/or chromosome segments retained from wheat. Thus, a herbicide resistance gene could migrate from wheat to jointed goatgrass. In theory, the risk of gene migration from herbicide-resistant wheat to jointed goatgrass is more likely if the gene is located on the D genome and less likely if the gene is located on the A or B genome of wheat. BC 1 populations (jointed goatgrass as a recurrent parent) were analyzed for chromosome numbers and transgene transmission rates under sprayed and non-sprayed conditions. Transgene retention in the non-sprayed BC 1 generation for the A, B and D genomes was 84, 60 and 64% respectively. In the sprayed populations, the retention was 81, 59 and 74% respectively. The gene transmission rates were higher than the expected 50% or less under sprayed and non-sprayed conditions, possibly owing to meiotic chromosome restitution and/or chromosome non-disjunction. Such high transmission rates in the BC 1 generation negates the benefits of gene placement for reducing the potential of gene migration from wheat to jointed goatgrass. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  13. Colobopsis explodens sp. n., model species for studies on “exploding ants” (Hymenoptera, Formicidae), with biological notes and first illustrations of males of the Colobopsis cylindrica group

    Science.gov (United States)

    Laciny, Alice; Zettel, Herbert; Kopchinskiy, Alexey; Pretzer, Carina; Pal, Anna; Salim, Kamariah Abu; Rahimi, Mohammad Javad; Hoenigsberger, Michaela; Lim, Linda; Jaitrong, Weeyawat; Druzhinina, Irina S.

    2018-01-01

    Abstract A taxonomic description of all castes of Colobopsis explodens Laciny & Zettel, sp. n. from Borneo, Thailand, and Malaysia is provided, which serves as a model species for biological studies on “exploding ants” in Southeast Asia. The new species is a member of the Colobopsis cylindrica (COCY) group and falls into a species complex that has been repeatedly summarized under the name Colobopsis saundersi (Emery, 1889) (formerly Camponotus saundersi). The COCY species group is known under its vernacular name “exploding ants” for a unique behaviour: during territorial combat, workers of some species sacrifice themselves by rupturing their gaster and releasing sticky and irritant contents of their hypertrophied mandibular gland reservoirs to kill or repel rivals. This study includes first illustrations and morphometric characterizations of males of the COCY group: Colobopsis explodens Laciny & Zettel, sp. n. and Colobopsis badia (Smith, 1857). Characters of male genitalia and external morphology are compared with other selected taxa of Camponotini. Preliminary notes on the biology of C. explodens Laciny & Zettel, sp. n. are provided. To fix the species identity of the closely related C. badia, a lectotype from Singapore is designated. The following taxonomic changes within the C. saundersi complex are proposed: Colobopsis solenobia (Menozzi, 1926), syn. n. and Colobopsis trieterica (Menozzi, 1926), syn. n. are synonymized with Colobopsis corallina Roger, 1863, a common endemic species of the Philippines. Colobopsis saginata Stitz, 1925, stat. n., hitherto a subspecies of C. badia, is raised to species level. PMID:29706783

  14. Colobopsis explodens sp. n., model species for studies on "exploding ants" (Hymenoptera, Formicidae), with biological notes and first illustrations of males of the Colobopsis cylindrica group.

    Science.gov (United States)

    Laciny, Alice; Zettel, Herbert; Kopchinskiy, Alexey; Pretzer, Carina; Pal, Anna; Salim, Kamariah Abu; Rahimi, Mohammad Javad; Hoenigsberger, Michaela; Lim, Linda; Jaitrong, Weeyawat; Druzhinina, Irina S

    2018-01-01

    A taxonomic description of all castes of Colobopsis explodens Laciny & Zettel, sp. n. from Borneo, Thailand, and Malaysia is provided, which serves as a model species for biological studies on "exploding ants" in Southeast Asia. The new species is a member of the Colobopsis cylindrica (COCY) group and falls into a species complex that has been repeatedly summarized under the name Colobopsis saundersi (Emery, 1889) (formerly Camponotus saundersi ). The COCY species group is known under its vernacular name "exploding ants" for a unique behaviour: during territorial combat, workers of some species sacrifice themselves by rupturing their gaster and releasing sticky and irritant contents of their hypertrophied mandibular gland reservoirs to kill or repel rivals. This study includes first illustrations and morphometric characterizations of males of the COCY group: Colobopsis explodens Laciny & Zettel, sp. n. and Colobopsis badia (Smith, 1857). Characters of male genitalia and external morphology are compared with other selected taxa of Camponotini. Preliminary notes on the biology of C. explodens Laciny & Zettel, sp. n. are provided. To fix the species identity of the closely related C. badia , a lectotype from Singapore is designated. The following taxonomic changes within the C. saundersi complex are proposed: Colobopsis solenobia (Menozzi, 1926), syn. n. and Colobopsis trieterica (Menozzi, 1926), syn. n. are synonymized with Colobopsis corallina Roger, 1863, a common endemic species of the Philippines. Colobopsis saginata Stitz, 1925, stat. n ., hitherto a subspecies of C. badia , is raised to species level.

  15. Exploring origins, invasion history and genetic diversity of Imperata cylindrica (L.) P. Beauv. (Cogongrass) in the United States using genotyping by sequencing.

    Science.gov (United States)

    Burrell, A Millie; Pepper, Alan E; Hodnett, George; Goolsby, John A; Overholt, William A; Racelis, Alexis E; Diaz, Rodrigo; Klein, Patricia E

    2015-05-01

    Imperata cylindrica (Cogongrass, Speargrass) is a diploid C4 grass that is a noxious weed in 73 countries and constitutes a significant threat to global biodiversity and sustainable agriculture. We used a cost-effective genotyping-by-sequencing (GBS) approach to identify the reproductive system, genetic diversity and geographic origins of invasions in the south-eastern United States. In this work, we demonstrated the advantage of employing the closely related, fully sequenced crop species Sorghum bicolor (L.) Moench as a proxy reference genome to identify a set of 2320 informative single nucleotide and insertion-deletion polymorphisms. Genetic analyses identified four clonal lineages of cogongrass and one clonal lineage of Imperata brasiliensis Trin. in the United States. Each lineage was highly homogeneous, and we found no evidence of hybridization among the different lineages, despite geographical overlap. We found evidence that at least three of these lineages showed clonal reproduction prior to introduction to the United States. These results indicate that cogongrass has limited evolutionary potential to adapt to novel environments and further suggest that upon arrival to its invaded range, this species did not require local adaptation through hybridization/introgression or selection of favourable alleles from a broad genetic base. Thus, cogongrass presents a clear case of broad invasive success, across a diversity of environments, in a clonal organism with limited genetic diversity. © 2015 John Wiley & Sons Ltd.

  16. Colobopsis explodens sp. n., model species for studies on “exploding ants” (Hymenoptera, Formicidae, with biological notes and first illustrations of males of the Colobopsis cylindrica group

    Directory of Open Access Journals (Sweden)

    Alice Laciny

    2018-04-01

    Full Text Available A taxonomic description of all castes of Colobopsis explodens Laciny & Zettel, sp. n. from Borneo, Thailand, and Malaysia is provided, which serves as a model species for biological studies on “exploding ants” in Southeast Asia. The new species is a member of the Colobopsis cylindrica (COCY group and falls into a species complex that has been repeatedly summarized under the name Colobopsis saundersi (Emery, 1889 (formerly Camponotus saundersi. The COCY species group is known under its vernacular name “exploding ants” for a unique behaviour: during territorial combat, workers of some species sacrifice themselves by rupturing their gaster and releasing sticky and irritant contents of their hypertrophied mandibular gland reservoirs to kill or repel rivals. This study includes first illustrations and morphometric characterizations of males of the COCY group: Colobopsis explodens Laciny & Zettel, sp. n. and Colobopsis badia (Smith, 1857. Characters of male genitalia and external morphology are compared with other selected taxa of Camponotini. Preliminary notes on the biology of C. explodens Laciny & Zettel, sp. n. are provided. To fix the species identity of the closely related C. badia, a lectotype from Singapore is designated. The following taxonomic changes within the C. saundersi complex are proposed: Colobopsis solenobia (Menozzi, 1926, syn. n. and Colobopsis trieterica (Menozzi, 1926, syn. n. are synonymized with Colobopsis corallina Roger, 1863, a common endemic species of the Philippines. Colobopsis saginata Stitz, 1925, stat. n., hitherto a subspecies of C. badia, is raised to species level.

  17. Cogon grass (Imperata cylindrica), a potential biomass candidate for bioethanol: cell wall structural changes enhancing hydrolysis in a mild alkali pretreatment regime.

    Science.gov (United States)

    Haque, Md Azizul; Barman, Dhirendra Nath; Kim, Min Keun; Yun, Han Dae; Cho, Kye Man

    2016-03-30

    Imperata cylindrica is being considered as a biomass candidate for bioethanol. This work aimed to evaluate a mild alkali pretreatment effect on the Imperata recalcitrant structure. Therefore, varied concentrations of NaOH (0, 7.5, 15, 20, and 25 g L(-1) ) were applied as treatments to Imperata at 105 °C for 10 min. Scanning electron microscopy, atomic force microscopy, and Fourier transform infrared spectroscopy studies revealed that 20 to 25 g L(-1) NaOH-treated Imperata exposed amorphous cellulose on surface granules composed of lignin, waxes, and partly hemicelluloses were abolished due to the comprehensive disruption of the linkages between lignin and carbohydrates. The cellulose crystalline index was increased with 7.5 to 20 g L(-1) NaOH treatments and reduced with a 25 g L(-1) NaOH treatment. In fact, the cellulose content in solids increased with the increasing NaOH concentration and was estimated to be 720 and 740 g kg(-1) for the 20 and 25 g L(-1) NaOH treatments, respectively. The yield of the reducing sugar was obtained 805 and 813 mg g(-1) from 20 and 25 g L(-1) NaOH-treated Imperata, respectively. Considering the cost of pretreatment, the 20 g L(-1) NaOH treatment is judged to be effective for disrupting Imperata recalcitrance in this pretreatment regime. © 2015 Society of Chemical Industry.

  18. Characterization of cogon grass (Imperata cylindrica) pollen extract and preliminary analysis of grass group 1, 4 and 5 homologues using monoclonal antibodies to Phleum pratense.

    Science.gov (United States)

    Kumar, L; Sridhara, S; Singh, B P; Gangal, S V

    1998-11-01

    Previous studies have established the role of Imperata cylindrica (Ic) pollen in type I allergic disorders. However, no systematic information is available on the allergen composition of Ic pollen extract. To characterize the IgE-binding proteins of Ic pollen extract and to detect the presence of grass group 1, 4 and 5 allergen homologues, if any. Pollen extract of Ic was analyzed by in vivo and in vitro procedures such as intradermal tests (ID), enzyme-linked immunosorbent assay (ELISA), ELISA-inhibition, thin-layer isoelectric focusing (TLIEF), sodium dodecylsulfate polyacrylamide gel electrophoresis (SDS-PAGE) and immunoblotting. Dot blot assay was carried out to check the presence of well-known group 1, 4, and 5 allergen homologues in Ic pollen extract. Out of 303 respiratory allergies patients skin-tested, 27 showed sensitivity to Ic pollen extract. Specific IgE levels were elevated in all 15 serum samples tested. The extract prepared for this study was found to be highly potent since it required only 400 ng of homologous proteins for 50% inhibition of binding in ELISA inhibition assays. TLIEF of Ic pollen extract showed 44 silver-stained bands (pI 3.5-7.0) while SDS-PAGE resolved it into 24 Coomassie-Brilliant-Blue-stained bands (MW 100-10 kD). Immunoblotting with individual patient sera recognized 7 major IgE-binding bands (MW 85, 62, 57, 43, 40, 28 and 16 kD) in Ic pollen extract. A panel of monoclonal antibodies, specific to group 1, 4 and 5 allergens from Phleum pratense pollen extract identified group 5 and group 4 homologues in Ic pollen extract. Ic pollen extract was characterized for the protein profile by TLIEF and SDS-PAGE. IgE reactivity was determined by ELISA and immunoblot. Monoclonal antibodies to group 5 and group 4 allergens reacted weakly showing that this pollen contains group 5 and group 4 homologous allergens.

  19. An ethnomedicinal survey of cucurbitaceae family plants used in the folk medicinal practices of Bangladesh 1

    Directory of Open Access Journals (Sweden)

    Mohammed Rahmatullah

    2012-01-01

    Full Text Available Background: The Cucurbitaceae family comprising about 125 genera and 960 species is a family that is further characterized by commonly having five-angled stems and coiled tendrils and is also known as gourd family of flowering plants. Plant species belonging to this family have a worldwide distribution, but most species can be found in tropical and subtropical countries. A number of the plants belonging to this family have reported important pharmacological activities. Cucurbitaceae family plants are also in use in the folk medicinal system of Bangladesh-a traditional medicinal system, which mainly relies on medicinal plants for treatment of diverse ailments. Aims: Since folk medicinal practitioners form the first tier of primary health care in Bangladesh, the objective of this study was to conduct ethnomedicinal surveys among 75 folk medicinal practitioners (Kavirajes practicing among the mainstream Bengali-speaking population of randomly selected 75 villages in 64 districts of Bangladesh and 8 tribal practitioners (1 each from 8 major indigenous communities or tribes, namely, Bede, Chakma, Garo, Khasia, Marma, Murong, Santal, and Tripura of the country. Materials and Methods: Surveys were carried out with the help of a semi-structured questionnaire and the guided field-walk method. Results: It was observed that the folk and tribal medicinal practitioners use a total of 19 Cucurbitaceae family species for treatment of ailments such as dysentery, diabetes, edema, skin disorders, leukoderma, hypertension, jaundice, typhoid, spleen disorders, respiratory problems, leprosy, rheumatoid arthritis, chicken pox, and cancer. The 19 species of Cucurbitaceae family plants in use were Benincasa hispida, Bryonopsis laciniosa, Citrullus colocynthis, Citrullus lanatu, Coccinia grandis, Cucumis melo, Cucumis sativus, Cucurbita maxima, Cucurbita pepo, Hodgsonia macrocarpa, Lagenaria vulgaris, Luffa acutangula, Luffa cylindrica, Momordica charantia, Momordica

  20. Cytotoxicity and modes of action of four Cameroonian dietary spices ethno-medically used to treat cancers: Echinops giganteus, Xylopia aethiopica, Imperata cylindrica and Piper capense.

    Science.gov (United States)

    Kuete, Victor; Sandjo, Louis P; Wiench, Benjamin; Efferth, Thomas

    2013-08-26

    Echinops giganteus, Imperata cylindrica, Piper capense and Xylopia aethiopica are four medicinal spices used in Cameroon to treat cancers. The above plants previously displayed cytotoxicity against leukemia CCRF-CEM and CEM/ADR5000 cell lines as well as human pancreatic MiaPaCa-2 cells. The present study aims at emphasizing the study of the cytotoxicity and the modes of action of the above plants on a panel of ten cancer cell lines including various sensitive and drug-resistant phenotypes. The study has been extended to the isolation of the bioactive constituents from Echinops giganteus. The cytotoxicity of the extracts was determined using a resazurin reduction assay, whereas the caspase-Glo assay was used to detect the activation of caspases 3/7, caspase 8 and caspase 9 in cells treated with the four extracts. Flow cytometry was used for cell cycle analysis and detection of apoptotic cells, analysis of mitochondrial membrane potential (MMP) as well as measurement of reactive oxygen species (ROS). The four tested extracts inhibited the proliferation of all tested cancer cell lines including sensitive and drug-resistant phenotypes. Collateral sensitivity of cancer cells to the extract of Echinops giganteus was generally better than to doxorubicin. The recorded IC50 ranges were 3.29 µg/mL [against human knockout clones HCT116 (p53(-/-)) colon cancer cells] to 14.32 µg/mL (against human liver hepatocellular carcinoma HepG2 cells) for the crude extract from Echinops giganteus, 4.17 µg/mL (against breast cancer cells transduced with control vector MDA-MB231 cells) to 19.45 µg/mL (against MDA-MB-231 BCRP cells) for that of Piper capense, 4.11 µg/mL (against leukemia CCRF-CEM cells) to 30.60 µg/mL (against leukemia HL60AR cells) for Xylopia aethiopica, 3.28 µg/mL [against HCT116 (p53(-/-)) cells] to 33.43 µg/mL (against HepG2 cells) for Imperata cylindica and 0.11 µg/mL (against CCRF-CEM cells) to 132.47 µg/mL (against HL60AR cells) for doxorubicin. The four

  1. Bitter gourd (Momordica charantia) as a rich source of bioactive components to combat cancer naturally: Are we on the right track to fully unlock its potential as inhibitor of deregulated signaling pathways.

    Science.gov (United States)

    Farooqi, Ammad Ahmad; Khalid, Sumbul; Tahir, Fatima; Sabitaliyevich, Uteuliev Yerzhan; Yaylim, Ilhan; Attar, Rukset; Xu, Baojun

    2018-05-10

    Research over decades has progressively explored pharmacological actions of bitter gourd (Momordica charantia). Biologically and pharmacologically active molecules isolated from M. charantia have shown significant anti-cancer activity in cancer cell lines and xenografted mice. In this review spotlight was set on the bioactive compounds isolated from M. charantia that effectively inhibited cancer development and progression via regulation of protein network in cancer cells. We summarize most recent high-quality research work in cancer cell lines and xenografted mice related to tumor suppressive role-play of M. charantia and its bioactive compounds. Although M. charantia mediated health promoting, anti-diabetic, hepatoprotective, anti-inflammatory effects have been extensively investigated, there is insufficient information related to regulation of signaling networks by bioactive molecules obtained from M. charantia in different cancers. M. charantia has been shown to modulate AKT/mTOR/p70S6K signaling, p38MAPK-MAPKAPK-2/HSP-27 pathway, cell cycle regulatory proteins and apoptosis-associated proteins in different cancers. However, still there are visible knowledge gaps related to the drug targets in different cancers because we have not yet developed comprehensive understanding of the M. charantia mediated regulation of signal transduction pathways. To explore these questions, experimental platforms are needed that can prove to be helpful in getting a step closer to personalized medicine. Copyright © 2018 Elsevier Ltd. All rights reserved.

  2. Nanoparticles in the fight against mosquito-borne diseases: bioactivity of Bruguiera cylindrica-synthesized nanoparticles against dengue virus DEN-2 (in vitro) and its mosquito vector Aedes aegypti (Diptera: Culicidae).

    Science.gov (United States)

    Murugan, Kadarkarai; Dinesh, Devakumar; Paulpandi, Manickam; Althbyani, Abdulaziz Dakhellah Meqbel; Subramaniam, Jayapal; Madhiyazhagan, Pari; Wang, Lan; Suresh, Udaiyan; Kumar, Palanisamy Mahesh; Mohan, Jagathish; Rajaganesh, Rajapandian; Wei, Hui; Kalimuthu, Kandasamy; Parajulee, Megha N; Mehlhorn, Heinz; Benelli, Giovanni

    2015-12-01

    Mosquitoes are blood-feeding insects serving as the most important vectors for spreading human pathogens and parasites. Dengue is a viral disease mainly vectored through the bite of Aedes mosquitoes. Its transmission has recently increased in urban and semi-urban areas of tropical and subtropical regions worldwide, becoming a major international public health concern. There is no specific treatment for dengue. Its prevention and control solely depend on effective vector control measures. Mangrove plants have been used in Indian traditional medicine for a wide array of purposes. In this research, we proposed a method for biosynthesis of antiviral and mosquitocidal silver nanoparticles (AgNP) using the aqueous extract of Bruguiera cylindrica leaves. AgNP were characterized using a variety of biophysical analyses, including UV-visible spectrophotometry, Fourier-transform infrared spectroscopy, scanning electron microscopy, and energy-dispersive X-ray spectroscopy. Bruguiera cilyndrica aqueous extract and green-synthesized AgNP were tested against the primary dengue vector Aedes aegypti. AgNP were the most effective. LC50 values ranged from 8.93 ppm (larva I) to 30.69 ppm (pupa). In vitro experiments showed that 30 μg/ml of AgNP significantly inhibited the production of dengue viral envelope (E) protein in vero cells and downregulated the expression of dengue viral E gene. Concerning nontarget effects, we observed that the predation efficiency of Carassius auratus against A. aegypti was not affected by exposure at sublethal doses of AgNP. Predation in the control was 71.81 % (larva II) and 50.43 % (larva III), while in an AgNP-treated environment, predation was boosted to 90.25 and 76.81 %, respectively. Overall, this study highlights the concrete potential of green-synthesized AgNP in the fight against dengue virus. Furthermore, B. cylindrica-synthesized AgNP can be employed at low doses to reduce larval and pupal population of A. aegypti, without detrimental

  3. Efeito do tamanho de fruto e do método de extração na qualidade fisiológica de sementes de porongo Effect of fruit size and extraction method on the physiological quality of bottle gourd seeds

    Directory of Open Access Journals (Sweden)

    Dilson Antônio Bisognin

    1997-03-01

    temperatura, umidade e aeração. germinam após terem atingido 43,4% de umidade.Bottie gourd - Lagenaria siceraria (Mol. Standl - the fruits harvested from a farm localed in Restinga Seca county, were used to evaluate seeds in the Seed Laboratory of the Federal University of Santa Maria. The effect of fruit size on seed physiological quality was studied using seeds from ten large, medium and small bottle gourd fruits. Fruits were characterized by the length, the diameter. the shell thickness, and by the number of seeds. The seeds were characterized by the length, the width, the thickness, and the weight of 1000 seeds. Water fermentation during 24, 48, 72, 96, and 120 hours and dipping in HCl solution by 10, 20, and 30% during 30 minutes were used to compare methods of extracting seeds from medium bottle gourd fruits stored for 60 days. The manual extraction of seeds was considered as the control treatment. The physiological quality of the seeds was evaluated by the germination and the first counting test and averaging time of germination parameters. Results indicated that the size of botlle gourd fruit can be characterized either by the length or the width. Lighter seeds with smaller width and thickness were extracted from smaller fruits. The treatment with HCl solution specially on 20 and 30% concentration was not efficient for the extracting bottle gourd seeds because the cleaning process was more difficult and qffècted negatively seed germination and the vigor. The results show that as the size of the fruits increase the number and weight of seeds also increase without changing the ability to produce normal seedlings. The cleaning process of bottle gourd seeds in HCl solution reduces their vigor. The best period of fermentation of seeds was observed in water at 25°C for 72 hours, however, the period from 48 to 96 hours improved their physiological quality and also facilitated the cleaning process. The bottle gourd seeds germinate in environment with 43.4% of humidity

  4. A Case of Cyperus spp. and Imperata cylindrica Occurrences on Acrisol of the Dahomey Gap in South Benin as Affected by Soil Characteristics: A Strategy for Soil and Weed Management

    Directory of Open Access Journals (Sweden)

    Brahima Kone

    2013-01-01

    Full Text Available Because of the limiting efficacy of common weed control methods on Cyperus spp. and Imperata cylindrica their occurrences in tropical agroecologies and the effect of soil properties in suppressing these species were investigated in south Benin (Cotonou, a typical ecology of the Dahomey gap. Weeds and soil samples were collected twice early and later in the rainy season in 2009 at four topographic positions (summit, upper slope, middle slope, and foot slope. Sampling was done according to Braun-Blanquet abundance indices (3 and 5 and the absence (0 of Cyperus and Imperata in a quadrat, respectively. The relationship between their respective abundances and soil parameters (texture, C, N, P, K, Na, Ca, Mg, and Fe was explored. Weed occurrence was less related to soil texture, and Imperata growth was more influenced by soil nutrients (K, Ca, and Fe than Cyperus spp. Soil cation ratios of K : Mg and Ca : Mg were the main factors that could be changed by applying K and/or Mg fertilizers to reduce Cyperus and/or Imperata occurrence. Maintaining high Fe concentration in soil at hillside positions can also reduce Imperata abundance, especially in the Dahomey gap.

  5. Quantification of Concentration of Microalgae Anabaena Cylindrica, Coal-bed Methane Water Isolates Nannochloropsis Gaditana and PW-95 in Aquatic Solutions through Hyperspectral Reflectance Measurement and Analytical Model Establishment

    Science.gov (United States)

    Zhou, Z.; Zhou, X.; Apple, M. E.; Spangler, L.

    2017-12-01

    Three species of microalgae, Anabaena cylindrica (UTEX # 1611), coal-bed methane water isolates Nannochloropsis gaditana and PW-95 were cultured for the measurements of their hyperspectral profiles in different concentrations. The hyperspectral data were measured by an Analytical Spectral Devices (ASD) spectroradiomter with the spectral resolution of 1 nanometer over the wavelength ranges from 350nm to 1050 nm for samples of microalgae of different concentration. Concentration of microalgae was measured using a Hemocytometer under microscope. The objective of this study is to establish the relation between spectral reflectance and micro-algal concentration so that microalgae concentration can be measured remotely by space- or airborne hyperspectral or multispectral sensors. Two types of analytical models, linear reflectance-concentration model and Lamber-Beer reflectance-concentration model, were established for each species. For linear modeling, the wavelength with the maximum correlation coefficient between the reflectance and concentrations of algae was located and then selected for each species of algae. The results of the linear models for each species are shown in Fig.1(a), in which Refl_1, Refl_2, and Refl_3 represent the reflectance of Anabaena, N. Gaditana, and PW-95 respectively. C1, C2, and C3 represent the Concentrations of Anabaena, N. Gaditana, and PW-95 respectively. The Lamber-Beer models were based on the Lambert-Beer Law, which states that the intensity of light propagating in a substance dissolved in a fully transmitting solvent is directly proportional to the concentration of the substance and the path length of the light through the solution. Thus, for the Lamber-Beer modeling, a wavelength with large absorption in red band was selected for each species. The results of Lambert-Beer models for each species are shown in Fig.1(b). Based on the Lamber-Beer models, the absorption coefficient for the three different species will be quantified.

  6. Cucurbits depicted in Byzantine mosaics from Israel, 350–600 ce

    Science.gov (United States)

    Avital, Anat; Paris, Harry S.

    2014-01-01

    Background and Aims Thousands of floor mosaics were produced in lands across the Roman and Byzantine empires. Some mosaics contain depictions of agricultural produce, potentially providing useful information concerning the contemporary presence and popularity of crop plants in a particular geographical region. Hundreds of floor mosaics produced in Israel during the Byzantine period have survived. The objective of the present work was to search these mosaics for Cucurbitaceae in order to obtain a more complete picture of cucurbit crop history in the eastern Mediterranean region. Results and Conclusions Twenty-three mosaics dating from 350–600 ce were found that had images positively identifiable as cucurbits. The morphological diversity of the cucurbit fruits in the mosaics of Israel is greater than that appearing in mosaics from any other Roman or Byzantine provincial area. The depicted fruits vary in shape from oblate to extremely long, and some are furrowed, others are striped and others lack definite markings. The cucurbit taxa depicted in the mosaics are Cucumis melo (melon), Citrullus lanatus (watermelon), Luffa aegyptiaca (sponge gourd) and Lagenaria siceraria (bottle gourd). Cucumis melo is the most frequently found taxon in the mosaics and is represented by round dessert melons and long snake melons. Fruits of at least two cultivars of snake melons and of watermelons are represented. To our knowledge, images of sponge gourds have not been found in Roman and Byzantine mosaics elsewhere. Indeed, the mosaics of Israel contain what are probably the oldest depictions of Luffa aegyptiaca in Mediterranean lands. Sponge gourds are depicted often, in 11 of the mosaics at eight localities, and the images include both mature fruits, which are useful for cleaning and washing, and immature fruits, which are edible. Only one mosaic has images positively identifiable as of bottle gourds, and these were round–pyriform and probably used as vessels. PMID:24948671

  7. Cucurbits depicted in Byzantine mosaics from Israel, 350-600 ce.

    Science.gov (United States)

    Avital, Anat; Paris, Harry S

    2014-08-01

    Thousands of floor mosaics were produced in lands across the Roman and Byzantine empires. Some mosaics contain depictions of agricultural produce, potentially providing useful information concerning the contemporary presence and popularity of crop plants in a particular geographical region. Hundreds of floor mosaics produced in Israel during the Byzantine period have survived. The objective of the present work was to search these mosaics for Cucurbitaceae in order to obtain a more complete picture of cucurbit crop history in the eastern Mediterranean region. Twenty-three mosaics dating from 350-600 ce were found that had images positively identifiable as cucurbits. The morphological diversity of the cucurbit fruits in the mosaics of Israel is greater than that appearing in mosaics from any other Roman or Byzantine provincial area. The depicted fruits vary in shape from oblate to extremely long, and some are furrowed, others are striped and others lack definite markings. The cucurbit taxa depicted in the mosaics are Cucumis melo (melon), Citrullus lanatus (watermelon), Luffa aegyptiaca (sponge gourd) and Lagenaria siceraria (bottle gourd). Cucumis melo is the most frequently found taxon in the mosaics and is represented by round dessert melons and long snake melons. Fruits of at least two cultivars of snake melons and of watermelons are represented. To our knowledge, images of sponge gourds have not been found in Roman and Byzantine mosaics elsewhere. Indeed, the mosaics of Israel contain what are probably the oldest depictions of Luffa aegyptiaca in Mediterranean lands. Sponge gourds are depicted often, in 11 of the mosaics at eight localities, and the images include both mature fruits, which are useful for cleaning and washing, and immature fruits, which are edible. Only one mosaic has images positively identifiable as of bottle gourds, and these were round-pyriform and probably used as vessels. © The Author 2014. Published by Oxford University Press on behalf of

  8. Hilly grasses and leaves: a promising unconventional feed resource for livestock.

    OpenAIRE

    Hossain M.E.; Karim M.H.; Ahmed M.I.; Sultana S.A.

    2016-01-01

    The study was undertaken to find out the chemical composition of different hilly grasses and leaves available in Bandarban areas of Bangladesh. Total 10 different hilly grasses and leaves such as Bottle gourd leaf (Lagenaria siceraria), Castor bean leaf (Ricinus communis), Cogon grass (Imperata cylindrica), Dhol kolmi (Ipomoea carnea), Giant reed leaf (Arundo donax), Hilly grass (Cynodon dactylon), Pithraj leaf (Aphanamixis polystachya), Sal leaf (Shorea robusta), Shegun leaf (Tectona grandis...

  9. Relative incidence of Bactrocera cucurbitae (Coquillett) and Dacus ciliatus Loew on cucurbitaceous vegetables

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, N.K. Krishna; Verghese, Abraham; Shivakumara, B.; Krishnamoorthy, P.N.; Ranganath, H.R. [Indian Institute of Horticultural Research, Bangalore (India). Div. of Entomology and Nematology

    2006-07-01

    The melon fly, Bactrocera cucurbitae (Coquillett) is a major pest of cucurbitaceous vegetables and fruits in many parts of the world. Infestation of an another species, the lesser pumpkin fly, Dacus ciliatus Loew is reported on a few cucurbits in the Indian sub-continent and Africa. While extensive work on seasonality, infestation percent, host preference, attraction to para pheromone on B. cucurbitae has been reported, little is known of D. ciliatus. Field experiments were carried out at the Indian Institute of Horticultural Research (IIHR), Bangalore (12058'N; 77035'E) from June 2002- October 2003. Cucumber (Cucumis sativus L), ridge gourd (Luffa acutangula (L.) Roxb), bitter gourd (Momordica charantia L.) and pickling cucumbers [C. sativus L (variety. Ijax)] were raised at monthly interval. Cue lure baited bottle traps were hung to monitor B. cucurbitae and other related species. Bactrocera cucurbitae was present all through the year and maximum number of adults was trapped during August (14.14/trap/week). Dacus ciliatus was trapped only from May to October but in relatively less numbers ({approx} 1/week). Maximum fruit fly infestation was 77.03 % on bitter gourd (August 2003), 75.65 % on ridge gourd (Nov. 02), 73.83 % on cucumber (October, 02) and 63.31 % on pickling cucumber (October, 02). Trap catches of B. cucurbitae was significantly and positively correlated with relative humidity. Maximum and minimum temperature, RH (%), rainfall (mm), evaporation (mm) and wind speed (km/h) collectively determined 44 % of B. cucurbitae trap catches. Maximum fruit fly emergence of 494.64/ kg fruit was on bitter gourd (October, 2002) followed by cucumber (431.97, November, 2002), pickling cucumber (307.51, October 2002) and ridge gourd (210.74, October, 2003). Dacus ciliatus formed only 4.5% of the total number of fruit flies on bitter gourd and 0.2% on pickling cucumber. Its infestation was not observed on cucumber and ridge gourd. Parasitism by the larval

  10. Relative incidence of Bactrocera cucurbitae (Coquillett) and Dacus ciliatus Loew on cucurbitaceous vegetables

    International Nuclear Information System (INIS)

    Kumar, N.K. Krishna; Verghese, Abraham; Shivakumara, B.; Krishnamoorthy, P.N.; Ranganath, H.R.

    2006-01-01

    The melon fly, Bactrocera cucurbitae (Coquillett) is a major pest of cucurbitaceous vegetables and fruits in many parts of the world. Infestation of an another species, the lesser pumpkin fly, Dacus ciliatus Loew is reported on a few cucurbits in the Indian sub-continent and Africa. While extensive work on seasonality, infestation percent, host preference, attraction to para pheromone on B. cucurbitae has been reported, little is known of D. ciliatus. Field experiments were carried out at the Indian Institute of Horticultural Research (IIHR), Bangalore (12058'N; 77035'E) from June 2002- October 2003. Cucumber (Cucumis sativus L), ridge gourd (Luffa acutangula (L.) Roxb), bitter gourd (Momordica charantia L.) and pickling cucumbers [C. sativus L (variety. Ijax)] were raised at monthly interval. Cue lure baited bottle traps were hung to monitor B. cucurbitae and other related species. Bactrocera cucurbitae was present all through the year and maximum number of adults was trapped during August (14.14/trap/week). Dacus ciliatus was trapped only from May to October but in relatively less numbers (∼ 1/week). Maximum fruit fly infestation was 77.03 % on bitter gourd (August 2003), 75.65 % on ridge gourd (Nov. 02), 73.83 % on cucumber (October, 02) and 63.31 % on pickling cucumber (October, 02). Trap catches of B. cucurbitae was significantly and positively correlated with relative humidity. Maximum and minimum temperature, RH (%), rainfall (mm), evaporation (mm) and wind speed (km/h) collectively determined 44 % of B. cucurbitae trap catches. Maximum fruit fly emergence of 494.64/ kg fruit was on bitter gourd (October, 2002) followed by cucumber (431.97, November, 2002), pickling cucumber (307.51, October 2002) and ridge gourd (210.74, October, 2003). Dacus ciliatus formed only 4.5% of the total number of fruit flies on bitter gourd and 0.2% on pickling cucumber. Its infestation was not observed on cucumber and ridge gourd. Parasitism by the larval-pupal parasitoid

  11. Effect of a herbal extract powder (YY-312) from Imperata cylindrica Beauvois, Citrus unshiu Markovich, and Evodia officinalis Dode on body fat mass in overweight adults: a 12-week, randomized, double-blind, placebo-controlled, parallel-group clinical trial.

    Science.gov (United States)

    Cho, Young-Gyu; Jung, Ji-Hye; Kang, Jae-Heon; Kwon, Jin Soo; Yu, Seung Pil; Baik, Tae Gon

    2017-07-28

    YY-312 is a herbal extract powder from Imperata cylindrica Beauvois, Citrus unshiu Markovich, and Evodia officinalis Dode, which have health promoting effects, including body fat reduction. We aimed to evaluate the efficacy and safety of YY-312 for body fat reduction in overweight adults. This was a 12-week, randomized, double-blind, placebo-controlled, parallel-group clinical trial performed in overweight Korean adults aged 19-60 years with a body mass index of 25.0-29.9 kg/m 2 . The daily dose of YY-312 was 2400 mg (containing 1800 mg of active herbal extract and 600 mg of cyclodextrin). Primary outcomes were reductions in body fat mass (BFM) and body fat percentage (BF%) after 12 weeks. Secondary outcomes included reductions in body weight and waist circumference (WC) after 12 weeks. After 12 weeks, BFM (1.6 kg vs. 0.1 kg; P = 0.023) and BF% (1.5% vs. -0.2%; P = 0.018) decreased significantly more in the YY-312 group than in the placebo group, as did body weight (2.7 kg vs. 1.0 kg; P = 0.014) and WC (2.2 cm vs. 0.8 cm; P = 0.049). All safety parameters were within normal limits; no serious adverse events occurred in either group. In a 12-week clinical trial in overweight adults, YY-312 resulted in significantly greater reduction in body fat vs. placebo, while being safe and well tolerated. cris.nih.go.kr: ( KCT0001225 ).

  12. Ethanolic leaf extract of Langenaria breviflora (bitter gourd) inhibits ...

    African Journals Online (AJOL)

    SARAH

    2015-01-30

    Jan 30, 2015 ... ABSTRACT. Objective: Gastrointestinal toxicity remains a barrier to applications of non-steroidal anti-inflammatory drugs in ... acetaminophen, ibuprofen, aspirin and indomethacin ..... Hepatic and Renal Function of Rats. IOSR.

  13. Genetic variability, correlation and path analysis in sponge gourd ...

    African Journals Online (AJOL)

    Windows-7

    2013-02-06

    Feb 6, 2013 ... fiber used in industries for filter and cleaning the motor car, glass wares, kitchen ... The fibrous vascular system inside the fruit after been separated from the skin, ... was carried out to gather information on genetic variability ...

  14. Teratogenic effect of the water extract of bitter gourd ( Momordica ...

    African Journals Online (AJOL)

    It also showed that 31.2% of all the malformed litters had multiple congenital malformations. It also showed that the experimental rats had nine resorption sites while control had none. This demonstrates that the water extract of Momordica charantia is teratogenic in Sprague Dawley rats and should be used with caution in ...

  15. Allelopathic Stress Produced by Bitter Gourd (Momordica charantia L.

    Directory of Open Access Journals (Sweden)

    N.B. Singh

    2014-05-01

    Full Text Available The present study deals with in vitro effects of allelochemicals present in leaf and fruit leachate of Momordica charantia in vitro on plant growth and metabolism of Lycopersicon esculentum. Momordica was selected as a donor plant and tomato as recipient. Seeds of tomato were shown in pots and after germination different concentrations viz. 25, 50, 75 and 100% of leaf and fruit leachates were applied as treatment. Twenty days old seedlings were harvested for biophysical and biochemical analyses. The root and shoot length, fresh and dry weight of the seedlings decreased in dose dependent manner. The reduction in pigment and protein contents and nitrate reductase activity was concentration dependent. Membrane leakage increased as the concentration of leachates increased. Activities of antioxidant enzymes viz. superoxide dismutase (SOD, catalase (CAT and peroxidase (POX activities significantly enhanced under allelopathic stress. Inhibition of various metabolic activities under allelopathic stress resulted in decreased plant growth and development. The fruit leachate of Momordica was more inhibitory than leaf leachate.

  16. Integrated management of Imperata cylindrica (speargrass) in yam ...

    African Journals Online (AJOL)

    those that were sprayed with glyphosate or hoed before mucuna was planted at 5 MAP. The residue from mucuna suppressed speargrass for about 5 months after senescence, resulting in more vigorous and taller cassava plants and cassava root yields of 110 to 118 per cent greater for the glyphosate + mucuna plot than ...

  17. ECO-FRIENDLY METHODS OF SPEARGRASS (Imperata cylindrica ...

    African Journals Online (AJOL)

    Choice-Academy

    Ethiopian Journal of Environmental Studies and Management. Vol. 1 no.1 March 2008 ... The study was designed to evaluate various control methods that would .... The following data were collected: i. Imperata shoot dry ... (kg/ha at 0 to 30cm soil depth) iii. Cassava ... soil flora and fauna as had been earlier suggested by.

  18. The Speargrass (Imperata cylindrica (L) Beauv.) menace in Ghana ...

    African Journals Online (AJOL)

    Farmers perceived average yield losses of 30–80% ha–1 due to speargrass interference, implying a national average crop loss ha-1 of $31–$84, $155–$414 and $272–$727 for maize, cassava and yam systems, respectively. Reductions in food quality due to the piercing nature of the rhizomes was also paramount.

  19. The Speargrass (Imperata cylindrica (L) Beauv.) Menace in Ghana ...

    African Journals Online (AJOL)

    Fiifi Baidoo

    (1999) report coverage range of 9–97% of farmers' fields in West Africa. .... due to the presence of the major market at Techiman that links the northern and .... reported that abandoning land to natural fallow is the traditional way of fighting the ...

  20. Abundance of food plant species and food habits of Rhinoceros unicorns Linn. in Pobitora Wildlife Sanctuary, Assam, India

    Directory of Open Access Journals (Sweden)

    P. Konwar

    2009-09-01

    Full Text Available Food habits and abundance of food plant species of Rhinoceros unicornis in Pobitora Wildlife Sanctuary were studied from January 1999 through December 2001. Totally 32 numbers of Rhino food plants were identified, of which 15 were grasses, four shrubs, five aquatic hydrophytes and eight tree species (21 terrestrial and 11 aquatic. During the dry season, the Rhino feeds on almost 90% food items from Hemarthria compressa, Arundo donax, Phragmites karka, Cerex rubro-brumee etc. The other short grasses such as Cynodon dactylon, Andropogon ssp., Cenchrus ciliaris, Chrysopogon aciculatus and tender and young shoots and twigs of Schelristechya fuesche, Saccharum spontaneum, Lagerstroemia flosreginae etc. are consumed in limited portions. The rhino consumes 11 cultivated crops and vegetables, viz., Ricinus communis, Oryza sativa, Solanum melongena, Lycopersicon esculentum, Solanum tuberosum, Brassica nigra, Luffa cylindrica, Luffa acutangula, Cucurbita moschata, Cucumis sativus and Ipomoea batatas etc. Highest density of food plant species observed in the study area were Cynodon dactylon (167.5/m2, Hemarthria compressa (73.75/m2, Vetiveria zizanioides (56/m2, Saccharum ravannae (51.5/m2, Pharagmites karka (50.75/m2, Leersia hexandra (46.75/m2, Brachiarea pseudointerrupta (40/m2 and Eichhornia crassipes (35/m2.

  1. Replacement Value of Soybean Meal with Luffa cylindrical in Diet of ...

    African Journals Online (AJOL)

    SH

    1Department of Fisheries Technology, Federal College of Animal Health and Production Technology, ... (P,0.05) decreases in growth and nutrient utilization parameters of fish fed different dietary ... consumption and by other animal feed.

  2. Mapping of the gynoecy in bitter gourd (Momordica charantia using RAD-seq analysis.

    Directory of Open Access Journals (Sweden)

    Hideo Matsumura

    Full Text Available Momordica charantia is a monoecious plant of the Cucurbitaceae family that has both male and female unisexual flowers. Its unique gynoecious line, OHB61-5, is essential as a maternal parent in the production of F1 cultivars. To identify the DNA markers for this gynoecy, a RAD-seq (restriction-associated DNA tag sequencing analysis was employed to reveal genome-wide DNA polymorphisms and to genotype the F2 progeny from a cross between OHB61-5 and a monoecious line. Based on a RAD-seq analysis of F2 individuals, a linkage map was constructed using 552 co-dominant markers. In addition, after analyzing the pooled genomic DNA from monoecious or gynoecious F2 plants, several SNP loci that are genetically linked to gynoecy were identified. GTFL-1, the closest SNP locus to the putative gynoecious locus, was converted to a conventional DNA marker using invader assay technology, which is applicable to the marker-assisted selection of gynoecy in M. charantia breeding.

  3. Mapping of the Gynoecy in Bitter Gourd (Momordica charantia) Using RAD-Seq Analysis

    Science.gov (United States)

    Matsumura, Hideo; Miyagi, Norimichi; Taniai, Naoki; Fukushima, Mai; Tarora, Kazuhiko; Shudo, Ayano; Urasaki, Naoya

    2014-01-01

    Momordica charantia is a monoecious plant of the Cucurbitaceae family that has both male and female unisexual flowers. Its unique gynoecious line, OHB61-5, is essential as a maternal parent in the production of F1 cultivars. To identify the DNA markers for this gynoecy, a RAD-seq (restriction-associated DNA tag sequencing) analysis was employed to reveal genome-wide DNA polymorphisms and to genotype the F2 progeny from a cross between OHB61-5 and a monoecious line. Based on a RAD-seq analysis of F2 individuals, a linkage map was constructed using 552 co-dominant markers. In addition, after analyzing the pooled genomic DNA from monoecious or gynoecious F2 plants, several SNP loci that are genetically linked to gynoecy were identified. GTFL-1, the closest SNP locus to the putative gynoecious locus, was converted to a conventional DNA marker using invader assay technology, which is applicable to the marker-assisted selection of gynoecy in M. charantia breeding. PMID:24498029

  4. Inmovilización de hongos ligninolíticos para la remoción del colorante negro reactivo 5

    Directory of Open Access Journals (Sweden)

    Jorge Andrés Fernández

    2009-01-01

    Full Text Available La presencia de colorantes azoicos en aguas residuales de la industria textil es un problema ambiental y sanitario, porque muchos de estos compuestos son cancerígenos. Los tratamientos biológicos son una alternativa para la remoción de ese tipo de colorantes. En el presente trabajo se evaluó el efecto de tres hongos de podredumbre blanca, Trametes versicolor, Pleurotus ostreatus y Phanerochaete chrysosporium sobre la decoloración de un agua que contiene colorante negro reactivo 5 (NR5, ampliamente usado en la industria textil. Se estudió la inmovilización de estos hongos en dos soportes, espuma de poliuretano y estropajo (L. cylíndrica para seleccionar el mejor soporte y el hongo con mayor capacidad para la decoloración. Ambos soportes fueron igualmente efectivos, pero se seleccionó estropajo por ser un producto natural. El hongo que generó los mayores porcentajes de decoloración en 4 días fue Trametes versicolor, con 96%, 98% y 98% para agua con concentración de NR5 300 ppm, 150 ppm y 75 ppm, respectivamente. La actividad lacasa para cada concentración de NR5 fue 8 U L-1, 7 U L-1 y 5 U L-1. Waste water from the textile industry represents a major environmental and health problem because it contains azo dyes whose carcirogenic effect has been tested in research. Biological treatment represents a valuable alternative for removing these dyes. The effect of Trametes versicolor, Pleurotus ostreatus and Phanerochaete chrysosporium rot fungi on decoloration of water containing reactive black five (NR5 textile dye was evaluated in this work. Immobilising the fungi on polyurethane foam and luffa sponge (Luffa cylindrica supports was studied in order to select the best support and the fungi having the best decolorisation. Both supports were equally effective; however, the luffa sponge was selected as being a natural product. Trametes versicolor produced the highest decolorisation percentages in four days (96%, 98% and 98% for 300 ppm, 150

  5. UNFOLDINGS OF THE CYLINDRICA L SURFACES USED IN THE INDUSTRIAL INSTALLATIONS

    Directory of Open Access Journals (Sweden)

    VASILE GHEORGHITA

    2013-02-01

    Full Text Available The connections in the construction of the various industrial installations: pipes, boilers, joints elements and fittings have a cylindrical configuration, or similar cylindrical shape. The execution and their installation require knowledge of the unfolding and intersection curves, which compose them. The graphical solving of the problems of tech nical representation has enabled the formation of abstract geometric of the pieces forms and the ability to see into space. The paper proposes to establish the unfolding of a connection, used in the industrial equipments, by the classical method of the des criptive geometry and mathematics, using appropriate software

  6. Chemical interaction in the invasiveness of cogongrass (Imperata cylindrica (L.) Beauv.).

    Science.gov (United States)

    Xuan, Tran Dang; Toyama, Tsuneaki; Fukuta, Masakazu; Khanh, Tran Dang; Tawata, Shinkichi

    2009-10-28

    From gas chromatography-mass spectrometry (GC-MS), numerous plant growth inhibitors were found in the rhizome and root exudates of cogongrass, one of the most problematic weeds in the world. iso-Eugenol, iso-ferulic acid, linoleic acid, ferulic acid, and vanillin were the major chemicals in the rhizome (88.1-392.2 microg/g of fresh root), while 4-acetyl-2-methoxyphenol was the principle substance (872.6 microg/plant) in the root exudates. In fields, the use of cutting and plowing reduced weed biomass and weed density of cogongrass >70%. However, the alternative invasion of beggar tick might be a problem, because its density and biomass increased 33.3 and 62.5%, respectively. Chemicals from cogongrass showed selective effects against tested invasive species. Of them, 2,4-di-tert-butylphenol was the most potent (78.3-100% of inhibition), followed by iso-eugenol and 4-acetyl-2-methoxyphenol. These compounds may play important roles in the invasiveness of cogongrass and might be promising parent constituents of synthesis to develop novel herbicides for control of invasive plants.

  7. Enhancing the Properties of Coal Briquette Using Spear Grass (Imperata Cylindrica

    Directory of Open Access Journals (Sweden)

    Adaora Stellamaris OGBUAGU

    2010-12-01

    Full Text Available Studies have been carried out on utilizing agricultural wastes (spear grass to enhance the properties of coal briquette. The proximate analysis of the plant material was carried out alongside with a sample of coal (sub-bituminous coal. Briquettes of different compositions were produced by blending the plant material with the coal at various concentrations: 0%, 10%, 20%, 30%, 40%, 50% and 100%, using cassava starch as a binder and calcium hydroxide (Ca(OH2 as desulfurizing agent. The properties of the briquettes were compared. It was found that the ignition, burning rate and reduction in smoke emission showed improvement with increase in biomass concentration. Compressive strength and cooking efficiency (water boiling time and specific fuel consumption showed initial improvement and rendered to decrease with briquette containing 30% biomass.

  8. Extraction of Spear Grass (Imperata Cylindrica As Pro-Oxidant In Polymer Blends

    Directory of Open Access Journals (Sweden)

    Nuradibah M.A.

    2018-01-01

    Full Text Available Packaging material such as plastic bags is one of the main factors that contribute to the environmental pollution due to slow degradation. The usage of metal oxide as pro-oxidant has been proven to accelerate the degradation of these materials, but the excessive usage of this pro-oxidant will be harmful to the human body. Therefore, in this research, spear grass is investigated to be used as natural based pro-oxidant that can increase the degradation rate of the polymers. In terms of that, spear grass is extracted by using pressurized hot water extraction (PHWE to obtain the metal element such as zinc (Zn and ferum (Fe. PHWE is using water as a solvent which is highly favourable due to non-toxicity and non-flammable characteristics that make it easy to handle. Box-Behnken design is used to optimize the temperature, extraction time, and sample-to-solvent ratio to get the maximum amount of Zn and Fe concentration from the extracted spear grass. As a conclusion, the leaf of spear grass contributed the highest amount of Zn and Fe concentration. The highest amount of Zn and Fe concentration is achieved at 150 °C, 20 minutes, and 3 g of sample to 45 ml of water.

  9. Invasion success in Cogongrass (Imperata cylindrica): A population genetic approach exploring genetic diversity and historical introductions

    Science.gov (United States)

    Rima D. Lucardi; Lisa E. Wallace; Gary N. Ervin

    2014-01-01

    Propagule pressure significantly contributes to and limits the potential success of a biological invasion, especially during transport, introduction, and establishment. Events such as multiple introductions of foreign parent material and gene flow among them can increase genetic diversity in founding populations, often leading to greater invasion success. We applied...

  10. 鹿児島県産作物に関するビフィズス菌増殖因子の検討

    OpenAIRE

    村山, 恵美子; 純浦, めぐみ; 吉元, 誠

    2015-01-01

    Effects of upland crops in Kagoshima prefecture on the growth of Bifidobacteria were examined in these edible and waste portions.The edible portion of wax gourd, sponge gourd, chayote (white, green), blue zuiki, stems of malabar nightshade, manchurian wild rice and the waste portion of wax gourd, sponge gourd, chayote, cotton of broad beans had large effect on the growth of the five species of Bifidobacteria. Especially wax gourd, sponge gourd, chayote (white), chayote (green), and manchuria...

  11. Analysis of Metabolites and Carbon Balance in the Biofilteration of Cumene Using Loofa Sponge as Biofilter Media.

    Science.gov (United States)

    Shahi, Amrita; Rai, B N; Singh, R S

    2016-09-01

    A laboratory-scale biofilter study was performed to treat cumene-inoculated mixed culture of bacterial community and loofa sponge (Luffa cylindrica) as support media for a period of 120 days in five distinct phases. The removal efficiency was obtained in the range of 40-85 % with maximum elimination capacity of 700 g m(-3) h(-1) at the inlet load of 1167 g m(-3) h(-1). The result demonstrated that loofa sponge is good support media for the removal of cumene at higher loading rates. Loofa sponge was characterized via chemical analysis and analytical techniques such as XRD; FTIR; XPS; and CHN, and the result obtained confirms its suitability as biofilter media. The SEM results of loofa with inoculum shows the formation of a biofilm layer on the surface of loofa. The GC-MS analysis of leachate confirms the presence of different organic compounds such as acetaldehyde and 4-hydroxy-2-oxopentanoic acids which are stable metabolites during cumene biodegradation. About 12.69 % of carbon present in inlet cumene was converted to biomass.

  12. MODULATION OF GROWTH AND PROTON PUMPING ATPase ACTIVITY OF PROBIOTIC Lactobacilli BY DIETARY CUCURBITS

    Directory of Open Access Journals (Sweden)

    Irfan Ahmad

    2013-12-01

    Full Text Available Gastrointestinal tract predominantly harbor probiotic Lactobacilli which exert beneficial effects on human health. Aqueous extracts from fruits of Lagenaria siceraria (Ls, Luffa cylindrica (Lc and Cucurbita maxima (Cm were prepared and lyophilized. Fruit extracts were investigated for their effects on Lactobacillus rhamnosus (L. rhamnosus, Lactobacillus plantarum (L. plantarum and Lactobacillus acidophilus (L. acidophilus. Extracts were found to enhance growth of Lactobacilli without any toxic effect (up to 1000µg/mL concentration. Minimum concentration of extracts at which growth of probiotic strains were found to be enhanced significantly were determined (103.67 µg/mL-118µg/mL and considered as effective concentration (EC or growth stimulatory concentration (GSC. Proton pumping ATPase activity of Lactobacilli were examined and found to be enhanced significantly (29.89- 61.96% in extracts treated probiotics (Lactobacilli as compared to the normal control. Inulin used as positive control and found to enhance the proton efflux activity (28.06-37.72% with respect to the control. These dietary cucurbits enhance metabolic activity of probiotic Lactobacilli by modulating their proton pumping ATPase mechanism. This study suggested that the consumption of cucurbit fruits might be a natural source of enhancing the activities of probiotic Lactobacilli in the gut.

  13. Phytochemical screening and antimalarial activity of some plants traditionally used in Indonesia

    Directory of Open Access Journals (Sweden)

    Syamsudin Abdillah

    2015-06-01

    Full Text Available Objective: To evaluate ethanolic extracts of phytochemical screening, in vitro and in vivo antiplasmodial activities of 15 plants used as antimalarial in Sei Kepayang, North Sumatra. Methods: Extraction was done through maceration with 70% ethanol and screened against chemical content, in vitro test anti-plasmodium against Plasmodium falciparum 3D7 strain and in vivo test in mice infected Plasmodium berghei. Results: The results showed that the plant extract contained a group of saponins, flavonoids, alkaloids, quinone, sterols, triterpene, tannins and cumarine. However, extract of Momordica charantia, Carica papaya, Garcinia atroviridis, Alstonia scholaris, Smallanthus sonchifolia and Cassia siamea had strong anti-plasmodium activity both in vitro and in vivo. Conclusions: In vitro and in vivo antiplasmodial activities of 15 plants are used as antimalarial in Sei Kepayang, North Sumatra. All the plants have in vitro and in vivo anti-plasmodium activity except Orthosiphon stamineus and Luffa cylindrica (ED50 > 1 000 mg/kg body weight and IC50 > 100 μg/mL, respectively.

  14. Jasmonic and salicylic acids enhanced phytochemical production and biological activities in cell suspension cultures of spine gourd (Momordica dioica Roxb).

    Science.gov (United States)

    Chung, Ill-Min; Rekha, Kaliyaperumal; Rajakumar, Govindasamy; Thiruvengadam, Muthu

    2017-03-01

    In vitro cell suspension culture was established for the production of commercially valuable phytochemicals in Momordica dioica. The influence of elicitors in jasmonic acid (JA) and salicylic acid (SA) increased their effect on phytochemical production and biomass accumulation in M. dioica. The results indicate that compared with non-elicited cultures, JA- and SA-elicited cell suspension cultures had significantly enhanced phenolic, flavonoid, and carotenoid production, as well as antioxidant, antimicrobial, and antiproliferative activities. Furthermore, elicited cultures produced 22 phenolic compounds, such as flavonols, hydroxycinnamic acids, and hydroxybenzoic acids. Greater biomass production, phytochemical accumulation, and biological activity occurred in JA- than in SA-elicited cell cultures. This study is the first to successfully establish M. dioica cell suspension cultures for the production of phenolic compounds and carotenoids, as well as for biomass accumulation.

  15. BG-4, a novel anticancer peptide from bitter gourd (Momordica charantia), promotes apoptosis in human colon cancer cells

    Science.gov (United States)

    Momordica charantia is a perennial plant with reported health benefits. BG-4, a novel peptide from Momordica charantia, was isolated, purified and characterized. The trypsin inhibitory activity of BG-4 is 8.6 times higher than purified soybean trypsin inhibitor. The high trypsin inhibitory activity ...

  16. Estimation of time-series properties of gourd observed solar irradiance data using cloud properties derived from satellite observations

    Science.gov (United States)

    Watanabe, T.; Nohara, D.

    2017-12-01

    The shorter temporal scale variation in the downward solar irradiance at the ground level (DSI) is not understood well because researches in the shorter-scale variation in the DSI is based on the ground observation and ground observation stations are located coarsely. Use of dataset derived from satellite observation will overcome such defect. DSI data and MODIS cloud properties product are analyzed simultaneously. Three metrics: mean, standard deviation and sample entropy, are used to evaluate time-series properties of the DSI. Three metrics are computed from two-hours time-series centered at the observation time of MODIS over the ground observation stations. We apply the regression methods to design prediction models of each three metrics from cloud properties. The validation of the model accuracy show that mean and standard deviation are predicted with a higher degree of accuracy and that the accuracy of prediction of sample entropy, which represents the complexity of time-series, is not high. One of causes of lower prediction skill of sample entropy is the resolution of the MODIS cloud properties. Higher sample entropy is corresponding to the rapid fluctuation, which is caused by the small and unordered cloud. It seems that such clouds isn't retrieved well.

  17. Genetic relationships and evolution in Cucurbita pepo (pumpkin, squash, gourd) as revealed by simple sequence repeat polymorphisms.

    Science.gov (United States)

    Gong, Li; Paris, Harry S; Nee, Michael H; Stift, Gertraud; Pachner, Martin; Vollmann, Johann; Lelley, Tamas

    2012-03-01

    Genetic relationships among 104 accessions of Cucurbita pepo were assessed from polymorphisms in 134 SSR (microsatellite) and four SCAR loci, yielding a total of 418 alleles, distributed among all 20 linkage groups. Genetic distance values were calculated, a dendrogram constructed, and principal coordinate analyses conducted. The results showed 100 of the accessions as distributed among three clusters representing each of the recognized subspecies, pepo, texana, and fraterna. The remaining four accessions, all having very small, round, striped fruits, assumed central positions between the two cultivated subspecies, pepo and texana, suggesting that they are relicts of undescribed wild ancestors of the two domesticated subspecies. In both, subsp. texana and subsp. pepo, accessions belonging to the same cultivar-group (fruit shape) associated with one another. Within subsp. pepo, accessions grown for their seeds or that are generalists, used for both seed and fruit consumption, assumed central positions. Specialized accessions, grown exclusively for consumption of their young fruits, or their mature fruit flesh, or seed oil extraction, tended to assume outlying positions, and the different specializations radiated outward from the center in different directions. Accessions of the longest-fruited cultivar-group, Cocozelle, radiated bidirectionally, indicating independent selection events for long fruits in subsp. pepo probably driven by a common desire to consume the young fruits. Among the accessions tested, there was no evidence for crossing between subspecies after domestication.

  18. BG-4, a novel anticancer peptide from bitter gourd (Momordica charantia), promotes apoptosis in human colon cancer cells.

    Science.gov (United States)

    Dia, Vermont P; Krishnan, Hari B

    2016-09-15

    Momordica charantia is a perennial plant with reported health benefits. BG-4, a novel peptide from Momordica charantia, was isolated, purified and characterized. The trypsin inhibitory activity of BG-4 is 8.6 times higher than purified soybean trypsin inhibitor. The high trypsin inhibitory activity of BG-4 may be responsible for its capability to cause cytotoxicity to HCT-116 and HT-29 human colon cancer cells with ED50 values of 134.4 and 217.0 μg/mL after 48 h of treatment, respectively. The mechanism involved in the cytotoxic effect may be associated with induction of apoptosis as evidenced by increased percentage of HCT-116 and HT-29 colon cancer cells undergoing apoptosis from 5.4% (untreated) to 24.8% (BG-4 treated, 125 μg/mL for 16 h) and 8.5% (untreated) to 31.9% (BG-4 treated, 125 μg/mL for 16 h), respectively. The molecular mechanistic explanation in the apoptosis inducing property of BG-4 is due to reduced expression of Bcl-2 and increased expression of Bax leading to increased expression of caspase-3 and affecting the expression of cell cycle proteins p21 and CDK2. This is the first report on the anti-cancer potential of a novel bioactive peptide isolated from Momordica charantia in vitro supporting the potential therapeutic property of BG-4 against colon cancer that must be addressed using in vivo models of colon carcinogenesis.

  19. Effect of acute -irradiation (Co) on morphological peculiarities of microcystic aeruginosa Kuetz. Elenk. and Anabaena cylindrica Lemm

    International Nuclear Information System (INIS)

    Kondrat'eva, N.B.; Golubkova, M.G.; Shevchenko, T.F.

    1986-01-01

    It is shown, that acute γ-irradiation with lower-than-lethal doses may cause growth inhibition and development arrest in blue-green algae in the culture; the shift of their orthomorphogenesis; trichome fragmentation, as well as anomalous morphological structure emergence. The degree of these radiation effect manifestation changes in time and depends on the radiation dose. It is proposed to use data on the frequency of the occuring anomalies in the maximum manifestation period in the course of development of the additional Cyanophyta trichomal form radiosensitivity test

  20. Konsentrasi Hambat Minimum (KHM) Kadar Sampel Alang-Alang (Imperata Cylindrica) dalam Etanol melalui Metode Difusi Cakram

    OpenAIRE

    Mulyadi, Moh; Wuryanti, Wuryanti; Sarjono, Purbowatiningrum Ria

    2017-01-01

    Bakteri merupakan mikroorganisme yang berada di sekitar kita. Penelitian yang sering dilakukan untuk mencari sumber alternatif lain yang berfungsi sebagai antibakteri karena adanya beberapa bakteri yang menjadi resisten terhadap suatu antibakteri. Bahan-bahan yang dilaporkan memiliki aktifitas antibakteri diantaranya adalah alang-alang. Alang-alang berkhasiat untuk obat radang ginjal akut, antibakteri, muntah darah, kencing nanah dan mimisan. Penelitian ini bertujuan untuk memperoleh Kosentra...

  1. Invasion Dynamics and Genotypic Diversity of Cogongrass (Imperata cylindrica) at the Point of Introduction in the Southeastern United States

    Science.gov (United States)

    Ludovic J. A. Capo-chichi; Wilson H. Faircloth; A. G. Williamson; Michael G. Patterson; James H. Miller; Edzard van Santen

    2008-01-01

    Nine sites of cogongrass were included in a study of genotypic dimity and spread dynamics at the point of introduction and its adjacent areas in the southern United States. Clones evaluated with two primer pairs yielded a total of 137 amplified fragment length polymorphism (AFLP) hi of which 102 (74.4%) were polymorphic. Genetic diversity was measured as the percentage...

  2. The effects of gap size and disturbance type on invasion of wet pine savanna by cogongrass, Imperata cylindrica (Poaceae)

    Science.gov (United States)

    King, S.E.; Grace, J.B.

    2000-01-01

    Cogongrass is a nonindigenous species perceived to threaten native communities of the southeastern United States through modification of species composition and alteration of community processes. To examine how gap size and disturbance type influence the invasion of wet pine savannas by cogongrass, we performed three field experiments to evaluate the response of cogongrass seeds and transplanted seedlings to four different gap sizes, four types of site disturbance, and recent burning of savanna vegetation. Cogongrass germinated, survived, and grew in all gap sizes, from 0 to 100 cm in diameter. Similarly, disturbance type had no effect on germination or seedling and transplant survival. Tilling, however, significantly enhanced transplanted seedling growth, resulting in a tenfold increase in biomass over the other disturbance types. Seedling survival to 1 and 2 mo was greater in burned savanna than unburned savanna, although transplant survival and growth were not affected by burning. Results of this study suggest that cogongrass can germinate, survive, and grow in wet pine savanna communities regardless of gap size or type of disturbance, including burning. Burning of savanna vegetation may enhance establishment by improving early seedling survival, and soil disturbance can facilitate invasion of cogongrass by enhancing plant growth.

  3. Cytotoxic and pro-oxidative effects of Imperata cylindrica aerial part ethyl acetate extract in colorectal cancer in vitro.

    Science.gov (United States)

    Kwok, Amy Ho Yan; Wang, Yan; Ho, Wing Shing

    2016-05-15

    Colorectal cancer (CRC) is the third most common cancer. Its global incidence and mortality have been on the rise. Recent strategy of therapies has involved the use of non-steroid anti-inflammatory drugs and cyclooxygenase-selective inhibitors. Aerial parts of Imperata cylindrical L. Raeusch (IMP) have been used as an anti-inflammatory agent in traditional Chinese medicine. Asarachidonate acid cascadeis often involved in inflammation-related malignancy and IMP is an anti-inflammatory agent, hence it is hypothesized that IMP aerial part ethyl acetate extract exerts cytotoxic effects on colorectal cancer cells in vitro. The HT-29 adenocarcinoma cell line was used to elucidate its pro-apoptotic activities. Flow cytometry and fluorescent microscopy were performed to assess cell cycle arrest and the accumulation of reactive oxygen species (ROS). The mRNA and hormone levels of arachidonate acid pathways were studied via quantitative reverse transcription PCR (qRT-PCR) and ELISA. The 50% growth inhibitory effect (GI50) of the IMP extract on HT-29 was measured with a value of 14.5 µg/ml. Immuno-blot and caspase-3/7 activity assay showed the pro-apoptotic effect of IMP on the activation of caspase cascade. G2/M arrest was observed via flow cytometry. The ROS activity was modulated by the IMP extraction a concentration-dependent manner in HT-29 cells. The IMP extract increased PGE2 and PGF2α levels qRT-PCR revealed that transcripts of rate-limiting PGE2- and PGF2α-biosynthetic enzymes - COX-1, mPGES1 and AKR1C3 were notably up-regulated. Among the prostanoid receptors, EP1 and FP transcripts were up-regulated while EP4 transcripts decreased. The findings suggest that the proliferative effect of PGE2, which is generally believed to associate with heightened DNA synthesis and cross-talk with MAPK pathways, is likely triggered by the pro-apoptotic or -oxidative effects exerted by IMP extract in HT-29 cells. Concurring with this notion, indomethacin (COX-1/2-inhibitor) was demonstrated to potentiate the cytotoxic effect of IMP extract (GI50 ≦ 10.8 µg/ml). The results show that the cytotoxic effect of IMP extract predominates over the influence of proliferative prostanoids released by challenged colorectal cancer cells, and may present a potential source for development of novel anti-cancer drugs. Copyright © 2016 Elsevier GmbH. All rights reserved.

  4. Raising, Sustaining Productivity and Quality in Mixtures Imperata Cylindrica-Stylosanthes Guyanensis Pastures with Phosphorus Fertilization and Defoliation Management

    OpenAIRE

    Nohong, Budiman

    2016-01-01

    Phosphorus fertilization on crop mixtures Cogongrass-Stylo's very important for the development of root nodules, nitrogen fixation and improve the botanical composition Stylo to confront an aggressive Cogon grass. This study aims to improve the productivity and quality of crops mixtures Cogon grass-Stylo through fertilization and defoliation frequency. The study consisted of two factors . The first factor is the phosphorus fertilizer with a dose of 0 (P0 ) and 100 kg P2O/ha (P1 ). The second ...

  5. Lower Mississippi River Environmental Program. Report 10. Evaluation of Bird and Mammal Utilization of Dike Systems Along the Lower Mississippi River.

    Science.gov (United States)

    1987-11-01

    Boehmeria cylindrica - + + + + + - - - - Brunnchia cirrhosa - + + + - + + + + + Campsisradicans - - + + - + + + + - Carya illinoensis ...erythrorhizos - - - + + + + + + - Desmanthus illinoensis + + + - - - - Digitaria ischaemum - - - - + - + + + + Digitaria sanguinalis

  6. PRELIMINARY NUTRITIONAL EVALUATION OF FIVE SPECIES OF ...

    African Journals Online (AJOL)

    pumpkin or squash gourd), Cucurbita moschata (musk melon), Lagenaria siceraria (bottle gourd or calabash) and Cucumis sativus (“Ibo” egusi). The moisture content was determined by drying in an oven to constant weight, crude protein content by ...

  7. GISD

    Science.gov (United States)

    , madhavi, Madhavi, madhumalati, madmalati, ragotpiti, vasantduti 43. Imperata cylindrica Native to Asia , cogon grass (Imperata cylindrica) is common in the humid tropics and has spread to the warmer temperate

  8. A Regional Guidebook for Applying the Hydrogeomorphic Approach to Assessing the Functions of Tidal Fringe Wetlands Along the Mississippi and Alabama Gulf Coast

    Science.gov (United States)

    2007-04-01

    philoxeroides Alligatorweed Alabama Class C noxious weed Imperata cylindrica Cogongrass Alabama Class A noxious weed; Mississippi noxious weed Ipomoea...Invasive Species Alternanthera philoxeroides Phragmites australis Cuscuta spp. Imperata cylindrica...weed Cuscuta spp. Dodder Alabama Class A noxious weed Imperata cylindrica Cogongrass Alabama Class A noxious weed; MS noxious weed Ipomoea

  9. Ovarian Cancer: Nutrition

    Science.gov (United States)

    ... Nightshade family: eggplant, tomatoes Cucurbitaceous vegetables Gourd family: pumpkin, squash, cucumber, muskmelon, watermelon Potential Cancer Fighters in Foods Phytochemical Food Source Isothiocyanates Cruciferous vegetables, mustard, horseradish ...

  10. Management of Florida Scrub for Threatened and Endangered Species

    Science.gov (United States)

    1998-12-01

    for Florida scrub: 1. The exotic species, cogon grass ( Imperata cylindrica), may become common in degraded scrubs. This is an aggressive, invasive...34Cogongrass, Imperata cylindrica (L.) Beauv.: A good grass gone bad!" Botany Circular No. 28, Florida Dept. Agric. & Consumer Services, Division of Plant...Industry, Gainesville, FL. Colvin, D.L., Gaffney, J., and Shilling, D. G. 1994. "Cogongrass ( Imperata cylindrica (L.) Beauv.) Biology, ecology and

  11. 7 CFR 360.200 - Designation of noxious weeds.

    Science.gov (United States)

    2010-01-01

    ... mantegazzianum Sommier & Levier (giant hogweed) Homeria spp. Imperata brasiliensis Trinius (Brazilian satintail) Imperata cylindrica (Linnaeus) Raeuschel (cogongrass) Ischaemum rugosum Salisbury (murainograss) Leptochloa...

  12. Co-occurence of Invasive Species on Priority TES Installations

    Science.gov (United States)

    2006-05-01

    Tropical Bushmint Hyptis mutabilis forb Clay Camp Blanding FL Red-cockaded Woodpecker Congongrass Imperata cylindrica grass O,F Clay Camp...Woodpecker Yellow Unicornplant Ibicella lutea forb Alachua Camp Blanding FL Red-cockaded Woodpecker Congongrass Imperata cylindrica grass O,F...Grey Bat & Indiana Bat Indian Swampweed Hygrophila polysperma forb A AL Grey Bat & Indiana Bat Brazilian satintail Imperata brasiliensis grass

  13. Pascagoula Harbor, Mississippi, Feasibility Report on Improvement of the Federal Deep-Draft Navigation Channel. Volume 1. Main Report and Environmental Impact Statement.

    Science.gov (United States)

    1985-03-01

    cerifera) and stands of Cogongrass, locally known as ’Jap Grass’ ( Imperata cylindrica) and torpedo grass (Panicum repens). The lower southeastern-most...dominated by wax myrtle and sea myrtle with stands of Cogongrass, locally known as ’Jap Grass’ ( Imperata cylindrica) and torpedo grass (Panicum repens

  14. Effects of Salinity Stress on Morphological and Physiological Characteristics of some Local Landrace and Inter specific Hybrids of Cucurbits Seedlings as Rootstocks

    Directory of Open Access Journals (Sweden)

    Ali Farhadi

    2017-12-01

    Full Text Available Introduction: Salinity stress is regarded as one of the most important abiotic factors in plant limiting growth, particularly in arid and semi-arid regions. The reduction of plant growth by salinity stress has been well documented. When water supply is limited, plant structure is modified by increasing the root: shoot ratio. To reduce of losses in vegetative growth and production of plant and to improve water use efficiency under saline conditions in high-yielding genotypes grafting them onto rootstocks could bereduced the effect of saline stress on plant shoot. Grafting is a routine technique in continuous cropping systems. Most of the species of cucurbits are distributed in the dry regions. The objective of this studywas investigated the effectiveness of salinity stress on accessions of cucurbita and hybrid inter specific which enter from another country to Iran. Materials and Methods: This research was conducted in laboratory and greenhouse at the Research Center of Agricultural and Natural Resources of Isfahan during 2013-2014 growing season. A factorial experiment based on completely randomized design with three replications was conducted for rootstock and irrigation water salinity.. In the first experiment 25 seeds of rootstocks were sown in petri dishes with 10 cm diameter and irrigated by 10 ml of saline water. Rootstocks included 20 different local landraces and interspecific hybrids (C.moschata cv. Isfahan and Koshk, C.pepo cv. Alvar, Tiran, Koshk and Asgharabad, C. maxima cv. Kermanshah, Shahreza, Mohamadiyeh and Alvar, Lagenaria Siceraria, Luffa cylindrica, Trichosanthes cucumerina, RZ-Ferro, Es113, Ews910, Ews909, Ews913, 426 and Es152. Salinity stress was 6 levels (0, 2, 4, 6, 8 and 10 ds/m of NaCl. Germination, diameter of stem, height of root and stem, shoot and root fresh mass, vigor index and root: shoot ratio were evaluated. In the second experiment seeds were sown in plastic pot by soil media. Seedlings were irrigated daily

  15. Oils and rubber from arid land plants

    Science.gov (United States)

    Johnson, J. D.; Hinman, C. W.

    1980-05-01

    In this article the economic development potentials of Cucurbita species (buffalo gourd and others), Simmondsia chinensis (jojoba), Euphorbia lathyris (gopher plant), and Parthenium argentatum (guayule) are discussed. All of these plants may become important sources of oils or rubber.

  16. Bio-resource Utilization for Food and Medicine: A Case Study of a ...

    African Journals Online (AJOL)

    user

    vegetables are Green papaya, lablab beans, Pumpkin (Jar kunde), Gourd ... fleshes of animals and birds, yet the consumption of meat is limited to only ceremonial ..... cooked traditionally on oven in earthen, copper or stainless steel vessels.

  17. Chapter Two

    African Journals Online (AJOL)

    User

    appreciation of Achebe's creative efforts and the novel's significance in the African literary ... understanding of intellectual culture is undisputable. ..... came his way, and it seldom did, he immediately bought gourds of palm-wine, called round.

  18. China Report, Red Flag, Number 4, 16 February 1985

    Science.gov (United States)

    1985-04-12

    bitter gourd, towel gourd, cucumbers and eggplants were usually in short supply, but since the reforms, the supply has doubled and redoubled. As network...diversified operations such as processing pickled products, processing bean products, preparing soy-sauce meat products and so on. This will enrich the...the theory of neovitalism, represented by the German biologist Driesch. He conducted experiments on sea urchin embryos and demonstrated that a

  19. Berimbau: A simple instrument for teaching basic concepts in the physics and psychoacoustics of music

    Science.gov (United States)

    Vilão, Rui C.; Melo, Santino L. S.

    2014-12-01

    We address the production of musical tones by a simple musical instrument of the Brazilian tradition: the berimbau-de-barriga. The vibration physics of the string and of the air mass inside the gourd are reviewed. Straightforward measurements of an actual berimbau, which illustrate the basic physical phenomena, are performed using a PC-based "soundcard oscilloscope." The inharmonicity of the string and the role of the gourd are discussed in the context of known results in the psychoacoustics of pitch definition.

  20. Ecosystem Management: Synthesis and Findings

    Science.gov (United States)

    2009-04-29

    Imperata cylindrica, in the United States. Weed Technology 7:1005-1009. Faircloth, W.H. M.G. Patterson, J.H. Miller, and D.H. Teem. 2005. Wanted dead or...S.E., and J.B. Grace. 2000. The Effects of Gap Size and Disturbance Type on Invasion of wet pine savanna by Cogongrass, Imperata cylindrica (Poaceae...American Journal of Botany, Vol. 87, No. 9. (Sep., 2000), pp. 1279-1286. Lippincott, C.L. 2000. Effects of Imperata cylindrica (L.) Beauv

  1. A Regional Guidebook for Applying the Hydrogeomorphic Approach to Assessing Wetland Functions of Forested Wetlands in Alluvial Valleys of the Coastal Plain of the Southeastern United States

    Science.gov (United States)

    2013-04-01

    galli Barnyard grass Imperata  cylindrica   Cogongrass Ligustrum japonicum   Japanese privet Ligustrum sinense   Chinese Privet Lonicera japonica... Imperata  cylindrica   Cogongrass Ligustrum japonicum   Japanese privet Ligustrum sinense   Chinese Privet Lonicera japonica   Japanese Honeysuckle...crus-galli Barnyard grass Imperata  cylindrica   Cogongrass Ligustrum japonicum   Japanese privet Ligustrum sinense   Chinese Privet Lonicera

  2. Archboldia, a new Verbenaceous genus from New Guinea

    NARCIS (Netherlands)

    Beer, Eva; Lam, H.J.

    1936-01-01

    Archboldia, nov. gen. — Frutices; folia opposita; inflorescentiae terminales, paniculato-corymbosae, e cymis compositae; calyx plus minusve patens, infundibuliformis, 5-lobatus; corolla exserta, ventricoso-cylindrica, utrinque glabra, aetinomorpha, breviter 5-lobata; stamina 4 alternipetalia,

  3. Protein (Cyanobacteria): 440680064 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available YP_007154859.1 NC_019775 1117:3991 ... 1161:5387 ... 1162:6232 1163:4927 1165:626 272123:626 ... putative addicti...on module antidote protein Anabaena cylindrica PCC 7122 MALTKDFKETVNARIQRDPDFAIVLLDEAISLFLNGELETARLILRNMLNLSHF

  4. Atoll mangroves and associated flora from Republic of Maldives, Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Jagtap, T.G.; Untawale, A.G.

    of the north atolls. Male' atoll was totally devoid of mangroves due to their large scale reclamation mainly for urbanisation and tourism. Mangrove flora comprised of 12 species and was dominated by Bruguiera cylindrica followed by Lumnitzera racemosa, Ceriops...

  5. Tabanone a new phytotoxic constituent of cogongrass (Imperta culindrica)

    Science.gov (United States)

    Cogongrass [Imperata cylindrica (L.) Beauv.] is a troublesome invasive weedy species with reported allelopathic properties. The phytotoxicity of different constituents isolated from roots and aerial parts of this species was evaluated on Lactuca sativa and Agrostis stolonifera. No significant phytot...

  6. Plant-Mediated Changes in Soil N-Cycling Genes during Revegetation of Copper Mine Tailings

    Directory of Open Access Journals (Sweden)

    Yang Li

    2017-11-01

    Full Text Available Nitrogen limitation represents a major bottleneck during the revegetation of mine tailings. However, controls over key nitrogen-cycling genes in rhizospheric soils under differential vegetation management remain poorly understood. The abundance and transcriptional activity of nitrogen-cycling genes and the enzymatic activity of nitrogen transformation are mediated differentially during revegetation of mine tailings by Imperata cylindrica and Chrysopogon zizanioides plants. Results showed that the highest total organic carbon (TOC, total nitrogen (TN, and NH4+-N contents were found in the rhizosphere of I. cylindrica. The nifH gene abundances differed between I. cylindrica and C. zizanioides, and were higher in I. cylindrica which demonstrated by 3.39-fold higher mRNA transcript abundance of the nifH gene and a 2.15-fold higher nitrogen fixation rate in the rhizosphere. In addition, C. zizanioides exhibited a 4.94-fold higher transcript abundance of the archaeal amoA gene and the highest nitrification rate (1.706 ± 0.293 μg N-NO2- g−1 h−1 in the rhizosphere. In conclusion, I. cylindrica and C. zizanioides stimulated the abundances and activities of nifH gene and archaeal amoA gene, respectively. In addition, I. cylindrica appears to be capable of enhancing nitrogen fixation and exhibited accelerated nitrogen accumulation, which may be particularly useful for the rehabilitation of mine tailings.

  7. Regulation of pathogenicity in hop stunt viroid-related group II citrus viroids.

    Science.gov (United States)

    Reanwarakorn, K; Semancik, J S

    1998-12-01

    Nucleotide sequences were determined for two hop stunt viroid-related Group II citrus viroids characterized as either a cachexia disease non-pathogenic variant (CVd-IIa) or a pathogenic variant (CVd-IIb). Sequence identity between the two variants of 95.6% indicated a conserved genome with the principal region of nucleotide difference clustered in the variable (V) domain. Full-length viroid RT-PCR cDNA products were cloned into plasmid SP72. Viroid cDNA clones as well as derived RNA transcripts were transmissible to citron (Citrus medica L.) and Luffa aegyptiaca Mill. To determine the locus of cachexia pathogenicity as well as symptom expression in Luffa, chimeric viroid cDNA clones were constructed from segments of either the left terminal, pathogenic and conserved (T1-P-C) domains or the conserved, variable and right terminal (C-V-T2) domains of CVd-IIa or CVd-IIb in reciprocal exchanges. Symptoms induced by the various chimeric constructs on the two bioassay hosts reflected the differential response observed with CVd-IIa and -IIb. Constructs with the C-V-T2 domains region from clone-IIa induced severe symptoms on Luffa typical of CVd-IIa, but were non-symptomatic on mandarin as a bioassay host for the cachexia disease. Constructs with the same region (C-V-T2) from the clone-IIb genome induced only mild symptoms on Luffa, but produced a severe reaction on mandarin, as observed for CVd-IIb. Specific site-directed mutations were introduced into the V domain of the CVd-IIa clone to construct viroid cDNA clones with either partial or complete conversions to the CVd-IIb sequence. With the introduction of six site-specific changes into the V domain of the clone-IIa genome, cachexia pathogenicity was acquired as well as a moderation of severe symptoms on Luffa.

  8. Investigation of NPK in fertilized and unfertilized vegetables

    International Nuclear Information System (INIS)

    Deeba, F.; Butt, M.T.; Iqubal, K.; Shafiq, T.

    2010-01-01

    Contents of selected minerals and moisture in Ridge Gourd, Gourd and Brinjal vegetables, collected from house and market of different localities, were determined. In house vegetables from kitchen garden of PCSIR colony the moisture contents were high (90%) as compared to market vegetables of Taj Bagh, Railway workshop Mandy and Singpura Lahore Mandy was 87%, 86.5% and 87.5% respectively. Regarding nitrogen, nitrate, nitrite, phosphate, sodium and potassium was high in market vegetables as compared to house samples due to the accumulation of nutrients in soil and crop. (author)

  9. Biodegradable packaging materials conception based on starch and polylactic acid (PLA) reinforced with cellulose.

    Science.gov (United States)

    Masmoudi, Fatma; Bessadok, Atef; Dammak, Mohamed; Jaziri, Mohamed; Ammar, Emna

    2016-10-01

    The plastic materials used for packaging are increasing leading to a considerable amount of undegradable solid wastes. This work deals with the reduction of conventional plastics waste and the natural resources preservation by using cellulosic polymers from renewable resources (alfa and luffa). Plasticized starch films syntheses were achieved at a laboratory scale. These natural films showed some very attractive mechanical properties at relatively low plasticizers levels (12 to 17 % by weight). Furthermore, mixtures including polylactic acid polymer (PLA) and cellulose fibers extracted from alfa and luffa were investigated by melt extrusion technique. When used at a rate of 10 %, these fibers improved the mixture mechanical properties. Both developed materials were biodegradable, but the plasticized starch exhibited a faster biodegradation kinetic compared to the PLA/cellulose fibers. These new materials would contribute to a sustainable development and a waste reduction.

  10. Differential response of human melanoma and Ehrlich ascites cells in vitro to the ribosome-inactivating protein luffin.

    Science.gov (United States)

    Poma, A; Miranda, M; Spanò, L

    1998-10-01

    The cytotoxicity and inhibitory effect on proliferation of the type 1 ribosome-inactivating protein luffin purified from the seeds of Luffa aegyptiaca were investigated both in human metastatic melanoma cells and in murine Ehrlich ascites tumour cells. Results indicate that luffin from the seeds of Luffa aegyptiaca is cytotoxic to the cell lines tested, with approximately 10 times greater potency in Ehrlich cells. Luffin was found to induce an increase in cytosolic oligonucleosome-bound DNA in both melanoma and Ehrlich ascites tumour cells, the level of DNA fragmentation in the former cell line being higher than in the latter. Experiments with melanoma cells indicate that an increase in cytosolic nucleosomes could be supportive of apoptosis as the type of cell death induced by luffin.

  11. EVALUACIÓN POR MÉTODO ECOMÉTRICO DE AGAR OBTENIDO DE ALGAS ROJAS COLOMBIANAS

    Directory of Open Access Journals (Sweden)

    A. Villalobos

    2007-12-01

    Full Text Available The purpose of this study was to evaluate the productivity on agar-agar of two species of red algae of thegenera Gracilaria belonging from the Colombiam Caribean coast (G. cylindrica and G. mammillarisobtained in laboratory. Productivity of culture media elaborated with base agar - agar was determinedusing the ecometric method with 20 different bacterial species. Results obtained from ICA and ICRshowed that agar extracted from Gracilaria cylindrica and Gracillaria mammillaris are equally productive,this shows that both species can be used for agar production. For better results, it is still necessary tooptimize extraction processes and purification of agar in both species of algae.

  12. Establishment of an efficient Agrobacterium tumefaciens -mediated ...

    African Journals Online (AJOL)

    Spine gourd (Momordica dioica Roxb. ex Willd) is a medicinally and economically important plant and also used as vegetable. In this study, we established an Agrobacterium tumefaciens-mediated transformation procedure for M. dioica. Leaf explants were incubated with A. tumefaciens strain LBA4404 containing a binary ...

  13. Cultivation and uses of cucurbits

    Science.gov (United States)

    Cultivated cucurbits have spread through trade and exploration from their respective Old and New World centers of origin to the six arable continents and are important in local, regional and world trade. Cucumber (Cucumis sativus L.), melon (Cucumis melo L.), pumpkin, squash and gourd (Cucurbita spp...

  14. Outrageous Owls

    Science.gov (United States)

    Walkup, Nancy

    2007-01-01

    The author's encounter with a live owl and her purchase of a Peruvian folk art gourd inspired a new interdisciplinary experience for the author's fourth grade students. In this article, she describes how her students explored owls through clay sculpture. (Contains 2 resources and 1 online resource.)

  15. Ghee-making in the cattle corridor of Uganda | Sempiira | African ...

    African Journals Online (AJOL)

    Milk and/or cream are allowed to ferment for up to 12 hours and butter is separated by churning in a gourd. The butter/ghee-making practices in the cattle corridor of Uganda differ in how the milk is handled before churning to separate the butterfat. The study revealed that butter/ghee-making is an effective way to reduce ...

  16. 75 FR 58433 - Notice of Inventory Completion: Brigham Young University, Museum of Peoples and Cultures, Provo, UT

    Science.gov (United States)

    2010-09-24

    .... Charles Lang and Mr. Platte Lyman donated the human remains to the Deseret Museum, Salt Lake City, UT... Saints in Salt Lake City, UT. The collection became known as the Lang-Lyman Collection, and was acquired... of human hair, 1 mug, 1 leather pouch, 1 piece of buckskin, 1 gourd container, 60 feathers, 1 bone...

  17. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    The structures of nine independent crystals of bitter gourd seed lectin (BGSL), a non-toxic homologue of type II RIPS, and its sugar complexes have been determined. The four-chain, two-fold symmetric, protein is made up of two identical two-chain modules, each consisting of a catalytic chain and a lectin chain, connected ...

  18. and dyes metabolized to benzidine were - AJOL

    African Journals Online (AJOL)

    LAB

    2012-07-17

    Jul 17, 2012 ... Violuric acid (VLA) was purchased from Fluka Chemicals. (Austria). Sodium alginate was the product of Koch-Light (Pool,. England). Jack bean meal was purchased from Loba Chemical. Company (Mumbai, India). Bitter gourd was purchased from the local vegetable market. Other chemicals and reagents ...

  19. Changes in germination characteristics and seedling growth ...

    African Journals Online (AJOL)

    Yomi

    2012-03-06

    Mar 6, 2012 ... Priming provides controlled hydration of seeds to a level ... water but drying them before complete germination. .... compared with the control, although, this difference was ... membrane damage, and restores germ inability to aged .... lipid per oxidation in bitter gourd seeds and effects of priming and hot.

  20. 40 CFR 180.920 - Inert ingredients used pre-harvest; exemptions from the requirement of a tolerance.

    Science.gov (United States)

    2010-07-01

    ... than 0.2 pt of pesticide formulation Light stabilizer Hydroxypropyl guar gum Thickener Isobornyl... per acre Preservative/stabilizer Boric acid Sequestrant Buffalo gourd root powder (Cucurbita foetidissima root powder); or, Zucchini juice (Cucurbita pepo juice) or Hawkesbury melon Citrullus lanatus. No...

  1. A Feminist Reading of a Regional Novel: Zora Neale Hurston's ...

    African Journals Online (AJOL)

    The novel, Jonah's Gourd Vine, comprises a search for self-identity for the black man and the black woman in America, as well as a search for new roles for each of the sexes during that period of transition in the African-American history just after the Slave Emancipation. Using the sociological framework qualified by the ...

  2. Preservative effect of various indigenous plants on fermented milk ...

    African Journals Online (AJOL)

    SARAH

    2014-01-31

    Jan 31, 2014 ... Verbenaceae*. Shrub stem. Applied to milk gourd before milk fermentation. Olorien ... powder using an electric grinder (model M10R Japan) and stored until ... measurement cell of a compact pH meter (Horiba B-. 212) and pH ...

  3. The chemical constituents of calabash ( Crescentia cujete ) | Ejelonu ...

    African Journals Online (AJOL)

    Virtually, all parts of the calabash (Crescentia cujete) tree have been found to be useful; the wood for tool handles, ribs in boat building, cattle yokes, and the gourd is used for cups, containers and musical instruments. The calabash (C. cujete) fruit was studied for its chemical constituents- proximate and mineral composition ...

  4. Structural studies on a non-toxic homologue of type II RIPs from ...

    Indian Academy of Sciences (India)

    Structural studies on a non-toxic homologue of type II RIPs from bitter gourd: Molecular basis of non-toxicity, conformational selection and glycan structure. MS accepted http://www.ias.ac.in/jbiosci. THYAGESHWAR CHANDRAN, ALOK SHARMA and M VIJAYAN. J. Biosci. 40(5), October 2015, 929–941, © Indian Academy of ...

  5. Watermelon and ragweed share allergens.

    Science.gov (United States)

    Enberg, R N; Leickly, F E; McCullough, J; Bailey, J; Ownby, D R

    1987-06-01

    A biotin-avidin amplified ELISA was used to measure antigen-specific IgE for ragweed, representative members of the gourd family (watermelon, cantaloupe, honeydew melon, zucchini, and cucumber), and banana in the sera of 192 allergic patients, each with an IgE greater than or equal to 180 microns/ml. Sixty-three percent (120/192) of the sera contained antiragweed IgE, and of these patients, 28% to 50% contained IgE specific for any single gourd family member. In contrast, no greater than 11% of the sera positive for a given gourd or banana were negative for ragweed. Correlations between ragweed and gourd-specific IgE levels were significant (p less than 0.001), and correlation coefficients between any two gourds exceeded 0.79. In an ELISA system, the extracts of watermelon and ragweed inhibited each other in a dose-dependent manner; the resulting nonparallel inhibition curves indicate that some, but not all, of the allergens in the two extracts are cross-reactive. Isoelectric focusing of watermelon and ragweed extracts in narrow range gel (pH 4 to 6) followed by immunoblotting demonstrated six watermelon allergen bands with isoelectric points identical to those of ragweed allergens. Several remaining bands in the two extracts had differing isoelectric points, however. Six of 26 patients interviewed with watermelon-specific IgE reported developing oropharyngeal symptoms (itching and/or swelling of the lips, tongue, or throat) after ingesting at least one of the study foods, whereas only one of 25 patients interviewed without detectable watermelon-specific IgE reported similar symptoms (p = 0.05).(ABSTRACT TRUNCATED AT 250 WORDS)

  6. Revisiting “Vegetables” to combat modern epidemic of imbalanced glucose homeostasis

    Science.gov (United States)

    Tiwari, Ashok Kumar

    2014-01-01

    Vegetables have been part of human food since prehistoric times and are considered nutritionally necessary and good for health. Vegetables are rich natural resource of biological antioxidants and possess capabilities of maintaining glucose homeostasis. When taken before starch-rich diet, juice also of vegetables such as ridge gourd, bottle gourd, ash gourd, chayote and juice of leaves of vegetables such as radish, Indian Dill, ajwain, tropical green amaranth, and bladder dock are reported to arrest significantly the rise in postprandial blood glucose level. Juice of vegetables such as ash gourd, squash gourd, and tropical green amaranth leaves are observed to tone-down sweet-beverages such as sucrose, fructose, and glucose-induced postprandial glycemic excursion. On the other hand, juice of egg-plant and juice of leaves of Ceylon spinach, Joyweed, and palak are reported to augment starch-induced postprandial glycemic excursion; and juice of leaves of Ceylon spinach, Joyweed, and radish supplement to the glucose-induced postprandial glycemia. Vegetables possess multifaceted antihyperglycemic activities such as inhibition of pancreatic α-amylase and intestinal α-glucosidase, inhibition of protein-tyrosine phosphatase 1β in liver and skeletal muscles, and insulin mimetic and secretagogue activities. Furthermore, they are also reported to influence polyol pathway in favor of reducing development of oxidative stress, and consequently the development of diabetic complications. In the wake of emergence of modern maladaptive diet-induced hyperglycemic epidemic therefore, vegetables may offer cost-effective dietary regimen to control diet-induced glycemic over load and future development of diabetes mellitus. However, for vegetables have been reported to do both, mitigate as well as supplement to the diet-induced postprandial glycemic load, care is required in selection of vegetables when considered as medicament. PMID:24991093

  7. Revisiting "Vegetables" to combat modern epidemic of imbalanced glucose homeostasis.

    Science.gov (United States)

    Tiwari, Ashok Kumar

    2014-04-01

    Vegetables have been part of human food since prehistoric times and are considered nutritionally necessary and good for health. Vegetables are rich natural resource of biological antioxidants and possess capabilities of maintaining glucose homeostasis. When taken before starch-rich diet, juice also of vegetables such as ridge gourd, bottle gourd, ash gourd, chayote and juice of leaves of vegetables such as radish, Indian Dill, ajwain, tropical green amaranth, and bladder dock are reported to arrest significantly the rise in postprandial blood glucose level. Juice of vegetables such as ash gourd, squash gourd, and tropical green amaranth leaves are observed to tone-down sweet-beverages such as sucrose, fructose, and glucose-induced postprandial glycemic excursion. On the other hand, juice of egg-plant and juice of leaves of Ceylon spinach, Joyweed, and palak are reported to augment starch-induced postprandial glycemic excursion; and juice of leaves of Ceylon spinach, Joyweed, and radish supplement to the glucose-induced postprandial glycemia. Vegetables possess multifaceted antihyperglycemic activities such as inhibition of pancreatic α-amylase and intestinal α-glucosidase, inhibition of protein-tyrosine phosphatase 1β in liver and skeletal muscles, and insulin mimetic and secretagogue activities. Furthermore, they are also reported to influence polyol pathway in favor of reducing development of oxidative stress, and consequently the development of diabetic complications. In the wake of emergence of modern maladaptive diet-induced hyperglycemic epidemic therefore, vegetables may offer cost-effective dietary regimen to control diet-induced glycemic over load and future development of diabetes mellitus. However, for vegetables have been reported to do both, mitigate as well as supplement to the diet-induced postprandial glycemic load, care is required in selection of vegetables when considered as medicament.

  8. Effects of SO/sub 2/ on photosynthesis and nitrogen fixation

    Energy Technology Data Exchange (ETDEWEB)

    Haellgren, J E; Huss, K

    1975-06-15

    Responses of photosynthesis and nitrogen fixation to NaHSO/sub 3/ (10/sup -5/ to 5 x 10/sup -3/ M) were investigated in the lichen Stereocaulon paschale (L.) Fr. and the blue-green alga Anabaena cylindrica Lemmermann. The treatments were performed in buffered media with varying pH (5.8 to 8.1) and light conditions (0 to 32 W x m/sup -2/). The activities of the intact organisms were investigated, under the same environmental conditions, with /sup 14/C liquid scintillation and acetylene reduction techniques respectively. The nitrogen fixation proved to be more susceptible than photosynthesis, in both organisms, and in all cases treatments at pH 5.8 were more inhibitory than at higher pH-values. Treatment with 5 x 10/sup -4/ M NaHSO/sub 3/ at pH 5.8 caused no reduction of photosynthesis in S. paschale, while the inhibition of nitrogen fixation was 97%. For A. cylindrica the corresponding values were 40% and 75% respectively. Short-time treatments of A. cylindrica showed that the nitrogen fixation was more rapidly affected than photosynthesis. The inhibition of nitrogenase activity and CO/sub 2/-fixation was smaller in the dark and increased at higher light intensities. Both processes showed a good capacity for recovery after removal of the NaHSO/sub 3/ solution. Also the clumping ability of A. cylindrica was disturbed by NaHSO/sub 3/ treatments.

  9. Seasonal and inter-annual photosynthetic response of representative C4 species to soil water content and leaf nitrogen concentration across a tropical seasonal floodplain

    NARCIS (Netherlands)

    Mantlana, K.B.; Arneth, A.; Veenendaal, E.M.; Wohland, P.; Wolski, P.; Kolle, O.; Lloyd, J.

    2008-01-01

    We examined the seasonal and inter-annual variation of leaf-level photosynthetic characteristics of three C4 perennial species, Cyperus articulatus, Panicum repens and Imperata cylindrica, and their response to environmental variables, to determine comparative physiological responses of plants

  10. Interim Regional Supplement to the Corps of Engineers Wetland Delineation Manual: Eastern Mountains and Piedmont Region

    Science.gov (United States)

    2010-07-01

    wetland species, whereas the higher zones can be very diverse with smallspike false nettle (Boehmeria cylindrica), Canadian woodnettle (Laportea...grasses (e.g., Chasmanthium laxum, Glyceria spp., and Cinna arundinacea), rushes (Juncus spp.), smallspike false nettle , lizard’s tail, skunk cabbage...Aquatic fauna Category: Primary General Description: Presence of live individuals, diapausing insect eggs or crustacean cysts, or dead remains of

  11. Regional Supplement to the Corps of Engineers Wetland Delineation Manual: Eastern Mountains and Piedmont Region (Version 2.0)

    Science.gov (United States)

    2012-04-01

    nettle (Boehmeria cylindrica), Canadian woodnettle (Laportea canaden- sis), white panicle aster (Symphyotrichum lanceolatum = Aster simplex...spp.), smallspike false nettle , lizard’s tail, skunk cabbage (Symplocarpus foetidus), cardinal flower, jewelweed (Impatiens capensis), tearthumbs...Presence of live individuals, diapausing insect eggs or crustacean cysts, or dead remains of aquatic fauna, such as, but not limited to, sponges, bivalves

  12. New journals

    NARCIS (Netherlands)

    NN,

    1972-01-01

    Biotrop Bulletin. This new Bulletin started with No. 1 in 1970, printed by Archipel, Bogor, a paper by Mr. M. Soerjani, ’Alang alang, Imperata cylindrica (L.) P.B. pattern of growth as related to its problem of control’. 88 pp., 18 fig., 18 tab. This served also as a Ph.D. thesis for the author

  13. Pengaruh Ekstrak Alang-alang, Babadotan dan Teki terhadap Penyakit Antraknosa pada Buah Pisang Kultivar Cavendish

    OpenAIRE

    Intan Zahara Arie; Joko Prasetyo; Efri Efri

    2015-01-01

    Penelitian ini bertujuan untuk mengetahui pengaruh ekstrak alang-alang (Imperata cylindrica), teki (Cyperus rotundus), dan babadotan (Ageratum conyzoides) terhadap pertumbuhan dan sporulasi Colletotrichum musae. Penelitian juga bertujuan mengetahui pengaruh ekstrak alang-alang, teki dan babadotan terhadap keparahan penyakit antraknosa secara in vivo.Penelitian dilaksanakan di Laboratorium Penyakit Tumbuhan, Fakultas Pertanian, Universitas Lampung, dari bulan Juni sampai dengan September 2014....

  14. Potential biological control agents for management of cogongrass (Cyperales: Poaceae) in the southeastern USA

    Science.gov (United States)

    Cogongrass, Imperata cylindrica (L.) Palisot de Beauvois (Cyperales: Poaceae), is a noxious invasive weed in the southeastern USA. Surveys for potential biological control agents of cogongrass were conducted in Asia and East Africa from 2013 to 2016. Several insect herbivores were found that may hav...

  15. Determination of trace elements in biological material by neutron activation analysis

    International Nuclear Information System (INIS)

    Tran Van, L.; Teherani, D.K.

    1989-01-01

    Eighteen trace elements in biological materials [grass (Imperata cylindrica), mimosa plant (Mimosa pudica), rice] by neutron activation method were determined. In the comparative analysis the content of the same element was different in each material, although they were collected at the same place and the same sampling method was applied. (author) 4 refs.; 1 fig.; 1 tab

  16. Integrated nutrient management research with sweet potato in Papua New Guinea

    NARCIS (Netherlands)

    Hartemink, A.E.

    2003-01-01

    This paper summarizes a series of field experiments that investigated the effects of organic and inorganic nutrients on sweet potato tuber yield in the humid lowlands of Papua New Guinea. In the first experiment, plots were planted with Piper aduncum, Gliricidia sepium and Imperata cylindrica, which

  17. Effect of an Invasive Grass on Ambient Rates of Decomposition and Microbial Community Structure: A Search for Causality

    Science.gov (United States)

    In sutu decomposition of above and below ground plant biomass of the native grass species Andropogon glmoeratus (Walt.) B.S.P and exotic Imperata cylindrica (L.) Beauv. (cogongrass) was investigated using litter bags over the course of a 12 month period. The above and below ground biomass of the inv...

  18. Final Environmental Assessment Implementation of the Integrated Natural Resources Management Plan for Avon Park Air Force Range Florida

    Science.gov (United States)

    2004-01-01

    divine nightshade (Solanum nigrescens) Coast sandspur (Cenchrus incertus) Three plants — tropical soda apple (Solanum viarum), cogon grass ( Imperata ...consequence on the APAFR ecosystem. However in the last 5 years, there has been an increase in the number of sites where cogon grass ( Imperata ...verticillata Hydrilla Hymenachne amplexicaulis West In mdian arsh grass Imperata cylindrica Cogon grass Lantana camara Lantana Ligustrum sinense Chinese

  19. Invasive Species Guidebook for Department of Defense Installations in the Chesapeake Bay Watershed: Identification, Control, and Restoration

    Science.gov (United States)

    2007-11-01

    Crown vetch Coronilla varia MD, VA 14 Leafy spurge Euphorbia esula VA 15 Ground ivy Glechoma hederacea DC, MD, PA, VA, WV 17 Cogongrass Imperata ...INSTALLATIONS IN THE CHESAPEAKE BAY WATERSHED IDENTIFICATION AND CONTROL METHODS Cogongrass ( Imperata cylindrica) Description & Biology – A large

  20. Varied growth response of cogongrass ecotypes to elevated CO2

    Science.gov (United States)

    Cogongrass [Imperata cylindrica (L.) P. Beauv] is an invasive C4 perennial grass which is listed as one of the top ten worst weeds in the world and is a major problem in the Southeast US. Five cogongrass ecotypes (Florida, Hybrid, Louisiana, Mobile, and North Alabama) collected across the Southeast ...

  1. Determination of trace elements in biological material by neutron activation analysis. [As,Au,Br,Cd,Cl,Co,Cr,Fe,Hg,K,Mn,Na,Ni,Rb,Sb,Sc,Se,Zn

    Energy Technology Data Exchange (ETDEWEB)

    Tran Van, L; Teherani, D K

    1989-04-10

    Eighteen trace elements in biological materials (grass (Imperata cylindrica), mimosa plant (Mimosa pudica), rice) by neutron activation method were determined. In the comparative analysis the content of the same element was different in each material, although they were collected at the same place and the same sampling method was applied. (author) 4 refs.; 1 fig.; 1 tab.

  2. Loblolly pine seedling response to competition from exotic vs. native plants

    Science.gov (United States)

    Pedram Daneshgar; Shibu Jose; Craig Ramsey; Robin Collins

    2006-01-01

    A field study was conducted in Santa Rosa County, FL to test the hypothesis that an exotic understory would exert a higher degree of competition on tree seedling establishment and growth than native vegetation. The study site was a 60 ha cutover area infested with the invasive exotic cogongrass [Imperata cylindrica (L.) Raeusch.]. A completely...

  3. Restoring productivity to cogograss-infested land through reforestation

    Science.gov (United States)

    W.H. Faircloth; M.G. Patterson; James H. Miller; D.H. Teem

    2004-01-01

    Cogongrass (Imperata cylindrica) is an invasive grass that is rapidly colonizing the Gulf coastal plain, with potential to spread well into the interior of the Southeastern U.S. Cogongrass is particularly harmful to forested land. In such situations, cogongrass hinders plantation establishment, may contribute to crowning fires in young stands,...

  4. International Symposium on the Biology and Management of Aquatic Plants. Volume 31

    Science.gov (United States)

    1993-01-01

    Yang. 1991. Lipid peroxidation and antioxidative transgenic plants overexpressing peroxidase. Plant Physiol 96:577- defense systems in early leaf...Factors 3. Chandrasena, J. P. N. R. and W. H. T. Dhammika. 1988. Studies on limiting the distribution of cogongrass, Imperata cylindrica, and torpe

  5. International Symposium on the Biology and Management of Aquatic Plants Held in Daytona Beach, Florida on 12-16 July 1992, Volume 31

    Science.gov (United States)

    1993-01-01

    antioxidative transgenic plants overexpressing peroxidase. Plant Physiol 96.577- defense systems in early leaf growth. J. Plant Growth Regul. 10- 187- 583...S. A. 1986. Effects of dalapon and glyphosate on Imperata cylindrica (L) Beauv. at different growth stages. MARDI Res. Bull. achieved. In addition

  6. General Plan Environmental Assessment, Hurlburt Field, Florida

    Science.gov (United States)

    2005-10-01

    sebiferum) and cogon grass (Imperata Resource/Issue Areas Hurlburt Field General Plan Environmental Assessment 4-9 cylindrica) are most...habitat on the western portion of the installation. The restoration of a native long-leaf pine/wire grass community on Hurlburt is associated with a

  7. A Regional Guidebook for Applying the Hydrogeomorphic Approach to Assessing Wetland Functions of Flats Wetlands in the Everglades

    Science.gov (United States)

    2002-07-01

    cylindrica Cogon grass lnamoea aouatica Water spinach Jasminum dichotomum Gold Coast jasmine Jasminum fluminense, Brazilian jasmine Jasminum sambac...dominated by Cladiumjamaicense (saw grass ) ............................................... 51 Figure 23. Relationship between percent concurrence of strata...Reference standard Marl Flats Everglades wetland dominated by Cladiumjamaicense (saw grass ), Spartina alterniflora (smooth cordgrass), Rhynchospora

  8. Earliest Cucurbita from the Great Lakes, Northern USA

    Science.gov (United States)

    Monaghan, G. William; Lovis, William A.; Egan-Bruhy, Kathryn C.

    2006-03-01

    Directly dated Cucurbita from archaeological sites near Lake Huron expand the range and human usage of adventive, cultivated wild gourds or squash into the Great Lakes region, USA, by 4000 14C yr BP. The data also show that domesticated C. pepo squash was cultivated there by 3000 14C yr BP. Although milder Hypsithermal climate may have been a contributing factor, squash and gourds expanded northward during the mid-Holocene mainly by human agency and may be the first human-introduced adventive plant in temperate North America. Even after 3000 14C yr BP, when domesticated squash generally replaced wild varieties at northern sites, squash stands were probably informally managed rather than intensively cultivated.

  9. Underexploited tropical plants with promising economic value

    Energy Technology Data Exchange (ETDEWEB)

    1975-01-01

    The apparent advantages of staple plants over the minor tropical plants often result only from the disproportionate research attention they have been given. A world-wide inquiry resulted in a list of 400 promising but neglected species. The 36 most important species are described in compact monographs and concern cereals (Echinochloa turnerana, grain amaranths, quinua and Zosterea mazina), roots and tubers (Arrachacha, cocoyams and taro), vegetables (chaya, hearts of palms, wax gourd, winged bean), fruits (durian, mangosteen, naranjilla, pejibaye, pummelo, soursop, uvilla), oilseeds (babassu palm, buffalo gourd, Caryocar species, Hessenia polycarpa and jojoba), forage (Acacia albida, Brosimum alicastrum Cassia sturtii, saltbushes and tamarugo) and other crops (buriti palm, Calathea lutea, candelilla, guar, guayule, Paspalum vaginatum, ramie and Spirulina).

  10. VEGETABLE PEELS: A PROMISING FEED RESOURCE FOR LIVESTOCK

    OpenAIRE

    Md. Emran HOSSAIN; Syeda Ayesha SULTANA; Mohammad Hasanul KARIM; Md. Imran AHMED

    2016-01-01

    The study was undertaken to find out the chemical composition of different vegetable peels available in Rangunia, Chittagong, Bangladesh. Total 10 different vegetable peels i.e., Banana blossom (Musa sapientum), Bottle gourd peel (Lagenaria siceraria), Brinjal peel (Solanum melongena), Gram husk (Cicer arietinum), Green banana peel (Musa sapieutum), Green coconut peel (Cocos nucifera), Pea husk (Pisum sativum), Potato peel (Solanum tuberosum), Pumpkin peel (Cucurbita maxima), Ripe banana peel...

  11. Development of shelf-stable radiation processed Ready-to-Cook (RTC) Indian vegetables

    International Nuclear Information System (INIS)

    Sharma, J.; Chatterjee, S.; Gupta, S.; Kumar, Vivekanand; Variyar, P.S.; Sharma, A.

    2009-01-01

    Use of radiation processing in combination with packaging and low temperature storage aided in extending shelf-life of RTC Indian vegetables without affecting their organoleptic and sensory quality. An extension in shelf-life of 15 days in case of RTC french beans and pumpkin and in RTC ash gourd and drumstick of 8 and 5 days respectively was achieved when cling wrapped, irradiated at a dose of 2 kGy and stored at 10 deg C. (author)

  12. Root exudates from grafted-root watermelon showed a certain contribution in inhibiting Fusarium oxysporum f. sp. niveum.

    Directory of Open Access Journals (Sweden)

    Ning Ling

    Full Text Available Grafting watermelon onto bottle gourd rootstock is commonly used method to generate resistance to Fusarium oxysporum f. sp. niveum (FON, but knowledge of the effect of the root exudates of grafted watermelon on this soil-borne pathogen in rhizosphere remains limited. To investigate the root exudate profiles of the own-root bottle gourd, grafted-root watermelon and own-root watermelon, recirculating hydroponic culture system was developed to continuously trap these root exudates. Both conidial germination and growth of FON were significantly decreased in the presence of root exudates from the grafted-root watermelon compared with the own-root watermelon. HPLC analysis revealed that the composition of the root exudates released by the grafted-root watermelon differed not only from the own-root watermelon but also from the bottle gourd rootstock plants. We identified salicylic acid in all 3 root exudates, chlorogenic acid and caffeic acid in root exudates from own-root bottle gourd and grafted-root watermelon but not own-root watermelon, and abundant cinnamic acid only in own-root watermelon root exudates. The chlorogenic and caffeic acid were candidates for potentiating the enhanced resistance of the grafted watermelon to FON, therefore we tested the effects of the two compounds on the conidial germination and growth of FON. Both phenolic acids inhibited FON conidial germination and growth in a dose-dependent manner, and FON was much more susceptible to chlorogenic acid than to caffeic acid. In conclusion, the key factor in attaining the resistance to Fusarium wilt is grafting on the non-host root stock, however, the root exudates profile also showed some contribution in inhibiting FON. These results will help to better clarify the disease resistance mechanisms of grafted-root watermelon based on plant-microbe communication and will guide the improvement of strategies against Fusarium-mediated wilt of watermelon plants.

  13. Dataset on the abundance of ants and Cosmopolites sordidus damage in plantain fields with intercropped plants

    OpenAIRE

    Anicet Gbèblonoudo Dassou; Dominique Carval; Sylvain Dépigny; Gabriel Fansi; Philippe Tixier

    2016-01-01

    The data presented in this article are related to the research article entitled ?Ant abundance and Cosmopolites sordidus damage in plantain fields as affected by intercropping? (A.G. Dassou, D. Carval, S. D?pigny, G.H Fansi, P. Tixier, 2015) [1]. This article describes how associated crops maize (Zea mays), cocoyam (Xanthosoma sagittifolium) and bottle gourd (Lagenaria siceraria) intercropped in the plantain fields in Cameroun modify ant community structure and damages of banana weevil Cosmop...

  14. A comparative study on drip and furrow irrigation methods

    International Nuclear Information System (INIS)

    Babar, M.M.; Shaikh, A.

    2008-01-01

    This study was conducted at Field Laboratory of the IIDE-MUET (Institute of lrrigation and Drainage Engineering, Mehran University of Engineering and Technology), Jamshoro in April 2007 and completed in October 2007. The soil was out-wash of the surrounding hilly tracts. Thus, the texture of the soil was sandy loam mixed with various sizes of gravels. Consequently, its water holding capacity was low and drainability high. The field capacity, wilting point and available moisture of the soil were found to be 10.35, 5.56 and 4.79%, respectively. The soil was moderate (ECe 8-16 dS/m) to strongly saline (ECe> 16 dS/m) and slightly sodic in nature in drip and furrow irrigated plots under study before start of vegetable crops. Three summer vegetables, i.e. okra, long gourd and ridge gourd were cultivated under drip and furrow systems of irrigation. Tap water was used for irrigation, which was class-I quality water i.e. nonsaline and non-sodic. Yields of the three respective vegetables were 25, 16.5 and 7.9% higher than the yields obtained from furrow method. Likewise, WUE (Water Use Efficiency) was higher in drip at 1.27, 3.19 and 2.28 Kg/m/sup 3/ against 0.59, 1.46 and 1.16 Kg/m/sup 3/ in furrow for the respective vegetables. The water saving in drip over furrow method for okra, long gourd and ridge gourd was estimated at 42.2, 46.9 and 45.0%, respectively. The soil salinity and sodicity decreased and did not develop within wetted zone under drip irrigation method and at furrow beds. However the same increased at the wetted periphery and at tops of the ridges under drip and furrow methods of irrigation respectively. (author)

  15. The Changes of P-fractions and Solubility of Phosphate Rock in Ultisol Treated by Organic Matter and Phosphate Rock

    Directory of Open Access Journals (Sweden)

    Heru Bagus Pulunggono

    2012-09-01

    Full Text Available Phosphorus (P is one of the essential elements for plant, however, its availability is mostly very low in acid soils. It is well documented that application of phosphate rock and organic matter are able to change the level of availability of P-form in acid soils. The objective of the research were to evaluate the changes of P-fractions ( resin-P, NaHCO3-Pi, and NaHCO3-Po and phosphate rock dissolution which were induced by application of organic matter (Imperata cylindrica, Pueraria javanica, dan Colopogonium mucunoides and phosphate rock in Utisol Lampung. The experiment was designed in a completely randomized design with three factors and three replications. The first factor was the types of organic matter (I. cylindrica, P. javanica, and C. mucunoides, the second factor was the rate of organic matter (0, 2.5, and 5%, and the third factor was the rate of phosphate rock (0, 40, and 80 mg P kg-1. The results showed that in the rate of 0 and 1% organic matter, the type of organic matter did not affect P-fraction of NaHCO3-Pi, but in the rate of 2.5 and 5%, NaHCO3-Pi due to application of P. javanica, and C. mucunoides higher than due to application of I. cylindrica. However, the increasing rate of organic matter increased NaHCO3-Pi. Then, P-fraction of Resin-Pi was affected by the type of organic matter, the rate of organic matter, and the rate of phosphate rock, respectively. P-fraction of resin-Pi due to application of P. javanica, and C. mucunoides was higher than due to application of I. cylindrica, but the effect of P. javanica, and C. mucunoides was not different. Increasing the rate of organic matter and phosphate rock increased P-fraction of resin-Pi and NaHCO3-Pi, but P-fraction of NaHCO3-Po was not affected by all treatments. Meanwhile, dissolution of phosphate rock was affected by the kind of organic matter and soil reaction. In the rate of 5% organic matter, dissolution of phosphate rock by application of I. cylindrica (70% was higher

  16. Major dietary patterns and carotid intima-media thickness in Bangladesh.

    Science.gov (United States)

    McClintock, Tyler R; Parvez, Faruque; Wu, Fen; Islam, Tariqul; Ahmed, Alauddin; Rani Paul, Rina; Shaheen, Ishrat; Sarwar, Golam; Rundek, Tatjana; Demmer, Ryan T; Desvarieux, Moise; Ahsan, Habibul; Chen, Yu

    2016-02-01

    Carotid intima-media thickness (IMT) is a validated surrogate marker of preclinical atherosclerosis and is predictive of cardiovascular morbidity and mortality. Research on the association between IMT and diet, however, is lacking, especially in low-income countries or low-BMI populations. Cross-sectional analysis. Dietary intakes were measured using a validated, thirty-nine-item FFQ at baseline cohort recruitment. IMT measurements were obtained from 2010-2011. Rural Bangladesh. Participants (n 1149) randomly selected from the Health Effects of Arsenic Longitudinal Study, an ongoing, population-based, prospective cohort study established in 2000. Average age at IMT measurement was 45·5 years. Principal component analysis of reported food items yielded a 'balanced' diet, an 'animal protein' diet and a 'gourd and root vegetable' diet. We observed a positive association between the gourd/root vegetable diet and IMT, as each 1 sd increase in pattern adherence was related to a difference of 7·74 (95 % CI 2·86, 12·62) μm in IMT (Pbalanced pattern was associated with lower IMT (-4·95 (95 % CI -9·78, -0·11) μm for each 1sd increase of adherence; P=0·045). A gourd/root vegetable diet in this Bangladeshi population positively correlated with carotid IMT, while a balanced diet was associated with decreased IMT.

  17. Efisiensi Tular Benih Squash mosaic virus pada Cucurbitaceae

    Directory of Open Access Journals (Sweden)

    Susanti Mugi Lestari

    2014-09-01

    Full Text Available Infection of viruses on Cucurbitaceae may cause high yield and economic losses. Squash mosaic virus is a seed borne virus and among the most important virus infecting Cucurbitaceae. The aims of these research was to detect infection of several viruses on Cucurbitaceae and to examine seed transmission efficiency of SqMV. Detection of Cucumber mosaic virus (CMV, Squash mosaic virus (SqMV, Watermelon mosaic virus-2 (WMV-2, Zucchini yellow mosaic virus (ZYMV, and Tobacco ringspot virus (TRSV from field samples and seeds was conducted using Indirect-ELISA method. Infection of CMV, SqMV and ZYMV was detected from field samples. Seed transmission of SqMV on commercial seeds of bottle gourd, watermelon, zucchini, cabocha, cucumber, and melon was 13, 13, 33, 73, 100, and 100%, respectively. Seed transmission of ZYMV was only occurred on bottle gourd and zucchini, i.e. 13.3% and 26.67%, respectively. Infection of SqMV through F2 seed was determined from cucumber, bottle gourd, and melon, i.e. 93, 100, and 100%, respectively. Therefore, the status of SqMV as quarantine pest should be evaluated since SqMV was already found in West Java.

  18. Antioxidant activities of various fruits and vegetables produced in Taiwan.

    Science.gov (United States)

    Huang, Hui-Yu; Chang, Chen-Kang; Tso, Tim K; Huang, Ju-Jen; Chang, Wei-Wei; Tsai, Ying-Chieh

    2004-08-01

    Fruits and vegetables have been known to contain a variety of antioxidant components. It has been suggested that antioxidants may protect biomolecules from oxidative damage and therefore be associated with reduced risks of cardiovascular disease and certain cancer. The antioxidant abilities of various parts of eight common fruits and vegetables produced in Taiwan were investigated, including tomato, guava, squash, tangerine, wax gourd, pineapple, chayote, and eggplant. Squash, wax gourd, tomato, and guava seeds showed the highest antioxidant activities in thiobarbituric acid assay. Wax guard and squash seeds showed the highest antioxidant activities in iodometric assay. At the level of 1 g fresh sample, low-density lipoprotein peroxidation was inhibited by at least 90% by tomato meat, guava meat, squash seed, wax gourd meat, core, and seed, and eggplant skin. The total phenolic content was significantly correlated with antioxidant activities measured by thiobarbituric acid (r=0.715, P<0.01) and iodometric (r=0.749, P<0.01) assays. The results of this study could be used for development of merchandise with potential health benefits from agricultural products.

  19. Influence of antioxidant rich fresh vegetable juices on starch induced postprandial hyperglycemia in rats.

    Science.gov (United States)

    Tiwari, Ashok K; Reddy, K Srikanth; Radhakrishnan, Janani; Kumar, D Anand; Zehra, Amtul; Agawane, Sachin B; Madhusudana, K

    2011-09-01

    This research analyzed the major chemical components and multiple antioxidant activities present in the fresh juice of eight vegetables, and studied their influence on starch induced postprandial glycemia in rats. A SDS-PAGE based protein fingerprint of each vegetable juice was also prepared. The yields of juice, chemical components like total proteins, total polyphenols, total flavonoids, total anthocyanins and free radicals like the ABTS˙(+) cation, DPPH, H(2)O(2), scavenging activities and reducing properties for NBT and FeCl(3) showed wide variations. Vegetable juice from brinjal ranked first in displaying total antioxidant capacity. Pretreatment of rats with vegetable juices moderated starch induced postprandial glycemia. The fresh juice from the vegetables ridge gourd, bottle gourd, ash gourd and chayote significantly mitigated postprandial hyperglycemic excursion. Total polyphenol concentrations present in vegetable juices positively influenced ABTS˙(+) scavenging activity and total antioxidant capacity. However, NBT reducing activity of juices was positively affected by total protein concentration. Contrarily, however, high polyphenol content in vegetable juice was observed to adversely affect the postprandial antihyperglycemic activity of vegetable juices. This is the first report exploring antihyperglycemic activity in these vegetable juices and highlights the possible adverse influence of high polyphenol content on the antihyperglycemic activity of the vegetable juices. This journal is © The Royal Society of Chemistry 2011

  20. Cucurbitane Triterpenoid from Momordica charantia Induces Apoptosis and Autophagy in Breast Cancer Cells, in Part, through Peroxisome Proliferator-Activated Receptor γ Activation

    Directory of Open Access Journals (Sweden)

    Jing-Ru Weng

    2013-01-01

    Full Text Available Although the antitumor activity of the crude extract of wild bitter gourd (Momordica charantia L. has been reported, its bioactive constituents and the underlying mechanism remain undefined. Here, we report that 3β,7β-dihydroxy-25-methoxycucurbita-5,23-diene-19-al (DMC, a cucurbitane-type triterpene isolated from wild bitter gourd, induced apoptotic death in breast cancer cells through peroxisome proliferator-activated receptor (PPAR γ activation. Luciferase reporter assays indicated the ability of DMC to activate PPARγ, and pharmacological inhibition of PPARγ protected cells from DMC's antiproliferative effect. Western blot analysis indicated that DMC suppressed the expression of many PPARγ-targeted signaling effectors, including cyclin D1, CDK6, Bcl-2, XIAP, cyclooxygenase-2, NF-κB, and estrogen receptor α, and induced endoplasmic reticulum stress, as manifested by the induction of GADD153 and GRP78 expression. Moreover, DMC inhibited mTOR-p70S6K signaling through Akt downregulation and AMPK activation. The ability of DMC to activate AMPK in liver kinase (LK B1-deficient MDA-MB-231 cells suggests that this activation was independent of LKB1-regulated cellular metabolic status. However, DMC induced a cytoprotective autophagy presumably through mTOR inhibition, which could be overcome by the cotreatment with the autophagy inhibitor chloroquine. Together, the ability of DMC to modulate multiple PPARγ-targeted signaling pathways provides a mechanistic basis to account for the antitumor activity of wild bitter gourd.

  1. Hydrodynamic advantages of swimming by salp chains.

    Science.gov (United States)

    Sutherland, Kelly R; Weihs, Daniel

    2017-08-01

    Salps are marine invertebrates comprising multiple jet-propelled swimming units during a colonial life-cycle stage. Using theory, we show that asynchronous swimming with multiple pulsed jets yields substantial hydrodynamic benefit due to the production of steady swimming velocities, which limit drag. Laboratory comparisons of swimming kinematics of aggregate salps ( Salpa fusiformis and Weelia cylindrica ) using high-speed video supported that asynchronous swimming by aggregates results in a smoother velocity profile and showed that this smoother velocity profile is the result of uncoordinated, asynchronous swimming by individual zooids. In situ flow visualizations of W. cylindrica swimming wakes revealed that another consequence of asynchronous swimming is that fluid interactions between jet wakes are minimized. Although the advantages of multi-jet propulsion have been mentioned elsewhere, this is the first time that the theory has been quantified and the role of asynchronous swimming verified using experimental data from the laboratory and the field. © 2017 The Author(s).

  2. Developing porous carbon with dihydrogen phosphate groups as sulfur host for high performance lithium sulfur batteries

    Science.gov (United States)

    Cui, Yanhui; Zhang, Qi; Wu, Junwei; Liang, Xiao; Baker, Andrew P.; Qu, Deyang; Zhang, Hui; Zhang, Huayu; Zhang, Xinhe

    2018-02-01

    Carbon matrix (CM) derived from biomass is low cost and easily mass produced, showing great potential as sulfur host for lithium sulfur batteries. In this paper we report on a dihydrogen phosphate modified CM (PCM-650) prepared from luffa sponge (luffa acutangula) by phosphoric acid treatment. The phosphoric acid not only increases the surface area of the PCM-650, but also introduces dihydrogen phosphate onto PCM-650 (2.28 at% P). Sulfur impregnated (63.6 wt%) PCM-650/S, in comparison with samples with less dihydrogen phosphate LPCM-650/S, shows a significant performance improvement. XPS analysis is conducted for sulfur at different stages, including sulfur (undischarged), polysulfides (discharge to 2.1 V) and short chain sulfides (discharge to 1.7 V). The results consistently show chemical shifts for S2p in PCM-650, suggesting an enhanced adsorption effect. Furthermore, density functional theory (DFT) calculations is used to clarify the molecular binding: carbon/sulfur (0.86 eV), carbon/Li2S (0.3 eV), CH3-O-PO3H2/sulfur (1.24 eV), and CH3-O-PO3H2/Li2S (1.81 eV). It shows that dihydrogen phosphate group can significantly enhance the binding with sulfur and sulfide, consistent with XPS results. Consequently a CM functionalised with dihydrogen phosphate shows great potential as the sulfur host in a Li-S battery.

  3. Teknologi Pengendalian Gulma Alang-alang dengan Tanaman Legum untuk Pertanian Tanaman Pangan

    OpenAIRE

    Ishak Juarsah

    2015-01-01

    Di Indonesia, Alang-alang (Imperata cylindrica L. Beauv) merupakan salah satu gulma terpenting dan termasuk sepuluh gulma bermasalah di dunia.  Melalui biji dan rimpang, alang-alang dapat tumbuh dan menyebar luas pada hampir semua kondisi lahan. Teknologi pengendalian alang-alang telah banyak dikenal namun belum dapat menjamin eradikasi populasi alang-alang secara berkelanjutan tanpa diikuti oleh kultur teknis dan pola budidaya tanaman pangan sepanjang tahun. Hasil penelitian menunjukan bahwa...

  4. The Contemporary Land Mammals of Egypt (Including Sinai).

    Science.gov (United States)

    1980-08-15

    dactylifera), Tamarix nilotica, and mats of Imperata cylin- drica and Juncus rigidus. The last, together with T nilotica, choke the salty stream bed of Wadi...bipinnata and Imperata cylindrical occur along the canal banks. Marshy areas are dominated byJuncus rigidus and Phragmites australis. Alhagi mannifera...mannifera and stands of Panicum turgidum, Imperata cylindrica, and l)esmostachya bi- pinnata occur on the deeper sand sheets. Trees (Maerua crassifolia

  5. Final Environmental Assessment for the High Explosive Research and Development Complex’s Proposed Long Term Upgrade and Expansion

    Science.gov (United States)

    2012-06-01

    AFB (but were not observed on the subject site) include: Chinese tallow tree (Sapium sebiferum), cogon grass (Imperata cylindrica), and chinaberry...natural processes, such as the fire regime, and abatement of specific threats, such as invasive species (e.g. sand pine and cogon grass ). The...canopy of longleaf pine, a sparse midstory of oaks and other hardwoods, and a diverse groundcover comprised mainly of grasses , forbs and low

  6. گزارش علمی کوتاه: تأثیر تنش های شوری و خشکی بر قابلیت جوانه زنی ریزوم های علف هرز سمج حلفه ((Imperata cylindrica (L. Beauv

    Directory of Open Access Journals (Sweden)

    حیدر حمیداوی

    2016-03-01

    Full Text Available حلفه یکی از خطرناک­ترین علف‌های هرز در نخلستان­ها و صنعت نیشکر خوزستان است. شناخت هر چه بهتر تأثیر تنش­های محیطی بر قابلیت تکثیر رویشی و جوانه­زنی ریزوم­های این علف­هرز می­تواند به کنترل آن کمک نماید. به همین جهت دو آزمایش جداگانه بر پایه طرح کاملاً تصادفی با 4 تکرار و 6 سطح مختلف خشکی (صفر، 0/3-، 0/6-، 0/9-، 1/2- و 1/5- مگاپاسکال با استفاده از پلی­اتیلن گلیکول 6000، و 6 سطح شوری (صفر، 3، 6، 9، 12 و 15 دسی­زیمنس بر متر با استفاده از کلرید سدیم، در آزمایشگاه تحقیقاتی موسسه تحقیقات و آموزش توسعه نیشکر و صنایع جانبی خوزستان انجام شدند. در این آزمایش ریزوم­های 5 سانتی­متری این گیاه با قطر 3-2 میلی­متر در ژرمیناتوری با شرایط دمایی 22/30 درجه سانتی­گراد و شرایط نوری 16/8 ساعت (شب/ روز تحت تاثیر تیمارهای فوق قرار داده شدند. نتایج نشان داد که با افزایش شدت تنش­ های خشکی و شوری درصد و سرعت جوانه­زنی ریزوم­ها به‌طور معنی­داری نسبت به شاهد کاهش یافتند (0/01> P. طبق برآورد مدل لجستیک سه پارامتریمیزان شوری و خشکی لازم برای کاهش 50 درصدی حداکثر میزان جوانه­ زنی ریزوم­ های حلفه به ترتیب 6/42 دسی­ زیمنس بر متر و 0/96- مگاپاسکال بود. طبق یافته ­های این تحقیق، ریزوم ­های حلفه در شرایط تنش شوری و خشکی قادر به جوانه­ زنی بودند که حاکی از دردسرساز بودن این علف‌هرز در شرایط تنش­های مذکور است.

  7. Evaluating sampling strategy for DNA barcoding study of coastal and inland halo-tolerant Poaceae and Chenopodiaceae: A case study for increased sample size.

    Science.gov (United States)

    Yao, Peng-Cheng; Gao, Hai-Yan; Wei, Ya-Nan; Zhang, Jian-Hang; Chen, Xiao-Yong; Li, Hong-Qing

    2017-01-01

    Environmental conditions in coastal salt marsh habitats have led to the development of specialist genetic adaptations. We evaluated six DNA barcode loci of the 53 species of Poaceae and 15 species of Chenopodiaceae from China's coastal salt marsh area and inland area. Our results indicate that the optimum DNA barcode was ITS for coastal salt-tolerant Poaceae and matK for the Chenopodiaceae. Sampling strategies for ten common species of Poaceae and Chenopodiaceae were analyzed according to optimum barcode. We found that by increasing the number of samples collected from the coastal salt marsh area on the basis of inland samples, the number of haplotypes of Arundinella hirta, Digitaria ciliaris, Eleusine indica, Imperata cylindrica, Setaria viridis, and Chenopodium glaucum increased, with a principal coordinate plot clearly showing increased distribution points. The results of a Mann-Whitney test showed that for Digitaria ciliaris, Eleusine indica, Imperata cylindrica, and Setaria viridis, the distribution of intraspecific genetic distances was significantly different when samples from the coastal salt marsh area were included (P Imperata cylindrica and Chenopodium album, average intraspecific distance tended to reach stability. These results indicate that the sample size for DNA barcode of globally distributed species should be increased to 11-15.

  8. Use of a vegetable model as a training tool for PCNL puncture.

    Science.gov (United States)

    Sinha, Maneesh; Krishnamoorthy, Venkatesh

    2015-01-01

    Training residents to perform a PCNL puncture is hampered by the non-availability of a good inanimate model that can be used for demonstration and practice. The ethics of surgical training during actual surgeries is being questioned and the role of simulation is increasingly important. Virtual reality trainers, however, are prohibitively expensive and the use of animal models is fraught with regulatory and ethical concerns. We have devised a model that can be used to teach the concept of depth perception during a PCNL puncture. A bottle gourd was used to mimic the posterior abdominal wall. Cotton pledgets dipped in intravenous contrast were fitted into 4 mm holes made at staggered levels in the bottle gourd which was strapped onto the operating table with the cotton pledgets facing away from the surgeon. Surgeons with varying degrees of experience made fluoroscopy-guided punctures onto the cotton pledgets. We recorded the time taken for puncture in seconds and the distance of the needle exit site from the center of the cotton ball. Speed was measured by recording the fluoroscopy time in seconds on the C-arm. Accuracy was documented by using a Vernier caliper to measure the distance from the edge of the target to the actual puncture. One second of fluoroscopy time and 0.1 mm distance were each given one point. The total points accumulated over a set of 10 punctures was added to give a total score. Longer fluoroscopy times and inaccurate punctures resulted in higher scores. A surgeon with more than 1000 PCNLs to his credit had a score of 99. The average score of five residents was 555. The bottle gourd model provides an ethically acceptable, inexpensive, easy to replicate model that can be used to train residents in the PCNL puncture.

  9. 『金瓶梅』にみられる住まいの空間構成と女性の領域に関する研究 : 住まいにみえるシンボリズムについて

    OpenAIRE

    藤原, 美樹; 松本, 靜夫; フジワラ, ミキ; マツモト, シズオ; Miki, FUJIWARA; Shizuo, MATSUMOTO

    2004-01-01

    In this paper meanings and images of a house mainly studied. In the illustrations of KIN PEI BAI, we can find a lot of 'taihu rock' surrounding a house, 'potted-plant' inside and outside of a room, and 'go' board in scenes of play. First, it is considered that supernatural idea is mainly composed of a wish for ageless and immortal life, and that symbolism of time and space is found in figures such as gourds and 'taihu rock'. Then, the symbolism found in women's house is considered. Women's ho...

  10. Dataset on the abundance of ants and Cosmopolites sordidus damage in plantain fields with intercropped plants.

    Science.gov (United States)

    Dassou, Anicet Gbèblonoudo; Carval, Dominique; Dépigny, Sylvain; Fansi, Gabriel; Tixier, Philippe

    2016-12-01

    The data presented in this article are related to the research article entitled "Ant abundance and Cosmopolites sordidus damage in plantain fields as affected by intercropping" (A.G. Dassou, D. Carval, S. Dépigny, G.H Fansi, P. Tixier, 2015) [1]. This article describes how associated crops maize (Zea mays), cocoyam (Xanthosoma sagittifolium) and bottle gourd (Lagenaria siceraria) intercropped in the plantain fields in Cameroun modify ant community structure and damages of banana weevil Cosmopolites sordidus. The field data set is made publicly available to enable critical or extended analyzes.

  11. Dataset on the abundance of ants and Cosmopolites sordidus damage in plantain fields with intercropped plants

    Directory of Open Access Journals (Sweden)

    Anicet Gbèblonoudo Dassou

    2016-12-01

    Full Text Available The data presented in this article are related to the research article entitled “Ant abundance and Cosmopolites sordidus damage in plantain fields as affected by intercropping” (A.G. Dassou, D. Carval, S. Dépigny, G.H Fansi, P. Tixier, 2015 [1]. This article describes how associated crops maize (Zea mays, cocoyam (Xanthosoma sagittifolium and bottle gourd (Lagenaria siceraria intercropped in the plantain fields in Cameroun modify ant community structure and damages of banana weevil Cosmopolites sordidus. The field data set is made publicly available to enable critical or extended analyzes.

  12. Determination of Cadmium, Lead and Zinc in Vegetables in Jaipur (India).

    Science.gov (United States)

    Kumar, Ashok; Verma, P S

    2014-01-01

    An atomic absorption spectroscopic method was used for the determination of Lead, Cadmium and Zinc in vegetables grown in and around Jaipur food stuffs irrigated with industrial waste water. Vegetable samples were collected after maturity, and analyzed, such as spinach (Spinacia oleracea), ladyfinger (Abelmoschus esulentus), pepper mint (Menthe pipereta), brinjal (Solanum melongena), coriander (Coriandrum sativum), cauliflower (Brassica oleracea), onion (Allium cepa), radish (Raphanus sativus), pointedgourd (Trichosanthes dioica), bottlegourd (Lagenaria siceraria), chilies (Capsicum annum), ribbedgourd (Luffa acutangula) and pumpkin (Curcurbites pepo). The concentration of Lead ranged between 1.40-71.06 ppm, Cadmium 0.61-34.48 ppm and Zinc 0.39-187.26 ppm in vegetable samples. The results reveal that urban consumers are at greater risk of purchasing fresh vegetables with high levels of heavy metal, beyond the permissible limits, as defined by the Indian Prevention of Food Adulteration Act, 1954 and WHO.

  13. Detection of In Vitro Antimalarial Activity of Some Myanmar Medicinal Plants

    Energy Technology Data Exchange (ETDEWEB)

    Ei, Shun Lai; Mon, Hla Myat; Myint, Khin Htay

    2008-06-15

    In order to find out the novel effective antimalarials. six medicinal plants, namely Erythrina stricta Roxb. (Kathit), Luffa acutangula Roxb. (Thabut - Kja), Cordia rothii Roem. and Schult. (Thanet), Tribulus terrestris Linn. (Sule). Zizphus oenoplia Mill. (Paung - pe) and Mimusops elengi Roxb. (Khaye) were selected and tested for their antimalarial activity by using in vitro microdilution technique. According to the in vitro test results, Erythrina stricta Roxb. (Kathit) was found to possess significant suppressive effect on Plasmodium falciparum. With the serially diluted extract dosage concentrations ranging from 1.250 ng/ml to 40,000 ng/ml, the schizont suppressive percentage of Eryhrina stricta Roxb. (Kathi) was observed to be 19.57%, 35.44%, 55.18%, 96.04%,100% and 100% respectively.

  14. Detection of In Vitro Antimalarial Activity of Some Myanmar Medicinal Plants

    International Nuclear Information System (INIS)

    Shun Lai Ei; Hla Myat Mon; Khin Htay Myint

    2008-06-01

    In order to find out the novel effective antimalarials. six medicinal plants, namely Erythrina stricta Roxb. (Kathit), Luffa acutangula Roxb. (Thabut - Kja), Cordia rothii Roem. and Schult. (Thanet), Tribulus terrestris Linn. (Sule). Zizphus oenoplia Mill. (Paung - pe) and Mimusops elengi Roxb. (Khaye) were selected and tested for their antimalarial activity by using in vitro microdilution technique. According to the in vitro test results, Erythrina stricta Roxb. (Kathit) was found to possess significant suppressive effect on Plasmodium falciparum. With the serially diluted extract dosage concentrations ranging from 1.250 ng/ml to 40,000 ng/ml, the schizont suppressive percentage of Eryhrina stricta Roxb. (Kathi) was observed to be 19.57%, 35.44%, 55.18%, 96.04%,100% and 100% respectively

  15. Molecular diversity of poleroviruses infecting cucurbit crops in four countries reveals the presence of members of six distinct species.

    Science.gov (United States)

    Knierim, D; Tsai, W S; Maiss, E; Kenyon, L

    2014-06-01

    When 66 cucurbit samples with yellowing symptoms from fields in Mali, the Philippines, Thailand and Uzbekistan were screened by RT-PCR using universal polerovirus primers, 21 were identified as harboring polerovirus RNA. When these 21 samples were screened with specific primers for the known cucurbit-infecting poleroviruses, suakwa aphid-borne yellows virus and a recombinant strain of cucurbit aphid-borne yellows virus were detected for the first time in the Philippines and Thailand. However, seven polerovirus-positive samples did not react with any of the known species-specific primers. Sequencing of 1.4-kb universal polerovirus RT-PCR products revealed the presence of two poleroviruses that had not been described previously. These viruses, from Mali and Thailand, were provisionally named pepo aphid-borne yellows virus and luffa aphid-borne yellows virus, respectively.

  16. CONTROLE EM PÓS-EMERGÊNCIA DE PLANTAS DANINHAS POR HERBICIDAS UTILIZADOS NA CULTURA DA CANA-DE-AÇÚCAR

    Directory of Open Access Journals (Sweden)

    PAULO VINICIUS DA SILVA

    2015-01-01

    Full Text Available The implantation of the mechanized harvesting system of sugarcane led to changes in the pro- duction system, in the production system was the modification of the weed flora, promoting the emergence of weed species that weren`t present in the conventional production system where the sugar cane was burnt. The present work had the objective of determining dose response curves of the herbicides amicarbazone, saflufenacil, mesotrione and sulfentrazone in post - emergence, over the weed species Merremia aegyptia ; Ipo- moea purpurea ; Luffa aegyptiaca ; Mucuna aterrima e Ricinus communis. The experiment was conducted in a greenhouse, with delineation entirely randomized, with four repetitions. The treatments constituted of the spraying of different doses of the herbicides amicarbazone, saflufenacil, mesotrione and sulfentrazone over the weed plants M. aegyptia ; I. purpurea ; L. aegyptiaca ; M. aterrima e R. communis when the plants had two pairs of true leaves. . The method used was the dose response curves, being sprayed doses equivalent to 1,5; 1,0; 0,5; 0,25 and 0,0 times the commercial dose of each product ( amicarbazone, saflufenacil, mesotrione, and sulfentrazone. The herbicides were sprayed individually over each weed species,. By 7, 14 and 21 days after the applications of the treatments (DAT, the symptoms of phytotoxicity were visually evaluated, and by 21 DAT, the dry mass of the shoots was determined. The herbicides saflufenacil and mesotrione weren`t effective in controlling Luffa aegyptiaca e Ricinus communis, respectively. The application of the herbicides sulfentrazone and amicarbazone resulted in control supe- rior to 80% for all weed species times the commercial dose studied. Therefore, different levels of susceptibility of the weed plants to post - emergent herbicides were observed. The herbicides amicarbazone and sulfentrazone were the most effective.

  17. Evaluating sampling strategy for DNA barcoding study of coastal and inland halo-tolerant Poaceae and Chenopodiaceae: A case study for increased sample size.

    Directory of Open Access Journals (Sweden)

    Peng-Cheng Yao

    Full Text Available Environmental conditions in coastal salt marsh habitats have led to the development of specialist genetic adaptations. We evaluated six DNA barcode loci of the 53 species of Poaceae and 15 species of Chenopodiaceae from China's coastal salt marsh area and inland area. Our results indicate that the optimum DNA barcode was ITS for coastal salt-tolerant Poaceae and matK for the Chenopodiaceae. Sampling strategies for ten common species of Poaceae and Chenopodiaceae were analyzed according to optimum barcode. We found that by increasing the number of samples collected from the coastal salt marsh area on the basis of inland samples, the number of haplotypes of Arundinella hirta, Digitaria ciliaris, Eleusine indica, Imperata cylindrica, Setaria viridis, and Chenopodium glaucum increased, with a principal coordinate plot clearly showing increased distribution points. The results of a Mann-Whitney test showed that for Digitaria ciliaris, Eleusine indica, Imperata cylindrica, and Setaria viridis, the distribution of intraspecific genetic distances was significantly different when samples from the coastal salt marsh area were included (P < 0.01. These results suggest that increasing the sample size in specialist habitats can improve measurements of intraspecific genetic diversity, and will have a positive effect on the application of the DNA barcodes in widely distributed species. The results of random sampling showed that when sample size reached 11 for Chloris virgata, Chenopodium glaucum, and Dysphania ambrosioides, 13 for Setaria viridis, and 15 for Eleusine indica, Imperata cylindrica and Chenopodium album, average intraspecific distance tended to reach stability. These results indicate that the sample size for DNA barcode of globally distributed species should be increased to 11-15.

  18. New approaches for morphological diagnosis of bovine Eimeria species: a study on a subtropical organic dairy farm in Brazil.

    Science.gov (United States)

    Florião, Mônica Mateus; Lopes, Bruno do Bomfim; Berto, Bruno Pereira; Lopes, Carlos Wilson Gomes

    2016-03-01

    Bovine eimeriosis or coccidiosis is an intestinal disease caused by Eimeria spp. which is related to gastrointestinal disorders and, in some cases, death. The current work aimed to identify and provide detailed morphological characteristic features of the different Eimeria spp. parasites of crossbred cows of a subtropical organic dairy farm in Brazil, offering tools for the diagnosis of bovine eimeriosis. Eimeria auburnensis, Eimeria bovis, Eimeria bukidnonensis, Eimeria canadensis, Eimeria cylindrica, Eimeria ildefonsoi, and Eimeria zuernii were identified. The application of line regressions and ANOVA provided a means for the identification of these species. Finally, the current work proposes a dichotomous key to assist in the morphologic identification of bovine Eimeria spp. oocysts.

  19. Keanekaragaman jenis benalu parasit pada tanaman koleksi di Kebun Raya Eka Karya, Bali

    Directory of Open Access Journals (Sweden)

    Tahan Uji

    2012-02-01

    Full Text Available Benalu is one of the parasitic plants which have ataccked many collection plants species in Eka Karya Botanical Garden, Bali. Exploration and collection of these parasitic plants in this area are conducted. Four parasitic plants species, i.e. Dendrophthoe pentandra, Helixanthera cylindrica, Scurrula atropurpurea, and S. parasitica are recorded and they attack 32 collection plants species in Eka Karya Botanical Garden. Dendrophthoe pentandra is reported as the highest population species to parasiting collection plants species. While the Myrtaceae family and Syzygium genera are also reported as the highest parasited species.

  20. Distribution of rats infected with Rickettsia tsutsugamushi (scrub typhus) in an edge habitat.

    Science.gov (United States)

    Muul, I; Chai, K S

    1978-12-01

    No focalization of rats (Rattus tiomanicus and R. argentiventer) infected with Rickettsia tsutsugamushi could be discerned over a 500 m trapping transect at the border between a forest and lalang grass (Imperata cylindrica). R. tiomanicus appeared to occupy 250 m of the transect on the average and had periods during which infections were observed which averaged 97 days. Calulations indicated that more than 50% of individuals become infected over their life-time. The high rate of infection in this and other areas described in earlier publications and the habits of the rats suggest that infected mites are densely and widely dispersed in the areas studied in Malaysia.

  1. Potensi Jamur Patogen Tumbuhan sebagai Agen Pengendali Biologi Gulma Alang-alang

    OpenAIRE

    Nugroho, Bambang; Suryani, Titik; Hadisutrisno, Bambang

    1997-01-01

    Biological control is an important component of integrated pest management, including integrated pest management on weed. One of the important biological control agents is plant pathogenic fungi. The purpose of this research is to identify potential fungi to be developed as an agent of biological control on alang-alang (Imperata cylindrica L). A survey was conducted in highland and lowland areas which were seriously infested by alang-alang to know the disease intensity and its distribution...

  2. PENDUGAAN DAYA TAMPUNG RUSA LIAR (Cervus timorensis DI PADANG RUMPUT MAR TAMAN NASIONAL WASUR MERAUKE

    Directory of Open Access Journals (Sweden)

    Bambang Tjahyono Hariadi

    2014-06-01

    Full Text Available The objective of this experiment was to know carrying capacity of rusa deer (Cervus timorensisi at Mar, Wasur National Park Merauke district. The data collected were spesies of grasses, production each species and carrying capacity. The results showed species of grasses were Cynadon dactylon, Imperata cylindrica and Phragmites karka. Mar was dominated by Cynadon dactylon. The production of Cynodon dactylon was 2.183 kg/ha. The carryng capacity of rusa deer was 0.5 ha/head/year.

  3. Potential of Cogon Grass as an Oil Sorbent

    OpenAIRE

    Wiloso, Edi Iswanto; Barlianti, Vera; Anggraini, Irni Fitria; Hendarsyah, Hendris

    2012-01-01

    Experiments on the potential of Cogon grass (lmperata cylindrica), a weed harmful to other plants, for use as a low-cost and biodegradable oil sorbent were carried out under various spill conditions. Flowers of Cogon grass adsorbed much larger amount of high-viscosity lubricating oil (57.9 g-oil/g-sorbent) than that adsorbed by Peat Sorb (7.7 g-oil/g-sorbent), a commercial oilsorbent based on peat. However, the flowers adsorbed only 27.9 g of low-viscosity crude oillgsorbent. In an oil-water ...

  4. Customized Cooking Methods Enhance Antioxidant, Antiglycemic, and Insulin-Like Properties of Momordica charantia and Moringa oleifera

    Directory of Open Access Journals (Sweden)

    Sarasvathy Subramaniam

    2017-01-01

    Full Text Available The current study compares antioxidant activities, total phenolic content (TPC, vitamin C content, and antiglycemic properties of Momordica charantia (small bitter gourd and Moringa oleifera (drumstick leaves before and after subjecting to boiling and microwave heating for different durations. Both cooking methods enhanced the antioxidant activity and vitamin C content in the vegetables studied when cooked for five minutes and these properties declined when the cooking time was prolonged to 20 minutes. Cooking also retained or slightly improved the α-glucosidase enzyme inhibition activity of the vegetables; however, it reduced the ability of the vegetable extracts to inhibit α-amylase enzyme activity. The antioxidant activities were positively correlated with the TPC and vitamin C content in the vegetable extracts tested. The present study also evaluated the insulin-like properties (stimulation of adipogenesis of selected vegetable extracts (five minutes microwaved. 3T3-L1 adipocytes treated with small bitter gourd extract significantly stimulated lipogenesis (in the absence of insulin compared to drumstick leaves. Thus, the finding of this study negates the belief that cooking will reduce the nutritional value of the vegetables and also suggested that appropriate cooking method and duration for different vegetables could be selected to improve or preserve their nutritional value.

  5. Assessment of pesticide residues on selected vegetables of Pakistan

    International Nuclear Information System (INIS)

    Khan, M.S.; Shah, M.M.

    2011-01-01

    The present study was conducted to determine the pesticide residues on selected summer vegetables. Five vegetables were grown with three replicates in a split plot randomized complete block design. Pesticides were sprayed on vegetables thrice at regular intervals each after 15 days. At maturity the pesticides residues were extracted from edible and leaf portions using anhydrous sodium sulfate and ethyl acetate while adsorption chromatography technique was used for cleanup. The extracts were subjected to high performance liquid chromatography (HPLC) for separation and analysis of the compounds. Significant differences (p<0.05) were found in the pesticides residues on edible portions whereas highly significant differences (p<0.001) were observed for the leafy portions. The residual level of cypermethrin was highest (16.2 mg kg/sup -1/) in edible portion of bitter gourd, while Lambdacyhalothrin and Mancozeb residues were detected high (4.50 mg kg/sup -1/, 6.26 mg kg/sup -1/) in edible portion of bitter gourd and Cucumber respectively. Cypermethrin residues were high (1.86 mg kg/sup -1/) in Okra leaves. Mancozeb and Lambdacyhalothrin residual level was high (1.23 mg kg/sup -1/, and 0.0002 mg kg/sup -1/) in chili and tomato leaves. Cypermethrin residues were readily detected in edible and leaf portion of the selected vegetables. (author)

  6. Use of household ingredients as complementary medicines for perceived hypoglycemic benefit among Sri Lankan diabetic patients; a cross-sectional survey.

    Science.gov (United States)

    Medagama, Arjuna Bandara; Senadhira, Danusha

    2015-01-01

    Biologic based therapies are frequently used as complementary medicines in diabetes. The aim of this study was to identify the commonly used herbal remedies and their preparations in Sri Lankan patients with Type 2 diabetes. This is a descriptive, cross-sectional study on 220 diabetic patients using herbal remedies for perceived glycemic benefit. All the patients used their regular conventional medications together with herbal remedies. The most commonly used medication was metformin (91.4%). Ivy gourd (Coccinia grandis) was the most commonly used herbal remedy (32%), followed by crepe ginger (Costus speciosus) (25%) and bitter gourd (Momordica charantia) (20%). Herbal remedies used less frequently were finger millet (Eleusine corocana) (5%), anguna leaves (Wattakaka volubilis) (5%), goat weed (Scoparia dulcis) (4%), Salacia reticulata (4%), fenugreek (Trigonella foenum-graecum) (3%) and tree turmeric (Coscinium fenestratum) (0.5%). None of the patients used commercially available over-the-counter herbal products. The common preparations were salads (72.8%), curries (12.8%), herbal tea (6%), and herbal porridges (6%). The practice of using household ingredients as complementary medicines is common in Sri Lanka. Few herbal remedies and their methods of preparation have limited evidence for efficacy. In view of the frequent use by diabetic patients each needs to be documented for reference and scientifically explored about their hypoglycemic potential.

  7. Competitive Interactions between Immature Stages of Bactrocera cucurbitae (Coquillett) and Bactrocera tau (Walker) (Diptera: Tephritidae) under Laboratory Conditions.

    Science.gov (United States)

    Shen, K; Hu, J; Wu, B; An, K; Zhang, J; Liu, J; Zhang, R

    2014-08-01

    The melon fly, Bactrocera cucurbitae (Coquillett), and the pumpkin fly, Bactrocera tau (Walker), are economically important pests that attack mainly cucurbitacean fruits. The two fruit fly species have similar natural distributions, host ranges, and population growth capacities. This study was designed to assess the asymmetrical competitions through resource exploitation between the larvae of B. cucurbitae and B. tau at different density levels and temperatures, and on different hosts by comparing the relative effects of interspecific and intraspecific interactions on four life history parameters: survival rate, puparial mass, puparial duration, and developmental duration. Our results showed that intraspecific and interspecific competitions occurred under some laboratory conditions, and B. cucurbitae took advantage over B. tau at the high-density level and at low and high temperatures on pumpkin, bitter gourd, and bottle gourd when interspecific competition took place. Intraspecific and interspecific competitions mainly affected the puparial mass and the survival rate of the two fruit fly species but had no marked effect on the puparial duration or development duration.

  8. Efficacy of protein bait sprays in controlling melon fruit fly [Bactrocera cucurbitae (Coquillett)] in vegetable agro-ecosystems

    International Nuclear Information System (INIS)

    Abro, Z.U.A.; Baloch, N.

    2017-01-01

    Melon fruit fly [Bactrocera cucurbitae (Coquillett)] is an injurious pest of vegetables and fruits throughout the cosmos. Vegetables are key source of proteins, minerals and vitamins for human nutrition. However, a number of factors, such as Tephritid flies, confine production of vegetables. Among them , B. cucurbitae is most deleterious pests of the vegetables. In the present investigation, conducted at two field locations of district, Hyderabad during 2016, efficacy of various bait sprays was evaluated in controlling Bactrocera cucurbitae (Coquillett) infestation. The field locations were Jeay Shah and Dehli farm and the cucurbit vegetable crops were bottle gourd (Lagenaria siceraria) and bitter gourd ( Momordica charantia). For this purpose, three food attractants such as Nu-lure, Protein hydrolysate and Prima were sprayed on onemeter square per field area, as spot treatment. Significantly higher reductions in B. cucurbitae infestations (24.80+-2.63, 21.20+-2.75) were recorded with Protein hydrolysate followed by Nu-lure (27.80+-3.26, 24.20+-3.57), as compared with untreated plots, at both field locations (P<0.05). Moreover, higher number of pupae were recovered (121.40+-13.81, 115.00+-14.17) and higher number of flies and trap catches were observed in control (P<0.05). This study established that Protein hydrolysate is an effective food attractant for reducing B. cucurbitae in all the tested cucurbits. Results of the present investigation would be useful in developing a sustainable pest management strategy in the cucurbit agro-ecosystem. (author)

  9. Chromatographic determination of alpha beta momocharin and its effects with the combination of temozolamide and vinblastine in the treatment of glioma cancer In-Vivo

    Directory of Open Access Journals (Sweden)

    Gunasekar Manoharan

    2016-06-01

    Full Text Available Prior to the availability of chemotherapeutic agents, dietary measures, including traditional medicines derived from plants, were the major forms of cancer treatment. One such plant is M.charantia (Family: Cucurbitaceae, whose fruit is known as Karela or bitter gourd. M.charantia is believed to posse’s anti-carcinogenic properties and it can modulate its effect via xenobiotic metabolism and oxidative stress. Different concentration (200μM - 800μMof the alpha and beta momorcharin a protein extracted from bitter gourd fruit, were treated (24 hrs incubation separately with six different cancer cell lines 1321N1, Gos-3, U87-MG, Sk Mel, Corl -23, Weri Rb-1 and normal L6 muscle cell line. The results also show that combining either temozolomide (240 μM or vinblastine (40 μg with (800 μM alpha and beta momorcharin, result in significant decreases in cell viability for each cell line, these effects were additive compared to the individual effect of temozolomide or vinblastine.

  10. Growth and root development of four mangrove seedlings under varying salinity

    Science.gov (United States)

    Basyuni, M.; Keliat, D. A.; Lubis, M. U.; Manalu, N. B.; Syuhada, A.; Wati, R.; Yunasfi

    2018-03-01

    This present study describes four mangrove seedlings namely Bruguiera cylindrica, B. sexangula, Ceriops tagal, and Rhizophora apiculata in response to salinity with particular emphasis to root development. The seedlings of four mangroves were grown for 5 months in 0%, 0.5%, 1.5%, 2.0% and 3.0% salt concentration. Salinity significantly decreased the growth (diameter and plant height) of all mangrove seedlings. Root developments were observed from the tap and lateral root. The number, length and diameter of both roots-typed of B. cylindrica, B. sexangula and C. tagal seedlings significantly decreased with increasing salt concentration with optimum development at 0.5% salinity. By contrast, the number, length, and diameter of tap root of R. apiculata seedlings were significantly enhanced by salt with maximal stimulation at 0.5%, and this increase was attenuated by increasing salinity. On the other hand, lateral root development of R. apiculata significantly thrived up to 1.5% salinity then decreasing with the increasing salinity. The different response of root development suggested valuable information for mangrove rehabilitation in North Sumatra and their adaption to withstand salt stress.

  11. Exposure of phototrophs to 548 days in low Earth orbit: microbial selection pressures in outer space and on early earth.

    Science.gov (United States)

    Cockell, Charles S; Rettberg, Petra; Rabbow, Elke; Olsson-Francis, Karen

    2011-10-01

    An epilithic microbial community was launched into low Earth orbit, and exposed to conditions in outer space for 548 days on the European Space Agency EXPOSE-E facility outside the International Space Station. The natural phototroph biofilm was augmented with akinetes of Anabaena cylindrica and vegetative cells of Nostoc commune and Chroococcidiopsis. In space-exposed dark controls, two algae (Chlorella and Rosenvingiella spp.), a cyanobacterium (Gloeocapsa sp.) and two bacteria associated with the natural community survived. Of the augmented organisms, cells of A. cylindrica and Chroococcidiopsis survived, but no cells of N. commune. Only cells of Chroococcidiopsis were cultured from samples exposed to the unattenuated extraterrestrial ultraviolet (UV) spectrum (>110 nm or 200 nm). Raman spectroscopy and bright-field microscopy showed that under these conditions the surface cells were bleached and their carotenoids were destroyed, although cell morphology was preserved. These experiments demonstrate that outer space can act as a selection pressure on the composition of microbial communities. The results obtained from samples exposed to >200 nm UV (simulating the putative worst-case UV exposure on the early Earth) demonstrate the potential for epilithic colonization of land masses during that time, but that UV radiation on anoxic planets can act as a strong selection pressure on surface-dwelling organisms. Finally, these experiments have yielded new phototrophic organisms of potential use in biomass and oxygen production in space exploration.

  12. Use of 13N in studies of fixation of dinitrogen and assimilation of ammonium by cyanobacteria

    International Nuclear Information System (INIS)

    Meeks, J.C.; Wolk, C.P.; Thomas, J.; Austin, S.M.; Galonsky, A.; Michigan State Univ., East Lansing

    1978-01-01

    13 N (tsub(1/2)=10min) has been used to identify the initial products of assimilation of N 2 and NH 4 + by intact filaments of a number of cyanobacteria and by heterocysts isolated from Anabaena cylindrica. Ammonium, the amide nitrogen of glutamine, and the α-amino nitrogen of glutamate, in that order, were the first observed products of fixation of [ 13 N]N 2 . Amide-labelled glutamine was the initial product of metabolism of 13 NH 4 + by A. cylindrica grown with either NH 4 + or N 2 as the nitrogen source. Glutamate was the second major product of 13 NH 4 + assimilation. Isolated heterocysts form [ 13 N]glutamine but not [ 13 N]glutamate from [ 13 N]N 2 or 13 NH 4 + . Formation of [ 13 N]glutamine from [ 13 N]N 2 was inhibited by acetylene, indicating metabolic coupling of the activity of glutamine synthetase to that of nitrogenase in these cells. A diffusible substance produced by heterocysts inhibits nearby cells of the same filament from differentiating into heterocysts. Glutamine (or a derivative of glutamine) may be involved in inhibiting differentiation of vegetative cells. (author)

  13. Comparative jet wake structure and swimming performance of salps.

    Science.gov (United States)

    Sutherland, Kelly R; Madin, Laurence P

    2010-09-01

    Salps are barrel-shaped marine invertebrates that swim by jet propulsion. Morphological variations among species and life-cycle stages are accompanied by differences in swimming mode. The goal of this investigation was to compare propulsive jet wakes and swimming performance variables among morphologically distinct salp species (Pegea confoederata, Weelia (Salpa) cylindrica, Cyclosalpa sp.) and relate swimming patterns to ecological function. Using a combination of in situ dye visualization and particle image velocimetry (PIV) measurements, we describe properties of the jet wake and swimming performance variables including thrust, drag and propulsive efficiency. Locomotion by all species investigated was achieved via vortex ring propulsion. The slow-swimming P. confoederata produced the highest weight-specific thrust (T=53 N kg(-1)) and swam with the highest whole-cycle propulsive efficiency (eta(wc)=55%). The fast-swimming W. cylindrica had the most streamlined body shape but produced an intermediate weight-specific thrust (T=30 N kg(-1)) and swam with an intermediate whole-cycle propulsive efficiency (eta(wc)=52%). Weak swimming performance variables in the slow-swimming C. affinis, including the lowest weight-specific thrust (T=25 N kg(-1)) and lowest whole-cycle propulsive efficiency (eta(wc)=47%), may be compensated by low energetic requirements. Swimming performance variables are considered in the context of ecological roles and evolutionary relationships.

  14. Temporal and spatial variations of canopy temperature over a C3C4 mixture grassland

    Science.gov (United States)

    Shimoda, S.; Oikawa, T.

    2006-10-01

    This study discusses the photosynthetic pathway types involved in canopy temperature measurements on a mixed grassland consisting of C3 and C4 plants (dominant species in biomass were Solidago altissima (C3), Miscanthus sinensis (C4), and Imperata cylindrica (C4)). In the wet conditions immediately after the rainy season, the mean canopy temperature for S. altissima was the lowest among the dominant species, mainly due to its leaf conductance being twice as large as the other two species. Despite using the same C4 photosynthetic pathway, M. sinensis had a lower apparent canopy temperature than I. cylindrica due to a smaller proportion of sunlit elements in the field of view. In the dry conditions during late July, the mean canopy temperatures of the three dominant species were within 0.3 °C of one another. These results can be explained by poor water conditions for C3 species (S. altissima). The simultaneous survey of vegetation and thermal imaging can help clarify characteristics of C3 and C4 canopy temperature over complicated grassland.

  15. Grazing Habitat of the Rusa Deer (Cervus timorensis in the Upland Kebar, Manokwari

    Directory of Open Access Journals (Sweden)

    AGUSTINA YOHANA SETYARINI AROBAYA

    2009-07-01

    Full Text Available The general objective of the study was to provide current information on grassland communities as deer habitat and its future development plan for a sustainable forage management in upland Kebar, Papua. Quantitative estimation of forage production was carried out by measuring a biomass harvest in fresh weight bases, while occasional observations on ranging deer were done within habitat range with the aid of 7x50 binoculars verified by actual visitation of grazed area. The study indicated that Kebar was the only grazing area of deer varies in low layer vegetation composition that comprised of eleven grass species and five legume species. Imperata cylindrica, Paspalum conjugatum, Themeda arguens, Melinis minutiflora and Cyperus rotundus were identified as food plant of deer in Kebar. Among these species T. arguens, M. minutiflora, C. rotundus and I. cylindrica were the most preferred species consumed by deer. The biomass harvest (species productivity was 30.36 kg/ha fresh weight, while deer food productivity in the grassland was slightly lower (26.70 kg/ha than total productivity of the grassland. The major drainage area is Kasi River, but two other rivers across this valley (Api River, Apriri River are also supply water to the swampy area.

  16. Performance of indirect solar cabinet dryer

    International Nuclear Information System (INIS)

    Sreekumar, A.; Manikantan, P.E.; Vijayakumar, K.P.

    2008-01-01

    In this paper, the development and testing of a new type of efficient solar dryer, particularly meant for drying vegetables and fruit, is described. The dryer has two compartments: one for collecting solar radiation and producing thermal energy and the other for spreading the product to be dried. This arrangement was made to absorb maximum solar radiation by the absorber plate. In this dryer, the product was loaded beneath the absorber plate, which prevented the problem of discoloration due to irradiation by direct sunlight. Two axial flow fans, provided in the air inlet, can accelerate the drying rate. The dryer had six perforated trays for loading the material. The absorber plate of the dryer attained a temperature of 97.2 deg. C when it was studied under no load conditions. The maximum air temperature in the dryer, under this condition was 78.1 deg. C. The dryer was loaded with 4 kg of bitter gourd having an initial moisture content of 95%, and the final desired moisture content of 5% was achieved within 6 h without losing the product colour, while it was 11 h for open sun drying. The collector glazing was inclined at a particular angle, suitable to the location, for absorption of maximum solar radiation. A detailed performance analysis was done by three methods, namely 'annualized cost method', 'present worth of annual savings' and 'present worth of cumulative savings'. The drying cost for 1 kg of bitter gourd was calculated as Rs. 17.52, and it was Rs. 41.35, in the case of an electric dryer. The life span of the solar dryer was assumed to be 20 years. The cumulative present worth of annual savings over the life of the solar dryer was calculated for bitter gourd drying, and it turned out be Rs. 31659.26, which was much higher than the capital cost of the dryer (Rs. 6500). The payback period was calculated as 3.26 years, which was also very small considering the life of the system (20 years). So, the dryer would dry products free of cost during almost its

  17. Performance of indirect solar cabinet dryer

    Energy Technology Data Exchange (ETDEWEB)

    Sreekumar, A.; Manikantan, P.E.; Vijayakumar, K.P. [Solar Thermal Energy Laboratory, Department of Physics, Cochin University of Science and Technology, Kochi 682 022 (India)

    2008-06-15

    In this paper, the development and testing of a new type of efficient solar dryer, particularly meant for drying vegetables and fruit, is described. The dryer has two compartments: one for collecting solar radiation and producing thermal energy and the other for spreading the product to be dried. This arrangement was made to absorb maximum solar radiation by the absorber plate. In this dryer, the product was loaded beneath the absorber plate, which prevented the problem of discoloration due to irradiation by direct sunlight. Two axial flow fans, provided in the air inlet, can accelerate the drying rate. The dryer had six perforated trays for loading the material. The absorber plate of the dryer attained a temperature of 97.2 C when it was studied under no load conditions. The maximum air temperature in the dryer, under this condition was 78.1 C. The dryer was loaded with 4 kg of bitter gourd having an initial moisture content of 95%, and the final desired moisture content of 5% was achieved within 6 h without losing the product colour, while it was 11 h for open sun drying. The collector glazing was inclined at a particular angle, suitable to the location, for absorption of maximum solar radiation. A detailed performance analysis was done by three methods, namely 'annualized cost method', 'present worth of annual savings' and 'present worth of cumulative savings'. The drying cost for 1 kg of bitter gourd was calculated as Rs. 17.52, and it was Rs. 41.35, in the case of an electric dryer. The life span of the solar dryer was assumed to be 20 years. The cumulative present worth of annual savings over the life of the solar dryer was calculated for bitter gourd drying, and it turned out be Rs. 31659.26, which was much higher than the capital cost of the dryer (Rs. 6500). The payback period was calculated as 3.26 years, which was also very small considering the life of the system (20 years). So, the dryer would dry products free of cost

  18. 137Cs Dan 90Sr Concentration In Several Vegetables From Lahat South Sumatra Province

    International Nuclear Information System (INIS)

    Emlinarti; Tutik-Indiyati

    2003-01-01

    Analysis of 137 Cs and 90 Sr in several vegetables, i.e beans, green peas, spinachs, gourd, nightshade, cabbages, carrots and potatoes, collected from Lahat. South Sumatra had been carried out. Analysis radiochemically were carried out, 137 Cs precipitated with ammmoniumphosphomolybdate. The samples were measured using the gamma spectrometer with the high purity germanium detector (HP-Ge). 90 Sr precipitated with fuming HNO 3 and measured using alpha/beta Low Background Counter system (LBC). Concentration of 137 Cs in the samples were varied from undetectable to (0.041 ± 0.015) Bq/kg and concentration of 90 Sr were varied from undetectable to (0.049 ± 0.017) Bq/kg. Compared with similar foodstuffs collected from several places in Lampung province, these results are relatively not different. (author)

  19. Multivariate analysis of the heavy metal concentrations in the vegetable and soil samples-a case study from district charsadda and district mardan

    International Nuclear Information System (INIS)

    Idrees, M.; Rahman, Z.; Bibi, S.; Shah, F.; Gulab, H.; Ali, L.

    2017-01-01

    Multivariate statistical methods like cluster analysis, principal component analysis (PCA) and regression analysis were applied on the metals concentration of both the vegetables and soil samples collected from the districts Charsada and Mardan to classify them in different groups. The concentrations of seven heavy metals including Cu, Cr, Co, Ni, Ag, Pb, Sb were investigated using atomic absorption spectrophotometer (AAS) in the leaves, fruits, extracts, and soil samples of potato, colocasia, turnip, radish, cabbage, angular loofah, cucumber, bitter gourd, round melon, and pumpkin. The concentration of copper, chromium, cobalt, nickel, silver, lead and antimony were found in the range of 6.133-72.933, 32.233-92.5, 2.25-8.083, 0.366-143.53, 0.4-4.467, 11.916-157.96, 28.75-165.367 mgKg/sup -1/ respectively. (author)

  20. Analgesic and antipyretic activities of Momordica charantia linn. fruits

    Directory of Open Access Journals (Sweden)

    Roshan Patel

    2010-01-01

    Full Text Available Plant Momordica charantia Linn. belongs to family Cucurbitaceae. It is known as bitter gourd in English and karela in Hindi. Earlier claims show that the plant is used in stomachic ailments as a carminative tonic; as an antipyretic and antidiabetic agent; and in rheumatoid arthritis and gout. The fruit has been claimed to contain charantin, steroidal saponin, momordium, carbohydrates, mineral matters, ascorbic acid, alkaloids, glucosides, etc. The ethanolic extract of the fruit showed the presence of alkaloids, tannins, glycosides, steroids, proteins, and carbohydrates. The present study was carried out using acetic acid-induced writhing and tail-immersion tests in mice, while yeast-induced pyrexia in rats. The ethanolic extracts (250 and 500 mg/kg, po. showed an analgesic and antipyretic effect, which was significantly higher than that in the control rats. The observed pharmacological activities provide the scientific basis to support traditional claims as well as explore some new and promising leads.

  1. Reassessing Coxcatlan Cave and the early history of domesticated plants in Mesoamerica.

    Science.gov (United States)

    Smith, Bruce D

    2005-07-05

    Reanalysis and direct accelerator mass spectrometry radiocarbon dating of the cucurbit assemblage from Coxcatlan Cave provide information on the timing and sequence of the initial appearance of three domesticated plants in the Tehuacán Valley (Puebla, Mexico) and allow reassessment of the overall temporal context of plant domestication in Mexico. Cucurbita pepo is the earliest documented domesticate in the cave, dating to 7,920 calibrated calendrical (cal) years B.P. The bottle gourd (Lagenaria siceraria) is dated at 7,200 cal years B.P. Cucurbita argyrosperma does not appear until 2,065 cal years B.P. The earlier identification of Cucurbita moschata specimens is not confirmed. Seventy-one radiocarbon dates, including 23 accelerator mass spectrometry dates on cucurbits, provide ample evidence of postdepositional vertical displacement of organic materials in the western half of Coxcatlan Cave, but they also indicate that the eastern half of the cave was largely undisturbed.

  2. An acoustic study of the Brazilian cuica

    Science.gov (United States)

    Wheeler, Paul A.

    2002-11-01

    The cuica is a friction drum of African origin played in the batucada (an ensemble of instruments used for the samba) during the Brazilian carnival. It is played by rubbing a bamboo rod which is connected to the center of a drum head, giving a rhythmic grunting sound. Pitch is changed by applying pressure to the membrane. This paper discusses several acoustic aspects of a folk cuica (made of a gourd) including the waveforms, spectra, and time envelopes produced. Rubbing the bamboo rod gives a primitive saw-toothed excitation, similar to a bowed violin string. This is connected to the center of a membrane which modifies and radiates the sound. The body of the cuica contributes little to the sound.

  3. Food-processing, packaging and irradiation/preservation

    International Nuclear Information System (INIS)

    Tripathi, Jyothi

    2017-01-01

    The present talk describes the major projects being carried out in FFACS during last few years. One of the major aims of the section is development of ready-to-cook (RTC) vegetables and ready-to-eat (RTE) fruits with improved shelf life using radiation processing. RTC vegetables and fruits (French beans, ash gourd, drumstick, pumpkin, cabbage, cauliflower and pomegranate having shelf life of 2-3 days at 10 °C) with enhanced shelf life (up to 21 days at 10°C) were developed using radiation treatment. The developed products were far superior as compared to the corresponding control samples with respect to sensory and microbial quality during the intended storage period. The findings have helped the food industry in adoption of food irradiation technology. The products developed are now being taken up by HyperCITY Retail (India) Ltd. for sale on their shelves

  4. Crystal defects observed by the etch-pit method and their effects on Schottky-barrier-diode characteristics on (\\bar{2}01) β-Ga2O3

    Science.gov (United States)

    Kasu, Makoto; Oshima, Takayoshi; Hanada, Kenji; Moribayashi, Tomoya; Hashiguchi, Akihiro; Oishi, Toshiyuki; Koshi, Kimiyoshi; Sasaki, Kohei; Kuramata, Akito; Ueda, Osamu

    2017-09-01

    A pixel array of vertical Schottky-barrier diodes (SBDs) was fabricated and measured on the surface of a (\\bar{2}01) β-Ga2O3 single crystal. Subsequently, etch pits and patterns were observed on the same surface. Three types of etch pits were discovered: (1) a line-shaped etch pattern originating from a void and extending toward the [010] direction, (2) an arrow-shaped etch pit whose arrow’s head faces toward the [102] direction and, (3) a gourd-shaped etch pit whose point head faces toward the [102] direction. Their average densities were estimated to be 5 × 102, 7 × 104, and 9 × 104 cm-2, respectively. We confirmed no clear relationship between the leakage current in SBDs and these crystalline defects. Such results are obtained because threading dislocations run mainly in the [010] growth direction and do not go through the (\\bar{2}01) sample plate.

  5. Facile moldless fabrication of disk-shaped and reed blood cell-like microparticles using photopolymerization of tripropylene glycol diacrylate

    International Nuclear Information System (INIS)

    Choi, Jongchul; Won, June; Song, Simon

    2014-01-01

    A facile method for the moldless fabrication of 2- or 3-dimensional microparticles is proposed by using a photopolymerization technique. Using only a monomer solution of tripropylene glycol diacrylate, a film mask and standard UV lithography equipment, we were able to fabricate microparticles of various shapes, such as disks, dimpled disks similar in shape to red blood cells, and slender gourd shapes, unlike previous moldless fabrication techniques requiring expensive and/or sophisticated equipment. The simple method could produce more than one million particles in a single batch, indicating that it can be applied to the mass production of polymer microparticles. Analyses of scanning electron micrographs and optical micrographs of the microparticles indicated that their size distribution was highly monodisperse. Detailed fabrication processes and statistics on the microparticle sizes are given in this paper. (technical note)

  6. Concentrations and health risk assessment of rare earth elements in vegetables from mining area in Shandong, China.

    Science.gov (United States)

    Zhuang, Maoqiang; Zhao, Jinshan; Li, Suyun; Liu, Danru; Wang, Kebo; Xiao, Peirui; Yu, Lianlong; Jiang, Ying; Song, Jian; Zhou, Jingyang; Wang, Liansen; Chu, Zunhua

    2017-02-01

    To investigate the concentrations of rare earth elements in vegetables and assess human health risk through vegetable consumption, a total of 301 vegetable samples were collected from mining area and control area in Shandong, China. The contents of 14 rare earth elements were determined by Inductively Coupled Plasma-Mass Spectrometry (ICP-MS). The total rare earth elements in vegetables from mining and control areas were 94.08 μg kg -1 and 38.67 μg kg -1 , respectively, and the difference was statistically significant (p vegetable had the highest rare earth elements concentration (984.24 μg kg -1 and 81.24 μg kg -1 for mining and control areas, respectively) and gourd vegetable had the lowest rare earth elements concentration (37.34 μg kg -1 and 24.63 μg kg -1 for mining and control areas, respectively). For both areas, the rare earth elements concentration in vegetables declined in the order of leaf vegetable > taproot vegetable > alliaceous vegetable > gourd vegetable. The rare earth elements distribution patterns for both areas were characterized by enrichment of light rare earth elements. The health risk assessment demonstrated that the estimated daily intakes (0.69 μg kg -1 d -1 and 0.28 μg kg -1 d -1 for mining and control areas, respectively) of rare earth elements through vegetable consumption were significantly lower than the acceptable daily intake (70 μg kg -1 d -1 ). The damage to adults can be neglected, but more attention should be paid to the effects of continuous exposure to low levels of rare earth elements on children. Copyright © 2016 Elsevier Ltd. All rights reserved.

  7. Juice blends--a way of utilization of under-utilized fruits, vegetables, and spices: a review.

    Science.gov (United States)

    Bhardwaj, Raju Lal; Pandey, Shruti

    2011-07-01

    The post-harvest shelf life of maximum of fruits and vegetables is very limited due to their perishable nature. In India more then 20-25 percent of fruits and vegetables are spoiled before utilization. Despite being the world's second largest producer of fruits and vegetables, in India only 1.5 percent of the total fruits and vegetables produced are processed. Maximum amounts of fruit and vegetable juices turn bitter after extraction due to conversion of chemical compounds. In spite of being under utilized, the utilization of highly nutritive fruits and vegetables is very limited due to high acidity, astringency, bitterness, and some other factors. While improving flavor, palatability, and nutritive and medicinal value of various fruit juices such as aonla, mango, papaya, pineapple, citrus, ber, pear, apple, watermelon, and vegetables including bottle gourd, carrot, beet root, bitter gourd, medicinal plants like aloe vera and spices can also be used for juice blending. All these natural products are valued very highly for their refreshing juice, nutritional value, pleasant flavor, and medicinal properties. Fruits and vegetables are also a rich source of sugars, vitamins, and minerals. However, some fruits and vegetables have an off flavor and bitterness although they are an excellent source of vitamins, enzymes, and minerals. Therefore, blending of two or more fruit and vegetable juices with spices extract for the preparation of nutritive ready-to-serve (RTS), beverages is thought to be a convenient and economic alternative for utilization of these fruits and vegetables. Moreover, one could think of a new product development through blending in the form of a natural health drink, which may also serve as an appetizer. The present review focuses on the blending of fruits, under-utilized fruits, vegetables, medicinal plants, and spices in appropriate proportions for the preparation of natural fruit and vegetable based nutritive beverages.

  8. Identification of Appropriate Reference Genes for Normalization of miRNA Expression in Grafted Watermelon Plants under Different Nutrient Stresses.

    Science.gov (United States)

    Wu, Weifang; Deng, Qin; Shi, Pibiao; Yang, Jinghua; Hu, Zhongyuan; Zhang, Mingfang

    2016-01-01

    Watermelon (Citrullus lanatus) is a globally important crop belonging to the family Cucurbitaceae. The grafting technique is commonly used to improve its tolerance to stress, as well as to enhance its nutrient uptake and utilization. It is believed that miRNA is most likely involved in its nutrient-starvation response as a graft-transportable signal. The quantitative real-time reverse transcriptase polymerase chain reaction is the preferred method for miRNA functional analysis, in which reliable reference genes for normalization are crucial to ensure the accuracy. The purpose of this study was to select appropriate reference genes in scion (watermelon) and rootstocks (squash and bottle gourd) of grafted watermelon plants under normal growth conditions and nutrient stresses (nitrogen and phosphorus starvation). Under nutrient starvation, geNorm identified miR167c and miR167f as two most stable genes in both watermelon leaves and squash roots. miR166b was recommended by both geNorm and NormFinder as the best reference in bottle gourd roots under nutrient limitation. Expression of a new Cucurbitaceae miRNA, miR85, was used to validate the reliability of candidate reference genes under nutrient starvation. Moreover, by comparing several target genes expression in qRT-PCR analysis with those in RNA-seq data, miR166b and miR167c were proved to be the most suitable reference genes to normalize miRNA expression under normal growth condition in scion and rootstock tissues, respectively. This study represents the first comprehensive survey of the stability of miRNA reference genes in Cucurbitaceae and provides valuable information for investigating more accurate miRNA expression involving grafted watermelon plants.

  9. Comprehensive Mineral Nutrition Analysis of Watermelon Grafted onto Two Different Rootstocks

    Directory of Open Access Journals (Sweden)

    Yuan Huang

    2016-03-01

    Full Text Available Grafting is a widely used practice in fruit-bearing vegetables. However, why grafting affects plant growth, fruit yield, and quality, especially from the aspect of mineral nutrition, remains unclear. In this study, watermelon cultivar ‘Zaojia 8424’ was grafted onto bottle gourd ‘Jingxinzhen 1’ (Lagenaria siceraria and pumpkin ‘Qingyanzhen 1’ (Cucurbita maxima × C. moschata. Non-grafted plants were used as the control. Results show that rootstock grafting significantly increases plant growth and single fruit weight of watermelon. Watermelon grafted onto rootstocks, especially pumpkin, exhibits significantly higher root volume, root surface area, and number of root tips and forks in comparison with non-grafted plants. Fruit flesh, rind firmness, and rind thickness were enhanced by grafting. However, fruit soluble solids and taste significantly decreased in plants grafted onto pumpkin. The total uptake (mg ⋅ plant−1 and concentration (mg ⋅ g−1 DW of N, K, Ca, Fe, Mg, and Mn in root, stem, leaf, fruit rind, and flesh were generally higher in grafted plants compared to non-grafted ones, especially for N of pumpkin rootstock-grafted plants. The total uptake of nutrients of plants grafted onto bottle gourd and pumpkin was increased by 30.41% and 49.14% at fruit development stage and by 21.33% and 47.46% at fruit maturation stage, respectively, compared with non-grafted plants. We concluded that watermelon grafting onto suitable rootstocks can increase the uptake of mineral nutrition, especially for N in the pumpkin rootstock grafted plants, thereby affecting plant growth, fruit yield, and quality.

  10. Analysis of vegetation in an Imperata grassland of Barak valley, Assam.

    Science.gov (United States)

    Astapati, Ashim Das; Das, Ashesh Kumar

    2012-09-01

    Imperata grassland at Dorgakona, Barak valley, North Eastern India was analyzed for species composition and diversity pattern in relation to traditional management practices. 19 families were in the burnt and unburnt plots of the study site with Poaceae as the most dominant one. 29 species occurred in the burnt plot and 28 in the unburnt plot. Most of the species were common in both the plots. The pattern of frequency diagrams indicated that the vegetation was homogeneous. Imperata cylindrica, a rhizomatous grass was the dominant species based on density (318.75 and 304.18 nos. m(-2)), basal cover (158.22 and 148.34 cm2 m(-2)) and Importance value index (IVI) (132.64 and 138.74) for the burnt and unburnt plots respectively. Borreria pusilla was the co-dominant species constituting Imperata-Borreria assemblage of the studied grassland. It was observed that B. pusilla (162.25 nos. m(-2) and 50.37 nos. m(-2), I. cylindrica (318.75 nos. m(-2) and 304.18 nos. m(-2)) and Setaria glauca (24.70 nos. m(-2) and 16.46 nos. m(-2) were benefited from burning as shown by the values sequentially placed for burnt and unburnt plots. Certain grasses like Chrysopogon aciculatus and Sacciolepis indica were restricted to burnt plot while Oxalis corniculata showed its presence to unburnt plot. Grasses dominated the grassland as revealed by their contribution to the mean percentage cover of 72% in burnt plot and 76% in umburnt plot. The dominance-diversity curves in the study site approaches a log normal series distribution suggesting that the resources are shared by the constituent species. Seasonal pattern in diversity index suggested definite influence of climatic seasonality on species diversity; rainy season was conducive for maximum diversity (1.40 and 1.38 in the burnt and unburnt plots, respectively). Dominance increased with concentration of fewer species (0.0021 in burnt plot and 0.0055 in unbumt plot) in summer and behaves inversely to index of diversity. This study showed

  11. Photodegradation of 17α-ethynylestradiol in aqueous solution exposed to a high-pressure mercury lamp (250 W)

    International Nuclear Information System (INIS)

    Liu, X.L.; Wu, F.; Deng, N.S.

    2003-01-01

    The photodegradation of 17α-ethynylestradiol (EE 2 ) induced by high-pressure mercury lamp (λ≥313, 250 W) in aqueous solution of EE 2 was investigated initially. The affecting factors on the photodegradation were studied and described in details, such as EE 2 initial concentration, Fe 3+ , algae, exposure time, and so on. The concentration of EE 2 in distilled water was mainly determined using fluorescence spectrophotometer. The photodegradation of EE 2 in aqueous solution exposed to high-pressure mercury lamp was evident and could be accelerated by Fe 3+ or algae (e.g. Anabaena cylindrica) in general. With the algae concentration increasing, photodegradation rate increased. In this paper, the mechanism of photocatalytic degradation of EE 2 by Fe 3+ or algae is discussed primarily. - Photodegradation increased with increasing concentrations of algae

  12. Documentation of hypoglycemic and wound healing plants in Kodiyampalayam coastal village (southeast coast of India

    Directory of Open Access Journals (Sweden)

    Satyavani Kaliamurthi

    2014-08-01

    Full Text Available Objective: To document the hypoglycemic and wound healing plant species especially halophytes and associates were carried out in the coastal village of Kodiyampalayam (Southeast coast of India. Methods: The data were collected during the month of December 2011 to November 2012 with personal interviews and group discussion of local coastal fisher women community and traditional practitioner. Results: The results indicated the traditional knowledge of 33 medicinal plant species, photographs, vernacular name, habit, active part and their mode of action. Among these, Citrullus colocynthis, Coccinia grandis, Rhizophora apiculata, Rhizophora mucronata, Bruguiera cylindrica, Excoecaria agallocha and Andrographis paniculata were discovered in huge number. Conclusions: This study concludes medicinal uses of halophytes and associates in the coastal area. It will be needed scientific validation for development of novel therapeutic agents.

  13. Eimeriosis in Danish Dairy Calves – Correlation between Species, Oocyst Excretion and Diarrhoea

    DEFF Research Database (Denmark)

    Enemark, Heidi L.; Dahl, Jan; Enemark, Jörg M Dehn

    2013-01-01

    The study collected up-to-date data on prevalence and importance of Eimeria infections in Danish dairy calves with suspected clinical eimeriosis and analysed correlation between Eimeria spp., oocyst excretion and diarrhoea. From October 2010 through August 2011, veterinarians collected faecal...... determined, along with opg values for the specific Eimeria spp. Association between opg and faeces consistency was evaluated in a multinomial, logistic regression model. Overall prevalence of Eimeria spp. was 96.2 % with a prevalence of 60.9 % in individual calves. E. zuernii and/or E. bovis were detected...... in 88.5 % of herds and 41.5 % of the calves. Mean opg was 2,040 (range 0–114,000) in the calves, of which 18.1 % had opg values ≥ 1,000. A total of 12 Eimeria spp. was found with the following calf prevalences: E. ellipsoidalis (37 %), E. zuernii (32 %), E. bovis (28 %), E. cylindrica (23 %), E...

  14. Potensi Jamur Patogen Tumbuhan sebagai Agen Pengendali Biologi Gulma Alang-alang

    Directory of Open Access Journals (Sweden)

    Bambang Nugroho

    1997-09-01

    pathogenic fungi. The purpose of this research is to identify potential fungi to be developed as an agent of biological control on alang-alang (Imperata cylindrica L. A survey was conducted in highland and lowland areas which were seriously infested by alang-alang to know the disease intensity and its distribution. Sample of diseased leaves were taken for identification and pathogenecity testing. Four fungal diseases - leaf blight, rust and two kinds of leaf spot that are caused by Phoma sp, Puccinia rufipes Diet and two unidentified pathogens - were found. By inoculation trials it was proven that Phoma sp. is pathogenic to alang-alang. Considering that there are potential pathogenic fungi causing several diseases on alang-alang, it is possible to develop a method of controlling the grass by using pathogenic fungi.

  15. EFFECTIVENESS OF GLYPHOSATE AND 2.4 D AMIN HERBICIDES TO CONTROL WEEDS UNDER Shorea selanica Bl. PLANTATION IN CARITA TRIAL GARDEN, BANTEN

    Directory of Open Access Journals (Sweden)

    Ari Wibowo

    2007-03-01

    Full Text Available A trial was carried out in Carita, West Java, to identify the effectiveness of Glyphosate and 2.4 D Amin Herbicide to control weeds under Shorea selanica Bl. plantation. The trial was conducted through the application of Glyphosate and 2.4 D Amin Herbicide with dosages of 5, 6, 7, 8 and 9 liter per ha and compared with Glyphosate herbicide 5 liter per ha, manual treatment, and control (no treatment. The result showed that Glyphosate and 2.4 D Amin Herbicide could be used to control weeds in order to maintaining S. selanica Bl. plantation. Minimum dosage of 6 liter/ha was effective to control weeds such as Chromolaena odorata DC, Mikania micrantha Will, Lantana camara L, Imperata cylindrica Beauv., Melastoma malabathricum L, and Boreria latifolia Bl. Furthermore, there was no symptom of poison on S. selanica Bl. plantation after herbicide application with all dosages applied.

  16. Weed management: a case study from north-west Pakistan

    International Nuclear Information System (INIS)

    Marwat, K.B.; Hashim, S.; Ali, H.

    2010-01-01

    Alien and exotic plant invasions are threatening the floral diversity around the globe and affect ecological processes. Weed invasion has been documented in North-West Pakistan. A total of 16 weeds were reported as invasive. These were Xanthium strumarium, Ipomoea eriocarpa, Alternanthera pungens, Trianthema portulacastrum, Tagetes minuta, Imperata cylindrica, Amaranthus hybridus subsp. hybridus, Robinia pseudo-acacia, Broussonetia papyrifera, Ailanthus altissima, Pistia stratiotes, Phragmites australis, Parthenium hysterophorus, Cannabis sativa, Galium aparine and Emex spinosus. Among these Robinia pseudo-acacia, Broussonetia papyrifera and Ailanthus altissima are trees and were purposely introduced as they later became invasive. They were aggressive in nature and replaced or suppressed the local vegetation. Their distribution, history of invasion and management has been discussed here. The behaviour and association of the 36 problem weeds with different crops has also been outlined as they perspired from the farmers. (author)

  17. Distribution of heavy metals in Tamshui mangrove forest ecosystem

    Energy Technology Data Exchange (ETDEWEB)

    Chiu, C Y; Chou, C H

    1990-06-01

    Tamsui estuary area is one of the few places in Taiwan where mangrove is still growing. Heavy metals, carried by the water of the Tamsui river, are accumulated in the estuary soil. Most heavy metals in soil, however, are immobile under reducing conditions and are fixed in the large amount of organic matter present. Heavy metals are distributed at different concentrations in various tissues of Kandelia candel as well as grasses of Phragmites communis, Imperata cylindrica, and Cyperus malaccensis growing in the swamp area. The concentration of heavy metals was significantly higher root than in stems and leaves. The absorption of heavy metals by the plants was less in soil that was frequently submerged. Kandelia candel seems to have no special tolerance to copper and zinc. The soil environment which favors reduced availability of heavy metals may help Kandelia candel adapt to growth in the polluted estuary.

  18. Weed management: a case study from north-west Pakistan

    Energy Technology Data Exchange (ETDEWEB)

    Marwat, K B; Hashim, S; Ali, H [KPK Agriculture University, Peshawar (Pakistan). Dept. of Weed Science

    2010-12-15

    Alien and exotic plant invasions are threatening the floral diversity around the globe and affect ecological processes. Weed invasion has been documented in North-West Pakistan. A total of 16 weeds were reported as invasive. These were Xanthium strumarium, Ipomoea eriocarpa, Alternanthera pungens, Trianthema portulacastrum, Tagetes minuta, Imperata cylindrica, Amaranthus hybridus subsp. hybridus, Robinia pseudo-acacia, Broussonetia papyrifera, Ailanthus altissima, Pistia stratiotes, Phragmites australis, Parthenium hysterophorus, Cannabis sativa, Galium aparine and Emex spinosus. Among these Robinia pseudo-acacia, Broussonetia papyrifera and Ailanthus altissima are trees and were purposely introduced as they later became invasive. They were aggressive in nature and replaced or suppressed the local vegetation. Their distribution, history of invasion and management has been discussed here. The behaviour and association of the 36 problem weeds with different crops has also been outlined as they perspired from the farmers. (author)

  19. EKSPLORASI DAN PRODUKTIFITAS PADANG PENGGEMBALAAN DI KECAMATAN PAMONA TIMUR KABUPATEN POSO SULAWESI TENGAH

    Directory of Open Access Journals (Sweden)

    P.D.M.H. Karti

    2015-06-01

    Full Text Available Pasture in District of East Pamona, Poso Regency has potential as forage for livestock.. This study was conducted in two villages (Didiri and Kelei to explore of plant species as feed and productivity calculation such as botanical composition and carrying capacities. Type of grasses that grow are Sporobolus sp, Paspalum sp, Paspalum cartilagineum, Axonopus compresus, Euleusine indica. Type of legumes that grow are Stylosanthes guianensis, Desmodium sp, Centrocema pubescens, Callyandra callothyrsus, Leucaena leucocephala. Types of weeds have started to grow in several locations within the region, such as Melastoma, Mimosa pudica, Imperata cylindrica, Cromolena odorata, Cyperacea, and Lamtana camara. Botanical composition (% in Kelei for grass, legumes, weeds (84.76: 6.75: 8:49 and Didiri for grass, legumes, weeds (95.34: 0:51: 4.15. Carrying Capacities in Kelei and Didiri was 0.96 ± 0:23 and 1:12 ± 0:29 ST / ha.

  20. Respons Curvularia lunata Penyebab Penyakit Bercak Daun Kelapa Sawit terhadap Berbagai Fungisida

    Directory of Open Access Journals (Sweden)

    Agus Susanto

    2014-08-01

    Full Text Available Leaf spot disease of oil palm caused by Curvularia sp. is the major disease in nursery. Implementation of best nursery practices is the key to prevent it. Generally, fungicides are used only if epidemic of leaf spot diseases occur in the field. The objectives of this research were to determine causal agent of leaf spot disease of oil palm and the potential alternative weed host around the nursery, to select suitable fungicides, and to study the effect of fungicides rotation to disease incidence. The results showed that the causal agent of leaf spot disease of oil palm was Curvularia lunata. The fungus was also found on grasses, Cyperus rotundus and Imperata cylindrica. Difeconazol, copper oxide, and propineb suppressed leaf spot disease in nursery. Application of fungicide by rotation between difeconazol and copper oxide with frequency every 10 days suppressed the development of leaf spot disease of oil palm in the nursery.

  1. Use of computational methods for substitution and numerical dosimetry of real bones

    International Nuclear Information System (INIS)

    Silva, I.C.S.; Gonzalez, K.M.L.; Barbosa, A.J.A.; Lucindo Junior, C.R.; Vieira, J.W.; Lima, F.R.A.

    2017-01-01

    Estimating the dose that ionizing radiation deposits in the soft tissues of the skeleton within the cavities of the trabecular bones represents one of the greatest difficulties faced by numerical dosimetry. The Numerical Dosimetry Group (GDN/CNPq) Brazil, Recife-PE has used a method based on micro-CT images. The problem of the implementation of micro-CT is the difficulty in obtaining samples of real bones (OR). The objective of this work was to evaluate the sample of a virtual block of trabecular bone through the nonparametric method based on the voxel frequencies (VF) and samples of the climbing plant called Luffa aegyptica, whose dry fruit is known as vegetal bush (BV) substitution of OR samples. For this, a theoretical study of the two techniques developed by the GDN was made. The study showed in both techniques, after the dosimetric evaluations, that the actual sample can be replaced by the synthetic samples, since they have shown dose estimates close to the actual one

  2. The insects as an assessment tool of ecotoxicology associated with metal toxic plants.

    Science.gov (United States)

    Azmat, Rafia; Moin, Sumeira; Saleem, Ailyan

    2018-04-01

    In this article, the assessment of lethal effects of Copper (Cu) on Luffa acutangula and Spinacia oleracea plants investigated in relation to the presence of insect species Oxycarenus hyalinipennis. The analysis of Cu-treated plants displays the information of rapid growth of Oxycarenus hyalinipennis species in triplicate. However, results showed that the impact of metal toxicity appeared as the reduced growth rate of plants, and dense growth of the insect species Oxycarenus halinipennis followed by the chewing/degradation of the toxic plant. The insect's inductees into polluted plants were justified by morphological and primary molecular level using plant stress hypothesis through analysis of the primary chemistry of leaves and roots. That includes various sugar contents which substantiated that these compounds act as the best feeding stimulant from oviposition to adult stage of the insects and accountable for the enactment of insects in the toxic plants. The relationship of these insects to the toxic plants linked with the higher contents of glucose, carbohydrates, and cellulose. The higher carbohydrate and cellulose content in both plants species under Cu accumulation exhibited more signs of insect mutilation over control plants and the lack of chemical resistances allowed the adult insects to spread, survive, reproduce and live long. The presence of insects developed relationships that assimilate all developmental, biological, and the interactive toxicity of Cu in both plant species which indicate the risk associated with these plants. Copyright © 2018 Elsevier Ltd. All rights reserved.

  3. Use of computational methods for substitution and numerical dosimetry of real bones; Utilização de métodos computacionais para substituição e dosimetria numérica de ossos reais

    Energy Technology Data Exchange (ETDEWEB)

    Silva, I.C.S.; Gonzalez, K.M.L.; Barbosa, A.J.A.; Lucindo Junior, C.R., E-mail: Islanecristina94@gmail.com [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil); Vieira, J.W. [Instituto Federal de Pernambuco (IFPE), Recife, PE (Brazil); Lima, F.R.A. [Centro Regional de Ciências Nucleares do Nordeste (CRCN-NE/CNEN-RJ), Recife-PE (Brazil)

    2017-07-01

    Estimating the dose that ionizing radiation deposits in the soft tissues of the skeleton within the cavities of the trabecular bones represents one of the greatest difficulties faced by numerical dosimetry. The Numerical Dosimetry Group (GDN/CNPq) Brazil, Recife-PE has used a method based on micro-CT images. The problem of the implementation of micro-CT is the difficulty in obtaining samples of real bones (OR). The objective of this work was to evaluate the sample of a virtual block of trabecular bone through the nonparametric method based on the voxel frequencies (VF) and samples of the climbing plant called Luffa aegyptica, whose dry fruit is known as vegetal bush (BV) substitution of OR samples. For this, a theoretical study of the two techniques developed by the GDN was made. The study showed in both techniques, after the dosimetric evaluations, that the actual sample can be replaced by the synthetic samples, since they have shown dose estimates close to the actual one.

  4. Incidence and molecular diversity of poleroviruses infecting cucurbit crops and weed plants in Thailand.

    Science.gov (United States)

    Cheewachaiwit, S; Warin, N; Phuangrat, B; Rukpratanporn, S; Gajanandana, O; Balatero, C H; Chatchawankanphanich, O

    2017-07-01

    Overall, 244 samples of cucurbit crops with yellowing symptoms and selected weed species, from 15 provinces in Thailand, were screened by RT-PCR using primers Polero-CP-F and Polero-CP-R. A total of 160 samples (~66%) were infected by poleroviruses. Analysis of a 1.4 kb region covering the 3' RNA-dependent RNA polymerase (RdRp) gene, the intergenic non-coding region (iNCR), and the coat protein (CP), showed that four poleroviruses, namely, cucurbit aphid-borne yellows virus (CABYV), luffa aphid-borne yellows virus (LABYV), melon aphid-borne yellows virus (MABYV) and suakwa aphid-borne yellows virus (SABYV) were associated with the yellowing symptoms in cucurbit crops. Further analyses indicated presence of putative recombinant viruses referred to as CABYV-R and SABYV-R. CABYV-R was derived from the recombination between MABYV and the common strain of CABYV (CABYV-C). SABYV-R was derived from the recombination of MABYV and SABYV.

  5. Vegetation successfully prevents oxidization of sulfide minerals in mine tailings.

    Science.gov (United States)

    Li, Yang; Sun, Qingye; Zhan, Jing; Yang, Yang; Wang, Dan

    2016-07-15

    The oxidization of metal sulfide in tailings causes acid mine drainage. However, it remains unclear whether vegetation prevents the oxidization of metal sulfides. The oxidization characteristics and microbial indices of the tailings in the presence of various plant species were investigated to explore the effects of vegetation on the oxidization of sulfide minerals in tailings. The pH, reducing sulfur, free iron oxides (Fed), chemical oxygen consumption (COC) and biological oxygen consumption (BOC) were measured. Key iron- and sulfur-oxidizing bacteria (Acidithiobacillus spp., Leptospirillum spp. and Thiobacillus spp.) were quantified using real-time PCR. The results indicate that vegetation growing on tailings can effectively prevent the oxidization of sulfide minerals in tailings. A higher pH and reducing-sulfur content and lower Fed were observed in the 0-30 cm depth interval in the presence of vegetation compared to bare tailings (BT). The COC gradually decreased with depth in all of the soil profiles; specifically, the COC rapidly decreased in the 10-20 cm interval in the presence of vegetation but gradually decreased in the BT profiles. Imperata cylindrica (IC) and Chrysopogon zizanoides (CZ) profiles contained the highest BOC in the 10-20 cm interval. The abundance of key iron- and sulfur-oxidizing bacteria in the vegetated tailings were significantly lower than in the BT; in particular, IC was associated with the lowest iron- and sulfur-oxidizing bacterial abundance. In conclusion, vegetation successfully prevented the oxidization of sulfide minerals in the tailings, and Imperata cylindrica is the most effective in reducing the number of iron- and sulfur-oxidizing bacteria and helped to prevent the oxidization of sulfide minerals in the long term. Copyright © 2016 Elsevier Ltd. All rights reserved.

  6. Saponins and the in vitro bioactivities of different solvent extracts of some tropical green and red seaweeds

    Directory of Open Access Journals (Sweden)

    Abhilash Parameswaran Kailas

    2015-12-01

    Full Text Available Objective: To evaluate the antioxidant and antimicrobial activities of the saponins content and the corresponding sequential extracts prepared using petroleum ether, chloroform, ethyl acetate and acetone, of some seaweed species [consisting of red Gracilaria corticata, Gracilaria corticata var. cylindrica and Gracilaria foliifera and green Enteromorpha prolifera, Ulva fasciata and Chaetomorpha antennina (C. antennina seaweeds], obtained from the southwest coast of India. Methods: The fractions were collected during the extraction of saponins and the saponins were chemically investigated for the saponification and iodine value. The antioxidant activities were estimated using the 2,2-diphenyl-1-picrylhydrazyl, UV-vis ferrous tartrate and KMnO4 titration methods against four standards. The antimicrobial activities were estimated against four pathogenic organisms. Bioactive fractions except saponins, were further investigated through gas chromatography-mass spectrometer. Statistical correlations were done to identify the correlation pattern between the activity and constituents. Results: The seaweed extracts exhibited appreciable biochemical activities. In general, the Chlorophyta had rich resource of saponins. C. antennina showed high content of saponins. Antioxidant activities were seen to be high when the saponins and fatty acid fractions were screened. C. antennina, Enteromorpha prolifera, Gracilaria corticata var. cylindrica and Gracilaria foliifera exhibited commendable antioxidant activities. Antibacterial activity was exhibited the highest in the extracts of Ulva fasciata. Selective antimicrobial inhibition was observed throughout. Gas chromatography-mass spectrometer investigation showed appreciable contents of ω-3, ω-5, ω-6, ω-7, ω-8, ω-9 and rare ω-11 fatty acids along with other saturated fatty acids. Conclusions: The correlation studies underlined the relation between the biochemical compositions and activities. These seaweeds

  7. Effects of Ocean Acidification and Temperature Increases on the Photosynthesis of Tropical Reef Calcified Macroalgae.

    Science.gov (United States)

    Scherner, Fernando; Pereira, Cristiano Macedo; Duarte, Gustavo; Horta, Paulo Antunes; E Castro, Clovis Barreira; Barufi, José Bonomi; Pereira, Sonia Maria Barreto

    2016-01-01

    Climate change is a global phenomenon that is considered an important threat to marine ecosystems. Ocean acidification and increased seawater temperatures are among the consequences of this phenomenon. The comprehension of the effects of these alterations on marine organisms, in particular on calcified macroalgae, is still modest despite its great importance. There are evidences that macroalgae inhabiting highly variable environments are relatively resilient to such changes. Thus, the aim of this study was to evaluate experimentally the effects of CO2-driven ocean acidification and temperature rises on the photosynthesis of calcified macroalgae inhabiting the intertidal region, a highly variable environment. The experiments were performed in a reef mesocosm in a tropical region on the Brazilian coast, using three species of frondose calcifying macroalgae (Halimeda cuneata, Padina gymnospora, and Tricleocarpa cylindrica) and crustose coralline algae. The acidification experiment consisted of three treatments with pH levels below those occurring in the region (-0.3, -0.6, -0.9). For the temperature experiment, three temperature levels above those occurring naturally in the region (+1, +2, +4°C) were determined. The results of the acidification experiment indicate an increase on the optimum quantum yield by T. cylindrica and a decline of this parameter by coralline algae, although both only occurred at the extreme acidification treatment (-0.9). The energy dissipation mechanisms of these algae were also altered at this extreme condition. Significant effects of the temperature experiment were limited to an enhancement of the photosynthetic performance by H. cuneata although only at a modest temperature increase (+1°C). In general, the results indicate a possible photosynthetic adaptation and/or acclimation of the studied macroalgae to the expected future ocean acidification and temperature rises, as separate factors. Such relative resilience may be a result of the

  8. Teknologi Pengendalian Gulma Alang-alang dengan Tanaman Legum untuk Pertanian Tanaman Pangan

    Directory of Open Access Journals (Sweden)

    Ishak Juarsah

    2015-07-01

    Full Text Available Di Indonesia, Alang-alang (Imperata cylindrica L. Beauv merupakan salah satu gulma terpenting dan termasuk sepuluh gulma bermasalah di dunia.  Melalui biji dan rimpang, alang-alang dapat tumbuh dan menyebar luas pada hampir semua kondisi lahan. Teknologi pengendalian alang-alang telah banyak dikenal namun belum dapat menjamin eradikasi populasi alang-alang secara berkelanjutan tanpa diikuti oleh kultur teknis dan pola budidaya tanaman pangan sepanjang tahun. Hasil penelitian menunjukan bahwa lahan alang-alang dapat dikendalikan/dikelola menjadi lahan produktif setelah direhabilitasi dengan tanaman legume (Mucuna sp. untuk usaha tani tanaman pangan lahan kering berorientasi konservasi tanah. Bahan hijauan tanaman Mucuna dapat meningkatkan kadar C-organik, memperbaiki sifat fisika, kimia tanah dan meningkatkan  produksi tanaman pangan. In Indonesia, Alang-alang (Imperata cylindrica L. Beauv is one of important weeds and included to ten most problematic weeds around the world. Through its seeds and roots, alang-alang can grow and expand in nearly all soil conditions. Many technologies for controlling have been known but can not ensure the eradication of weeds population, however the controlling via food crops cropping systems for the whole years is the best method so far to have sustainability of the agriculture land. Research showed that alang-alang area could be controlled/managed became more productive land after rehabilitation with legume (ie Mucuna sp. especially for dry land conservation oriented. Mucuna green materials might increase C-organic content, both soil chemical and physical improvement, furthermore increased foodcrops production.

  9. Screening of salt-tolerance potential of some native forage grasses from the eastern part of Terai-Duar grasslands in India

    Directory of Open Access Journals (Sweden)

    Swarnendu Roy

    2017-09-01

    Full Text Available The salt tolerance of 12 native forage grasses from the eastern part of Terai-Duar grasslands was assessed using a rapid method of leaf disc senescence bioassay. Samples of these grasses were grown in untreated water as well as 100 and 200 mM NaCl solutions for periods of 3, 6 and 9 days. Discs of fresh leaf were then placed in untreated water as well as in 100 and 200 mM NaCl solutions for 96 hours. Quantitative effects were measured as the effects on chlorophyll concentration in leaves in response to exposure to the varying solutions. From these results, the salt sensitivity index (SSI of the individual grasses was determined. The SSI values indicated that Imperata cylindrica, Digitaria ciliaris and Cynodon dactylon were most salt-tolerant of all grasses tested. Further characterization of the grasses was done by observing the changes in 6 biomarkers for salinity tolerance: relative water content, total sugar concentration, proline concentration, electrolyte leakage, membrane lipid peroxidation and H2O2 concentration following exposure to 100 and 200 mM NaCl concentrations for 3, 6 and 9 days. Finally, hierarchical cluster analysis using the software CLUSTER 3.0 was used to represent the inter-relations among the physiological parameters and to group the grasses on the basis of their salinity tolerance. The overall results indicated that Imperata cylindrica, Eragrostis amabilis, Cynodon dactylon and Digitaria ciliaris were potentially salt-tolerant grasses and should be planted on saline areas to verify our results. On the other hand, Axonopus compressus, Chrysopogon aciculatus, Oplismenus burmanni and Thysanolaena latifolia were found to be highly salt-sensitive and would be unsuitable for use in saline areas. 

  10. Italian horticultural and culinary records of summer squash (Cucurbita pepo, Cucurbitaceae) and emergence of the zucchini in 19th-century Milan.

    Science.gov (United States)

    Lust, Teresa A; Paris, Harry S

    2016-07-01

    Summer squash, the young fruits of Cucurbita pepo, are a common, high-value fruit vegetable. Of the summer squash, the zucchini, C. pepo subsp. pepo Zucchini Group, is by far the most cosmopolitan. The zucchini is easily distinguished from other summer squash by its uniformly cylindrical shape and intense colour. The zucchini is a relatively new cultivar-group of C. pepo, the earliest known evidence for its existence having been a description in a book on horticulture published in Milan in 1901. For this study, Italian-language books on agriculture and cookery dating from the 16th to 19th centuries have been collected and searched in an effort to follow the horticultural development and culinary use of young Cucurbita fruits in Italy. The results indicate that Cucurbita fruits, both young and mature, entered Italian kitchens by the mid-16th century. A half-century later, round and elongate young fruits of C. pepo were addressed as separate cookery items and the latter had largely replaced the centuries-old culinary use of young, elongate bottle gourds, Lagenaria siceraria Allusion to a particular, extant cultivar of the longest fruited C. pepo, the Cocozelle Group, dates to 1811 and derives from the environs of Naples. The Italian diminutive word zucchini arose by the beginning of the 19th century in Tuscany and referred to small, mature, desiccated bottle gourds used as containers to store tobacco. By the 1840s, the Tuscan word zucchini was appropriated to young, primarily elongate fruits of C. pepo The Zucchini Group traces its origins to the environs of Milan, perhaps as early as 1850. The word zucchini and the horticultural product zucchini arose contemporaneously but independently. The results confirm that the Zucchini Group is the youngest of the four cultivar-groups of C. pepo subsp. pepo but it emerged approximately a half-century earlier than previously known. © The Author 2016. Published by Oxford University Press on behalf of the Annals of Botany

  11. Genome-wide identification and comparative analysis of conserved and novel microRNAs in grafted watermelon by high-throughput sequencing.

    Science.gov (United States)

    Liu, Na; Yang, Jinghua; Guo, Shaogui; Xu, Yong; Zhang, Mingfang

    2013-01-01

    MicroRNAs (miRNAs) are a class of endogenous small non-coding RNAs involved in the post-transcriptional gene regulation and play a critical role in plant growth, development and stresses response. However less is known about miRNAs involvement in grafting behaviors, especially with the watermelon (Citrullus lanatus L.) crop, which is one of the most important agricultural crops worldwide. Grafting method is commonly used in watermelon production in attempts to improve its adaptation to abiotic and biotic stresses, in particular to the soil-borne fusarium wilt disease. In this study, Solexa sequencing has been used to discover small RNA populations and compare miRNAs on genome-wide scale in watermelon grafting system. A total of 11,458,476, 11,614,094 and 9,339,089 raw reads representing 2,957,751, 2,880,328 and 2,964,990 unique sequences were obtained from the scions of self-grafted watermelon and watermelon grafted on-to bottle gourd and squash at two true-leaf stage, respectively. 39 known miRNAs belonging to 30 miRNA families and 80 novel miRNAs were identified in our small RNA dataset. Compared with self-grafted watermelon, 20 (5 known miRNA families and 15 novel miRNAs) and 47 (17 known miRNA families and 30 novel miRNAs) miRNAs were expressed significantly different in watermelon grafted on to bottle gourd and squash, respectively. MiRNAs expressed differentially when watermelon was grafted onto different rootstocks, suggesting that miRNAs might play an important role in diverse biological and metabolic processes in watermelon and grafting may possibly by changing miRNAs expressions to regulate plant growth and development as well as adaptation to stresses. The small RNA transcriptomes obtained in this study provided insights into molecular aspects of miRNA-mediated regulation in grafted watermelon. Obviously, this result would provide a basis for further unravelling the mechanism on how miRNAs information is exchanged between scion and rootstock in grafted

  12. Food resource and temporal partitioning amongst a guild of predatory agroecosystem - inhabiting ant species

    Directory of Open Access Journals (Sweden)

    Vivek Mohan AGARWAL, Neelkamal RASTOGI

    2009-10-01

    Full Text Available Prey diversity and temporal foraging patterns of six abundant, predatory ant species were investigated seasonally in an agroecosystem with two main vegetable crops. Pheidole sp. demonstrated the highest predation success and therefore appears to be the dominant species while Tapinoma melanocephalum showed the lowest success under the natural field conditions. Investigation of prey diversity and temporal activity patterns with the null model tests of niche overlap revealed a significant overlap indicating that the activity periods and prey diversity may not be solely influenced by interactions among the co-existing ant species. However, niche partitioning in the daily peak activity periods was demonstrated during all the three seasons (summer, rainy and winter particularly between Pheidole sp. and T. melanocephalum. Pheidole sp. exhibited a high intensity, broadly extended mono-modal foraging pattern. Camponotus compressus and C. paria showed bi-modality in their foraging activity during the rainy season and mono-modal patterns during summer and winter seasons. Pachycondyla tesserinoda, Tetramorium sp. and T. melanocephalum exhibited peak foraging activities in the morning hours during the summer and rainy seasons. The activity profiles of C. compressus and T. melanocephalum were skewed towards late afternoon hours during the winter season indicating avoidance of foraging activity during the favourable periods when the more aggressive Pheidole sp. is active. In the sponge gourd agroecosystem, the ants captured predominantly hymenopteran, orthopteran and coleopteran insects. While Pheidole sp. hunted mainly the large orthopteran prey, other ant species captured worker ants in the sponge gourd agroecosystem. In the cauliflower agroecosystem, while other species captured prey chiefly belonging to six orders, i.e., Lepidoptera, Hymenoptera, Coleoptera, Hemiptera, Isoptera and Diptera, Pheidole sp. was the only species to also hunt orthopteran prey

  13. Atividade antifúngica de extratos de plantas a Colletotrichum gloeosporioides = Antifungal activity of plant extracts to Colletotrichum gloeosporioides

    Directory of Open Access Journals (Sweden)

    Mercia Ikarugi Bomfim Celoto

    2008-01-01

    Full Text Available O presente trabalho teve como objetivo avaliar o efeito fungitóxico de extratos vegetais sobre o crescimento micelial e a germinação de esporos de Colletotrichum gloeosporioides. Os extratos foram obtidos a partir de plantas secas e moídas, utilizando-se água e etanol como meio extrator. Foram utilizadas 22 espécies de plantas para a obtençãodos extratos. Os extratos foram avaliados por meio da incorporação de 20% do extrato em meio BDA, antes ou após a autoclavagem do mesmo. Determinou-se a percentagem de inibição do crescimento micelial (PIC. Utilizando-se extrato na proporção de 50% e suspensão de esporos, determinou-se a percentagem de inibição da germinação de esporos (PIG. Verificou-se que os extratos hidroetanólicos proporcionaram maior PIC de C. gloeosporioides, enquanto maior PIG foi obtido com os extratos aquosos. Extratos não autoclavados foram mais eficientes na redução do crescimento micelial de C. gloeosporioides que os extratos autoclavados. Os extratos aquoso e hidroetanólico de melão-de-são-caetano e extrato hidroetanólico de eucalipto proporcionaram maiores PIC. Os extratos aquosos deLuffa acutangula, Eucalyptus citriodora, Chenopodium ambrosioides e Bauhinia, e os extratos hidroetanólicos de Ruta graveolens, Eucalyptus citriodora, Zingiber officinale e Chenopodiumambrosioides inibiram mais de 90% da germinação de esporos.The present work aimed to evaluate the effect fungitoxic of plant extracts on the mycelial growth and on the spores germination of C. gloeosporioides. The plant extracts were obtained starting from dried ground plants, using water and ethilic alcohol as extractor. Twenty-two plant species were used to obtain the extracts. The extracts were tested by means of the incorporation of 20% (v/v in PDA medium, before or after sterilization. The percentage ofinhibition of the mycelial growth (PIM was determined. Extract in the proportion of 50% was added to a spore suspension used to

  14. Remediation of Cu metal-induced accelerated Fenton reaction by potato peels bio-sorbent.

    Science.gov (United States)

    Azmat, Rafia; Moin, Sumeira; Saleem, Ailyan

    2016-12-01

    This article has allied exposure to Ecological Particulate Matter (EPM) and its remediation using potato peel surface (PPC) bio-sorbent on two important edible crops Spinacia oleracea and Luffa acutangula. Fenton reaction acceleration was one of the major stress oxidation reactions as a consequence of iron and copper toxicity, which involve in the formation of hydroxyl radical (OH) through EPM. Results showed that the oxidative stress encouraged by Cu in both species that recruits the degradation of photosynthetic pigments, initiating decline in growth, reduced leaf area and degrade proteins. The plants were cultivated in natural environmental condition in three pots with three replicates like (a) control, (b) Cu treated and (c) treated water. Oxidative stress initiated by metal activity in Cu accumulated plant (b) were controlled, through bio-sorption of metal from contaminated water using PPC; arranged at laboratory scale. The acceleration of Fenton reaction was verified in terms of OH radical generation. These radicals were tested in aqueous extract of leaves of three types of plants via benzoic acid. The benzoic acid acts as a scavenger of OH radical due to which the decarboxylation of benzoic acid cured. Observation on (b) showed more rapid decarboxylation as compared to other plants which showed that Cu activity was much higher in (b) as compared to (a) and (c). The rapid decarboxylation of benzoic acid and lower chlorophyll contents in (b) suggest that Fenton reaction system was much enhanced by Cu-O and Fe-O chemistry that was successfully controlled by PPC which results in restoring the metabolic pathway and nullifying oxidative stress in (c).

  15. Three-dimensional microscopic deformation measurements on cellular solids.

    Science.gov (United States)

    Genovese, K

    2016-07-01

    The increasing interest in small-scale problems demands novel experimental protocols providing dense sets of 3D deformation data of complex shaped microstructures. Obtaining such information is particularly significant for the study of natural and engineered cellular solids for which experimental data collected at macro scale and describing the global mechanical response provide only limited information on their function/structure relationship. Cellular solids, in fact, due their superior mechanical performances to a unique arrangement of the bulk material properties (i.e. anisotropy and heterogeneity) and cell structural features (i.e. pores shape, size and distribution) at the micro- and nano-scales. To address the need for full-field experimental data down to the cell level, this paper proposes a single-camera stereo-Digital Image Correlation (DIC) system that makes use of a wedge prism in series to a telecentric lens for performing surface shape and deformation measurements on microstructures in three dimensions. Although the system possesses a limited measurement volume (FOV~2.8×4.3mm(2), error-free DOF ~1mm), large surface areas of cellular samples can be accurately covered by employing a sequential image capturing scheme followed by an optimization-based mosaicing procedure. The basic principles of the proposed method together with the results of the benchmarking of its metrological performances and error analysis are here reported and discussed in detail. Finally, the potential utility of this method is illustrated with micro-resolution three-dimensional measurements on a 3D printed honeycomb and on a block sample of a Luffa sponge under compression. Copyright © 2016 Elsevier Ltd. All rights reserved.

  16. Lead and cadmium contamination and exposure risk assessment via consumption of vegetables grown in agricultural soils of five-selected regions of Pakistan

    Science.gov (United States)

    Rehman, Zahir Ur; Khan, Sardar; Brusseau, Mark L; Shah, Mohammad Tahir

    2017-01-01

    Rapid urbanization and industrialization result in serious contamination of soil with toxic metals such as lead (Pb) and cadmium (Cd), which can lead to deleterious health impacts in the exposed population. This study aimed to investigate Pb and Cd contamination in agricultural soils and vegetables in five different agricultural sites in Pakistan. The metal transfer from soil-to-plant, average daily intake of metals, and health risk index (HRI) were also characterized. The Pb concentrations for all soils were below the maximum allowable limits (MAL 350 mg kg−1) set by the State Environmental Protection Administration of China (SEPA), for soils in China. Conversely, Cd concentrations in the soils exceeded the MAL set by SEPA (0.6 mg kg−) and the European Union (1.5 mg kg−1) by 62-74% and 4-34%, respectively. The mean Pb concentration in edible parts of vegetables ranged from 1.8-11 mgkg−1. The Pb concentrations for leafy vegetables were higher than the fruiting and pulpy vegetables. The Pb concentrations exceeded the MAL (0.3 mg kg−1) for leafy vegetables and the MAL for fruity and rooty/tuber vegetables (0.1 mg kg−1) set by FAO/WHO-CODEX.. Likewise, all vegetables except Pisum sativum (0.12 mg kg−1) contained Cd concentrations that exceeded the MAL set by SEPA. The HRI values for Pb and Cd were vegetable species except Luffa acutangula, Solanum lycopersicum, Benincasa hispada, Momordi charantia, Aesculantus malvaceae, Cucumis sativus, Praecitrullus fistulosus, Brassica oleracea, and Colocasia esculanta for children. Based on these results, consumption of these Pb and Cd contaminated vegetables poses a potential health risk to the local consumers. PMID:27939659

  17. Prevalence and Correlates of Herbal Medicine Use among Women Seeking Care for Infertility in Freetown, Sierra Leone

    Science.gov (United States)

    Taidy-Leigh, Lexina; Bah, Abdulai Jawo; Kanu, Joseph Sam; Kangbai, Jia Bainga; Sevalie, Stephen

    2018-01-01

    In resource-poor countries where access to infertility care is limited, women may turn to traditional medicine to achieve motherhood. It is unknown whether Sierra Leonean women with such condition use herbal medicine. This study investigates the prevalence and factors associated with herbal medicine use among women seeking care for infertility. This was a questionnaire-based cross-sectional study conducted among women seeking care for infertility at various clinics within Freetown, Sierra Leone. Data analysis included Chi-square tests and logistic regression. Out of the 167 women that participated, 36.5% used herbal medicine for infertility treatment. Women with no formal (AOR 4.03, CL: 1.38–11.76, p = 0.011), primary education (AOR: 6.23, CL: 2.02–19.23, p = 0.001) and those that visited a traditional medicine practitioner (AOR: 20.05, CL: 2.10–192.28, p = 0.009) as well as women suffering from other reproductive health problems (AOR: 2.57, CL: 1.13–5.83, p = 0.024) were more likely to use herbal medicines. Friends and family (n = 57, 96.7%) were the main influencers of herbal medicine use. Only (n = 12) 19.7% of users disclosed their status to their healthcare provider. Over half (n = 32, 52.5%) could not remember the name of the herb they used. Luffa acutangula (n = 29, 100%) was the herbal medicinal plant users could recall. Herbal medicine use among women seeking care for infertility in Freetown is common. Healthcare providers should be aware of the potential dyadic use of herbal and allopathic medicines by their patients and be knowledgeable about commonly used herbal remedies as well as being proactive in communicating the potential risks and benefits associated with their use. PMID:29849738

  18. Prevalence and Correlates of Herbal Medicine Use among Women Seeking Care for Infertility in Freetown, Sierra Leone.

    Science.gov (United States)

    James, Peter Bai; Taidy-Leigh, Lexina; Bah, Abdulai Jawo; Kanu, Joseph Sam; Kangbai, Jia Bainga; Sevalie, Stephen

    2018-01-01

    In resource-poor countries where access to infertility care is limited, women may turn to traditional medicine to achieve motherhood. It is unknown whether Sierra Leonean women with such condition use herbal medicine. This study investigates the prevalence and factors associated with herbal medicine use among women seeking care for infertility. This was a questionnaire-based cross-sectional study conducted among women seeking care for infertility at various clinics within Freetown, Sierra Leone. Data analysis included Chi-square tests and logistic regression. Out of the 167 women that participated, 36.5% used herbal medicine for infertility treatment. Women with no formal (AOR 4.03, CL: 1.38-11.76, p = 0.011), primary education (AOR: 6.23, CL: 2.02-19.23, p = 0.001) and those that visited a traditional medicine practitioner (AOR: 20.05, CL: 2.10-192.28, p = 0.009) as well as women suffering from other reproductive health problems (AOR: 2.57, CL: 1.13-5.83, p = 0.024) were more likely to use herbal medicines. Friends and family ( n = 57, 96.7%) were the main influencers of herbal medicine use. Only ( n = 12) 19.7% of users disclosed their status to their healthcare provider. Over half ( n = 32, 52.5%) could not remember the name of the herb they used . Luffa acutangula ( n = 29, 100%) was the herbal medicinal plant users could recall. Herbal medicine use among women seeking care for infertility in Freetown is common. Healthcare providers should be aware of the potential dyadic use of herbal and allopathic medicines by their patients and be knowledgeable about commonly used herbal remedies as well as being proactive in communicating the potential risks and benefits associated with their use.

  19. Prevalence and Correlates of Herbal Medicine Use among Women Seeking Care for Infertility in Freetown, Sierra Leone

    Directory of Open Access Journals (Sweden)

    Peter Bai James

    2018-01-01

    Full Text Available In resource-poor countries where access to infertility care is limited, women may turn to traditional medicine to achieve motherhood. It is unknown whether Sierra Leonean women with such condition use herbal medicine. This study investigates the prevalence and factors associated with herbal medicine use among women seeking care for infertility. This was a questionnaire-based cross-sectional study conducted among women seeking care for infertility at various clinics within Freetown, Sierra Leone. Data analysis included Chi-square tests and logistic regression. Out of the 167 women that participated, 36.5% used herbal medicine for infertility treatment. Women with no formal (AOR 4.03, CL: 1.38–11.76, p=0.011, primary education (AOR: 6.23, CL: 2.02–19.23, p=0.001 and those that visited a traditional medicine practitioner (AOR: 20.05, CL: 2.10–192.28, p=0.009 as well as women suffering from other reproductive health problems (AOR: 2.57, CL: 1.13–5.83, p=0.024 were more likely to use herbal medicines. Friends and family (n=57, 96.7% were the main influencers of herbal medicine use. Only (n=12 19.7% of users disclosed their status to their healthcare provider. Over half (n=32, 52.5% could not remember the name of the herb they used. Luffa acutangula (n=29, 100% was the herbal medicinal plant users could recall. Herbal medicine use among women seeking care for infertility in Freetown is common. Healthcare providers should be aware of the potential dyadic use of herbal and allopathic medicines by their patients and be knowledgeable about commonly used herbal remedies as well as being proactive in communicating the potential risks and benefits associated with their use.

  20. Protective effects of plant seed extracts against amyloid β-induced neurotoxicity in cultured hippocampal neurons

    Directory of Open Access Journals (Sweden)

    Yoshinori Okada

    2013-01-01

    Full Text Available Aim: Alzheimer′s disease (AD is characterized by large deposits of amyloid β (Aβ peptide. Aβ is known to increase reactive oxygen species (ROS production in neurons, leading to cell death. In this study, we screened 15 plant seeds′ aqueous extracts (PSAE for inhibitory effects on Aβ (25-35-induced cell death using hippocampus neurons (HIPN. Materials and Methods: Fifteen chosen plants were nine medical herbs (Japanese honeywort, luffa, rapeseed, Chinese colza, potherb mustard, Japanese radish, bitter melon, red shiso, corn, and kaiware radish and six general commercial plants (common bean, komatsuna, Qing geng cai, bell pepper, kale, and lettuce. PSAE were measured for total phenolic content (TPC with the Folin-Ciocalteu method, and the 2-diphenyl-1-picryl-hydrazyl (DPPH radical scavenging effect of each seed extract was measured. To find a protectant against Aβ-induced oxidative stress, we screened 15 PSAE using a 2′, 7′-dichlorofluorescein diacetate assay. To further unravel the anti-inflammatory effects of PSAE on Aβ-induced inflammation, PSAE were added to HIPN. The neuroprotective effects of the PSAE were evaluated by Cell Counting Kit-8 assay, measuring the cell viability in Aβ-induced HIPN. Results: TPC of 15 PSAE was in the range of 0.024-1.96 mg of chlorogenic acid equivalents/gram. The aqueous extracts showed antioxidant activities. Furthermore, intracellular ROS accumulation resulting from Aβ treatment was reduced when cells were treated with some PSAE. Kale, bitter melon, kaiware radish, red shiso, and corn inhibited tumor necrosis factor-alpha secretion by the Aβ-stimulated neurons and all samples except Japanese honeywort showed enhancement of cell survival. Conclusion: From these results, we suggest that some plant seed extracts offer protection against Aβ-mediated cell death.

  1. Protective effects of plant seed extracts against amyloid β-induced neurotoxicity in cultured hippocampal neurons.

    Science.gov (United States)

    Okada, Yoshinori; Okada, Mizue

    2013-04-01

    Alzheimer's disease (AD) is characterized by large deposits of amyloid β (Aβ) peptide. Aβ is known to increase reactive oxygen species (ROS) production in neurons, leading to cell death. In this study, we screened 15 plant seeds' aqueous extracts (PSAE) for inhibitory effects on Aβ (25-35)-induced cell death using hippocampus neurons (HIPN). Fifteen chosen plants were nine medical herbs (Japanese honeywort, luffa, rapeseed, Chinese colza, potherb mustard, Japanese radish, bitter melon, red shiso, corn, and kaiware radish) and six general commercial plants (common bean, komatsuna, Qing geng cai, bell pepper, kale, and lettuce). PSAE were measured for total phenolic content (TPC) with the Folin-Ciocalteu method, and the 2-diphenyl-1-picryl-hydrazyl (DPPH) radical scavenging effect of each seed extract was measured. To find a protectant against Aβ-induced oxidative stress, we screened 15 PSAE using a 2', 7'-dichlorofluorescein diacetate assay. To further unravel the anti-inflammatory effects of PSAE on Aβ-induced inflammation, PSAE were added to HIPN. The neuroprotective effects of the PSAE were evaluated by Cell Counting Kit-8 assay, measuring the cell viability in Aβ-induced HIPN. TPC of 15 PSAE was in the range of 0.024-1.96 mg of chlorogenic acid equivalents/gram. The aqueous extracts showed antioxidant activities. Furthermore, intracellular ROS accumulation resulting from Aβ treatment was reduced when cells were treated with some PSAE. Kale, bitter melon, kaiware radish, red shiso, and corn inhibited tumor necrosis factor-alpha secretion by the Aβ-stimulated neurons and all samples except Japanese honeywort showed enhancement of cell survival. From these results, we suggest that some plant seed extracts offer protection against Aβ-mediated cell death.

  2. In vitro antibacterial, antioxidant and cytotoxic activity of acetone leaf extracts of nine under-investigated Fabaceae tree species leads to potentially useful extracts in animal health and productivity.

    Science.gov (United States)

    Dzoyem, Jean P; McGaw, Lyndy J; Eloff, Jacobus N

    2014-05-05

    The Fabaceae family is the second largest family of medicinal plants, containing more than 490 species which are being used as traditional medicine. The aim of this study was to determine the antioxidant and antibacterial activity as well as the cytotoxicity of acetone leaf extracts of nine tree species from the Fabaceae family that have not been investigated well previously for possible use in animal health and production. The antibacterial activity was determined by a serial microdilution method against three Gram-positive and three Gram-negative bacteria. Antioxidant activity was determined using free-radical scavenging assays. The safety of the extracts was ascertained using the 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) assay on Vero African green monkey kidney cells. Six of the nine acetone extracts had significant antibacterial activity against at least one of the six bacterial species with (MIC 20-80 μg/mL). The Crotalaria capensis extract had the highest activity against Salmonella typhimurium, followed by Indigofera cylindrica with MICs of 20 μg/mL and 40 μg/mL respectively. The Dalbergia nitidula extract had free radical scavenging capacity (IC50 of 9.31±2.14 μg/mL) close to that of the positive control Trolox in the DPPH assay. The Xylia torreana extract also had high activity (IC50 of 14.56±3.96 μg/mL) in the ABTS assay. There was a good correlation between antioxidant activity and total phenolic content (R2 values>0.8). The extracts had weak or no toxicity to Vero cells, compared to the positive control doxorubicin with the LC50 varying from 10.70±3.47 to 131.98±24.87 μg/mL at the concentrations tested. Extracts of D. nitidula, X. torreana, C. capensis and I. cylindrica had a low cytotoxicity and high antimicrobial and/or antioxidant activity. These species are therefore promising candidates for the development of useful antimicrobial/antioxidant preparations with a low cytotoxicity that may be useful in promoting

  3. The Final Days of Paracas in Cerro del Gentil, Chincha Valley, Peru

    Science.gov (United States)

    2016-01-01

    This article describes and analyzes a highly significant archaeological context discovered in a late Paracas (400–200 BCE) sunken patio in the monumental platform mound of Cerro Gentil, located in the Chincha Valley, Peru. This patio area was used for several centuries for ritual activities, including large-scale feasting and other public gatherings. At one point late in this historical sequence people deposited a great deal of objects in what is demonstrably a single historical event. This was quickly followed by a series of minor events stratigraphically immediately above this larger event. This entire ritual process included the consumption of liquids and food, and involved the offering of whole pottery, pottery fragments, botanical remains, bone, lithics, baskets, pyro-engraved gourds, mummies, and other objects. We interpret these events as an “abandonment ceremony” or “termination ritual” during the late Paracas period, one that may have lasted for weeks or even months. The subsequent Topará occupation at the site (ca. 200 BCE- AD 100) involved the architectural enhancement of the mound area, but the pattern of use of the patio itself ended. Such a termination ritual signals a reorganization in the regional political structure of Paracas society. PMID:27144824

  4. First Known Image of Cucurbita in Europe, 1503–1508

    Science.gov (United States)

    PARIS, HARRY S.; DAUNAY, MARIE-CHRISTINE; PITRAT, MICHEL; JANICK, JULES

    2006-01-01

    • Background The genus Cucurbita (pumpkin, squash, gourd) is native to the Americas and diffused to other continents subsequent to the European contact in 1492. For many years, the earliest images of this genus in Europe that were known to cucurbit specialists were the two illustrations of C. pepo pumpkins that were published in Fuchs' De Historia Stirpium, 1542. Images of fruits of two Cucurbita species, drawn between 1515 and 1518, were recently discovered in the Villa Farnesina in Rome. • Findings An even earlier image of Cucurbita exists in the prayer book, Grandes Heures d'Anne de Bretagne, illustrated by Jean Bourdichon in Touraine, France, between 1503 and 1508. This image, which shows a living branch bearing flowers and fruits, had not been examined and analysed by cucurbit specialists until now. The image is identified as depicting Cucurbita pepo subsp. texana. Unlike some of the fruits of Cucurbita depicted in the Villa Farnesina a decade later, this image does not depict an esculent and does not constitute evidence of early European contact with New World agriculture. Based on the descriptive, ecological and geographical accounts of C. pepo subsp. texana in the wild, the idea is considered that the image was based on an offspring of a plant found growing along the Gulf Coast of what is now the United States. PMID:16687431

  5. Phylogenetic relationships among domesticated and wild species of Cucurbita (Cucurbitaceae) inferred from a mitochondrial gene: Implications for crop plant evolution and areas of origin.

    Science.gov (United States)

    Sanjur, Oris I; Piperno, Dolores R; Andres, Thomas C; Wessel-Beaver, Linda

    2002-01-08

    We have investigated the phylogenetic relationships among six wild and six domesticated taxa of Cucurbita using as a marker an intron region from the mitochondrial nad1 gene. Our study represents one of the first successful uses of a mtDNA gene in resolving inter- and intraspecific taxonomic relationships in Angiosperms and yields several important insights into the origins of domesticated Cucurbita. First, our data suggest at least six independent domestication events from distinct wild ancestors. Second, Cucurbita argyrosperma likely was domesticated from a wild Mexican gourd, Cucurbita sororia, probably in the same region of southwest Mexico that gave rise to maize. Third, the wild ancestor of Cucurbita moschata is still unknown, but mtDNA data combined with other sources of information suggest that it will probably be found in lowland northern South America. Fourth, Cucurbita andreana is supported as the wild progenitor of Cucurbita maxima, but humid lowland regions of Bolivia in addition to warmer temperate zones in South America from where C. andreana was originally described should possibly be considered as an area of origin for C. maxima. Fifth, our data support other molecular results that indicate two separate domestications in the Cucurbita pepo complex. The potential zone of domestication for one of the domesticated subspecies, C. pepo subsp. ovifera, includes eastern North America and should be extended to northeastern Mexico. The wild ancestor of the other domesticated subspecies, C. pepo subsp. pepo, is undiscovered but is closely related to C. pepo subsp. fraterna and possibly will be found in southern Mexico.

  6. Grafting of Romanian Melons and Watermelons for Culture from South Area of Romania

    Directory of Open Access Journals (Sweden)

    Dorin Sora

    2016-11-01

    Full Text Available The vegetable grafting is useful in Romania; it is more difficult in watermelons and melons and it is continuously developing. The research was aimed the establishing of the technological stages for seedling producing of scions (Romanian melons and watermelons and rootstocks (F1 hybrids of Lagenaria siceraria and Cucurbita maxima x C. moschata for obtaining of grafted plant seedlings. The experience was realized out on a collection consisting from two Romanian scions, melon (‘Fondant’ variety and watermelon (‘Dochiţa’ variety obtained at Research and Development Station for Vegetable Growing Buzău and two rootstocks, bottle gourd - L. siceraria (‘Emphasis’ F1 and interspecific hybrid squash - C. maxima x C. moschata (‘Cobalt’ F1. The obtaining of scion and rootstock plants was made according to the ecological requirements of the species. The grafting was made by annexation (splice grafting. The plants had optimal diameters for splice grafting. Between scions (‘Fondant’ and ‘Dochiţa’ are no diference, statistical analysis could not be performed. Technological stages for producing grafted seedlings of Romanian melon and watermelon were established. The grafting was performed successfully for cucurbit symbiotes (scions and rootstocks. These technological stages for grafting by annexation of Romanian melons and watermelons are recommended for cultures in the south area of Romania.

  7. Trace elements analysis of crops and vegetables grown around industrial areas of Faisalabad and Gujranwala cities using INAA and AAS

    International Nuclear Information System (INIS)

    Husaini, S.N.; Zaidi, J.H.; Matiullah; Akram, M.; Subhan, K.

    2010-01-01

    Industrial effluents pollution is a source of risk to the health of people living in industrial cities of Pakistan. Most of the untreated effluents are discharged to the nearby agricultural fields that pollutes the vegetation grown in such soil. A majority of the industries are not equipped with suitable recycling and effluent treatment plants. Consequently, toxic metals enter our food chain and results in significant health risks and serious diseases. In order to evaluate the concentration of toxic metals (namely As, Cd, Co, Cr, Cu, Mn, Ni, Pb, Sb and Se), in crops and vegetable samples collected from the irrigated areas of Faisalabad and Gujranwala regions. Neutron activation analysis (NAA) and atomic absorption spectrometric (AAS) techniques have been used. All the observed metal concentrations were higher than the reported literature values. Moreover, the highest values of toxic metals of As (0.44 +- .03 mu g/g) and Co (0.5 +- 0.01 mu g/g), Mn (45.3 +- 2.0 mu g/g) and Sb (0.1 +- 0.01 mu g/g), Se (1.28 +- 0.06 mug/g) and Pb (3.84 +- 0.27 mu g/g) were found in tomato, bitter gourd and rice samples respectively. (author)

  8. Local indigenous fruit-derived juices as alternate source of acidity regulators.

    Science.gov (United States)

    D'souza, Cassandra; Fernandes, Rosaline; Kudale, Subhash; Naik, Azza Silotry

    2018-03-01

    Acidity regulators are additives that alter and control food acidity. The objective of this study was to explore local indigenous fruits as sources of natural acidity regulators. Juices extracted from Garcinia indica (kokum), Embilica officinalis (amla) and Tamarindus indica (tamarind) were used as acidulants for media such as coconut milk and bottle gourd juice. The buffering capacity β, acid composition, antioxidant activity and shelf-life study of the acidified media were estimated. Potentiometric titration showed G. indica to possess the highest buffering capacity in both ranges. High-performance liquid chromatography analysis showed T. indica contained a high level of tartaric acid (4.84 ± 0.01 mg g -1 ), while G. indica had citric acid (22.37 ± 0.84 mg g -1 ) and E. officinalis had citric acid (2.75 ± 0.02 mg g -1 ) along with ascorbic acid (2.68 ± 0.01 mg g -1 ). 1,1-Diphenyl-2-picrylhydrazyl scavenging activity was high for E. officinalis (91.24 ± 0.66%) and T. indica (90.93 ± 0.817%) and relatively lower for G. indica (34.61 ± 3.66%). The shelf-life study showed total plate count to be within the prescribed limits up to a week, in accordance with safety regulations. This investigation confirmed the suitability of indigenous fruit juices as alternatives to existing acidity regulators. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  9. LEGISLATIVE ENSURING FOR SEED PRODUCTION OF VEGETABLE CROPS IN RUSSIAN FEDERATION (BASED ON PARLIAMENTARY SESSION ON 11 JULY IN 2017

    Directory of Open Access Journals (Sweden)

    S. M. Sirota

    2017-01-01

    Full Text Available The analysis of the national seed market state really showed the high dependence of Russian food security on imported seeds. The government means for supporting the national seed production program undertaken in 2015 by Ministry of Agriculture of RF were very effective and took action as showed the data from ‘Roselkhozcentre’. Thus, the total land area used for seed production in vegetables, melons and gourds was increased by 48% that amounted to 2104.3 ha in 2016, and that was more than in 2015. Moreover, the vegetable and melon seed producers and breeders are worried about the facts of falsification and low quality. The main reason of occurrence of such seeds that are not meeting the variety requirements in the market is an insufficient legislative system and its lack of correspondence to the current seed production, conditions and up-to-date requirements. It is necessary to take urgent measures to revise the current state of legislative system in national seed production program. 

  10. Closure Report for Corrective Action Unit 107: Low Impact Soil Sites, Nevada Test Site, Nevada

    International Nuclear Information System (INIS)

    2009-01-01

    Corrective Action Unit (CAU) 107 is identified in the Federal Facility Agreement and Consent Order (FFACO) as 'Low Impact Soil Sites' and consists of the following 15 Corrective Action Sites (CASs), located in Areas 1, 2, 3, 4, 5, 9, 10, and 18 of the Nevada Test Site: CAS 01-23-02, Atmospheric Test Site - High Alt; CAS 02-23-02, Contaminated Areas (2); CAS 02-23-03, Contaminated Berm; CAS 02-23-10, Gourd-Amber Contamination Area; CAS 02-23-11, Sappho Contamination Area; CAS 02-23-12, Scuttle Contamination Area; CAS 03-23-24, Seaweed B Contamination Area; CAS 03-23-27, Adze Contamination Area; CAS 03-23-28, Manzanas Contamination Area; CAS 03-23-29, Truchas-Chamisal Contamination Area; CAS 04-23-02, Atmospheric Test Site T4-a; CAS 05-23-06, Atmospheric Test Site; CAS 09-23-06, Mound of Contaminated Soil; CAS 10-23-04, Atmospheric Test Site M-10; and CAS 18-23-02, U-18d Crater (Sulky). Closure activities were conducted from February through April 2009 according to the FFACO (1996; as amended February 2008) and Revision 1 of the Streamlined Approach for Environmental Restoration Plan for CAU 107 (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office, 2009). The corrective action alternatives included No Further Action and Closure in Place with Administrative Controls. Closure activities are summarized.

  11. De novo transcriptome assembly of two contrasting pumpkin cultivars

    Directory of Open Access Journals (Sweden)

    Aliki Xanthopoulou

    2016-03-01

    Full Text Available Cucurbita pepo (squash, pumpkin, gourd, a worldwide-cultivated vegetable of American origin, is extremely variable in fruit characteristics. However, the information associated with genes and genetic markers for pumpkin is very limited. In order to identify new genes and to develop genetic markers, we performed a transcriptome analysis (RNA-Seq of two contrasting pumpkin cultivars. Leaves and female flowers of cultivars, ‘Big Moose’ with large round fruits and ‘Munchkin’ with small round fruits, were harvested for total RNA extraction. We obtained a total of 6 GB (Big Moose; http://www.ncbi.nlm.nih.gov/Traces/sra/?run=SRR3056882 and 5 GB (Munchkin; http://www.ncbi.nlm.nih.gov/Traces/sra/?run=SRR3056883 sequence data (NCBI SRA database SRX1502732 and SRX1502735, respectively, which correspond to 18,055,786 and 14,824,292 150-base reads. After quality assessment, the clean sequences where 17,995,932 and 14,774,486 respectively. The numbers of total transcripts for ‘Big Moose’ and ‘Munchkin’ were 84,727 and 68,051, respectively. TransDecoder identified possible coding regions in assembled transcripts. This study provides transcriptome data for two contrasting pumpkin cultivars, which might be useful for genetic marker development and comparative transcriptome analyses. Keywords: RNA-Seq, Pumpkin, Contrasting cultivars, Cucurbita pepo

  12. Confirmation by DNA analysis that Contarinia maculipennis (Diptera: Cecidomyiidae) is a polyphagous pest of orchids and other unrelated cultivated plants.

    Science.gov (United States)

    Uechi, N; Tokuda, M; Yukawa, J; Kawamura, F; Teramoto, K K; Harris, K M

    2003-12-01

    The cytochrome oxidase subunit I gene in mitochondrial DNA of 53 larvae of Contarinia maculipennis Felt from flower buds of various host plants, collected from Hawaii, Japan and Thailand was analysed. Monophyly of the clade including C. maculipennis from Hawaii, Thailand and Japan was supported. There was no sequential variation within the specimens from Hawaii and Japan, which differed from one another by 6 bp (1.37%). Three haplotypes were recognized in specimens from Thailand but differences from Hawaiian and Japanese specimens were small. Overall, there were no differences in the 146 deduced amino acid residues. It is therefore concluded that C. maculipennis is a polyphagous species that can develop on plant hosts representing at least seven botanical families. This pest of Dendrobium flower buds in glasshouses is considered to have entered Hawaii, Florida and Japan from Southeast Asia, and was recently intercepted in the Netherlands. Infestations have established and spread in orchid glasshouses, causing concern about the possibility of more extensive damage to orchids and to crops, such as bitter gourd, grown in close proximity to orchid glasshouses in Japan. The potential usefulness of DNA analysis in determining host plant ranges of morphologically identical cecidomyiid species that are currently identified solely on differences of host plant is emphasized.

  13. Determination of elemental concentrations in environmental plant samples by instrumental neutron activation analysis

    International Nuclear Information System (INIS)

    Datta, J.; Chowdhury, D.P.; Verma, R.; Reddy, A.V.R.

    2012-01-01

    The intake of leafy vegetables in daily diet is very important to meet our nutritional needs. Vegetables provide the essential elements which are necessary and recommended for human growth. However, due to rapid industrialization and urbanization our environment becomes polluted and this affects the normal growth of agricultural products and composition of environmental species. The elemental concentrations present in the environmental samples are good indicators to assess the toxicological levels due to pollution affects. In the present work we have analysed several vegetable plant samples by instrumental neutron activation analysis to determine the elemental concentrations at major, minor and trace levels. The leafy vegetables like spinach, red leafy vegetable, pui, gourd leaf, lettuce and katoua were chosen as these are extensively consumed by local people in eastern part of India. We have determined 15 elements in the above mentioned vegetable samples and some of these are essential elements and some are toxic elements. It was found that Na and K were present as major elements, Fe and Zn as minor elements and As, Ce, Cr, Co, La, Mo, Rb, Sc, Sm, Sr as trace elements. The concentration level of Cr was found to be higher than that of recommended value certified by WHO and National environment quality control for human consumption. The validation of our analytical results have been performed by the Z-score tests through the determination of concentrations of the elements of interest in certified reference materials. (author)

  14. Efficacy of dietary supplementation with botanicals on carbohydrate metabolism in humans.

    Science.gov (United States)

    Cefalu, William T; Ye, Jianping; Wang, Zhong Q

    2008-06-01

    Botanical products are widely used in nutritional supplementation for promotion of health or prevention of diseases. With the high prevalence of obesity and type 2 diabetes, abnormalities in carbohydrate metabolism are common in the general population and obtaining glycemic control is important in reducing the complications of diabetes. If shown to be effective, botanical products have a unique position in potentially aiding the general public in regard to obesity and diabetes. They can be obtained "over-the-counter" and may have less side effects compared to many synthetic drugs. Although most of the popular botanicals have a long history in folk medicine, there is paucity of data regarding their efficacy and safety, particularly as it relates to human studies. In this review, we discuss the data that was available in the literature for nine botanicals that are frequently promoted to help manage blood glucose. They are Bitter Melon (Momordica charantia), Fenugreek (trigonella foenum graecum), Gymnema Sylvestre, Ivy Gourd (Coccinia indica), Nopal or Prickly Pear Cactus (Opuntia streptacantha), Ginseng, Aloe Vera, Russian Tarragon (Artemisia dracunculus), and Garlic (Allium sativum). The discussion is emphasized on the clinical aspect of these botanicals. Due to the lack of sufficient evidence from clinical studies for any of the botanicals reviewed, it is premature to actively recommend use of any particular herb to treat either glucose or other risk factors. Thus, well defined randomized clinical trials are warranted in this area.

  15. Plantas medicinales en el tratamiento de la Diabetes Mellitus Tipo 2: una revisión

    Directory of Open Access Journals (Sweden)

    Gallego Muñoz C

    2015-12-01

    Full Text Available Objetivo: El objetivo de esta revisión es proporcionar a los farmacéuticos comunitarios información práctica para orientar a los pacientes con DM2 en tratamiento con plantas medicinales. Material y método: Se realizó una búsqueda exhaustiva de la literatura publicada en las principales bases de datos hasta el 31 de marzo de 2014. Las revisiones y estudios seleccionados fueron sometidos a lectura crítica y a la evaluación de su calidad metodológica. Resultados: Los pacientes, a menudo, solicitan asesoramiento farmacéutico para el empleo de estas plantas en el tratamiento de DM2; sin embargo, no existen estudios robustos que ayuden a los farmacéuticos a ofrecer consejos con fiabilidad. Los estudios existentes incluyen pocos pacientes, están mal diseñados y los resultados son heterogéneos. Conclusión: El fenogreco o alholva posee un efecto hipoglucemiante con una fuerte evidencia científica. También existe buena evidencia en el caso de ivy gourd y gymnema en el manejo de la hiperglucemia.

  16. Determination of Opiinae parasitoids (Hymenoptera: Braconidae) associated with crop infesting Bactrocera spp. (Diptera: Tephritidae) using COI and Cyt b sequences

    Science.gov (United States)

    Shariff, Safiah; Yaakop, Salmah; Zain, Badrul Munir Md.

    2013-11-01

    Members of the Opiinae subfamily (Hymenoptera: Braconidae) are well known as important parasitoids of fruit fly larvae (Diptera: Tephritidae). They are widely used as biological control agents of fruit flies, especially the Bactrocera Macquart species that infest fruits. In this study, the larvae of fruit flies were collected from infested crops including star fruit, guava, wax apple and ridge gourd. The parasitized larvae were then reared under laboratory conditions until emergence of the adult parasitoids. Additionally, Malaise trap also was used to collect parasitoid species. The general concept of the multiplex PCR has been performed is to amplify two mitochondrial DNA markers, namely cytochrome oxidase subunit I (COI) and cytochrome b (Cyt b) simultaneously. Therefore, the lengthy process of reaction will be reduced. The status of the fruit fly species has also been confirmed by using COI marker on the early stage of the larvae. Maximum parsimony (MP) and Bayesian Inference (BI) were implemented to help and support the identification of Opiinae species. The result obtained from this study showed three parasitoid genera of the Opiinae viz. Fopius Wharton, Psyttalia Walker and Diachasmimorpha Viereck. Each genus has been determined by clustering together in a similar clade according to their infested crops. Therefore, accurate determination of parasitoids and the fruit fries species was highly useful and necessary for successful biological control of Bactrocera species.

  17. Comparisons of dioxin levels of cucumber varieties and cultivation periods

    Energy Technology Data Exchange (ETDEWEB)

    Eun, H.; Watanabe, E.; Ishii, Y.; Ueji, M. [National Inst. for Agro-Environmental Sciences, Tsukuba (Japan); Narita, I.; Nakamura, K. [Saitama Prefecture Agriculture and Forestry Research Center, Saitama (Japan)

    2004-09-15

    According to a 2001 survey on Daily Intake in Japan, the total dioxins intake of a person in Japan amounts to 1.68 pg-TEQ per kg of body weight/day on average. The sharing a percentage of agricultural crops was about 3%in Japanese TDI amounts. However, all cases collect samples from supermarkets to estimate TDI of dioxins, which make it difficult to understand under what environment, food samples were pretreated and cultivated. Especially, TDI values in agricultural crops are probably dependent on the collection situation. In the agricultural environment, some reports indicate that dioxins have accumulated in paddy and upland in Japan due to the past use of some types of agricultural chemicals, which contained dioxins as impurities. Furthermore, taking the atmospheric pathway, for example, dioxins in the ambient air are associated with particulate matter and fall to the ground, contaminating agricultural land. Thus, it has been emphasized that dioxin compounds have a possibility to have adverse effect on vegetables. However, there is little understanding related to this fact in the country and worldwide. Empirical studies conducted in Japan and abroad have reported low residual concentrations of dioxins in cucumbers (Cucumis sativus L.), a member of the gourd family. However, there have been extremely few instances of research involving overall comparisons of cultivation environments. Thus, we studied the persistence of dioxins in cucumbers of different varieties cultivated outdoors over varying cultivation periods, conducting thorough experiments to elucidate the actual conditions and mechanisms of dioxin contamination of cucumbers.

  18. Controllable rotational inversion in nanostructures with dual chirality.

    Science.gov (United States)

    Dai, Lu; Zhu, Ka-Di; Shen, Wenzhong; Huang, Xiaojiang; Zhang, Li; Goriely, Alain

    2018-04-05

    Chiral structures play an important role in natural sciences due to their great variety and potential applications. A perversion connecting two helices with opposite chirality creates a dual-chirality helical structure. In this paper, we develop a novel model to explore quantitatively the mechanical behavior of normal, binormal and transversely isotropic helical structures with dual chirality and apply these ideas to known nanostructures. It is found that both direction and amplitude of rotation can be finely controlled by designing the cross-sectional shape. A peculiar rotational inversion of overwinding followed by unwinding, observed in some gourd and cucumber tendril perversions, not only exists in transversely isotropic dual-chirality helical nanobelts, but also in the binormal/normal ones when the cross-sectional aspect ratio is close to 1. Beyond this rotational inversion region, the binormal and normal dual-chirality helical nanobelts exhibit a fixed directional rotation of unwinding and overwinding, respectively. Moreover, in the binormal case, the rotation of these helical nanobelts is nearly linear, which is promising as a possible design for linear-to-rotary motion converters. The present work suggests new designs for nanoscale devices.

  19. Constraints to the possible alternatives from Arizona agriculture

    Energy Technology Data Exchange (ETDEWEB)

    Foster, K.E.

    1979-01-01

    The problems plaguing Arizona agriculture are outlined including the primary factors of declining groundwater supplies and increasing costs of energy to pump irrigation water. Two alternatives are suggested. The first alternative is to reduce or stabilize energy costs, an event that the authors acknowledge as being rather unlikely. Pumping costs using various fuels during the period 1891 to 1978 are reviewed. The second alternative involves developing cultivation techniques for drought-resistant plants native to arid regions, plants which have economic potential. Most of these plants would require little irrigation under cultivation and could substitute for cash crops being cultivated under heavy irrigation in Arizona. Four of these plants native to arid regions in the United States are discussed in some detail. Guayule (Parthenium argentatum) is a known rubber producer. Jojoba (Simmondsia chinensis) produces a liquid wax similar to the oil of the sperm whale, an endangered species. The gopher plant (Euphorbia lathyrus) is a potential producer of petrochemical feedstock for use as an energy source. Finally the buffalo gourd (Cucurbita foetidissima) is a possible source of food for both humans and livestock.

  20. Electrozymographic evaluation of the attenuation of arsenic induced degradation of hepatic SOD, catalase in an in vitro assay system by pectic polysaccharides of Momordica charantia in combination with curcumin

    Directory of Open Access Journals (Sweden)

    Hasina Perveen

    2017-09-01

    Full Text Available Momordica charantia (MC fruit known as bitter gourd, is of potential nutritional and medicinal value. The objectives of the present in vitro study were to evaluate the efficacy of bioactive pectic polysaccharides (CCPS of MC along with another well-known bioactive compound curcumin in the abrogation of hepatocellular oxidative stress persuaded by sodium arsenite. Electrozymographic method was developed for the assessment of superoxide dismutase (SOD and catalase activities of liver tissues maintained under an in vitro system. A significant association of CCPS of MC in combination with curcumin was found in the alleviation of oxidative stress induced by sodium arsenite in liver slice. Generated data pointed out that CCPS of MC and curcumin separately or in combination can offer significant protection against alterations in malondialdehyde (MDA, conjugated diene (CD and antioxidative defense (SOD, CAT markers. Furthermore, results of hepatic cell DNA degradation strongly supported that both these co-administrations have efficacy in preventing cellular damage. This is the first information of extracted polysaccharides from MC preventing arsenic induced damage in a liver slice of rat.

  1. Musical instruments of Brazilian capoeira: Historical roots, symbolism, and use

    Science.gov (United States)

    Ilari, Beatriz

    2002-11-01

    This paper describes the historical roots, symbolism, and uses of musical instruments in capoeira. A martial art form of Afro-Brazilian origin, capoeira is rhythmically performed to music in a roda (i.e., circle). Capoeira is at times defined as a martial art form disguised as dance because it is rooted in the struggles of African slaves. Elements of music, dance, fight, and ritual are part of this unique martial art form, which has two main styles: Angola and Regional. Capoeira styles are important as they determine rhythmic patterns, chant, movement, and musical instrumentation in a roda. The leading instrument in all capoeira styles is the berimbau. The instrument dictates the rhythm and movement of capoeira players in a roda (Ilari, 2001). Made out of a wooden stick, a wire, and a gourd and played with a stick and a coin, the berimbau is considered a sacred instrument due to its association with the cry of the slaves. Other instruments used in capoeira are pandeiros, agogo bells, reco-recos, and atabaques. A discussion regarding the use of these instruments within the context of capoeira will be presented at the conference. The incorporation of these instruments into contemporary Brazilian music will also be considered.

  2. Traditional Galactagogue Foods and Their Connection to Human Milk Volume in Thai Breastfeeding Mothers.

    Science.gov (United States)

    Buntuchai, Ganokwun; Pavadhgul, Patcharanee; Kittipichai, Wirin; Satheannoppakao, Warapone

    2017-08-01

    Thai traditional galactagogue consumption is still observed today. However, there are few scientific studies that describe this practice. Research aim: The aim of this study was to describe the connection between traditional galactagogue consumption and human milk volume. Self-reported maternal surveys ( N = 36) were conducted of mothers and their infants who breastfeed exclusively. The mothers were interviewed about traditional galactagogue consumption and intake of protein-rich foods using a semiquantitative food-frequency questionnaire. They were also assessed for energy and nutrient intake using the 24-hr dietary recall method. Their infants were between 1 and 3 months of age and were test weighed for 24 hr to measure their mother's own milk volume. Partial correlation was used to test the relationship between galactagogue consumption and milk volume by controlling the infants' birth weight, weight-for-age, maternal energy, and carbohydrate intake. The results revealed that consumption of some traditional galactagogues was significantly correlated to human milk volume, including banana flower, lemon basil, Thai basil, bottle gourd, and pumpkin ( p traditional galactagogues and proteins are associated with human milk volume. However, studies related to the active ingredients in these galactagogues are required to secure a recommendation about use of traditional galactagogues among breastfeeding mothers.

  3. Elemental analysis of fertilizers using X-ray fluorescence and their impact on alpha radioactivity of plants

    International Nuclear Information System (INIS)

    Pooja Chauhan; Chauhan, R.P.

    2013-01-01

    The fertilizers used for plantation contain different elements including some natural radionuclides with their daughter decay products. The radiological impact of the use of fertilizers may be due to internal irradiation of the lung by the alpha particles, short lived radon-thoron progeny and the external irradiation of the body by gamma ray emitted from the radionuclides. The aim of this study was to estimate the enhanced alpha radioactivity in different parts of plants due to fertilizers and to measure the concentration of different elements present in the fertilizers. A control study was carried out on round gourd plants using different fertilizers. Fertilizers were added to the soil just before the plantation of seeds in the pots. For the measurement of alpha track densities in different parts of plants we used α-sensitive LR-115 type II plastic track detectors. The alpha-track density (T cm -2 days -1 ) was measured in leaves of plants at different interval of time. The variation in alpha track densities was also observed in root, stem leaf and grain parts of the plants. In case of the plants grown using some phosphate fertilizers the alpha radioactivity was found to be more compared with others. A positive correlation between alpha track densities and mass exhalation rates of radon from different fertilizers has been observed. The concentration of major elements (Al, Si, P, S, Cl, K) along with other elements present in fertilizer samples was measured by X-ray fluorescence analysis. (author)

  4. Milk Production in the Sylvopastoral Zone of Senegal: Variation Factors and Local Populations’ Management System

    Directory of Open Access Journals (Sweden)

    A. T. Diop

    2009-01-01

    Full Text Available In the Sahelian region of Senegal, milk production in pastoral systems is subjected to inter- and intra-annual variations because the animal feed is almost exclusively based on natural resources. Studies conducted from a monitoring set-up in pastoralist settlements and in station, and data from Nestle Company have shown that milk production was highly related to the milk collection date, but with a low correlation with the total amount of rainfall. The relationship between total milk production and the normalized difference vegetation index (NDVI was polynomial. The production peak was reached when the water content in forage was 70%. Surveys on pastoralists (men and women belonging to different ethnic groups and living in different production subsystems (Walo, Djoloff and Ferlo showed that the duration of lactation, number of cows and animal species were the main factors of variation of milk production. The actors in charge of milk production management differed depending on the ethnic group. Milk curdling and butter making were the two preserving methods used, and five types of gourds were used in the process. Dairy products still held a major place in farmers’ incomes and skim milk curd was the most marketed product.

  5. Effect of planting density on fruit size, light-interception and photosynthetic activity of vertically trained watermelon (Citrullus lanatus (Thunb.) Matsum. et Nakai) plants

    International Nuclear Information System (INIS)

    Watanabe, S.; Nakano, Y.; Okano, K.

    2003-01-01

    Summary The effect of planting density on fruit size of vertically trained watermelon (Citrullus lanatus (Thunb.) Matsum. et Nakai) plants was investigated with regard to light - interception characteristics and photosynthetic production. Watermelon plants, grafted on bottle gourd, were grown in a glasshouse at different planting densities. Two vines per plant were allowed to grow and trained vertically. One hand-pollinated fruit per plant was set around the 15th node on either vine. The solar radiation and photosynthetic rate of individual leaves during fruit development period were determined by an integrated solarimeter film and a portable photosynthesis system, respectively. Fruit size was significantly decreased as the planting density increased, whereas soluble solids content of the fruits was affected little. The solar radiation and the photosynthetic rate of the individual leaves gradually decreased as the leaf position became lower at all planting densities on account of shading; those at lower leaves tended to decrease as the planting density increased. Fruit size was closely related to both the total solar radiation and the photosynthetic production per plant. In conclusion, the difference in fruit size among the planting densities is attributed to the photosynthetic productivity of the whole plant, which is mainly a function of the total solar radiation. This paper appears to be the first trial relating the influence of light interception and photosynthetic rates in high density plantings of vertically trained watermelon plants on fruit size

  6. Contamination level in vegetables grown around Peshawar using sewerage and canal water

    International Nuclear Information System (INIS)

    Mahmood, S.

    2001-01-01

    The level of contamination in vegetables grown around Peshawar using sewerage/canal water is reported. The vegetable samples were collected from three representative locations. The results indicated that vegetables grown with sewerage water contained higher levels of Cd, Cu and Pb than those with irrigation water. Maximum amount of Cd was in Qulfa (3.68 mu g/ g) followed by sponge gourd leaves (3.38 mu g/ g) the tomato leaves (93.32 mu g/ g). while Pb in tomato leaves (4.88 mu g / g), Cu content ranged between 2.08 and 7.5 mu g/g in these vegetables. In the vegetables grown with canal water the Cd ranged 0.82 - 2.88 mu g/g, Cu 2.38 mu g /g and Pb 0.84 - 1.88 mu g/ g. The concentration of Fe and P in the vegetables of sewerage water ranged 9.0-25.0 and 5.6-14.8 mg/100g respectively while those grown with canal water 9.0-11.0 mg/ 100 g and 8.4-12.8 mg/ 100 g respectively. (author)

  7. Subwavelength elastic joints connecting torsional waveguides to maximize the power transmission coefficient

    Science.gov (United States)

    Lee, Joong Seok; Lee, Il Kyu; Seung, Hong Min; Lee, Jun Kyu; Kim, Yoon Young

    2017-03-01

    Joints with slowly varying tapered shapes, such as linear or exponential profiles, are known to transmit incident wave power efficiently between two waveguides with dissimilar impedances. This statement is valid only when the considered joint length is longer than the wavelengths of the incident waves. When the joint length is shorter than the wavelengths, however, appropriate shapes of such subwavelength joints for efficient power transmission have not been explored much. In this work, considering one-dimensional torsional wave motion in a cylindrical elastic waveguide system, optimal shapes or radial profiles of a subwavelength joint maximizing the power transmission coefficient are designed by a gradient-based optimization formulation. The joint is divided into a number of thin disk elements using the transfer matrix approach and optimal radii of the disks are determined by iterative shape optimization processes for several single or bands of wavenumbers. Due to the subwavelength constraint, the optimized joint profiles were found to be considerably different from the slowly varying tapered shapes. Specifically, for bands of wavenumbers, peculiar gourd-like shapes were obtained as optimal shapes to maximize the power transmission coefficient. Numerical results from the proposed optimization formulation were also experimentally realized to verify the validity of the present designs.

  8. Molecular genetic studies of natives on Easter Island: evidence of an early European and Amerindian contribution to the Polynesian gene pool.

    Science.gov (United States)

    Lie, B A; Dupuy, B M; Spurkland, A; Fernández-Viña, M A; Hagelberg, E; Thorsby, E

    2007-01-01

    Most archaeological and linguistic evidence suggest a Polynesian origin of the population of Easter Island (Rapanui), and this view has been supported by the identification of Polynesian mitochondrial DNA (mtDNA) polymorphisms in prehistoric skeletal remains. However, some evidence of an early South American contact also exists (the sweet potato, bottle gourd etc.), but genetic studies have so far failed to show an early Amerindian contribution to the gene pool on Easter Island. To address this issue, we analyzed mtDNA and Y chromosome markers and performed high-resolution human leukocyte antigen (HLA) genotyping of DNA harvested from previously collected sera of 48 reputedly nonadmixed native Easter Islanders. All individuals carried mtDNA types and HLA alleles previously found in Polynesia, and most men carried Y chromosome markers of Polynesian origin, providing further evidence of a Polynesian origin of the population of Easter Island. A few individuals carried HLA alleles and/or Y chromosome markers of European origin. More interestingly, some individuals carried the HLA alleles A*0212 and B*3905, which are of typical Amerindian origin. The genealogy of some of the individuals carrying these non-Polynesian HLA alleles and their haplotypic backgrounds suggest an introduction into Easter Island in the early 1800s, or earlier. Thus, there may have been an early European and Amerindian contribution to the Polynesian gene pool of Easter Island.

  9. CONVEYOR OF VARIETIES OF PUMPKIN OF FEDERAL RESEARCH VEGETABLE CENTER (VNIISSOK SELECTION

    Directory of Open Access Journals (Sweden)

    G. A. Khimich

    2018-01-01

    Full Text Available Several early ripening pumpkin varieties adn hybrids with high yield and resistance to cold and diseases and high organoleptic properties were developed in Federal Scientific Vegetable Cencer. They are early, cold-resistant, yielding and resistant to a diseases and they have high taste and technological qualities of fruits. Most varieties of pumpkin need to fruit ripening to improve their taste. Lateripening varieties with long-term storage of fruits, until the end of November – early December, accumulate up to 10% of the amount of sugars. The timing of pumpering and storage of pumpkin fruits without loss of quality and taste indicators are individual for each variety and can vary greatly between each other. Gourds of a pumpkin of a dining room are shown as practically not requiring, and requiring in fruit ripening – from two weeks to two months. To a large extent, all varieties differ in terms of the shelf life of the fruit. Using these characteristics of varieties, even in the conditions of the Moscow region, you can create a continuous conveyor of consumption of pumpkin fruits. Recommendations are given on the timing of dosage and use of fruits of different varieties of pumpkin selection Federal Scientific Vegetable Center. 

  10. Antileukemic Potential of Momordica charantia Seed Extracts on Human Myeloid Leukemic HL60 Cells

    Directory of Open Access Journals (Sweden)

    Ramani Soundararajan

    2012-01-01

    Full Text Available Momordica charantia (bitter gourd has been used in the traditional system of medicine for the treatment of various diseases. Anticancer activity of M. charantia extracts has been demonstrated by numerous in vitro and in vivo studies. In the present study, we investigated the differentiation inducing potential of fractionated M. charantia seed extracts in human myeloid HL60 cells. We found that the HL60 cells treated with the fractionated seed extracts differentiated into granulocytic lineage as characterized by NBT staining, CD11b expression, and specific esterase activity. The differentiation inducing principle was found to be heat-stable, and organic in nature. The differentiation was accompanied by a downregulation of c-myc transcript, indicating the involvement of c-myc pathway, at least in part, in differentiation. Taken together these results indicate that fractionated extracts of M. charantia seeds possess differentiation inducing activity and therefore can be evaluated for their potential use in differentiation therapy for leukemia in combination with other inducers of differentiation.

  11. Antidiabetic effects of Momordica charantia (bitter melon) and its medicinal potency

    Science.gov (United States)

    Joseph, Baby; Jini, D

    2013-01-01

    Diabetes mellitus is among the most common disorder in developed and developing countries, and the disease is increasing rapidly in most parts of the world. It has been estimated that up to one-third of patients with diabetes mellitus use some form of complementary and alternative medicine. One plant that has received the most attention for its anti-diabetic properties is bitter melon, Momordica charantia (M. charantia), commonly referred to as bitter gourd, karela and balsam pear. Its fruit is also used for the treatment of diabetes and related conditions amongst the indigenous populations of Asia, South America, India and East Africa. Abundant pre-clinical studies have documented in the anti-diabetic and hypoglycaemic effects of M. charantia through various postulated mechanisms. However, clinical trial data with human subjects are limited and flawed by poor study design and low statistical power. The present review is an attempt to highlight the antidiabetic activity as well as phytochemical and pharmacological reports on M. charantia and calls for better-designed clinical trials to further elucidate its possible therapeutic effects on diabetes.

  12. Hypoglycemic and hypolipidemic effects of Lactobacillus fermentum, fruit extracts of Syzygium cumini and Momordica charantia on diabetes induced mice.

    Science.gov (United States)

    Yousaf, Sehar; Hussain, Abid; Rehman, Shafiqur; Aslam, Muhammad Shahbaz; Abbas, Zaigham

    2016-09-01

    A lot of treatment strategies available for diabetes but its complications are still a medical problem around the globe. It demands to find out some alternative therapeutic measures. In order to investigate the anti-diabetic potential of probiotics and natural extracts, this study was designed. Accordingly, a local source of yogurt probiotic strain Lactobacillus fermentum was isolated and characterized that showed its probiotic properties. Besides this, natural extracts of plants fruits like java plum (Syzygium cumini) and bitter gourd (M. charantia) were made. Lactobacillus fermentum and the extracts were administered individually as well as in combination to diabetes induced mice. Different parameters like body weight, blood glucose level and lipid profile including total cholesterol, HDL & LDL were analyzed before and after treatment. The results showed that Lactobacillus fermentum and natural extracts have hypoglycemic as well hypolipidemic activity against diabetic mice. This study can further investigated to screen potential compounds from these extracts to control the glucose and the lipid levels in diabetic patients.

  13. Antidiabetic effects of Momordica charantia (bitter melon and its medicinal potency

    Directory of Open Access Journals (Sweden)

    Baby Joseph

    2013-04-01

    Full Text Available Diabetes mellitus is among the most common disorder in developed and developing countries, and the disease is increasing rapidly in most parts of the world. It has been estimated that up to one-third of patients with diabetes mellitus use some form of complementary and alternative medicine. One plant that has received the most attention for its anti-diabetic properties is bitter melon, Momordica charantia (M. charantia, commonly referred to as bitter gourd, karela and balsam pear. Its fruit is also used for the treatment of diabetes and related conditions amongst the indigenous populations of Asia, South America, India and East Africa. Abundant pre-clinical studies have documented in the anti-diabetic and hypoglycaemic effects of M. charantia through various postulated mechanisms. However, clinical trial data with human subjects are limited and flawed by poor study design and low statistical power. The present review is an attempt to highlight the antidiabetic activity as well as phytochemical and pharmacological reports on M. charantia and calls for better-designed clinical trials to further elucidate its possible therapeutic effects on diabetes.

  14. Geographical distribution of myrothecium leaf spot disease of momordica charantial L. caused by myrothecium roridum tode in agro-ecological zone of punjab, Pakistan

    International Nuclear Information System (INIS)

    Din, G. M.; Farooq, S.; Khan, S. N.; Imani, J.; Naz, S.

    2017-01-01

    A series of field surveys were carried out during July-October 2012-14 for the development of disease distribution map and updating the index of Myrothecium leaf spot of Momordica charantia (Bitter gourd) in Punjab province. A total of 29 districts were surveyed belonging to 9 sub agro ecological zones of Punjab. The index was calculated on the basis of incidence, prevalence and severity of the disease. The information from stakeholders was gathered through field scouting, formal and informal discussions. Data on socioeconomics was collected by a structured questionnaire. The symptomatic plants and soil specimens were collected form diseased field and transferred to lab for onward studies on host-pathogen characterization and management. Infection development on the plant was investigated on a (0-5) visual severity rating scale. Fungus was isolated, identified on morphological and molecular characteristics as Myrothecium roridum and cultures were deposited to First Fungal Culture Bank of Pakistan (Accession No. FCBP 1155) and Leibniz-institut DSMZ-Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH, Germany (Accession No. DSM 28971). Data gathered highlighted dominance of the disease in mixed cropping zone of Punjab province. Highest disease index (31%) was recorded in mixed cropping zone and lowest (3%) in D.G khan zone. However its severity may vary due to adopted cultural and chemical practices by individual farmers. The investigations strengthen the involvement of irrigation technique, soil type and cropping history in introduction and sporadic occurrence of the disease. (author)

  15. Antileukemic Potential of Momordica charantia Seed Extracts on Human Myeloid Leukemic HL60 Cells

    Science.gov (United States)

    Soundararajan, Ramani; Prabha, Punit; Rai, Umesh; Dixit, Aparna

    2012-01-01

    Momordica charantia (bitter gourd) has been used in the traditional system of medicine for the treatment of various diseases. Anticancer activity of M. charantia extracts has been demonstrated by numerous in vitro and in vivo studies. In the present study, we investigated the differentiation inducing potential of fractionated M. charantia seed extracts in human myeloid HL60 cells. We found that the HL60 cells treated with the fractionated seed extracts differentiated into granulocytic lineage as characterized by NBT staining, CD11b expression, and specific esterase activity. The differentiation inducing principle was found to be heat-stable, and organic in nature. The differentiation was accompanied by a downregulation of c-myc transcript, indicating the involvement of c-myc pathway, at least in part, in differentiation. Taken together these results indicate that fractionated extracts of M. charantia seeds possess differentiation inducing activity and therefore can be evaluated for their potential use in differentiation therapy for leukemia in combination with other inducers of differentiation. PMID:22654956

  16. RNase MC2: a new Momordica charantia ribonuclease that induces apoptosis in breast cancer cells associated with activation of MAPKs and induction of caspase pathways.

    Science.gov (United States)

    Fang, Evandro Fei; Zhang, Chris Zhi Yi; Fong, Wing Ping; Ng, Tzi Bun

    2012-04-01

    Ribonucleases (RNases) are ubiquitously distributed nucleases that cleave RNA into smaller pieces. They are promising drugs for different cancers based on their concrete antitumor activities in vitro and in vivo. Here we report for the first time purification and characterization of a 14-kDa RNase, designated as RNase MC2, in the seeds of bitter gourd (Momordica charantia). RNase MC2 manifested potent RNA-cleavage activity toward baker's yeast tRNA, tumor cell rRNA, and an absolute specificity for uridine. RNase MC2 demonstrated both cytostatic and cytotoxic activities against MCF-7 breast cancer cells. Treatment of MCF-7 cells with RNase MC2 caused nuclear damage (karyorrhexis, chromatin condensation, and DNA fragmentation), ultimately resulting in early/late apoptosis. Further molecular studies unveiled that RNase MC2 induced differential activation of MAPKs (p38, JNK and ERK) and Akt. On the other hand, RNase MC2 exposure activated caspase-8, caspase-9, caspase-7, increased the production of Bak and cleaved PARP, which in turn contributed to the apoptotic response. In conclusion, RNase MC2 is a potential agent which can be exploited in the worldwide fight against breast cancer.

  17. Comprehensive Evaluation of Anti-hyperglycemic Activity of Fractionated Momordica charantia Seed Extract in Alloxan-Induced Diabetic Rats

    Directory of Open Access Journals (Sweden)

    Shailesh Kumar Choudhary

    2012-01-01

    Full Text Available The present study evaluates anti-hyperglycemic activity of fractionated Momordica charantia (bitter gourd seed extracts. Fasting blood glucose levels were evaluated before and after administration of different fractions of the seed extract. Among the three fractions tested, fraction Mc-3 (15 mg/kg b.wt. showed the maximum anti-hyperglycemic activity and reduced blood glucose levels in experimental diabetic rats significantly. The activities of the key regulatory enzymes of glucose metabolism (hexokinase, pyruvate kinase, lactate dehydrogenase, and glucose-6-phosphate dehydrogenase were determined in Mc-3-treated diabetic animals. Once-daily administration of the fraction Mc-3 for prolonged period of 18 days to the experimental diabetic animals did not result in any nephrotoxicity or hepatotoxicity as evident from insignificant changes in biochemical parameters indicative of liver and kidney functions. Further fractionation of the fraction Mc-3 by size exclusion chromatography resulted in a fraction, designated Mc-3.2, possessing anti-hyperglycemic activity. The fraction Mc-3.2 showed the presence of a predominant protein band of ~11 kDa on SDS-PAGE. Loss in anti-hyperglycemic activity of the Mc-3.2 upon protease treatment indicates the proteinaceous nature of the anti-hyperglycemic principles. Overall, the results suggest that Momordica charantia seeds contain an effective anti-hyperglycemic protein(s which may find application in treatment of diabetes without evident toxic effects.

  18. Emerging Trends On Drug Delivery Strategy of Momordica charantia against Diabetes and its Complications.

    Science.gov (United States)

    Thent, Zar Chi; Das, Srijit; Zaidun, Nurul Hannim

    2018-01-01

    The incidence of diabetes mellitus has increased drastically over the past few decades. This oxidant-antioxidant imbalance resulting in complication of diabetes mellitus includes macro- and microvascular complications. Resistance to conventional treatment and patient compliance has paved the way to the usage of effective natural products and supplements. Momordica charantia (bitter gourd) is widely consumed in many parts of Malaysia as a vegetable. Momordica charantia (MC) is mainly used in the management of diabetes mellitus. The present review discusses the literature concerning the antidiabetic and antioxidant properties of MC focusing on the complication of diabetes mellitus along with its mode of delivery. We found that among the whole part of MC, its fruit extract has been widely studied, therapeutically. The evidence based analysis of the beneficiary effects of MC on the different organs involved in diabetes complication is also highlighted. This review elucidated an essential understanding of MC based drug delivery system in both clinical and experimental studies and appraised the great potential of the protein based MC extract against diabetes mellitus. The review paper is believed to assist the researchers and medical personnel in treating diabetic associated complications. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

  19. Distribution patterns of flavonoids from three Momordica species by ultra-high performance liquid chromatography quadrupole time of flight mass spectrometry: a metabolomic profiling approach

    Directory of Open Access Journals (Sweden)

    Ntakadzeni Edwin Madala

    Full Text Available ABSTRACT Plants from the Momordica genus, Curcubitaceae, are used for several purposes, especially for their nutritional and medicinal properties. Commonly known as bitter gourds, melon and cucumber, these plants are characterized by a bitter taste owing to the large content of cucurbitacin compounds. However, several reports have shown an undisputed correlation between the therapeutic activities and polyphenolic flavonoid content. Using ultra-high performance liquid chromatography quadrupole time of flight mass spectrometry in combination with multivariate data models such as principal component analysis and hierarchical cluster analysis, three Momordica species (M. foetida Schumach., M. charantia L. and M. balsamina L. were chemo-taxonomically grouped based on their flavonoid content. Using a conventional mass spectrometric-based approach, thirteen flavonoids were tentatively identified and the three species were found to contain different isomers of the quercetin-, kaempferol- and isorhamnetin-O-glycosides. Our results indicate that Momordica species are overall very rich sources of flavonoids but do contain different forms thereof. Furthermore, to the best of our knowledge, this is a first report on the flavonoid content of M. balsamina L.

  20. Identification of evolutionarily conserved Momordica charantia microRNAs using computational approach and its utility in phylogeny analysis.

    Science.gov (United States)

    Thirugnanasambantham, Krishnaraj; Saravanan, Subramanian; Karikalan, Kulandaivelu; Bharanidharan, Rajaraman; Lalitha, Perumal; Ilango, S; HairulIslam, Villianur Ibrahim

    2015-10-01

    Momordica charantia (bitter gourd, bitter melon) is a monoecious Cucurbitaceae with anti-oxidant, anti-microbial, anti-viral and anti-diabetic potential. Molecular studies on this economically valuable plant are very essential to understand its phylogeny and evolution. MicroRNAs (miRNAs) are conserved, small, non-coding RNA with ability to regulate gene expression by bind the 3' UTR region of target mRNA and are evolved at different rates in different plant species. In this study we have utilized homology based computational approach and identified 27 mature miRNAs for the first time from this bio-medically important plant. The phylogenetic tree developed from binary data derived from the data on presence/absence of the identified miRNAs were noticed to be uncertain and biased. Most of the identified miRNAs were highly conserved among the plant species and sequence based phylogeny analysis of miRNAs resolved the above difficulties in phylogeny approach using miRNA. Predicted gene targets of the identified miRNAs revealed their importance in regulation of plant developmental process. Reported miRNAs held sequence conservation in mature miRNAs and the detailed phylogeny analysis of pre-miRNA sequences revealed genus specific segregation of clusters. Copyright © 2015 Elsevier Ltd. All rights reserved.

  1. Comprehensive Evaluation of Anti-hyperglycemic Activity of Fractionated Momordica charantia Seed Extract in Alloxan-Induced Diabetic Rats

    Science.gov (United States)

    Choudhary, Shailesh Kumar; Chhabra, Gagan; Sharma, Dipali; Vashishta, Aruna; Ohri, Sujata; Dixit, Aparna

    2012-01-01

    The present study evaluates anti-hyperglycemic activity of fractionated Momordica charantia (bitter gourd) seed extracts. Fasting blood glucose levels were evaluated before and after administration of different fractions of the seed extract. Among the three fractions tested, fraction Mc-3 (15 mg/kg b.wt.) showed the maximum anti-hyperglycemic activity and reduced blood glucose levels in experimental diabetic rats significantly. The activities of the key regulatory enzymes of glucose metabolism (hexokinase, pyruvate kinase, lactate dehydrogenase, and glucose-6-phosphate dehydrogenase) were determined in Mc-3-treated diabetic animals. Once-daily administration of the fraction Mc-3 for prolonged period of 18 days to the experimental diabetic animals did not result in any nephrotoxicity or hepatotoxicity as evident from insignificant changes in biochemical parameters indicative of liver and kidney functions. Further fractionation of the fraction Mc-3 by size exclusion chromatography resulted in a fraction, designated Mc-3.2, possessing anti-hyperglycemic activity. The fraction Mc-3.2 showed the presence of a predominant protein band of ~11 kDa on SDS-PAGE. Loss in anti-hyperglycemic activity of the Mc-3.2 upon protease treatment indicates the proteinaceous nature of the anti-hyperglycemic principles. Overall, the results suggest that Momordica charantia seeds contain an effective anti-hyperglycemic protein(s) which may find application in treatment of diabetes without evident toxic effects. PMID:23320026

  2. Ecological restoration alters microbial communities in mine tailings profiles.

    Science.gov (United States)

    Li, Yang; Jia, Zhongjun; Sun, Qingye; Zhan, Jing; Yang, Yang; Wang, Dan

    2016-04-29

    Ecological restoration of mine tailings have impact on soil physiochemical properties and microbial communities. The surface soil has been a primary concern in the past decades, however it remains poorly understood about the adaptive response of microbial communities along the profile during ecological restoration of the tailings. In this study, microbial communities along a 60-cm profile were investigated in a mine tailing pond during ecological restoration of the bare waste tailings (BW) with two vegetated soils of Imperata cylindrica (IC) and Chrysopogon zizanioides (CZ) plants. Revegetation of both IC and CZ could retard soil degradation of mine tailing by stimulation of soil pH at 0-30 cm soils and altered the bacterial communities at 0-20 cm depths of the mine tailings. Significant differences existed in the relative abundance of the phyla Alphaproteobacteria, Deltaproteobacteria, Acidobacteria, Firmicutes and Nitrospira. Slight difference of bacterial communities were found at 30-60 cm depths of mine tailings. Abundance and activity analysis of nifH genes also explained the elevated soil nitrogen contents at the surface 0-20 cm of the vegetated soils. These results suggest that microbial succession occurred primarily at surface tailings and vegetation of pioneering plants might have promoted ecological restoration of mine tailings.

  3. Allelochemicals Produced by Brown Macroalgae of the Lobophora Genus Are Active against Coral Larvae and Associated Bacteria, Supporting Pathogenic Shifts to Vibrio Dominance.

    Science.gov (United States)

    Morrow, Kathleen M; Bromhall, Katrina; Motti, Cherie A; Munn, Colin B; Bourne, David G

    2017-01-01

    Pervasive environmental stressors on coral reefs are attributed with shifting the competitive balance in favor of alternative dominants, such as macroalgae. Previous studies have demonstrated that macroalgae compete with corals via a number of mechanisms, including the production of potent primary and secondary metabolites that can influence coral-associated microbial communities. The present study investigates the effects of the Pacific brown macroalga Lobophora sp. (due to the shifting nature of the Lobophora species complex, it will be referred to here as Lobophora sp.) on coral bacterial isolates, coral larvae, and the microbiome associated with the coral Porites cylindrica. Crude aqueous and organic macroalgal extracts were found to inhibit the growth of coral-associated bacteria. Extracts and fractions were also shown to inhibit coral larval settlement and cause mortality at concentrations lower (pathogenic. Macroalgae (e.g., seaweeds) can physically and chemically interact with corals, causing abrasion, bleaching, and overall stress. This study contributes to a growing body of evidence suggesting that macroalgae play a critical role in shifting the coral holobiont equilibrium, which may promote the invasion of opportunistic pathogens and cause coral mortality, facilitating additional macroalgal growth and invasion in the reef. Thus, macroalgae not only contribute to a decline in coral fitness but also influence coral reef ecosystem structure. © Crown copyright 2016.

  4. The effects of habitat on coral bleaching responses in Kenya.

    Science.gov (United States)

    Grimsditch, Gabriel; Mwaura, Jelvas M; Kilonzo, Joseph; Amiyo, Nassir

    2010-06-01

    This study examines the bleaching responses of scleractinian corals at four sites in Kenya (Kanamai, Vipingo, Mombasa and Nyali) representing two distinct lagoon habitats (relatively shallow and relatively deep). Bleaching incidence was monitored for the whole coral community, while zooxanthellae densities and chlorophyll levels were monitored for target species (Pocillopora damicornis, Porites lutea, and Porites cylindrica) during a non-bleaching year (2006) and a year of mild-bleaching (2007). Differences in bleaching responses between habitats were observed, with shallower sites Kanamai and Vipingo exhibiting lower bleaching incidence than deeper sites Nyali and Mombasa. These shallower lagoons display more fluctuating thermal and light environments than the deeper sites, suggesting that corals in the shallower lagoons have acclimatized and/or adapted to the fluctuating environmental conditions they endure on a daily basis and have become more resistant to bleaching stress. In deeper sites that did exhibit higher bleaching (Mombasa and Nyali), it was found that coral recovery occurred more quickly in the protected area than in the non-protected area.

  5. A novel method for the transport and analysis of genetic material from polyps and zooxanthellae of scleractinian corals.

    Science.gov (United States)

    Crabbe, M James C

    2003-08-29

    We have developed a new simple method for transport, storage, and analysis of genetic material from the corals Agaricia agaricites, Dendrogyra cylindrica, Eusmilia ancora, Meandrina meandrites, Montastrea annularis, Porites astreoides, Porites furcata, Porites porites, and Siderastrea siderea at room temperature. All species yielded sufficient DNA from a single FTA card (19 microg-43 ng) for subsequent PCR amplification of both coral and zooxanthellar DNA. The D1 and D2 variable region of the large subunit rRNA gene (LSUrDNA) was amplified from the DNA of P. furcata and S. siderea by PCR. Electrophoresis yielded two major DNA bands: an 800-base pair (bp) DNA, which represented the coral ribosomal RNA (rRNA) gene, and a 600-bp DNA, which represented the zooxanthellar srRNA gene. Extraction of DNA from the bands yielded between 290 microg total DNA (S. siderea coral DNA) and 9 microg total DNA (P. furcata zooxanthellar DNA). The ability to transport and store genetic material from scleractinian corals without resort to laboratory facilities in the field allows for the molecular study of a far wider range and variety of coral sites than have been studied to date.

  6. Characterization of Co-Cultivation of Cyanobacteria on Growth, Productions of Polysaccharides and Extracellular Proteins, Nitrogenase Activity, and Photosynthetic Activity.

    Science.gov (United States)

    Xue, Chuizhao; Wang, Libo; Wu, Tong; Zhang, Shiping; Tang, Tao; Wang, Liang; Zhao, Quanyu; Sun, Yuhan

    2017-01-01

    Cyanobacteria as biofertilizers are benefit to reduce the use of chemical fertilizers and reestablish the ecological system in soil. In general, several strains of cyanobacteria were involved in the biofertilizers. The co-cultivation of cyanobacteria were characterized on growth profile, production of polysaccharides and extracellular proteins, nitrogenase activity, and photosynthetic activity for three selected N 2 -fixing cyanobacteria, Anabaena cylindrica (B1611 and F243) and Nostoc sp. (F280). After eight-day culture, the highest dry weights were obtained in F280 pure culture and co-cultivation of B1611 and F280. Higher production of extracellular proteins and cell-bonding polysaccharides (CPS) were observed in co-cultivations compared with pure culture. The highest released polysaccharides (RPS) contents were obtained in pure culture of F280 and co-cultivation of F280 and F243. Galactose and glucose were major components of CPS and RPS in all samples. Trehalose was a specific component of RPS in F280 pure culture. Based on the monosaccharide contents of CPS and RPS, F280 was the dominant species in the related treatments of co-cultivation. The nitrogenase activities in all treatments exhibited a sharp rise at the late stage while a significant decrease existed when three cyanobacteria strains were mixed. Photosynthetic activities for all treatments were determined with rapid light curve, and the related parameters were estimated.

  7. Antifungal compounds from cyanobacteria.

    Science.gov (United States)

    Shishido, Tânia K; Humisto, Anu; Jokela, Jouni; Liu, Liwei; Wahlsten, Matti; Tamrakar, Anisha; Fewer, David P; Permi, Perttu; Andreote, Ana P D; Fiore, Marli F; Sivonen, Kaarina

    2015-04-13

    Cyanobacteria are photosynthetic prokaryotes found in a range of environments. They are infamous for the production of toxins, as well as bioactive compounds, which exhibit anticancer, antimicrobial and protease inhibition activities. Cyanobacteria produce a broad range of antifungals belonging to structural classes, such as peptides, polyketides and alkaloids. Here, we tested cyanobacteria from a wide variety of environments for antifungal activity. The potent antifungal macrolide scytophycin was detected in Anabaena sp. HAN21/1, Anabaena cf. cylindrica PH133, Nostoc sp. HAN11/1 and Scytonema sp. HAN3/2. To our knowledge, this is the first description of Anabaena strains that produce scytophycins. We detected antifungal glycolipopeptide hassallidin production in Anabaena spp. BIR JV1 and HAN7/1 and in Nostoc spp. 6sf Calc and CENA 219. These strains were isolated from brackish and freshwater samples collected in Brazil, the Czech Republic and Finland. In addition, three cyanobacterial strains, Fischerella sp. CENA 298, Scytonema hofmanni PCC 7110 and Nostoc sp. N107.3, produced unidentified antifungal compounds that warrant further characterization. Interestingly, all of the strains shown to produce antifungal compounds in this study belong to Nostocales or Stigonematales cyanobacterial orders.

  8. Protozoa in a stressed area of the Egyptian Mediterranean coast of Damietta, Egypt

    Directory of Open Access Journals (Sweden)

    Mohamed Moussa Dorgham

    2013-08-01

    Full Text Available The Damietta coast is part of the Egyptian Mediterranean coast off the Nile Delta and has recently been polluted as a result of intensive human activities.The environmental parameters and protozoan community in the area were studied biweekly from January to December 2007. The results of the environmentalparameters indicated low salinity, oxic and anoxic conditions, high nutrient levels and intensive phytoplankton growth. A total of 69 protozoan specieswere identified, belonging to Amoebozoa (8 species, Foraminifera (12 species, non-tintinnid ciliates (22 species and tintinnids (27 species. The numerical density of protozoans was high over the whole area, with annual averages between 8.2 × 103 cells m-3 and 51.4 × 103 cells m-3.Spring was the most productive season for protozoans, but several distinct peaks were observed during the year at the sampling sites. The protozoangroups showed clearly different spatial patterns in both composition and abundance: whereas amoebozoans and non-tintinnid ciliates were dominant in themore polluted areas (sites IV and V, tintinnids dominated in the less polluted areas (sites, I, II and III. Several pollution indicators wererecorded: amoebozoans - Centropyxis aculeata, Centropyxis sp., Cochliopodium sp.,Difflugia sp.; non-tintinnids - Bursaridium sp., Frontonia atra,Holophrya sp., Paramecium sp., Paramecium bursaria,Vasicola ciliata, Vorticella sp., Strombidium sp.; tintinnids- Favella ehrenbergii, Helicostomella subulata, Leprotintinnus nordgvisti,Tintinnopsis beroidea, Stenosemella ventricosa, Tintinnopsis campanula,T. cylindrica, T. lobiancoi, Eutintinnus lusus-undae.

  9. Upwelling dynamics in the Baltic Sea studied by a combined SAR/infrared satellite data and circulation model analysis

    Directory of Open Access Journals (Sweden)

    Evgenia Gurova

    2013-08-01

    Full Text Available The Damietta coast is part of the Egyptian Mediterranean coast off the Nile Delta and has recently been polluted as a result of intensive human activities.The environmental parameters and protozoan community in the area were studied biweekly from January to December 2007. The results of the environmentalparameters indicated low salinity, oxic and anoxic conditions, high nutrient levels and intensive phytoplankton growth. A total of 69 protozoan specieswere identified, belonging to Amoebozoa (8 species, Foraminifera (12 species, non-tintinnid ciliates (22 species and tintinnids (27 species. The numerical density of protozoans was high over the whole area, with annual averages between 8.2 × 103 cells m-3 and 51.4 × 103 cells m-3.Spring was the most productive season for protozoans, but several distinct peaks were observed during the year at the sampling sites. The protozoangroups showed clearly different spatial patterns in both composition and abundance: whereas amoebozoans and non-tintinnid ciliates were dominant in themore polluted areas (sites IV and V, tintinnids dominated in the less polluted areas (sites, I, II and III. Several pollution indicators wererecorded: amoebozoans - Centropyxis aculeata, Centropyxis sp., Cochliopodium sp.,Difflugia sp.; non-tintinnids - Bursaridium sp., Frontonia atra,Holophrya sp., Paramecium sp., Paramecium bursaria,Vasicola ciliata, Vorticella sp., Strombidium sp.; tintinnids- Favella ehrenbergii, Helicostomella subulata, Leprotintinnus nordgvisti,Tintinnopsis beroidea, Stenosemella ventricosa, Tintinnopsis campanula,T. cylindrica, T. lobiancoi, Eutintinnus lusus-undae.

  10. Identification of the protective effects of traditional medicinal plants against SDS-induced Drosophila gut damage.

    Science.gov (United States)

    Zhou, Yang; Liu, Zonglin; Chen, Yuchen; Jin, Li Hua

    2016-10-01

    Traditional medicinal plants are widely used as immunomodulatory medicines that help improve health. A total of 50 different plants used for the treatment of toxicity were screened for their in vivo protective effects. Flies were fed a standard cornmeal-yeast medium (control group) or the standard medium containing medicinal plant extracts (experimental groups). Assessment of the survival rate was performed by feeding flies with toxic compounds. Gut epithelial cells were analyzed for cell proliferation and death by green fluorescent protein antibodies and 7-aminoactinomycin D staining under the microscope. The expression of antimicrobial peptides (AMPs) was evaluated by the quantitative polymerase chain reaction and the results revealed that after feeding the flies with toxic compounds, aqueous extracts from Codonopsis pilosula (Franch.) Nannf ( C. pilosula ), Saussurea lappa (Decne.) C.B.Clarke ( S. lappa ), Imperata cylindrica Beauv.var. major (Nees) C.E. Hubb. ( I. cylindrical var. major ) and Melia toosendan Sied. Et Zucc. ( M.toosendan ) increased the fly survival rate, reduced epithelial cell death and improved gut morphology. In addition, C. pilosula extracts induced the antimicrobial peptide levels (Dpt and Mtk) following treatment with sodium dodecyl sulfate (SDS). However, these extracts were not observed to increase SDS-induced cell proliferation in vivo . These results indicate that there are strong protective effects in extracts of C. pilosula , S. lappa , I. cylindrical var. major and M. toosendan on Drosophila intestinal cells among 50 medicinal plants.

  11. Antifungal Compounds from Cyanobacteria

    Directory of Open Access Journals (Sweden)

    Tânia K. Shishido

    2015-04-01

    Full Text Available Cyanobacteria are photosynthetic prokaryotes found in a range of environments. They are infamous for the production of toxins, as well as bioactive compounds, which exhibit anticancer, antimicrobial and protease inhibition activities. Cyanobacteria produce a broad range of antifungals belonging to structural classes, such as peptides, polyketides and alkaloids. Here, we tested cyanobacteria from a wide variety of environments for antifungal activity. The potent antifungal macrolide scytophycin was detected in Anabaena sp. HAN21/1, Anabaena cf. cylindrica PH133, Nostoc sp. HAN11/1 and Scytonema sp. HAN3/2. To our knowledge, this is the first description of Anabaena strains that produce scytophycins. We detected antifungal glycolipopeptide hassallidin production in Anabaena spp. BIR JV1 and HAN7/1 and in Nostoc spp. 6sf Calc and CENA 219. These strains were isolated from brackish and freshwater samples collected in Brazil, the Czech Republic and Finland. In addition, three cyanobacterial strains, Fischerella sp. CENA 298, Scytonema hofmanni PCC 7110 and Nostoc sp. N107.3, produced unidentified antifungal compounds that warrant further characterization. Interestingly, all of the strains shown to produce antifungal compounds in this study belong to Nostocales or Stigonematales cyanobacterial orders.

  12. Gametocidal genes of Aegilops: segregation distorters in wheat-Aegilops wide hybridization.

    Science.gov (United States)

    Niranjana, M

    2017-08-01

    Aegilops is a genus belonging to the family Poaceace, which have played an indispensible role in the evolution of bread wheat and continues to do so by transferring genes by wide hybridization. Being the secondary gene pool of wheat, gene transfer from Aegilops poses difficulties and segregation distortion is common. Gametocidal genes are the most well characterized class of segregation distorters reported in interspecific crosses of wheat with Aegilops. These "selfish" genetic elements ensure their preferential transmission to progeny at the cost of gametes lacking them without providing any phenotypic benefits to the plant, thereby causing a proportional reduction in fertility. Gametocidal genes (Gc) have been reported in different species of Aegilops belonging to the sections Aegilops (Ae. geniculata and Ae. triuncialis), Cylindropyrum (Ae. caudata and Ae. cylindrica), and Sitopsis (Ae. longissima, Ae. sharonensis, and Ae. speltoides). Gametocidal activity is mostly confined to 2, 3, and 4 homeologous groups of C, S, S 1 , S sh , and M g genomes. Removal of such genes is necessary for successful alien gene introgression and can be achieved by mutagenesis or allosyndetic pairing. However, there are some instances where Gc genes are constructively utilized for development of deletion stocks in wheat, improving genetic variability and chromosome engineering.

  13. Intraspecific variations in responses to ocean acidification in two branching coral species.

    Science.gov (United States)

    Sekizawa, Ayami; Uechi, Hikaru; Iguchi, Akira; Nakamura, Takashi; Kumagai, Naoki H; Suzuki, Atsushi; Sakai, Kazuhiko; Nojiri, Yukihiro

    2017-09-15

    Ocean acidification is widely recognised to have a negative impact on marine calcifying organisms by reducing calcifications, but controversy remains over whether such organisms could cope with ocean acidification within a range of phenotypic plasticity and/or adapt to future acidifying ocean. We performed a laboratory rearing experiment using clonal fragments of the common branching corals Montipora digitata and Porites cylindrica under control and acidified seawater (lower pH) conditions (approximately 400 and 900μatm pCO 2 , respectively) and evaluated the intraspecific variations in their responses to ocean acidification. Intra- and interspecific variations in calcification and photosynthetic efficiency were evident according to both pCO 2 conditions and colony, indicating that responses to acidification may be individually variable at the colony level. Our results suggest that some corals may cope with ocean acidification within their present genotypic composition by adaptation through phenotypic plasticity, while others may be placed under selective pressures resulting in population alteration. Copyright © 2017 Elsevier Ltd. All rights reserved.

  14. KEANEKARAGAMAN VEGETASI DAN PROFIL HABITAT DI TAMAN KEHATI UNIVERSITAS NEGERI SEMARANG

    Directory of Open Access Journals (Sweden)

    Bambang Priyono

    2014-02-01

    Full Text Available Taman Kehati Unnes merupakan salah satu kawasan yang dirancang sebagai kawasan konservasi tanaman lokal Jawa Tengah.Penelitian tahun sebelumnya telah dilakukan analisis keanekaragaman jenis fauna di Taman Kehati Unnes. Penelitian sebelumnya (2013 menunjukan di Taman Kehati Unnes tercatat sebanyak 24 jenisburung, 63 jenis kupu-kupu, dan 26 jenis herpetofauna (amfibi dan reptil berhasil diidentifikasi. Keanekaragaman fauna juga ditentukan oleh kondisi habitatnya, oleh karena itu tujuan penelitian ini adalah melakukan analisis profil habitat. Pengambilan data vegetasi dilakukan menggunakan metode garis berpetak berukuran 20 x 20 m untuk tingkat pohon, 10 x 10 m untuk tingkat tiang, 5 x 5 m untuk pancang, 2 x 2 untuk semai, dan 1 x 1 untuk. Profil vegetasi dibuat dari struktur vertikal penutupan tajukdengan membuat petak ukuran pemanfaatan 40 x20 m. Pengukuran dilakukan terhadap kedudukan vegetasi, penutupan tajuk, arah tajuk, tinggi tajuk, tinggi bekas cabang vegetasi, dan diameter batang. Hasil penelitian dari 52 petak sampel vegetasi di Taman Kehati Unnes menunjukkan sebanyak 32 jenis tumbuhan herba atau perdu, 13 jenis Pancang, 12 jenis tiang dan 7 jenis pohon dapat diidentifikasi. Jenis rumput yang paling mendominasi adalah Imperata cylindrica (Alang-alang dengan nilai INP 37.85 tanaman tersebut adalah jenis gulma yang biasa terdapat ditempat terbuka dan terganggu.Jenis tanaman yang paling mendominasi dari kelas pohon, pancangdan tiang adalahLeucaena leucocephala(Mlandingan. Hasil analisis menunjukan Taman Kehati Unnes memiliki tumbuhan yang sangat seragam, hal ini dapat dilihat dari dominasi Mlandingan (Leucaena leucocephala.

  15. Larvacidal Effect of Imperata Cylindrical Root Decoction against Culex sp. Larvae

    Directory of Open Access Journals (Sweden)

    Afini Tiara Resi

    2014-08-01

    Full Text Available Background: Filariasis is one of the neglected tropical diseases. About 337 of 401 districts in Indonesia are endemic areas for filariasis, especially in Sumatera, Kalimantan, and Papua. Culex sp. is one of the lymphatic filariasis vectors which can be controlled by insecticide, including larvacide. This study was conducted to determine the larvacidal effect of Imperata cylindrical root decoction against Culex sp. larvae. Methods: This study was conducted at the Laboratory of Parasitology, Faculty of Medicine, Universitas Padjadjaran during the period of September to November 2012. The study object was Culex sp. larvae III/IV instars. The design of this study was experimental laboratory using true experimental approach. The larvae were divided into three groups: negative control (distilled water, reference (Abate®, and decoction. The number of larvae in each group was 25 larvae, and the effects were evaluated by the total number of dead larvae in 48 hours under observation. The data were then analyzed by Mann-Whitney test and Probit test. Results: The result of the Mann-Whitney test to compare Imperata cylindrica root decoction treatment to distilled water as control was significant (p<0.05. However, Abate® gave a better result. The Probit test resultwas LC50: 63% and LC90: 489%. Conclusions: Imperata cylindrical root decoction has a larvacidal effect against Culex sp. larvae.

  16. KEANEKARAGAMAN VEGETASI DAN PROFIL HABITAT DI TAMAN KEHATI UNIVERSITAS NEGERI SEMARANG

    Directory of Open Access Journals (Sweden)

    Bambang P

    2015-02-01

    Full Text Available Taman Kehati Unnes merupakan salah satu kawasan yang dirancang sebagai kawasan konservasi tanaman lokal Jawa Tengah.Penelitian tahun sebelumnya telah dilakukan analisis keanekaragaman jenis fauna di Taman Kehati Unnes. Penelitian sebelumnya (2013 menunjukan di Taman Kehati Unnes tercatat sebanyak 24 jenisburung, 63 jenis kupu-kupu, dan 26 jenis herpetofauna (amfibi dan reptil berhasil diidentifikasi. Keanekaragaman fauna juga ditentukan oleh kondisi habitatnya, oleh karena itu tujuan penelitian ini adalah melakukan analisis profil habitat. Pengambilan data vegetasi dilakukan menggunakan metode garis berpetak berukuran 20 x 20 m untuk tingkat pohon, 10 x 10 m untuk tingkat tiang, 5 x 5 m untuk pancang, 2 x 2 untuk semai, dan 1 x 1 untuk.Profil vegetasi dibuat dari struktur vertikal penutupan tajukdengan membuat petak ukuran pemanfaatan 40 x 20 m. Pengukuran dilakukan terhadap kedudukan vegetasi, penutupan tajuk, arah tajuk, tinggi tajuk, tinggi bekas cabang vegetasi, dan diameter batang. Hasil penelitian dari 52 petak sampel vegetasi di Taman Kehati Unnes menunjukkan sebanyak 32 jenis tumbuhan herba atau perdu, 13 jenis Pancang, 12 jenis tiang dan 7 jenis pohon dapat diidentifikasi. Jenis rumput yang paling mendominasi adalah Imperata cylindrica (Alang-alang dengan nilai INP 37.85 tanaman tersebut adalah jenis gulma yang biasa terdapat ditempat terbuka dan terganggu.Jenis tanaman yang paling mendominasi dari kelas pohon, pancangdan tiang adalahLeucaena leucocephala(Mlandingan. Hasil analisis menunjukan Taman Kehati Unnes memiliki tumbuhan yang sangat seragam, hal ini dapat dilihat dari dominasi Mlandingan (Leucaena leucocephala

  17. The invasive alien plants threatened the balance of ecosystem in conservative area in Ontoloe Island, Flores-Indonesia

    Science.gov (United States)

    Antonius Mboka Segu Wake, Ignatius; Retnaningsih Soeprobowati, Tri; Jumari

    2018-05-01

    Invasive alien plants threaten to biodiversity, particularly in small island with high endemicity values such as Ontoloe Island, a tourist destination area of Riung Seventeen Island in Flores. The study aims to characterized the invasive plants have attacked the conservative area in Ontoloe Island. The method used by combining the line method and the plot method with three observation stations in utilization block and four observation station in protection block. Plot of 1mx1m was used for the observation of ground cover plants and seedling, 5mx5m for the observation in stake level, 10mx10m for the observation in pole level, 20mx20m for the observation in tree level. The data level of the plants obtained then analyzed with Important Value Index (IVI). Result showed that Lamtoro plants (Leuchaena leucocephala) is the invasive alien species which has the highest IVI in both of utilization block and protection block in each level of tree, stake, and pole. There are other invasive alien plants such as Tembeleken (Lantana camara) and Bidara (Zizipus mauritiana) dominated in stake level and Alang-alang (Imperata cylindrica) dominated in seedling level. All the native plants in Ontoloe Island will be threatened their existing because of the less control of invasive alien plants. Therefore, needs serious handling by the government in order to keep the balanced of the ecosystems in Ontoloe Island to be maintained especially to not deviated from management objectives area of Komodo Dragons conservation (Varanus komodoensis Ouwens, 1912).

  18. Tingkat Kesukaan Rusa Bawean (Axis kuhlii terhadap Jenis-Jenis Tumbuhan Bawah di Suaka Margasatwa dan Cagar Alam Pulau Bawean

    Directory of Open Access Journals (Sweden)

    Sena Adi Subrata

    2013-01-01

    Full Text Available Level of Food Preference of Bawean Deer (Axis kuhlii on Food Species in Wildlife Sanctuary and Nature Reserve of Bawean Island This research has a background on the importance of food preference of Rusa Bawean (Axis kuhlii. This information can be used to ensure the adequacy of preferred food availability within their habitat. This paper aimed to estimate food preference of Rusa Bawean employing faecal analysis. The technique was selected because it is safe for the animal and is easy in data analysis and interpretation. To achieve the aim, quasi experimental design was applied to 30 vegetation plots and 60 faecal samples. Data was collected during January 2005 and June 2006 in the area of Wildlife Sanctuary and Nature Reserve of Bawean Island. Data was analyzed with chi-square test and food selection index. Result shows Rusa Bawean have preferences on some of food species, and they do not select their food species randomly according to its abundance.  Preferred food species include Kabak-kabakan alas (Brachiaria distachya, Talioar (Panicum cordayum, Gadung (Dioscorea hispida, Andudur (Caryota mitis, Rombok putih (Merremia peltata, Pele (Urena lobata and Kabak-kabakan merah (Ischaemum timorense. Whereas avoided food species include Lating-latingan (Scleria hebecarpa, Ancucu (Pericampylus glaucus, Lambu Merah (Paspalum conjugatum, Alang-alang (Imperata cylindrica, Padi-padian (Centotheca lappacea, Lente-lentean (Fimbristylis dichotoma, Taliata (Lygodium circinnatum dan Kayu sape (Symplocos adenophylla.

  19. Forage Food of Timor Deer (Cervus timorensis in Manokwari, West Papua

    Directory of Open Access Journals (Sweden)

    AYS Arobaya

    2010-05-01

    Full Text Available Traditionally, back yard deer husbandry is well developed in some parts in Papua, though information on deer husbandry has not been provided yet. Therefore, this study was aimed at highlighting the diet provided to the deer in back yard husbandry model in Manokwari. Survey method was approached by visiting eight deer back yard farmer respondents. Direct observation to the feeding site and semi-structured interview were carried out to learn about the deer management system, and identify the forage diet species consumed and served to the animals. The results indicated five most common forage species consumed in the study; they were field grass, Imperata (Imperata cylindrica, elephant grass (Penisetum purpureum, king grass (Penisetum purpureopoidhes and Melinis minutiflora depending on the location of farmed deer. Drinking water was offered and feed supplement such as various leafs, food and vegetable left over and banana peel was provided by 62.5% of the respondents. Food supplement was given two times per day (morning, evening and (afternoon, evening. Forage food species consumed in the study sites were relatively more similar to the food in the natural habitat. (Animal Production 12(2: 91-95 (2010Key Words: forage, food, Timor deer, Manokwari

  20. Concentration of radionuclides in uranium tailings and its uptake by plants at Jaduguda, Jharkhand, India

    International Nuclear Information System (INIS)

    Singh, Lal; Soni, Prafulla

    2010-01-01

    Mining and processing of uranium ore was started in several parts of eastern Singhbhum, viz. Jaduguda, Bhatin and Narwapahar (Jharkhand) in 1968. Radioactivity in the mine tailings has to be consolidated so that it does not emanate in the atmosphere or enter the food chain. Hence, the area has been covered with 30 cm thick soil cover followed by development of plant species that do not have any socioeconomic relevance in the area. Seven native plant species of forestry origin, viz. Colebrookea oppositifolia, Dodonaea viscosa, Furcraea foetida, Imperata cylindrica, Jatropha gossypifolia, Pogostemon benghalense and Saccharum spontaneum have been selected for experimental trials. Distribution and concentration of radionuclides have been evaluated in a tailing pond at different depths in soil and tailings. Radionuclide uptake in each of the selected plant species has been evaluated and discussed in this article. The highest concentration of radionuclides has been found in tailings > soil cover on tailings > roots of selected plant species > shoots of all the selected species. These results show that among the seven species tried, J. gossypifolia and F. foetida have the lowest uptake (below detectable limits), while S. spontaneum and P. benghalense have comparatively higher uptake. However, radionuclide concentration in all the tried species is significantly low compared to species of natural occurrence which have higher radionuclides uptake and accumulation. (author)

  1. Binding capacity and root penetration of seven species selected for revegetation of uranium tailings at Jaduguda in Jharkhand, India

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Lal; Soni, Prafulla [Ecology and Environment Division, Forest Research Institute, Dehradun (India)

    2010-08-25

    Uranium from ores mined at the three mines - Jaduguda, Bhatin and Narwapahar (Jharkhand) - is processed in the mill and the waste emerges as tailings. The recorded radioactivity level in these tailings is very low, but to avoid any long-term effect of these tailings on the atmosphere, humans, cattle as well as native flora and fauna, the tailings are covered with 30 cm layer of soil. This reduces the gamma radiation and radon emission levels. However, to consolidate the soil covering the tailings on a sustainable basis, the area needs to be revegetated by plant species having shallow root systems, good conservation value and low canopy cover. Another important criterion for selection of species is that they should not have any ethnobotanical relevance to the surrounding villages. Considering these criteria, seven native plant species of forestry origin, viz. Colebrookea oppositifolia, Dodonaea viscosa, Furcraea foetida, Imperata cylindrica, Jatropha gossypifolia, Pogostemon benghalense and Saccharum spontaneum have been selected for experimental trials. We describe here the strategies adopted for consolidation of radioactivity in tailings, revegetation practices used and the ecological role of the selected species in consolidating the tailings. (author)

  2. Some preliminary studies on plants and pollutant levels along Pindi Bhattian-Faisalabad motorway (m-3) (Pakistan)

    Energy Technology Data Exchange (ETDEWEB)

    Akbar, K F; Maqbool, S; Ashraf, I; Ahmad, S S; Ansari, Y.M., E-mail: kezmh@yahoo.com

    2011-10-15

    The roadside verges of M-3 were surveyed to investigate their floristic composition and the levels of heavy metals in their soils. For this purpose, the floristic data from 102 quadrats, each 1 x 2 m in size were collected and their associated soils were analyzed for total lead, cadmium, copper, manganese, iron and zinc. These quadrats were distributed on three zones (border, verge, and fence) within the M-3 verges. Fifty eight plant species were recorded. By considering their frequency and abundance values, Cynodon dactylon, Anagallis arvensis, Imperata cylindrica, Trifolium alexandrianum and Sonchus oleracea were the most frequent and abundant species of M-3. The mean concentrations of total Cu, Cd, Zn, Mn, Pb and Fe, 1.8 mu gg/sup 1-/, 43.4 mu gg/sup 1-/ , 336.1 mu gg/sup 1-/, 43.2 mu gg/sup 1-/ and 683.1 mu gg/sup 1-/ respectively. By in the roadside soils of M-3 were 14.0 mu gg/sup 1-/ comparing these values with their standard toxic levels, these soils can be considered as non-contaminated. (author)

  3. Evidence of prehistoric Lapita diet at Watom Island, Papua New Guinea, using stable isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Leach, B F [Archaeozoology Laboratory, Museum of New Zealand, Wellington (New Zealand); Quinn, C J [178 Queen Street North, Dunedin (New Zealand); Lyon, G L [Institute of Geological and Nuclear Sciences Ltd., Lower Hutt (New Zealand); Haystead, A [Auckland Institute of Technology, Auckland (New Zealand); Myers, D B [Wellcome Medical Research Institute, Otago Medical School, Dunedin (New Zealand)

    1998-07-01

    Samples of human bone from six individuals from the Lapita burial ground at Reber-Rakival on Watom Island in New Britain were analysed for {delta}{sup 13}C, {delta}{sup 15}N, and {delta}{sup 34}/S. The mean values obtained were -18.1, 11.6 and 9.9 respectively. From existing knowledge of isotope values, calorific content and protein yields for the main Pacific food types, computer simulation was used to randomly generate a large number of possible food compositions, in order to find the type of diet which could have produced the isotope pattern at Watom. The simulation produced solutions which are within acceptable limits of the Watom isotope signature. The mean food composition per day was then estimated. This analysis shows that approximately 64% of the diet at Watom came from land-based foods and 36% from the sea. Plant foods contributed 53% per weight. It is notable that C4 plants were present in the diet. There are two possible sources of this - sugar cane, Saccharum officinarum, and/or a herbivore which browsed on the C4 grasslands of Papua New Guinea, such as Saccharum spontaneum (pit-pit) and Imperata cylindrica (kunai). Fish and land herbivores are the main sources of protein in the Watom diet, while plant foods contributed by far the most food energy. (author). 20 refs., 2 figs., 3 tabs.

  4. Jenis dan Kandungan Tanin Pakan Satwa Anoa (Bubalus sp.

    Directory of Open Access Journals (Sweden)

    M. Basri

    2011-04-01

    Full Text Available Study of kinds and tannin content of diets consumed by anoa is limited. This information is very important and necessary for anoa domestication. The aims of this research were to obtain information on kinds and tannin content of anoa diets. The research was conducted in forest of Pangi Binangga nature reserve and Lore Lindu National Park, province of Central Sulawesi in March to November 2009. Digestive content analyses method was used to study the kinds of diets consumed by anoa. Chromatography was used for tannin analysis. Results of the digestive content analysis found ten kinds of anoa diets, i.e. Ficus miquelly, Caryota mitis, Ficus ampelas, Syzigium sp., Cordia mixab, Paspalum conjugatum, Smilax leocophylla, Saccarum spontaneum, Isachne globosa and Imperata cylindrica. The proportion of the diets were 60%, 45%, 35%, 17%, 12%, 10%, 8%, 8%, 5%, and 4%, respectively. Three of six diets namely Ficus miquelly, Saccarum spontaneum and Isachne globosa contained low tannin. The tannin content of three diets was 0.34%, 0.61%, and 0.99%, respectively. It is concluded that anoa in forest prefer diets that contain low tannin, such as Ficus fruits, shoots of shrubs.

  5. Distribution of 137Cs in the Surface Soil of Serpong Nuclear Site

    International Nuclear Information System (INIS)

    Lubis, E.

    2011-01-01

    The distribution of 137 Cs in the surface soil layer of Serpong Nuclear Site (SNS) was investigated by field sampling. The Objectives of the investigation is finding the profile of 137 Cs distribution in the surface soil and the T f value that can be used for estimation of radiation dose from livestock product-man pathways. The results indicates that the 137 Cs activity in surface soil of SNS is 0.80 ± 0.29 Bq/kg, much lower than in the Antarctic. The contribution value of 137 Cs from the operation of G.A. Siwabessy Reactor until now is undetectable. The T f of 137 Cs from surface soil to Panisetum Purpureum, Setaria Spha Celata and Imperata Cylindrica grasses were 0.71 ± 0.14, 0.84 ± 0.27 and 0.81 ± 0.11 respectively. The results show that value of the transfer factor of 137 Cs varies between cultivated and uncultivated soil and also with the soils with thick humus. (author)

  6. Evidence of prehistoric Lapita diet at Watom Island, Papua New Guinea, using stable isotopes

    International Nuclear Information System (INIS)

    Leach, B.F.; Quinn, C.J.; Lyon, G.L.; Haystead, A.; Myers, D.B.

    1998-01-01

    Samples of human bone from six individuals from the Lapita burial ground at Reber-Rakival on Watom Island in New Britain were analysed for δ 13 C, δ 15 N, and δ 34 /S. The mean values obtained were -18.1, 11.6 and 9.9 respectively. From existing knowledge of isotope values, calorific content and protein yields for the main Pacific food types, computer simulation was used to randomly generate a large number of possible food compositions, in order to find the type of diet which could have produced the isotope pattern at Watom. The simulation produced solutions which are within acceptable limits of the Watom isotope signature. The mean food composition per day was then estimated. This analysis shows that approximately 64% of the diet at Watom came from land-based foods and 36% from the sea. Plant foods contributed 53% per weight. It is notable that C4 plants were present in the diet. There are two possible sources of this - sugar cane, Saccharum officinarum, and/or a herbivore which browsed on the C4 grasslands of Papua New Guinea, such as Saccharum spontaneum (pit-pit) and Imperata cylindrica (kunai). Fish and land herbivores are the main sources of protein in the Watom diet, while plant foods contributed by far the most food energy. (author). 20 refs., 2 figs., 3 tabs

  7. Influence de divers traitements physico-chimiques de graines de Mucuna pruriens sur leur composition chimique en nutriments

    Directory of Open Access Journals (Sweden)

    Dossa, CS.

    1999-01-01

    Full Text Available Influence of Various Physicochemical Treatments of Mucuna pruriens Seeds on the Nutrient Chemical Composition. Mucuna pruriens is being intensively used to fight off couch grass Imperata cylindrica and restore washed out lithosol fertility, in most of the agro ecological zones of Benin. From the huge amount of grains harvested, only a small part is used as seeds. This study was made to determine the effects of different ways of processing Mucuna pruriens var. utilis and M. pruriens var. cochichennensis grains on the toxic factor contents such as L-dopa and other antinutritionnal factors. Of the different physical and chemical treatment tested, grilling remarkably increased the potential nutritional content while boiling gave lower nutrient values. While awaiting assessment of the residual L-dopa level, the following treatment could be advised : after a preliminary soaking of the grains in cold water during 24 hours, they were dehulled and grilled for one hour. That procedure offered higher dry matter, higher crude protein and higher nitrogen-free extract in the preparations. The chemical contents of the two cultivars are not identical but dry matter and phosphorus contents are comparable.

  8. Varied growth response of cogongrass ecotypes to elevated CO2

    Directory of Open Access Journals (Sweden)

    G. Brett Runion

    2016-01-01

    Full Text Available Cogongrass [Imperata cylindrica (L. P. Beauv] is an invasive C4 perennial grass which is listed as one of the top ten worst weeds in the world and is a major problem in the Southeast US. Five cogongrass ecotypes (Florida, Hybrid, Louisiana, Mobile, and North Alabama collected across the Southeast and a red-tip ornamental variety were container grown for six months in open top chambers under ambient and elevated (ambient plus 200 ppm atmospheric CO2. Elevated CO2 increased average dry weight (13% which is typical for grasses. Elevated CO2 increased height growth and both nitrogen and water use efficiencies, but lowered tissue nitrogen concentration; again, these are typical plant responses to elevated CO2. The hybrid ecotype tended to exhibit the greatest growth (followed by Louisiana, North Alabama, and Florida ecotypes while the red-tip and Mobile ecotypes were smallest. Interactions of CO2 with ecotype generally showed that the hybrid, Louisiana, Florida, and/or North Alabama ecotypes showed a positive response to CO2 while the Mobile and red-tip ecotypes did not. Cogongrass is a problematic invasive weed in the southeastern U.S. and some ecotypes may become more so as atmospheric CO2 continues to rise.

  9. Some preliminary studies on plants and pollutant levels along Pindi Bhattian-Faisalabad motorway (m-3) (Pakistan)

    International Nuclear Information System (INIS)

    Akbar, K.F.; Maqbool, S.; Ashraf, I.; Ahmad, S.S.; Ansari, Y.M.

    2011-01-01

    The roadside verges of M-3 were surveyed to investigate their floristic composition and the levels of heavy metals in their soils. For this purpose, the floristic data from 102 quadrats, each 1 x 2 m in size were collected and their associated soils were analyzed for total lead, cadmium, copper, manganese, iron and zinc. These quadrats were distributed on three zones (border, verge, and fence) within the M-3 verges. Fifty eight plant species were recorded. By considering their frequency and abundance values, Cynodon dactylon, Anagallis arvensis, Imperata cylindrica, Trifolium alexandrianum and Sonchus oleracea were the most frequent and abundant species of M-3. The mean concentrations of total Cu, Cd, Zn, Mn, Pb and Fe, 1.8 mu gg/sup 1-/, 43.4 mu gg/sup 1-/ , 336.1 mu gg/sup 1-/, 43.2 mu gg/sup 1-/ and 683.1 mu gg/sup 1-/ respectively. By in the roadside soils of M-3 were 14.0 mu gg/sup 1-/ comparing these values with their standard toxic levels, these soils can be considered as non-contaminated. (author)

  10. Concentration of radionuclides in uranium tailings and its uptake by plants at Jaduguda, Jharkhand, India

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Lal; Soni, Prafulla [Ecology and Environment Div., Forest Research Institute, Dehradun (India)

    2010-01-10

    Mining and processing of uranium ore was started in several parts of eastern Singhbhum, viz. Jaduguda, Bhatin and Narwapahar (Jharkhand) in 1968. Radioactivity in the mine tailings has to be consolidated so that it does not emanate in the atmosphere or enter the food chain. Hence, the area has been covered with 30 cm thick soil cover followed by development of plant species that do not have any socioeconomic relevance in the area. Seven native plant species of forestry origin, viz. Colebrookea oppositifolia, Dodonaea viscosa, Furcraea foetida, Imperata cylindrica, Jatropha gossypifolia, Pogostemon benghalense and Saccharum spontaneum have been selected for experimental trials. Distribution and concentration of radionuclides have been evaluated in a tailing pond at different depths in soil and tailings. Radionuclide uptake in each of the selected plant species has been evaluated and discussed in this article. The highest concentration of radionuclides has been found in tailings > soil cover on tailings > roots of selected plant species > shoots of all the selected species. These results show that among the seven species tried, J. gossypifolia and F. foetida have the lowest uptake (below detectable limits), while S. spontaneum and P. benghalense have comparatively higher uptake. However, radionuclide concentration in all the tried species is significantly low compared to species of natural occurrence which have higher radionuclides uptake and accumulation. (author)

  11. An ecological assessment of Hispid Hare Caprolagus hispidus (Mammalia: Lagomorpha: Leporidae in Manas National Park, Assam, India

    Directory of Open Access Journals (Sweden)

    Naba K. Nath

    2015-12-01

    Full Text Available This study of the Hispid Hare Caprolagus hispidus in the tall grassland habitat of Manas National Park, Assam during 2009–2010 is the first detailed assessment in northeastern India.  We assessed the status, distribution, habitat use and key threats to this rare and little studied lagomorph species.  After interviewing local forest staff, 20 grassland patches within a survey area of 2.65ha were selected and transects (50x2 m laid randomly to determine the presence/absence of Hispid Hare by recording pellets and other indirect evidence.  Hare presence was recorded in 17 grassland patches within transects dominated by Imperata cylindrica and Saccharum narenga.  Hispid Hare preferred dry savannah grasslands to wet alluvial grasslands during winter and avoided recently burned patches due to lack of cover and food.  The distribution pattern observed was clumped (s2/a = 6.2, with more evidence of Hispid Hare presence in areas where ground cover was dense, dry and away from water sources. Population density was estimated at 381.55 individuals/km2, which in comparison with other studies indicates that Manas National Park currently holds the highest density of Hispid Hare.  Habitat loss due to overgrazing, unsustainable thatch harvesting, burning of grassland, weed invasion, encroachment and hunting were identified as key threats which must be addressed to ensure survival of this threatened species in the Park.  

  12. Seasonal variations in food plant preferences of reintroduced Rhinos Rhinoceros unicornis (Mammalia: Perrissodactyla: Rhinocerotidae in Manas National Park, Assam, India

    Directory of Open Access Journals (Sweden)

    Deba Kumar Dutta

    2016-11-01

    Full Text Available The food preferences of translocated Rhinos in Manas National Park were studied to find out variations in seasonal and annual preferences.  A total of 139 plants species belonging to 39 families were observed to be consumed as food.  On an average, grasses (n=33 contributed 24% of Rhino food, aquatic plants (n=23 16.5%, shrubs (n=11 7.5%, herbs (n = 31 22.3% trees (n=26 18.7%, creepers (n=3 2.1% and agricultural crops (n=12 8.6%.  Among the grasses, throughout the year Arundo donax, Cynodon dactylon, Imperata cylindrica, Saccharum elephantinus and Saccharum spontaneum were the maximum preferred species.  Rhinos were observed to browse shrubs and tree twigs during the winter season and browsing was found to be very limited during the monsoon due to the abundance of young grass.  Various anthropogenic pressures such as unregulated grassland burning, cattle grazing, invasions of Bombax ceiba and shrubs like Chromolaena odorata, Leea asiatica and herbs like Ageratum conyzoides have degraded some of the important grasslands.  So, a proper grassland management protocol including the burning of grasslands during the dry season, keeping grazing animals away and control of weeds is suggested in the areas extensively used by the Rhinos. 

  13. AUTECOLOGY OF INVASIVE SPECIES Cyperus rotundus L. IN FOREST EDGE OF POHEN MOUNTAIN, BATUKAHU NATURE RESERVE, BALI, INDONESIA

    Directory of Open Access Journals (Sweden)

    Sutomo Sutomo

    2015-11-01

    Full Text Available Anthropogenic-origin forest disturbance has been known to increase the risk of invasion to native habitat. Invasive species caused problems for local ecosystems and their native species. The  research on the dynamics and autecology of invasive species Cyperus rotundus was conducted on anthropogenic disturbed Pohen mountain forest in Bali, Indonesia. Results showed significant changes in microclimatic variables from forest edge to interior. C. rotundus in Pohen mountain forest can be found in a road edge and forest exterior where sunlight is abundant and decrease in a more shady sites and absent under thick forest canopies CCA ordination analysis showed that C. rotundus in Pohen mountain forest tends to co-occur together with Imperata cylindrica and Bidens biternata. To be able to control potentially troublesome exotic invasive species, firstly we have to understand what factors limit their growth and development. Therefore this study is has important value because the data which from  result in studying invasive species autecology will act as baseline data that will be useful to generate management program including rehabilitation and restoration program. Key words: species dynamics, autecology, Cyperus rotundus, Pohen mountain forest, Bali

  14. Diet of the Four-horned Antelope Tetracerus quadricornis (De Blainville, 1816 in the Churia Hills of Nepal

    Directory of Open Access Journals (Sweden)

    Amar Kunwar

    2016-05-01

    Full Text Available The food composition of the Four-horned Antelope Tetracerus quadricornis was studied in the Churia Hills of Nepal during summer, monsoon and the winter seasons of 2012–2013.  Microhistological technique was used to determine the diet.  The Four-horned Antelope was found to be a mixed feeder feeding on trees, shrubs, forbs, grasses and climbers.  Trees and shrubs contribute the major percentage of diet in all the three seasons.  The Gramineae family is consumed in highest proportion.  Mitragyna parvifolia, Bridelia retusa, Bambusa vulgaris, Hymenodictyon sp. and Ziziphus mauritiana are major tree species while Barleria cristata, Pogostemon benghalensis, Achyranthes sp., Clerodendrum viscosum are among shrubs.  Ageratum conyzoides and Blumea virens are the main forbs Eulaliopsis binata and Imperata cylindrica are the principal grass species.  Climber Trachelospermum lucidum is consumed in a small proportion.  Grasses in monsoon were consumed distinctly at a higher percentage than during the other two seasons.  The Four-horned Antelopes are concentrated feeders and browsers with a generalized feeding strategy. Similar studies need to be conducted in other landscapes and with sympatric and potential competitor species to understand its niche overlaps and degree of competition. 

  15. Plant community establishment on the volcanic deposits following the 2006 nuées ardentes (pyroclastic flows of Mount Merapi: diversity and floristic variation

    Directory of Open Access Journals (Sweden)

    SUTOMO

    2011-04-01

    Full Text Available Sutomo, Hobbs R, Cramer V (2011 Plant community establishment on the volcanic deposits following the 2006 nuées ardentes (pyroclastic flows of Mount Merapi: diversity and floristic variation. Biodiversitas 12: 86-91. Species establishment and composition changes in a substrate with little or no biological legacy is known as primary succession, and volcanoes, erosion, landslides, floodplains and glaciers are some type of disturbances that can create this kind of environment. Mount Merapi with its Merapi-type nuées ardentes or pyroclastic flows provides excellent opportunities to study primary succession. Using chronosequence approach, plant establishment and succession was studied, and thus five areas that were affected by nuées ardentes deposits between 1994 and 2006 were chosen as study sites. Results showed that there was a rapid colonization by vascular plants in primary succession as the sites aged. Imperata cylindrica, Eupatorium riparium, Anaphalis javanica, Athyrium macrocarpum, Brachiaria paspaloides, Dichantium caricosum, Selaginella doederleinii, Eleusine indica, Cyperus flavidus, Calliandra callothyrsus and Acacia decurrens were the species mainly responsible in explaining the differences between sites. Furthermore, the species richness and diversity reach their peak 14 years after disturbance.

  16. Biodiversity and Phytosociological Studies of Upstream and Downstream Riparian Areas of Pakistan: Special Reference to Taunsa Wildlife Sanctuary and Keti Shah Forests

    International Nuclear Information System (INIS)

    Arfeen, R. Z.; Saleem, A.; Mirza, S. N.; Tayyab, H. M.; Akmal, M.; Afzal, O.

    2015-01-01

    Pakistan riparian zone mostly belongs to Sindh and Punjab provinces and prone to climatic problems and anthropogenic activities. The research was conduct to estimate and compare the structure and composition of riverine floral diversity in low riparian zone of River Indus. The data was collected from Keti Shah forest and Taunsa wildlife sanctuary. Total 14259 plants/individuals were recorded, which belong to 54 plant species with 18 different families. In Taunsa pre-monsoon survey, total 30 plant species were found with 4476 plants from 16 different families. In Taunsa post-monsoon survey total 3348 individuals were recorded from 20 plant species and 9 families. Similarly, in Keti Shah forest, total 3975 individual were recorded from 22 species and 11 families during the pre-monsoon season and 2460 plants were recorded in post-monsoon season, belonging to 16 species and 10 families. These species mostly belong to Fabaceae, Poaceae, Cyperaceae and Asclepiadaceae. Different phytosociological parameters indicate Tamarix dioca, Cynodon dactylon, Desmostachya bipinnata, Imperata cylindrica, Fimbristylis hispidula, Acacia nilotica, Phragmites karka, Tamarix sp. and Saccharum bengalense as dominant species. The biodiversity in upstream and downstream areas were rich in pre-monsoon season in comparison to post-monsoon season in surveyed areas. This study is useful for management of the area in the future as conservation strategies can be made through considering the adaptive tree species in future plantation and endangered species can be conserved. (author)

  17. Ecological restoration alters microbial communities in mine tailings profiles

    Science.gov (United States)

    Li, Yang; Jia, Zhongjun; Sun, Qingye; Zhan, Jing; Yang, Yang; Wang, Dan

    2016-04-01

    Ecological restoration of mine tailings have impact on soil physiochemical properties and microbial communities. The surface soil has been a primary concern in the past decades, however it remains poorly understood about the adaptive response of microbial communities along the profile during ecological restoration of the tailings. In this study, microbial communities along a 60-cm profile were investigated in a mine tailing pond during ecological restoration of the bare waste tailings (BW) with two vegetated soils of Imperata cylindrica (IC) and Chrysopogon zizanioides (CZ) plants. Revegetation of both IC and CZ could retard soil degradation of mine tailing by stimulation of soil pH at 0-30 cm soils and altered the bacterial communities at 0-20 cm depths of the mine tailings. Significant differences existed in the relative abundance of the phyla Alphaproteobacteria, Deltaproteobacteria, Acidobacteria, Firmicutes and Nitrospira. Slight difference of bacterial communities were found at 30-60 cm depths of mine tailings. Abundance and activity analysis of nifH genes also explained the elevated soil nitrogen contents at the surface 0-20 cm of the vegetated soils. These results suggest that microbial succession occurred primarily at surface tailings and vegetation of pioneering plants might have promoted ecological restoration of mine tailings.

  18. Salt marsh and seagrass communities of Bakkhali Estuary, Cox's Bazar, Bangladesh

    Science.gov (United States)

    Hena, M. K. Abu; Short, F. T.; Sharifuzzaman, S. M.; Hasan, M.; Rezowan, M.; Ali, M.

    2007-10-01

    The species identification, distribution pattern, density and biomass of salt marsh and seagrass plants with some of the ecological parameters were studied in the Bakkhali river estuary, Cox's Bazar, Bangladesh during the first half of 2006. Two salt marsh species ( Spartina sp. and Imperata cylindrica) and one seagrass species ( Halophila beccarii) were identified during this investigation, providing the first reports of Spartina sp. and H. beccarii in coastal Bangladesh. Seagrass H. beccarii was found in an accreted area and co-existing with salt marsh, and scattered sparsely in the salt marsh habitat and macroalgae Ulva intestinalis. Flowering and fruiting were recorded from the seagrass H. beccarri during January and February. No flowers and fruits were observed for the salt marsh Spartina sp. during the study period. Results showed that the shoot density of Spartina ranged from 400 to 2875 shoots m -2 with the highest total biomass (165.80 g dry weight (DW) m -2) in March. Shoot density of H. beccarii ranged from 2716 to 14320 shoots m -2 in this estuarine coastal environment. The total biomass of seagrass was higher (17.56 g DW m -2) in March compared to the other months. The highest H. beccarii above ground (AG) biomass and below ground (BG) biomass were 9.59 g DW m -2 and 9.42 g DW m -2, respectively. These parameters are comparable with those generally observed for the salt marsh and seagrass species in the other places of the world.

  19. Distribution of {sup 137}Cs in the Surface Soil of Serpong Nuclear Site

    Energy Technology Data Exchange (ETDEWEB)

    Lubis, E., E-mail: erlub@batan.go.id [Center for Radioactive Waste Technology, National Nuclear Energy Agency, Serpong (Indonesia)

    2011-08-15

    The distribution of {sup 137}Cs in the surface soil layer of Serpong Nuclear Site (SNS) was investigated by field sampling. The Objectives of the investigation is finding the profile of {sup 137}Cs distribution in the surface soil and the T{sub f} value that can be used for estimation of radiation dose from livestock product-man pathways. The results indicates that the {sup 137}Cs activity in surface soil of SNS is 0.80 {+-} 0.29 Bq/kg, much lower than in the Antarctic. The contribution value of {sup 137}Cs from the operation of G.A. Siwabessy Reactor until now is undetectable. The T{sub f} of {sup 137}Cs from surface soil to Panisetum Purpureum, Setaria Spha Celata and Imperata Cylindrica grasses were 0.71 {+-} 0.14, 0.84 {+-} 0.27 and 0.81 {+-} 0.11 respectively. The results show that value of the transfer factor of {sup 137}Cs varies between cultivated and uncultivated soil and also with the soils with thick humus. (author)

  20. Eucalyptus and Populus short rotation woody crops for phosphate mined lands in Florida USA

    Energy Technology Data Exchange (ETDEWEB)

    Rockwood, D L; Carter, D R; Langholtz, M H [The School of Forest Resources and Conservation, University of Florida, Box 110410, Gainesville, FL 32611 0410 (United States); Stricker, J A [Polk County Extension Service, University of Florida, Gainesville, FL 32611 (United States)

    2006-08-15

    Our short-rotation woody crops (SRWC) research in central and southern Florida is (1) developing superior Eucalyptus grandis (EG), E. amplifolia (EA), and cottonwood (Populus deltoides, PD) genotypes, (2) determining appropriate management practices for and associated productivities of these genotypes, and (3) assessing their economics and markets. Reclaimed clay settling areas (CSA) and overburden sites in phosphate mined areas in central Florida are a potential land base of over 80,000ha for SRWC production. On CSAs, PD grows well in the absence of cogongrass (Imperata cylindrica) but is not as productive as the non-invasive EG and EA. SRWC establishment on CSAs requires strict implementation of the following cultural practices: thorough site preparation through herbiciding/disking and bedding, superior trees, watering/packing seedlings, fertilization with ammonium nitrate at planting and annually thereafter as feasible, high planting density possibly including double row planting, and winter harvesting so that coppice regeneration suppresses weeds. PD cultural requirements, that may require post-planting weed control to suppress herbaceous competition, exceed those of the eucalypts. EG SRWCs on CSAs are at risk of blowdown 3-4 years after planting or coppicing; younger PD, EG, and EA SRWCs appear much less susceptible to wind damage. Genetic improvement must continue if EG, EA, and PD are to increase in commercial feasibility. SRWC cost competitiveness will depend on establishment success, yield improvements, harvesting costs, and identifying/using incentives. Strong collaboration among public and private partners is necessary for commercializing SRWCs in Florida. (author)

  1. Peatland Fire Danger Rating According to Weeds Characteristic Under Jelutung (Dyera Polyphylla Plantation

    Directory of Open Access Journals (Sweden)

    Acep Akbar

    2016-04-01

    Full Text Available Besides to be a competitor plant, weeds could act as the potential fuel under plantation forest in peatland. Characteristic of weeds in relation to peat swamp forest fire danger was studied under jelutung  plantation in Central Kalimantan. The research was aimed at exploring the potency of weed to become one of the fire danger rating indicators. By using vegetation analyses method in sampling unit of weeds population, results showed that three plantation area have different dominance weed species. The weeds species that could be the indicator of height fire risk according to water content and percentage of weed mortality during the drought, height potency of greenhouse gas emmision, culm height, and chemical material content that easy burned in this study were Imperata cylindrica, Stenochlaena polustris, Cyclosorus aridus, and Nephrolepis exaltata. While, the presence of Glichenia linearis, Melastoma malabatracum, Ficus grossulariodes, Saurophus androginus, Spatoglathis plicata,Himenocalis littoralis, Leptaspis urcheolata, Cyperus rotundus, and Amaranthus spinosa were not indicated high fire risk.

  2. Natural food monitoring of Sumatran elephant (Elephas maximus sumatraensis in Taman Hutan Raya Cut Nya’ Dhien Seulawah, Aceh Besar

    Directory of Open Access Journals (Sweden)

    DJUFRI

    2003-07-01

    Full Text Available The objectives of this research were to monitoring natural food of Sumatran elephant; determine rank taxonomy of species, and to give information quantitative value of taxa for vegetation analysis. The wide of area total Taman Hutan Raya Cut Nya’ Dhien Seulawah were 6.220 Ha. About 20% of area total used as an observed area. The data was collected by transect and quadratic plot method. The observed area it was took 10 transect with 500 m of long for observed station. Each observed station was put seven and ten plot samples systematically. Each plot samples has a 5 m2 of width. The result indicated that there were 69 species of the plant including 23 families. Diversity index was between 1.9838-2.7202; an evenness index was between 1.6868-2.0631. The importance value is relatively low on all station observed. The refer of importance value show that Oplismenus burmanii, Imperata cylindrica, Crassocephalum crepidiodes, Mimosa pudica, and Zingiber aquosum were dominated on secondary forest and Zingiber zerumbet, Zingiber purpureum, and Oplismenus burmanii were dominated on primary forest. The result of diversity index show that regeneration of natural food in Taman Hutan Raya Cut Nya’ Dhien Seulawah is available constant because grazing occurred with continue by elephant.

  3. Contraintes socio-économiques de répartition des terres et impacts sur la conservation des sols dans les hauts plateaux de l'Ouest du Cameroun

    Directory of Open Access Journals (Sweden)

    Djoukeng, HG.

    2016-01-01

    Full Text Available Socio-economic Constraints of Land Distribution and Impacts on Soil Conservation in the Western Highlands of Cameroon. This article combines the data of a social survey on access to land and those regarding the adoption of tied ridging as soil conservation technique to help better understanding the management of erosion and runoff by farmers in the Western Highlands of Cameroon, specifically in the hills of Fongo-Tongo villages' group. The study focused on 230 plots owned by 157 respondents among 158 people inventoried. Five main modes of access to land were listed as: inheritance, purchase, temporary transfers, donations and rental. The owners and operators of the hills with gentle slopes (between 11% and 17% and of steep slopes (between 22% and 29% were inventoried. Two main social ranks were identified: the dignitaries (Chiefs, Notables, Elites, and Heirs and other (Non-heirs son, and Women. The study showed that the agronomic abilities of plots as recognized by farmers are a key factor in the implementation of soil conservation techniques. The peasant approach of soil fertility has been scientifically proven by physicochemical analysis of soil samples taken under indicator plant species (Pennisetum spp on fertile soils, and Imperata cylindrica and Melinis minutiflora on poor soils. The study showed that access to land, adoption of tied ridging, and cultivation on the slopes were significantly influenced by socio- economic status of farmers (p<0.05.

  4. Binding capacity and root penetration of seven species selected for revegetation of uranium tailings at Jaduguda in Jharkhand, India

    International Nuclear Information System (INIS)

    Singh, Lal; Soni, Prafulla

    2010-01-01

    Uranium from ores mined at the three mines - Jaduguda, Bhatin and Narwapahar (Jharkhand) - is processed in the mill and the waste emerges as tailings. The recorded radioactivity level in these tailings is very low, but to avoid any long-term effect of these tailings on the atmosphere, humans, cattle as well as native flora and fauna, the tailings are covered with 30 cm layer of soil. This reduces the gamma radiation and radon emission levels. However, to consolidate the soil covering the tailings on a sustainable basis, the area needs to be revegetated by plant species having shallow root systems, good conservation value and low canopy cover. Another important criterion for selection of species is that they should not have any ethnobotanical relevance to the surrounding villages. Considering these criteria, seven native plant species of forestry origin, viz. Colebrookea oppositifolia, Dodonaea viscosa, Furcraea foetida, Imperata cylindrica, Jatropha gossypifolia, Pogostemon benghalense and Saccharum spontaneum have been selected for experimental trials. We describe here the strategies adopted for consolidation of radioactivity in tailings, revegetation practices used and the ecological role of the selected species in consolidating the tailings. (author)

  5. Utilization of low quality roughage by ruminants. A contribution to animal nutrition in the tropics

    International Nuclear Information System (INIS)

    Sastradipradja, D.; Soewardi, B.; Sofjan, L.A.; Hendratno, C.W.

    1976-01-01

    Because of the importance of low quality roughage in ruminant production in Indonesia, a research project to evaluate the nutritive value of forages, and the possible improvement in their utilization, was undertaken. These studies are here reviewed. The effects of cassava meal, sago starch and molasses as supplements in urea-containing rations with alangalang (Imperata cylindrica (L) Beauv.) as the sole roughage source were investigated in Ongole grade calves. Using 35 S in vitro systems, the effects of levels of only cassava meal supplements in alangalang rations on rumen microbial protein synthesis were estimated. Another experiment was carried out to study alangalang in pelleted rations of different main energy source and concentrate to roughage ratios for Ongole grade bulls. Data on the average daily gain in bodyweight and ruminal ammonia concentration suggest that alangalang alone already produced enough ammonia for protein synthesis, and that non-protein nitrogen supplementation can be beneficial if cassava meal is offered at a level greater than 3% metabolic body size (MBS). Results from the in vitro studies show that the level of 1.0% MBS gave the highest rate of microbial protein synthesis. With alangalang in pelleted complete rations, acceptable gains in body weight were obtained, and it was concluded that dried cassava roots can replace corn as the main energy source. (author)

  6. Ketertarikan Anaxipha longipennis Serville (Orthoptera: Gryllidae terhadap Beberapa Jenis Gulma di Sawah sebagai Tempat Bertelur

    Directory of Open Access Journals (Sweden)

    Sri Karindah

    2015-09-01

    Full Text Available Anaxipha longipennis Serville (Orthoptera: Gryllidae is one of the generalist predator in rice habitat that has a potential as a biological control agents of rice leaf folder eggs and small insects such as rice hoppers. Females insert their eggs in plant tissue. The female’s oviposition site is important for the subsequent distribution of the cricket. Oviposition preference on 17 weeds species from rice habitat were tested in a free choice experiment in the laboratory. There was strong evidence to conclude that the cricket preferred certain plant for laying eggs. In free choice experiment nine species of weeds were preferred by A. longipennis for laying their eggs instead of rice. The preferred species were ranked as follows: rice, Monochoria vaginalis, Cyperus rotundus, C. iria, Echinochloa colonum, E. crusgalli, Eleusine indica, Fimbristylis miliacea, Imperata cylindrica, and Limnocharis flava. Whereas Ageratum conyzoides, Alternanthera sessilis, Commelina diffusa, Leersia hexandra, Leptochloa chinensis, Ludwigia adscendens, Panicum repens, and Sonchus arvensis were not preferred in free-choice test.

  7. Distribution of 137Cs In the Surface Soil of Serpong Nuclear Site

    Directory of Open Access Journals (Sweden)

    E. Lubis

    2011-08-01

    Full Text Available The distribution of 137Cs in the surface soil layer of Serpong Nuclear Site (SNS was investigated by field sampling. The Objectives of the investigation is finding the profile of 137Cs distribution in the surface soil and the Tf value that can be used for estimation of radiation dose from livestock product-man pathways. The results indicates that the 137Cs activity in surface soil of SNS is 0.80 ± 0,29 Bq/kg, much lower than in the Antarctic. The contribution value of 137Cs from the operation of G.A.Siwabessy Reactor until now is undetectable. The Tf of 137Cs from surface soil to Panisetum Purpureum, Setaria Spha Celata and Imperata Cylindrica grasses were 0.71 ± 0.14, 0.84 ± 0.27 and 0.81 ± 0.11 respectively. The results show that value of the transfer factor of 137Cs varies between cultivated and uncultivated soil and also with the soils with thick humus

  8. Coatal salt marshes and mangrove swamps in China

    Science.gov (United States)

    Yang, Shi-Lun; Chen, Ji-Yu

    1995-12-01

    Based on plant specimen data, sediment samples, photos, and sketches from 45 coastal crosssections, and materials from two recent countrywide comprehensive investigations on Chinese coasts and islands, this paper deals with China’s vegetative tidal-flats: salt marshes and mangrove swamps. There are now 141700 acres of salt marshes and 51000 acres of mangrove swamps which together cover about 30% of the mud-coast area of the country and distribute between 18°N (Southern Hainan Island) and 41 °N (Liaodong Bay). Over the past 45 years, about 1750000 acres of salt marshes and 49400 acres of mangrove swamps have been reclaimed. The 2.0×109 tons of fine sediments input by rivers into the Chinese seas form extensive tidal flats, the soil basis of coastal helophytes. Different climates result in the diversity of vegetation. The 3˜8 m tidal range favors intertidal zone development. Of over 20 plant species in the salt marshes, native Suaeda salsa, Phragmites australis, Aeluropus littoralis, Zoysia maerostachys, Imperata cylindrica and introduced Spartina anglica are the most extensive in distribution. Of the 41 mangrove swamps species, Kandelia candel, Bruguiera gymnorrhiza, Excoecaria agallocha and Avicennia marina are much wider in latitudinal distribution than the others. Developing stages of marshes originally relevant to the evolution of tidal flats are given out. The roles of pioneer plants in decreasing flood water energy and increasing accretion rate in the Changjiang River delta are discussed.

  9. Anylisis of botanical composition and nutrient content on natural pastures in Samosir Island of Samosir Regency

    Science.gov (United States)

    Hanafi, N. D.; Tafsin, M.; Hutasuhut, U.; Lubis, E.

    2018-02-01

    Samosir regency is one of the areas that have large grazing area. The potential of grazing production in the area plays an important role for the development of livestock, especially on ruminant livestock.The study aims to know the botanical composition and the nutritional content of forage on natural pasture at the Samosir Island. Animal feed assessment method on natural pastures in Samosir regency includes the determination of research location points based on the altitude through the survey method. Location of the study amounted to 15 locations. The result showed that at altitude 905 - 1200 meters above sea level had a botanical composition were 31 species with ratio of grass 80.58 %, legumes 9.14 % and weeds 9.63 % and the most dominant forage is Imperata cylindrica l. The botanical composition at altitude more than 1205 meters above sea level is 15 species with ratio of grass 92.72 %, legumes 2.87 % and weeds 4.39 % and the most dominant forage is Axonopus compressus. The forage which has the highest crude protein is Starkuak 15.13 %. The conclusion that the altitude in pastures give effect on the botanical composition of forages.

  10. SPECIES COMPOSITION, DISTRIBUTION, LIFE FORMS AND FOLK NOMENCLATURE OF FOREST AND COMMON LAND PLANTS OF WESTERN CHITWAN, NEPAL

    Science.gov (United States)

    Dangol, D. R.

    2012-01-01

    This paper enumerates 349 plant species belonging to 77 families of vascular plants collected in the winter seasons of 1996 and 2000 by the flora teams of the Population and Ecology Research Laboratory, Nepal. Of the total species, 249 species belong to dicotyledons, 87 species to monocotyledons and 13 species to pteridophytes. Among the families, dicotyledons contributed the highest number of families (55 in number) followed by monocotyledons and pteridophytes. In the study areas, species composition varies with the type of habitats in the study plots. Some species are unique in distribution. The highest unique species are contributed by common lands (87 spp.), followed by the Chitwan National Park forest (36 spp.) and Tikauli forest (32 spp.). Ageratum houstonianum Mill., Cynodon dactylon (L.) Pers., Imperata cylindrica (L.) Beauv., Rungia parviflora (Retz.) Nees, Saccharum spontaneum L. and Thelypteris auriculata (J. Sm.) K. Iwats are the most common species across all the research blocks. Of the listed plants, many plants have local names either in Nepalese or other tribal languages. Plants are named in different ways on the basis of habit, habitat, smell, taste, and morphological characters of the plants, which are also the basis of nomenclature in plant taxonomy. PMID:22962539

  11. The parasitic fauna of the European bison (Bison bonasus) (Linnaeus, 1758) and their impact on the conservation. Part 1. The summarising list of parasites noted.

    Science.gov (United States)

    Karbowiak, Grzegorz; Demiaszkiewicz, Aleksander W; Pyziel, Anna M; Wita, Irena; Moskwa, Bożena; Werszko, Joanna; Bień, Justyna; Goździk, Katarzyna; Lachowicz, Jacek; Cabaj, Władysław

    2014-09-01

    During the current century, 88 species of parasites have been recorded in Bison bonasus. These are 22 species of protozoa (Trypanosoma wrublewskii, T. theileri, Giardia sp., Sarcocystis cruzi, S. hirsuta, S. hominis, S. fusiformis, Neospora caninum, Toxoplasma gondii, Cryptosporidium sp., Eimeria cylindrica, E. subspherica, E. bovis, E. zuernii, E. canadensis, E. ellipsoidalis, E. alabamensis, E. bukidnonensis, E. auburnensis, E. pellita, E. brasiliensis, Babesia divergens), 4 trematodes species (Dicrocoelium dendriticum, Fasciola hepatica, Parafasciolopsis fasciolaemorpha, Paramphistomum cervi), 4 cestodes species (Taenia hydatigena larvae, Moniezia benedeni, M. expansa, Moniezia sp.), 43 nematodes species (Bunostomum trigonocephalum, B. phlebotomum, Chabertia ovina, Oesophagostomum radiatum, O. venulosum, Dictyocaulus filaria, D.viviparus, Nematodirella alcidis, Nematodirus europaeus, N. helvetianus, N. roscidus, N. filicollis, N. spathiger, Cooperia oncophora, C. pectinata, C. punctata, C. surnabada, Haemonchus contortus, Mazamastrongylus dagestanicus, Ostertagia lyrata, O. ostertagi, O. antipini, O. leptospicularis, O. kolchida, O. circumcincta, O. trifurcata, Spiculopteragia boehmi, S. mathevossiani, S. asymmetrica, Trichostrongylus axei, T. askivali, T. capricola, T. vitrinus, Ashworthius sidemi, Onchocerca lienalis, O. gutturosa, Setaria labiatopapillosa, Gongylonema pulchrum, Thelazia gulosa, T. skrjabini, T. rhodesi, Aonchotheca bilobata, Trichuris ovis), 7 mites (Demodex bisonianus, D. bovis, Demodex sp., Chorioptes bovis, Psoroptes equi, P. ovis, Sarcoptes scabiei), 4 Ixodidae ticks (Ixodes ricinus, I. persulcatus, I. hexagonus, Dermacentor reticulatus), 1 Mallophaga species (Bisonicola sedecimdecembrii), 1 Anoplura (Haematopinus eurysternus), and 2 Hippoboscidae flies (Lipoptena cervi, Melophagus ovinus). There are few monoxenous parasites, many typical for cattle and many newly acquired from Cervidae.

  12. Reef Development on Artificial Patch Reefs in Shallow Water of Panjang Island, Central Java

    Science.gov (United States)

    Munasik; Sugiyanto; Sugianto, Denny N.; Sabdono, Agus

    2018-02-01

    Reef restoration methods are generally developed by propagation of coral fragments, coral recruits and provide substrate for coral attachment using artificial reefs (ARs). ARs have been widely applied as a tool for reef restoration in degraded natural reefs. Successful of coral restoration is determined by reef development such as increasing coral biomass, natural of coral recruits and fauna associated. Artificial Patch Reefs (APRs) is designed by combined of artificial reefs and coral transplantation and constructed by modular circular structures in shape, were deployed from small boats by scuba divers, and are suitable near natural reefs for shallow water with low visibility of Panjang Island, Central Java. Branching corals of Acropora aspera, Montipora digitata and Porites cylindrica fragments were transplanted on to each module of two units of artificial patch reefs in different periods. Coral fragments of Acropora evolved high survival and high growth, Porites fragments have moderate survival and low growth, while fragment of Montipora show in low survival and moderate growth. Within 19 to 22 months of APRs deployment, scleractinian corals were recruited on the surface of artificial patch reef substrates. The most recruits abundant was Montastrea, followed by Poritids, Pocilloporids, and Acroporids. We conclude that artificial patch reefs with developed by coral fragments and natural coral recruitment is one of an alternative rehabilitation method in shallow reef with low visibility.

  13. Kahua A';o--A Learning Foundation: Using Hawaiian Language Newspaper Articles for Science and Science Education

    Science.gov (United States)

    Chinn, P. W.; Businger, S.

    2013-12-01

    Kahua A';o, an NSF OEDG project, utilizes Hawaiian language newspaper articles written between 1843 and 1948 in lessons and professional development intended to increase participation of underrepresented Native Hawaiian students in earth science. Guided by sociocultural theories that view learning as experiential and culturally situated, geoscientists (Steven Businger, Scott Rowland, Floyd McCoy, UG student Kelly Lance); Hawaiian translators (M. Puakea Nogelmeier, GRAs Kapomaikai Stone and Iasona Ellinwood); science educators (Pauline Chinn, graduate student Lindsey Spencer), utilize articles to develop place-based meteorology and geology curricula for middle school teachers. Articles are valuable to science and science education: Native Hawaiians are citizen scientists who recorded, interpreted, and communicated findings to potentially critical audiences, while dated, descriptive, eye witness reports provide data on events unrecorded by westerners. Articles reveal Hawaiian intellectual tradition placed great value on environmental knowledge. Moolelo (traditional stories) e.g., Kuapākaa (Nakuina, 1905), translated as The Wind Gourd of Laamaomao, tells of Kuapākaa controlling all the winds of Hawai';i by chanting their names--a metaphor for the power of knowledge of winds, rains and their patterns. In the moolelo of Kalapana, a boy hero challenges and defeats the king of Kauai to a life-and-death riddling contest (Nakuina, 1902). Maly's (2001) translation of a riddle involving 22 zones spanning mountaintop to deep-sea underscores the knowledge base informing sustainable practices. Articles provide insight into indigenous maps (Nogelmeier, personal communication) while riddling contests (Beckwith, 1940/1970) establish demonstrations of knowledge as central to power, identity, and status. Eight field-based lessons have been presented to formal and informal science educators, with teachers adapting lessons for 3rd-12th grade students. Graduate students Spencer, Stone

  14. A report on 36 years practical work on crop improvement through induced mutagenesis

    Energy Technology Data Exchange (ETDEWEB)

    Datta, S.K. [CSIR, Madhyamgram Experimental Farm, Bose Institute, Kolkata (India)], E-mail: subodhskdatta@rediffmail.com

    2008-07-01

    Physical and/or chemical mutagens cause random changes in the nuclear DNA or cytoplasmic organelles, resulting in gene, chromosomal or genomic mutations. The author will share his life time experience and achievement on induced mutagenesis. The author initiated induced mutagenesis work in 1971 till July 2007 and used both physical (X-ray and Gamma rays) and chemical (EMS, MMS, Colchicine) mutagens for improvement of vegetables (Trichosanthes anguina L, T. cucumarina , Cucurbita maxima L, Cephalandra indica, Luffa acutangula Roxb., Lagenaria ciceraria), medicinal (Trigonella foenum-graecum L, Mentha citrate Ehrh), pulse (Winged Bean (Psophocarpus tetragonolobus L. D.C.), oil bearing (Jatropha curcas L, Rosa damascene, Cymbopogon flexuosus (Nees) Wats) and ornamental (Bougainvillea, Chrysanthemum, Dahlia, Gladiolus, Hibiscus, Lantana depressa Naud, Rose, Tuberose, Narcissus etc.) crops. All classical and advanced mutagenesis methods have been extensively used for the development of new and novel cultivars of economic importance. Early flowering, late flowering, dwarf, yellow fruit color, crinkled leaf, short thick fruit, increased branching, increased pod and seed number, seed size, seed color (green, brown, chocolate color) high fruit-, seed-, oil- and punicic acidyielding mutants have been developed in T. anguina, T. fornum-graecum, Winged Bean and in J.curcas containing 'curcas oil', an efficient substitute fuel for diesel engines. Induction of flower color and chlorophyll variegated mutants in L. depressa proved the efficiency of mutation technique for domestication of wild relatives. Author was deeply engaged for the last 30 years for improvement of ornamentals and has been most successful to produce quite a large number of new promising mutant varieties in different ornamentals. Colchicine has been successfully used to develop new flower color in chrysanthemum and rose and high yielding strains in T. anguina. A novel direct in vitro regeneration technique has

  15. Phylogenetic relationships among domesticated and wild species of Cucurbita (Cucurbitaceae) inferred from a mitochondrial gene: Implications for crop plant evolution and areas of origin

    Science.gov (United States)

    Sanjur, Oris I.; Piperno, Dolores R.; Andres, Thomas C.; Wessel-Beaver, Linda

    2002-01-01

    We have investigated the phylogenetic relationships among six wild and six domesticated taxa of Cucurbita using as a marker an intron region from the mitochondrial nad1 gene. Our study represents one of the first successful uses of a mtDNA gene in resolving inter- and intraspecific taxonomic relationships in Angiosperms and yields several important insights into the origins of domesticated Cucurbita. First, our data suggest at least six independent domestication events from distinct wild ancestors. Second, Cucurbita argyrosperma likely was domesticated from a wild Mexican gourd, Cucurbita sororia, probably in the same region of southwest Mexico that gave rise to maize. Third, the wild ancestor of Cucurbita moschata is still unknown, but mtDNA data combined with other sources of information suggest that it will probably be found in lowland northern South America. Fourth, Cucurbita andreana is supported as the wild progenitor of Cucurbita maxima, but humid lowland regions of Bolivia in addition to warmer temperate zones in South America from where C. andreana was originally described should possibly be considered as an area of origin for C. maxima. Fifth, our data support other molecular results that indicate two separate domestications in the Cucurbita pepo complex. The potential zone of domestication for one of the domesticated subspecies, C. pepo subsp. ovifera, includes eastern North America and should be extended to northeastern Mexico. The wild ancestor of the other domesticated subspecies, C. pepo subsp. pepo, is undiscovered but is closely related to C. pepo subsp. fraterna and possibly will be found in southern Mexico. PMID:11782554

  16. De novo assembly of the zucchini genome reveals a whole-genome duplication associated with the origin of the Cucurbita genus.

    Science.gov (United States)

    Montero-Pau, Javier; Blanca, José; Bombarely, Aureliano; Ziarsolo, Peio; Esteras, Cristina; Martí-Gómez, Carlos; Ferriol, María; Gómez, Pedro; Jamilena, Manuel; Mueller, Lukas; Picó, Belén; Cañizares, Joaquín

    2017-11-07

    The Cucurbita genus (squashes, pumpkins and gourds) includes important domesticated species such as C. pepo, C. maxima and C. moschata. In this study, we present a high-quality draft of the zucchini (C. pepo) genome. The assembly has a size of 263 Mb, a scaffold N50 of 1.8 Mb and 34 240 gene models. It includes 92% of the conserved BUSCO core gene set, and it is estimated to cover 93.0% of the genome. The genome is organized in 20 pseudomolecules that represent 81.4% of the assembly, and it is integrated with a genetic map of 7718 SNPs. Despite the small genome size, three independent lines of evidence support that the C. pepo genome is the result of a whole-genome duplication: the topology of the gene family phylogenies, the karyotype organization and the distribution of 4DTv distances. Additionally, 40 transcriptomes of 12 species of the genus were assembled and analysed together with all the other published genomes of the Cucurbitaceae family. The duplication was detected in all the Cucurbita species analysed, including C. maxima and C. moschata, but not in the more distant cucurbits belonging to the Cucumis and Citrullus genera, and it is likely to have occurred 30 ± 4 Mya in the ancestral species that gave rise to the genus. © 2017 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.

  17. Disease interactions in a shared host plant: effects of pre-existing viral infection on cucurbit plant defense responses and resistance to bacterial wilt disease.

    Directory of Open Access Journals (Sweden)

    Lori R Shapiro

    Full Text Available Both biotic and abiotic stressors can elicit broad-spectrum plant resistance against subsequent pathogen challenges. However, we currently have little understanding of how such effects influence broader aspects of disease ecology and epidemiology in natural environments where plants interact with multiple antagonists simultaneously. In previous work, we have shown that healthy wild gourd plants (Cucurbita pepo ssp. texana contract a fatal bacterial wilt infection (caused by Erwinia tracheiphila at significantly higher rates than plants infected with Zucchini yellow mosaic virus (ZYMV. We recently reported evidence that this pattern is explained, at least in part, by reduced visitation of ZYMV-infected plants by the cucumber beetle vectors of E. tracheiphila. Here we examine whether ZYMV-infection may also directly elicit plant resistance to subsequent E. tracheiphila infection. In laboratory studies, we assayed the induction of key phytohormones (SA and JA in single and mixed infections of these pathogens, as well as in response to the feeding of A. vittatum cucumber beetles on healthy and infected plants. We also tracked the incidence and progression of wilt disease symptoms in plants with prior ZYMV infections. Our results indicate that ZYMV-infection slightly delays the progression of wilt symptoms, but does not significantly reduce E. tracheiphila infection success. This observation supports the hypothesis that reduced rates of wilt disease in ZYMV-infected plants reflect reduced visitation by beetle vectors. We also documented consistently strong SA responses to ZYMV infection, but limited responses to E. tracheiphila in the absence of ZYMV, suggesting that the latter pathogen may effectively evade or suppress plant defenses, although we observed no evidence of antagonistic cross-talk between SA and JA signaling pathways. We did, however, document effects of E. tracheiphila on induced responses to herbivory that may influence host

  18. Trichosanthes cucumerina extracts enhance glucose uptake and regulate adiponectin and leptin concentrations in 3T3-L1 adipocytes model

    Directory of Open Access Journals (Sweden)

    Sassi, A.,

    2017-10-01

    Full Text Available Trichosanthes cucumerina (Cucurbitaceae commonly known as Snake gourd or Labu Ular is considered the largest genre in the Cucurbitaceae family and is mainly found in the southeast areas of Asia. It has been used in Ayurvedic medicine as a treatment for certain diseases such as Diabetes mellitus, but these acclaims lack scientific-based evidence. In this study, water and ethanol extracts of three parts of Trichosanthes cucumerina namely; whole vegetable, peels, and seeds, were assessed for toxicity through a cell viability assay using 3T3-L1 pre-adipocytes model which revealed a maximum toleration concentration of 0.063 mg/mL. The extracts were further tested on adipocytes’ differentiation and positively showed a stimulation of lipid droplets formation during adipogenesis and significantly (p<0.001 increased glycerol release levels (75.34±3.69 μg/ml during adipolysis. The extracts also significantly (p<0.001 promoted the uptake of glucose into the cells (2636.22±91.33 Bq in an action similar to that of insulin. Similar results were observed during ELISA assay with a significant increase (p<0.001 in adiponectin concentrations (3593.1±225.25 ng/mL and a decrease in leptin concentrations (23870±5066.07 pg/mL. The present study results indicate a beneficial effect of Trichosanthes cucumerina extracts on adipogenesis, adipolysis and glucose uptake, in addition to a regulation of adiponectin and leptin concentrations in 3T3-L1 adipocytes which can be of clinical importance in energy regulation which is a key factor in treating diabetes, obesity, and metabolic syndrome.

  19. MENTIMUN(Cucumis Sativus L DI DESA TIRTA MULYA KECAMATAN MAKARTI JAYA KABUPATEN BANYUASIN II

    Directory of Open Access Journals (Sweden)

    Irham Falahudin

    2015-08-01

    Full Text Available Cucumber plants (Cucumis sativus L. that includes or creeping vines and is one type of vegetable-fruit of the gourd family labuan (Cucurbitaceae that has been popular throughout the world and favored from Asia. Cucumber cultivation in Indonesia, found almost in every region, ranging from lowland to highland hot climate (tropical and moderate. One animal that has an abundant amount in cucumber plants are insects. This study aims to know the different types of species that exist on the Order Coleoptera cucumber farm in the village of Tirta Mulya District of makarti Jaya Banyuasin II and determine the role of the Order Coleoptera insects on cucumber plantations in the village of Tirta Mulya District of makarti Jaya Banyuasin II. This is a qualitative study conducted in October-November 2014 held in Cucumber Plants in the village of Tirta Mulya District of makarti Jaya Banyuasin II. Catching insects done using transect method and pitfall traps such as sweeping the net, pit fall traps and light traps, results in identification in the laboratory penelitanya UIN Raden Fatah Palembang. The results of this study indicate that insects are caught in a cucumber plantation obtained as many as 113 individual 3 families and 7 species. Insects which dominates in the village of Tirta Mulya District of makarti Jaya Banyuasin II is Cocinella repanda, Curinus coeruleus, Coelophora inaequalis, and Aulacophora similis, and insects that have the fewest number is Micraspis discolor, Micraspis vincta and Oryctes rhinoceros. The role of the Order Coleoptera Insects in general predators of the family Coccinellidae to eradicate mites while the family Chrysomelidae Scarabacidae and are pests that attack on cucumber plants that can cause death.

  20. An Overview of Herbal Products and Secondary Metabolites Used for Management of Type Two Diabetes.

    Science.gov (United States)

    Ota, Ajda; Ulrih, Nataša P

    2017-01-01

    Diabetes mellitus is a common effect of uncontrolled high blood sugar and it is associated with long-term damage, dysfunction, and failure of various organs. In the adult population, the global prevalence of diabetes has nearly doubled since 1980. Without effective prevention and management programs, the continuing significant rise in diabetes will have grave consequences on the health and lifespan of the world population, and also on the world economy. Supplements can be used to correct nutritional deficiencies or to maintain an adequate intake of certain nutrients. These are often used as treatments for diabetes, sometimes because they have lower costs, or are more accessible or "natural" compared to prescribed medications. Several vitamins, minerals, botanicals, and secondary metabolites have been reported to elicit beneficial effects in hypoglycemic actions in vivo and in vitro ; however, the data remain conflicting. Many pharmaceuticals commonly used today are structurally derived from natural compounds from traditional medicinal plants. Botanicals that are most frequently used to help manage blood glucose include: bitter melon ( Momordica charantia ), fenugreek ( Trigonella foenum graecum ), gurmar ( Gymnema sylvestre ), ivy gourd ( Coccinia indica ), nopal ( Opuntia spp.), ginseng, Russian tarragon ( Artemisia dracunculus ), cinnamon ( Cinnamomum cassia ), psyllium ( Plantago ovata ), and garlic ( Allium sativum ). In majority of the herbal products and secondary metabolites used in treating diabetes, the mechanisms of action involve regulation of insulin signaling pathways, translocation of GLUT-4 receptor and/or activation the PPARγ. Several flavonoids inhibit glucose absorption by inhibiting intestinal α-amylase and α-glucosidase. In-depth studies to validate the efficacies and safeties of extracts of these traditional medicinal plants are needed, and large, well designed, clinical studies need to be carried out before the use of such preparations can